3MMYA

Structural and functional analysis of the interaction between the nucleoporin nup98 and the mrna export factor rae1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
362
structure length
354
Chain Sequence
FGTTSGFGTSGTSMFTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords mRNA export factor
publication title Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 354
sequence length 362
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3mmyA00
2AH0A 2H6NA 1B9YA 1JJUB 5FQDA 3IIWA 2H9MA 3MZKA 1U4CA 4PC0A 2CO0A 3I7LA 3F3PA 3MKQA 3SLED 2OVQB 3SBRA 3KRWB 4JT5C 2P9KC 3N0EA 3OW8A 3ODTA 3SHFA 1XKSA 3I7HA 2AGLA 3CFVA 3JZGA 3DWLC 5GXIA 3GFCA 4FA5D 4J78A 4GQBB 2Z2PA 1OLZA 3I8CA 3RN0D 3SBQA 3UVLA 5IT9g 3RN1D 2H14A 4FB1D 3OKYB 2H6KA 4KFMB 2GC4A 4U1EI 2H9LA 2EBSA 4A09A 2AQ5A 2YMUA 4O9DA 2YNPA 4E54A 1N6FA 3KRXB 2AGXA 3SXTD 1P22A 3ZWLB 5EAPA 2IUVA 5CXBA 2P9IC 5C2WB 2B4EA 3PSLA 3UVKA 2XYIA 4GMBA 5H17A 3AFCA 4J86A 1XHMA 5IGQA 5CYKA 4A08A 4ZOVA 5TEEA 4QL1A 2P9PC 2H6QA 2PM9B 2OJYA 4I79A 4K3JB 4FA1D 5I5MA 2W18A 5KDOB 4LG8A 1GP2B 1N6EA 1A0RB 2CN3A 3DXMC 4GM9A 3V7DB 5FA5B 4L9OA 2CN2A 4FHLA 3PVUB 5C9ZB 3JROA 2CE9A 3PSCB 4JSNC 5FKSA 2AGZA 5B4WA 5H1MA 1NR0A 4QQEA 1MG2A 3OKWA 3NVNA 4JT6C 2I3SA 5C2VB 1SQ9A 2HXCA 3SJLD 3I8EA 3OKYA 3UR4A 2Z2NA 4JSVC 3I7NA 4PNKB 3FGBA 2PM6B 3F3GA 4A7JA 3JB9L 3AH8B 3I89A 4D6VA 1GXRA 5FLXg 5AMSA 3I7KA 4PSWB 3FRXA 1VYHC 5HYNB 4GGAA 3UVNA 4GGDA 4GQ1A 4IMMA 4X61B 4O1QD 3EI2B 3B7FA 1MG3A 4L3GD 2YBAA 4O45A 2B5LA 3ORVD 3NVXA 4BUJC 4J73A 5CXCB 4CZYA 3RMZD 4A2LA 4EWRA 3EI3B 3EG6A 2UZXB 5EALA 5EMKB 1Q47A 3A0FA 2PM9A 4J81A 3OL2B 4ERQA 1GOTB 5IC7A 4JXMA 2IWKA 2OIZA 1U2VC 3RFHA 1PEVA 1QNIA 4J84A 3I2NA 3JAMg 2I0TA 4K3ID 4MK0B 3U4YA 4OZUA 1TYQC 5TF2A 4CY2A 2H68A 4OWRA 2PBIB 3CIKB 5TDHB 4A0AB 4CC9A 4ERZA 3PXTD 5FKQA 3EI1B 4GQ2P 4ZOZA 1GG2B 2OK4A 1PI6A 4CI8A 4YVDA 2I3TA 3GREA 2P9LC 4O3UB 3AL9A 3IJ1A 3IJCA 3JRPA 2QC5A 4J87A 3F3FA 5TEFA 1JMZB 3FM0A 3SWSD 2XL3A 5A2Qg 3J80g 4X60B 2OVPB 2GC7A 3JZNA 4CY1A 3C5MA 3V9FA 4J8GA 3HFQA 5I5JA 3V5WB 5IJ7E 3ULEC 3EI2A 3AL8B 2H47A 4J0XA 4CI2A 2BBKH 2TRCB 1PBYB 2AH1A 2H9NA 4E5ZB 4QT8A 5CXCA 5HE2B 4Y5RD 4U7AA 3IIYA 4CY3A 3JZHA 3EI3A 2Z2OA 3SCYA 2P9SC 3N0DA 4QRJA 5GXHA 4FWWA 2CNXA 4O3TB 5I5IA 3MXXA 3SVWD 2YB8B 3EMHA 4GGCA 4IA9A 2BCJB 3OL2A 2G99A 3C9CA 5IGOA 4CI3A 4CY5A 4J0WA 4J82A 5EARA 2P9UC 3J81g 4AOWA 4J8BA 1SHYB 4JD2C 3I7OA 2YNOA 3NVQA 3RSEC 3I7PA 4A0AA 3RLMD 4XEIC 3BG1A 4LGNA 4XYHA 5FXYA 1S4UX 3OTTA 3PXSD 4FA4D 3EI1A 3UVOA 5AJAA 3IKOA 3JPXA 5EAMA 2HKRA 4FAND 4XYIA 1YFQA 2HJ4A 2IUQA 4Y7RA 4BH6A 4A0BB 1JOFA 5GMKn 4X63B 3SBPA 3OKTA 3VH0A 2OK6A 2HYEA 2QXVA 4A11B 3SN6B 4PBYA 2YNNA 3DSMA 3AL8A 5HQGA 1TBGA 3UKRC 2IUPA 3MKSB 2XU7A 5EM2B 4E5ZA 4TZ4A 4GZ8A 4FAVD 4ERYA 5GSAA 4JSPC 3W15A 1XIPA 2XL2A 3EI4B 5FKRA 1K32A 1N6DA 4ZN4A 1PGUA 4L3HD 4JSXC 2J55H 1MDAH 4L1QD 5AFU3 3C75H 1K8KC 2B5NA 4UI9R 4PXWA 2J57G 3MMYA 1NEXB 3PXWD 2HJBA 4BL0A 3BWSA 2G9AA 3UVMA 3E0CA 2AGYA 2AGWA 2HKMA 5K1CC 4GM8A 3SFZA 4G56B 2H9PA 2P9NC 4H5JA 4PBZA 3UKUC 2GNQA 4J77A 2UZYB 2H13A 4AEZA 2OVRB 3PVWB 2O9KA 3SMRA 1JMXB 3VGZA 4A0BA 3EU7A 3RFGA 3L4OD 4A11A 1FWXA 4A2MA 4LG9A 3BG0A 3L4MD 3P4FA 4ESGA 2IURA 4FA9D 2B5MA 2HESX 5EM2A 3K26A 3EWEA 5EMLB 4X3EA 5H14A 3DM0A 4N14A 3DXKC 2PM7B 2I0SA 4H5IA 5EMJB 3EI4A 5SXMA 3RRMC 3IJ0A 5IJ8E 4ES0A 4CZVA 2MTAH 2I0RA 2J56H 4CZXA 1RI6A 4PSXB 4ZOYA 4ZOXA 4A09B 1L0QA 5HE0B 5JWZA 2IWFA 3K27A 4E54B 3CFSB 4Z8LA 1B9XA 5K19A 1ERJA 3MZLA 5HE3B 5THAA 1OMWB 4GM3A 5CXBB 5HE1B 1SQJA 3C99A 2CE8A 2IAAA 4HDJA 3PE7A 4J79A 1R5MA 5FKTA 4CI1A 2H3XA 3VA6A 4D0KA 5EMMB 2CO0C 5CYKB 4A08B 2Q7QA 4R7AB 4NSXA
chains in the Genus database with same CATH superfamily
2AH0A 1H2YA 2H6NA 1B9YA 1JJUB 3IVMA 3K72A 5FQDA 3IIWA 2H9MA 2VDQA 3MZKA 3EQ9A 3T3PA 1U4CA 1JTDB 4PC0A 1GOFA 2CO0A 3I7LA 3F3PA 3MKQA 3SLED 2OVQB 3SBRA 3V4PA 3ZDYA 3KRWB 4JT5C 2P9KC 1O6FA 2VDMA 3N0EA 3OW8A 3ODTA 3SHFA 1XKSA 3I7HA 2AGLA 3CFVA 3JZGA 3DWLC 3KCIA 4MMXA 5GXIA 3GFCA 4FA5D 4UM9A 4J78A 1H2XA 4DNVA 4GQBB 2Z2PA 1OLZA 3I8CA 3RN0D 3SBQA 5M5UA 1VE7A 3UVLA 5IT9g 3RN1D 2H14A 4FB1D 3OKYB 2H6KA 4Z7OA 4KFMB 2GC4A 4U1EI 2H9LA 2EBSA 4A09A 2AQ5A 2YMUA 4O9DA 2YNPA 4E54A 1N6FA 2VDLA 3KRXB 5C92A 2AGXA 3SXTD 1P22A 4IRZA 3ZWLB 5EAPA 2IUVA 1K3IA 5CXBA 2P9IC 4DNUA 5C2WB 3O4GA 2B4EA 3PSLA 4WJKA 3UVKA 2XYIA 4GMBA 5H17A 3AFCA 4J86A 1XHMA 5IGQA 1H2WA 5CYKA 4A08A 4ZOVA 5TEEA 3OF7A 4QL1A 4AN1A 2P9PC 4G1MA 2H6QA 2PM9B 2OJYA 4I79A 4K3JB 4FA1D 5I5MA 2W18A 4G1EA 4RE6A 5KDOB 4LG8A 1GP2B 1N6EA 1A0RB 2EIEA 3DXMC 2CN3A 4GM9A 3V7DB 3V4VA 5FA5B 4L9OA 2CN2A 3FCUA 4FHLA 3QHYB 3PVUB 5C9ZB 3JROA 2QZPA 2CE9A 3PSCB 4JSNC 5FKSA 2AGZA 5HDBA 5B4WA 1JV2A 1NR0A 4QQEA 5H1MA 1MG2A 3OKWA 3NVNA 4JT6C 2I3SA 5C2VB 1SQ9A 2HXCA 3SJLD 2EICA 4BCDA 3I8EA 3OKYA 4Z7QA 3UR4A 2Z2NA 4JSVC 3I7NA 1A12A 4PNKB 1GOHA 3FGBA 2BKLA 2PM6B 3F3GA 4A7JA 3JB9L 1UOPA 4JHPC 2VDOA 3AH8B 4NENA 3I89A 4D6VA 1GXRA 5FLXg 5AMSA 3I7KA 4PSWB 3FRXA 1VYHC 5HYNB 4GGAA 3UVNA 4GGDA 4GQ1A 4IMMA 4X61B 4O1QD 3EI2B 3B7FA 1MG3A 4L3GD 2YBAA 3NIDA 4O45A 2B5LA 3IJEA 3ORVD 3NVXA 4BUJC 4J73A 4NBMA 5CXCB 4CZYA 3RMZD 4A2LA 3O4JA 2VZ1A 4EWRA 3EI3B 3EG6A 2UZXB 5EALA 5EMKB 1Q47A 3A0FA 2PM9A 4J81A 3OL2B 4ERQA 4NAAA 5E6RA 1GOTB 5IC7A 4JXMA 2IWKA 2OIZA 1U2VC 4WK4A 3RFHA 1PEVA 1QNIA 4J84A 3I2NA 3JAMg 2I0TA 4K3ID 4L1MA 4MK0B 4OZUA 3U4YA 1TYQC 5TF2A 4CY2A 3O4IA 2H68A 4OWRA 2PBIB 1BPOA 3CIKB 5TDHB 4A0AB 4CC9A 4MMZA 4ERZA 3PXTD 2VDNA 5FKQA 3EI1B 1E8NA 4GQ2P 1GG2B 4ZOZA 5E6SA 1O6GA 2OK4A 1PI6A 4CI8A 5FFOA 4YVDA 2I3TA 3GREA 2P9LC 4O3UB 3AL9A 3JRPA 3IJ1A 3IJCA 2QC5A 4J87A 3F3FA 5TEFA 1JMZB 2XZGA 2XDWA 3FM0A 3SWSD 2XL3A 5A2Qg 3J80g 4X60B 2OVPB 2GC7A 3JZNA 4CY1A 4Z7NA 4NC4A 3C5MA 3V9FA 4J8GA 3HFQA 5I5JA 3V5WB 5IJ7E 3ULEC 5M5VA 3AL8B 3EI2A 2H47A 3FCSA 4J0XA 4CI2A 2BBKH 1TYEA 2TRCB 1PBYB 2AH1A 2H9NA 3MUOA 4E5ZB 2EIBA 4QT8A 5CXCA 5HE2B 4Y5RD 4U7AA 3IIYA 4CY3A 3JZHA 3EI3A 2Z2OA 3ZDZA 3SCYA 2P9SC 3IUNA 3N0DA 4QRJA 4AMYA 4FWWA 2CNXA 5GXHA 4O3TB 4O02A 5I5IA 3MXXA 3SVWD 2YB8B 3EMHA 3VI3A 2XE4A 4GGCA 4IA9A 4MMYA 4QAMA 2BCJB 3OL2A 2G99A 3C9CA 5IGOA 4CI3A 3ZDXA 4CY5A 4J0WA 4J82A 5EARA 3GD1I 2P9UC 3J81g 4WK2A 3IUMA 4AOWA 4J8BA 1SHYB 4JD2C 2YNOA 3NVQA 3RSEC 3I7PA 1VZ2A 4A0AA 3RLMD 3QI0A 4XEIC 3BG1A 4LGNA 4XYHA 3GC3B 5E6UA 5FXYA 1S4UX 3OTTA 3PXSD 4FA4D 1C9IA 4BCCA 4AX4A 3EI1A 3O4HA 3UVOA 5AJAA 4DNWA 3IKOA 3JPXA 5EAMA 1H2ZA 2HU5A 2HKRA 3ZE2A 4FAND 4XYIA 1YFQA 2HJ4A 2IUQA 4Y7RA 1L5GA 4BH6A 4A0BB 4BP8A 1JOFA 4JHNA 3IURA 5GMKn 4X63B 3SBPA 3OKTA 3VH0A 2OK6A 2HYEA 2QXVA 4WK0A 4A11B 1T2XA 1GOGA 4PBYA 2YNNA 3DSMA 3AL8A 3SN6B 5HQGA 4RE5A 1TBGA 1E8MA 3UKRC 2IUPA 3ZE1A 1E5TA 4G55A 3MKSB 2XU7A 5EM2B 4E5ZA 4TZ4A 4GZ8A 4FAVD 4ERYA 5GSAA 4JSPC 3W15A 1XIPA 2XL2A 1QFMA 3EI4B 3IUJA 5FKRA 1K32A 1UTCA 1U8CA 3NIFA 1N6DA 4ZN4A 1PGUA 4L3HD 1UOQA 4JSXC 2J55H 1MDAH 5FFGA 4L1QD 5AFU3 3C75H 1K8KC 2B5NA 4UI9R 4PXWA 2J57G 3MMYA 4UM8A 4BP9A 2VDRA 1NEXB 1YR2A 3PXWD 2HJBA 4BCBA 4BL0A 3BWSA 2G9AA 3UVMA 3E0CA 2AGYA 2AGWA 2HKMA 5K1CC 4GM8A 1QFSA 3SFZA 4G56B 2H9PA 2P9NC 3IUQA 5C86A 3K6SA 4H5JA 3IULA 4PBZA 3UKUC 1C9LA 2GNQA 4J77A 2UZYB 2H13A 3T3MA 3K71A 2VC2A 4AEZA 2OVRB 3PVWB 2O9KA 3SMRA 2VDKA 1JMXB 5M61A 3VGZA 4A0BA 2EIDA 1I2MB 3EU7A 3RFGA 3L4OD 4A11A 2WQ8A 1FWXA 4A2MA 4LG9A 3BG0A 2VZ3A 3L4MD 3P4FA 4ESGA 2IURA 3ZE0A 3DDUA 4FA9D 2B5MA 2HESX 5EM2A 3K26A 5M5RA 3EWEA 5EMLB 4X3EA 5H14A 3DM0A 3MUNA 4N14A 3DXKC 2PM7B 2I0SA 4H5IA 5EMJB 3EI4A 5SXMA 3RRMC 4D9SA 3IJ0A 5IJ8E 4ES0A 1VE6A 4CZVA 2MTAH 1VZ3A 2I0RA 2HU8A 2J56H 4NSXA 4CZXA 5M5TA 1RI6A 4PSXB 3VI4A 4ZOYA 5M5SA 4ZOXA 4A09B 1L0QA 3NIGA 5HE0B 5JWZA 2IWFA 3K27A 2JKXA 4E54B 3CFSB 3EQ7A 4Z8LA 1B9XA 5K19A 2HU7A 3EQ8A 1ERJA 3MZLA 5HE3B 5THAA 4AMZA 1OMWB 4GM3A 5CXBB 5HE1B 1SQJA 3C99A 2CE8A 2IAAA 2VDPA 4HDJA 3PE7A 4J79A 1R5MA 5FKTA 4CI1A 4AN0A 1M1XA 1UOOA 2H3XA 4O2WA 3VA6A 4D0KA 5EMMB 2CO0C 5CYKB 4A08B 2Q7QA 4R7AB 3MVDK 2QR5A 3I7OA
chains in the Genus database with same CATH topology
2AH0A 2H6NA 1B9YA 1JJUB 5FQDA 3IIWA 2H9MA 3MZKA 1U4CA 4PC0A 2CO0A 3I7LA 3F3PA 3MKQA 3SLED 2OVQB 3SBRA 3KRWB 4JT5C 2P9KC 3N0EA 3OW8A 3ODTA 3SHFA 1XKSA 3I7HA 2AGLA 3CFVA 3JZGA 3DWLC 5GXIA 3GFCA 4FA5D 4J78A 4GQBB 2Z2PA 1OLZA 3I8CA 3RN0D 3SBQA 3UVLA 5IT9g 3RN1D 2H14A 4FB1D 3OKYB 2H6KA 4KFMB 2GC4A 4U1EI 2H9LA 2EBSA 4A09A 2AQ5A 2YMUA 4O9DA 2YNPA 4E54A 1N6FA 3KRXB 2AGXA 3SXTD 1P22A 3ZWLB 5EAPA 2IUVA 5CXBA 2P9IC 5C2WB 2B4EA 3PSLA 3UVKA 2XYIA 4GMBA 5H17A 3AFCA 4J86A 1XHMA 5IGQA 5CYKA 4A08A 4ZOVA 5TEEA 4QL1A 2P9PC 2H6QA 2PM9B 2OJYA 4I79A 4K3JB 4FA1D 5I5MA 2W18A 5KDOB 4LG8A 1GP2B 1N6EA 1A0RB 2CN3A 3DXMC 4GM9A 3V7DB 5FA5B 4L9OA 2CN2A 4FHLA 3PVUB 5C9ZB 3JROA 2CE9A 3PSCB 4JSNC 5FKSA 2AGZA 5B4WA 5H1MA 1NR0A 4QQEA 1MG2A 3OKWA 3NVNA 4JT6C 2I3SA 5C2VB 1SQ9A 2HXCA 3SJLD 3I8EA 3OKYA 3UR4A 2Z2NA 4JSVC 3I7NA 4PNKB 3FGBA 2PM6B 3F3GA 4A7JA 3JB9L 3AH8B 3I89A 4D6VA 1GXRA 5FLXg 5AMSA 3I7KA 4PSWB 3FRXA 1VYHC 5HYNB 4GGAA 3UVNA 4GGDA 4GQ1A 4IMMA 4X61B 4O1QD 3EI2B 3B7FA 1MG3A 4L3GD 2YBAA 4O45A 2B5LA 3ORVD 3NVXA 4BUJC 4J73A 5CXCB 4CZYA 3RMZD 4A2LA 4EWRA 3EI3B 3EG6A 2UZXB 5EALA 5EMKB 1Q47A 3A0FA 2PM9A 4J81A 3OL2B 4ERQA 1GOTB 5IC7A 4JXMA 2IWKA 2OIZA 1U2VC 3RFHA 1PEVA 1QNIA 4J84A 3I2NA 3JAMg 2I0TA 4K3ID 4MK0B 3U4YA 4OZUA 1TYQC 5TF2A 4CY2A 2H68A 4OWRA 2PBIB 3CIKB 5TDHB 4A0AB 4CC9A 4ERZA 3PXTD 5FKQA 3EI1B 4GQ2P 4ZOZA 1GG2B 2OK4A 1PI6A 4CI8A 4YVDA 2I3TA 3GREA 2P9LC 4O3UB 3AL9A 3IJ1A 3IJCA 3JRPA 2QC5A 4J87A 3F3FA 5TEFA 1JMZB 3FM0A 3SWSD 2XL3A 5A2Qg 3J80g 4X60B 2OVPB 2GC7A 3JZNA 4CY1A 3C5MA 3V9FA 4J8GA 3HFQA 5I5JA 3V5WB 5IJ7E 3ULEC 3EI2A 3AL8B 2H47A 4J0XA 4CI2A 2BBKH 2TRCB 1PBYB 2AH1A 2H9NA 4E5ZB 4QT8A 5CXCA 5HE2B 4Y5RD 4U7AA 3IIYA 4CY3A 3JZHA 3EI3A 2Z2OA 3SCYA 2P9SC 3N0DA 4QRJA 5GXHA 4FWWA 2CNXA 4O3TB 5I5IA 3MXXA 3SVWD 2YB8B 3EMHA 4GGCA 4IA9A 2BCJB 3OL2A 2G99A 3C9CA 5IGOA 4CI3A 4CY5A 4J0WA 4J82A 5EARA 2P9UC 3J81g 4AOWA 4J8BA 1SHYB 4JD2C 3I7OA 2YNOA 3NVQA 3RSEC 3I7PA 4A0AA 3RLMD 4XEIC 3BG1A 4LGNA 4XYHA 5FXYA 1S4UX 3OTTA 3PXSD 4FA4D 3EI1A 3UVOA 5AJAA 3IKOA 3JPXA 5EAMA 2HKRA 4FAND 4XYIA 1YFQA 2HJ4A 2IUQA 4Y7RA 4BH6A 4A0BB 1JOFA 5GMKn 4X63B 3SBPA 3OKTA 3VH0A 2OK6A 2HYEA 2QXVA 4A11B 3SN6B 4PBYA 2YNNA 3DSMA 3AL8A 5HQGA 1TBGA 3UKRC 2IUPA 3MKSB 2XU7A 5EM2B 4E5ZA 4TZ4A 4GZ8A 4FAVD 4ERYA 5GSAA 4JSPC 3W15A 1XIPA 2XL2A 3EI4B 5FKRA 1K32A 1N6DA 4ZN4A 1PGUA 4L3HD 4JSXC 2J55H 1MDAH 4L1QD 5AFU3 3C75H 1K8KC 2B5NA 4UI9R 4PXWA 2J57G 3MMYA 1NEXB 3PXWD 2HJBA 4BL0A 3BWSA 2G9AA 3UVMA 3E0CA 2AGYA 2AGWA 2HKMA 5K1CC 4GM8A 3SFZA 4G56B 2H9PA 2P9NC 4H5JA 4PBZA 3UKUC 2GNQA 4J77A 2UZYB 2H13A 4AEZA 2OVRB 3PVWB 2O9KA 3SMRA 1JMXB 3VGZA 4A0BA 3EU7A 3RFGA 3L4OD 4A11A 1FWXA 4A2MA 4LG9A 3BG0A 3L4MD 3P4FA 4ESGA 2IURA 4FA9D 2B5MA 2HESX 5EM2A 3K26A 3EWEA 5EMLB 4X3EA 5H14A 3DM0A 4N14A 3DXKC 2PM7B 2I0SA 4H5IA 5EMJB 3EI4A 5SXMA 3RRMC 3IJ0A 5IJ8E 4ES0A 4CZVA 2MTAH 2I0RA 2J56H 4CZXA 1RI6A 4PSXB 4ZOYA 4ZOXA 4A09B 1L0QA 5HE0B 5JWZA 2IWFA 3K27A 4E54B 3CFSB 4Z8LA 1B9XA 5K19A 1ERJA 3MZLA 5HE3B 5THAA 1OMWB 4GM3A 5CXBB 5HE1B 1SQJA 3C99A 2CE8A 2IAAA 4HDJA 3PE7A 4J79A 1R5MA 5FKTA 4CI1A 2H3XA 3VA6A 4D0KA 5EMMB 2CO0C 5CYKB 4A08B 2Q7QA 4R7AB 4NSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH0 A;  2H6N A;  1B9Y A;  1JJU B;  5FQD A;  3IIW A;  2H9M A;  3MZK A;  1U4C A;  4PC0 A;  2CO0 A;  3I7L A;  3F3P A;  3MKQ A;  3SLE D;  2OVQ B;  3SBR A;  3KRW B;  4JT5 C;  2P9K C;  3N0E A;  3OW8 A;  3ODT A;  3SHF A;  1XKS A;  3I7H A;  2AGL A;  3CFV A;  3JZG A;  3DWL C;  5GXI A;  3GFC A;  4FA5 D;  4J78 A;  4GQB B;  2Z2P A;  1OLZ A;  3I8C A;  3RN0 D;  3SBQ A;  3UVL A;  5IT9 g;  3RN1 D;  2H14 A;  4FB1 D;  3OKY B;  2H6K A;  4KFM B;  2GC4 A;  4U1E I;  2H9L A;  2EBS A;  4A09 A;  2AQ5 A;  2YMU A;  4O9D A;  2YNP A;  4E54 A;  1N6F A;  3KRX B;  2AGX A;  3SXT D;  1P22 A;  3ZWL B;  5EAP A;  2IUV A;  5CXB A;  2P9I C;  5C2W B;  2B4E A;  3PSL A;  3UVK A;  2XYI A;  4GMB A;  5H17 A;  3AFC A;  4J86 A;  1XHM A;  5IGQ A;  5CYK A;  4A08 A;  4ZOV A;  5TEE A;  4QL1 A;  2P9P C;  2H6Q A;  2PM9 B;  2OJY A;  4I79 A;  4K3J B;  4FA1 D;  5I5M A;  2W18 A;  5KDO B;  4LG8 A;  1GP2 B;  1N6E A;  1A0R B;  2CN3 A;  3DXM C;  4GM9 A;  3V7D B;  5FA5 B;  4L9O A;  2CN2 A;  4FHL A;  3PVU B;  5C9Z B;  3JRO A;  2CE9 A;  3PSC B;  4JSN C;  5FKS A;  2AGZ A;  5B4W A;  5H1M A;  1NR0 A;  4QQE A;  1MG2 A;  3OKW A;  3NVN A;  4JT6 C;  2I3S A;  5C2V B;  1SQ9 A;  2HXC A;  3SJL D;  3I8E A;  3OKY A;  3UR4 A;  2Z2N A;  4JSV C;  3I7N A;  4PNK B;  3FGB A;  2PM6 B;  3F3G A;  4A7J A;  3JB9 L;  3AH8 B;  3I89 A;  4D6V A;  1GXR A;  5FLX g;  5AMS A;  3I7K A;  4PSW B;  3FRX A;  1VYH C;  5HYN B;  4GGA A;  3UVN A;  4GGD A;  4GQ1 A;  4IMM A;  4X61 B;  4O1Q D;  3EI2 B;  3B7F A;  1MG3 A;  4L3G D;  2YBA A;  4O45 A;  2B5L A;  3ORV D;  3NVX A;  4BUJ C;  4J73 A;  5CXC B;  4CZY A;  3RMZ D;  4A2L A;  4EWR A;  3EI3 B;  3EG6 A;  2UZX B;  5EAL A;  5EMK B;  1Q47 A;  3A0F A;  2PM9 A;  4J81 A;  3OL2 B;  4ERQ A;  1GOT B;  5IC7 A;  4JXM A;  2IWK A;  2OIZ A;  1U2V C;  3RFH A;  1PEV A;  1QNI A;  4J84 A;  3I2N A;  3JAM g;  2I0T A;  4K3I D;  4MK0 B;  3U4Y A;  4OZU A;  1TYQ C;  5TF2 A;  4CY2 A;  2H68 A;  4OWR A;  2PBI B;  3CIK B;  5TDH B;  4A0A B;  4CC9 A;  4ERZ A;  3PXT D;  5FKQ A;  3EI1 B;  4GQ2 P;  4ZOZ A;  1GG2 B;  2OK4 A;  1PI6 A;  4CI8 A;  4YVD A;  2I3T A;  3GRE A;  2P9L C;  4O3U B;  3AL9 A;  3IJ1 A;  3IJC A;  3JRP A;  2QC5 A;  4J87 A;  3F3F A;  5TEF A;  1JMZ B;  3FM0 A;  3SWS D;  2XL3 A;  5A2Q g;  3J80 g;  4X60 B;  2OVP B;  2GC7 A;  3JZN A;  4CY1 A;  3C5M A;  3V9F A;  4J8G A;  3HFQ A;  5I5J A;  3V5W B;  5IJ7 E;  3ULE C;  3EI2 A;  3AL8 B;  2H47 A;  4J0X A;  4CI2 A;  2BBK H;  2TRC B;  1PBY B;  2AH1 A;  2H9N A;  4E5Z B;  4QT8 A;  5CXC A;  5HE2 B;  4Y5R D;  4U7A A;  3IIY A;  4CY3 A;  3JZH A;  3EI3 A;  2Z2O A;  3SCY A;  2P9S C;  3N0D A;  4QRJ A;  5GXH A;  4FWW A;  2CNX A;  4O3T B;  5I5I A;  3MXX A;  3SVW D;  2YB8 B;  3EMH A;  4GGC A;  4IA9 A;  2BCJ B;  3OL2 A;  2G99 A;  3C9C A;  5IGO A;  4CI3 A;  4CY5 A;  4J0W A;  4J82 A;  5EAR A;  2P9U C;  3J81 g;  4AOW A;  4J8B A;  1SHY B;  4JD2 C;  3I7O A;  2YNO A;  3NVQ A;  3RSE C;  3I7P A;  4A0A A;  3RLM D;  4XEI C;  3BG1 A;  4LGN A;  4XYH A;  5FXY A;  1S4U X;  3OTT A;  3PXS D;  4FA4 D;  3EI1 A;  3UVO A;  5AJA A;  3IKO A;  3JPX A;  5EAM A;  2HKR A;  4FAN D;  4XYI A;  1YFQ A;  2HJ4 A;  2IUQ A;  4Y7R A;  4BH6 A;  4A0B B;  1JOF A;  5GMK n;  4X63 B;  3SBP A;  3OKT A;  3VH0 A;  2OK6 A;  2HYE A;  2QXV A;  4A11 B;  3SN6 B;  4PBY A;  2YNN A;  3DSM A;  3AL8 A;  5HQG A;  1TBG A;  3UKR C;  2IUP A;  3MKS B;  2XU7 A;  5EM2 B;  4E5Z A;  4TZ4 A;  4GZ8 A;  4FAV D;  4ERY A;  5GSA A;  4JSP C;  3W15 A;  1XIP A;  2XL2 A;  3EI4 B;  5FKR A;  1K32 A;  1N6D A;  4ZN4 A;  1PGU A;  4L3H D;  4JSX C;  2J55 H;  1MDA H;  4L1Q D;  5AFU 3;  3C75 H;  1K8K C;  2B5N A;  4UI9 R;  4PXW A;  2J57 G;  3MMY A;  1NEX B;  3PXW D;  2HJB A;  4BL0 A;  3BWS A;  2G9A A;  3UVM A;  3E0C A;  2AGY A;  2AGW A;  2HKM A;  5K1C C;  4GM8 A;  3SFZ A;  4G56 B;  2H9P A;  2P9N C;  4H5J A;  4PBZ A;  3UKU C;  2GNQ A;  4J77 A;  2UZY B;  2H13 A;  4AEZ A;  2OVR B;  3PVW B;  2O9K A;  3SMR A;  1JMX B;  3VGZ A;  4A0B A;  3EU7 A;  3RFG A;  3L4O D;  4A11 A;  1FWX A;  4A2M A;  4LG9 A;  3BG0 A;  3L4M D;  3P4F A;  4ESG A;  2IUR A;  4FA9 D;  2B5M A;  2HES X;  5EM2 A;  3K26 A;  3EWE A;  5EML B;  4X3E A;  5H14 A;  3DM0 A;  4N14 A;  3DXK C;  2PM7 B;  2I0S A;  4H5I A;  5EMJ B;  3EI4 A;  5SXM A;  3RRM C;  3IJ0 A;  5IJ8 E;  4ES0 A;  4CZV A;  2MTA H;  2I0R A;  2J56 H;  4CZX A;  1RI6 A;  4PSX B;  4ZOY A;  4ZOX A;  4A09 B;  1L0Q A;  5HE0 B;  5JWZ A;  2IWF A;  3K27 A;  4E54 B;  3CFS B;  4Z8L A;  1B9X A;  5K19 A;  1ERJ A;  3MZL A;  5HE3 B;  5THA A;  1OMW B;  4GM3 A;  5CXB B;  5HE1 B;  1SQJ A;  3C99 A;  2CE8 A;  2IAA A;  4HDJ A;  3PE7 A;  4J79 A;  1R5M A;  5FKT A;  4CI1 A;  2H3X A;  3VA6 A;  4D0K A;  5EMM B;  2CO0 C;  5CYK B;  4A08 B;  2Q7Q A;  4R7A B;  4NSX A; 
#chains in the Genus database with same CATH topology
 2AH0 A;  1H2Y A;  2H6N A;  1B9Y A;  1JJU B;  3IVM A;  3K72 A;  5FQD A;  3IIW A;  2H9M A;  2VDQ A;  3MZK A;  3EQ9 A;  3T3P A;  1U4C A;  1JTD B;  4PC0 A;  1GOF A;  2CO0 A;  3I7L A;  3F3P A;  3MKQ A;  3SLE D;  2OVQ B;  3SBR A;  3V4P A;  3ZDY A;  3KRW B;  4JT5 C;  2P9K C;  1O6F A;  2VDM A;  3N0E A;  3OW8 A;  3ODT A;  3SHF A;  1XKS A;  3I7H A;  2AGL A;  3CFV A;  3JZG A;  3DWL C;  3KCI A;  4MMX A;  5GXI A;  3GFC A;  4FA5 D;  4UM9 A;  4J78 A;  1H2X A;  4DNV A;  4GQB B;  2Z2P A;  1OLZ A;  3I8C A;  3RN0 D;  3SBQ A;  5M5U A;  1VE7 A;  3UVL A;  5IT9 g;  3RN1 D;  2H14 A;  4FB1 D;  3OKY B;  2H6K A;  4Z7O A;  4KFM B;  2GC4 A;  4U1E I;  2H9L A;  2EBS A;  4A09 A;  2AQ5 A;  2YMU A;  4O9D A;  2YNP A;  4E54 A;  1N6F A;  2VDL A;  3KRX B;  5C92 A;  2AGX A;  3SXT D;  1P22 A;  4IRZ A;  3ZWL B;  5EAP A;  2IUV A;  1K3I A;  5CXB A;  2P9I C;  4DNU A;  5C2W B;  3O4G A;  2B4E A;  3PSL A;  4WJK A;  3UVK A;  2XYI A;  4GMB A;  5H17 A;  3AFC A;  4J86 A;  1XHM A;  5IGQ A;  1H2W A;  5CYK A;  4A08 A;  4ZOV A;  5TEE A;  3OF7 A;  4QL1 A;  4AN1 A;  2P9P C;  4G1M A;  2H6Q A;  2PM9 B;  2OJY A;  4I79 A;  4K3J B;  4FA1 D;  5I5M A;  2W18 A;  4G1E A;  4RE6 A;  5KDO B;  4LG8 A;  1GP2 B;  1N6E A;  1A0R B;  2EIE A;  3DXM C;  2CN3 A;  4GM9 A;  3V7D B;  3V4V A;  5FA5 B;  4L9O A;  2CN2 A;  3FCU A;  4FHL A;  3QHY B;  3PVU B;  5C9Z B;  3JRO A;  2QZP A;  2CE9 A;  3PSC B;  4JSN C;  5FKS A;  2AGZ A;  5HDB A;  5B4W A;  1JV2 A;  1NR0 A;  4QQE A;  5H1M A;  1MG2 A;  3OKW A;  3NVN A;  4JT6 C;  2I3S A;  5C2V B;  1SQ9 A;  2HXC A;  3SJL D;  2EIC A;  4BCD A;  3I8E A;  3OKY A;  4Z7Q A;  3UR4 A;  2Z2N A;  4JSV C;  3I7N A;  1A12 A;  4PNK B;  1GOH A;  3FGB A;  2BKL A;  2PM6 B;  3F3G A;  4A7J A;  3JB9 L;  1UOP A;  4JHP C;  2VDO A;  3AH8 B;  4NEN A;  3I89 A;  4D6V A;  1GXR A;  5FLX g;  5AMS A;  3I7K A;  4PSW B;  3FRX A;  1VYH C;  5HYN B;  4GGA A;  3UVN A;  4GGD A;  4GQ1 A;  4IMM A;  4X61 B;  4O1Q D;  3EI2 B;  3B7F A;  1MG3 A;  4L3G D;  2YBA A;  3NID A;  4O45 A;  2B5L A;  3IJE A;  3ORV D;  3NVX A;  4BUJ C;  4J73 A;  4NBM A;  5CXC B;  4CZY A;  3RMZ D;  4A2L A;  3O4J A;  2VZ1 A;  4EWR A;  3EI3 B;  3EG6 A;  2UZX B;  5EAL A;  5EMK B;  1Q47 A;  3A0F A;  2PM9 A;  4J81 A;  3OL2 B;  4ERQ A;  4NAA A;  5E6R A;  1GOT B;  5IC7 A;  4JXM A;  2IWK A;  2OIZ A;  1U2V C;  4WK4 A;  3RFH A;  1PEV A;  1QNI A;  4J84 A;  3I2N A;  3JAM g;  2I0T A;  4K3I D;  4L1M A;  4MK0 B;  4OZU A;  3U4Y A;  1TYQ C;  5TF2 A;  4CY2 A;  3O4I A;  2H68 A;  4OWR A;  2PBI B;  1BPO A;  3CIK B;  5TDH B;  4A0A B;  4CC9 A;  4MMZ A;  4ERZ A;  3PXT D;  2VDN A;  5FKQ A;  3EI1 B;  1E8N A;  4GQ2 P;  1GG2 B;  4ZOZ A;  5E6S A;  1O6G A;  2OK4 A;  1PI6 A;  4CI8 A;  5FFO A;  4YVD A;  2I3T A;  3GRE A;  2P9L C;  4O3U B;  3AL9 A;  3JRP A;  3IJ1 A;  3IJC A;  2QC5 A;  4J87 A;  3F3F A;  5TEF A;  1JMZ B;  2XZG A;  2XDW A;  3FM0 A;  3SWS D;  2XL3 A;  5A2Q g;  3J80 g;  4X60 B;  2OVP B;  2GC7 A;  3JZN A;  4CY1 A;  4Z7N A;  4NC4 A;  3C5M A;  3V9F A;  4J8G A;  3HFQ A;  5I5J A;  3V5W B;  5IJ7 E;  3ULE C;  5M5V A;  3AL8 B;  3EI2 A;  2H47 A;  3FCS A;  4J0X A;  4CI2 A;  2BBK H;  1TYE A;  2TRC B;  1PBY B;  2AH1 A;  2H9N A;  3MUO A;  4E5Z B;  2EIB A;  4QT8 A;  5CXC A;  5HE2 B;  4Y5R D;  4U7A A;  3IIY A;  4CY3 A;  3JZH A;  3EI3 A;  2Z2O A;  3ZDZ A;  3SCY A;  2P9S C;  3IUN A;  3N0D A;  4QRJ A;  4AMY A;  4FWW A;  2CNX A;  5GXH A;  4O3T B;  4O02 A;  5I5I A;  3MXX A;  3SVW D;  2YB8 B;  3EMH A;  3VI3 A;  2XE4 A;  4GGC A;  4IA9 A;  4MMY A;  4QAM A;  2BCJ B;  3OL2 A;  2G99 A;  3C9C A;  5IGO A;  4CI3 A;  3ZDX A;  4CY5 A;  4J0W A;  4J82 A;  5EAR A;  3GD1 I;  2P9U C;  3J81 g;  4WK2 A;  3IUM A;  4AOW A;  4J8B A;  1SHY B;  4JD2 C;  2YNO A;  3NVQ A;  3RSE C;  3I7P A;  1VZ2 A;  4A0A A;  3RLM D;  3QI0 A;  4XEI C;  3BG1 A;  4LGN A;  4XYH A;  3GC3 B;  5E6U A;  5FXY A;  1S4U X;  3OTT A;  3PXS D;  4FA4 D;  1C9I A;  4BCC A;  4AX4 A;  3EI1 A;  3O4H A;  3UVO A;  5AJA A;  4DNW A;  3IKO A;  3JPX A;  5EAM A;  1H2Z A;  2HU5 A;  2HKR A;  3ZE2 A;  4FAN D;  4XYI A;  1YFQ A;  2HJ4 A;  2IUQ A;  4Y7R A;  1L5G A;  4BH6 A;  4A0B B;  4BP8 A;  1JOF A;  4JHN A;  3IUR A;  5GMK n;  4X63 B;  3SBP A;  3OKT A;  3VH0 A;  2OK6 A;  2HYE A;  2QXV A;  4WK0 A;  4A11 B;  1T2X A;  1GOG A;  4PBY A;  2YNN A;  3DSM A;  3AL8 A;  3SN6 B;  5HQG A;  4RE5 A;  1TBG A;  1E8M A;  3UKR C;  2IUP A;  3ZE1 A;  1E5T A;  4G55 A;  3MKS B;  2XU7 A;  5EM2 B;  4E5Z A;  4TZ4 A;  4GZ8 A;  4FAV D;  4ERY A;  5GSA A;  4JSP C;  3W15 A;  1XIP A;  2XL2 A;  1QFM A;  3EI4 B;  3IUJ A;  5FKR A;  1K32 A;  1UTC A;  1U8C A;  3NIF A;  1N6D A;  4ZN4 A;  1PGU A;  4L3H D;  1UOQ A;  4JSX C;  2J55 H;  1MDA H;  5FFG A;  4L1Q D;  5AFU 3;  3C75 H;  1K8K C;  2B5N A;  4UI9 R;  4PXW A;  2J57 G;  3MMY A;  4UM8 A;  4BP9 A;  2VDR A;  1NEX B;  1YR2 A;  3PXW D;  2HJB A;  4BCB A;  4BL0 A;  3BWS A;  2G9A A;  3UVM A;  3E0C A;  2AGY A;  2AGW A;  2HKM A;  5K1C C;  4GM8 A;  1QFS A;  3SFZ A;  4G56 B;  2H9P A;  2P9N C;  3IUQ A;  5C86 A;  3K6S A;  4H5J A;  3IUL A;  4PBZ A;  3UKU C;  1C9L A;  2GNQ A;  4J77 A;  2UZY B;  2H13 A;  3T3M A;  3K71 A;  2VC2 A;  4AEZ A;  2OVR B;  3PVW B;  2O9K A;  3SMR A;  2VDK A;  1JMX B;  5M61 A;  3VGZ A;  4A0B A;  2EID A;  1I2M B;  3EU7 A;  3RFG A;  3L4O D;  4A11 A;  2WQ8 A;  1FWX A;  4A2M A;  4LG9 A;  3BG0 A;  2VZ3 A;  3L4M D;  3P4F A;  4ESG A;  2IUR A;  3ZE0 A;  3DDU A;  4FA9 D;  2B5M A;  2HES X;  5EM2 A;  3K26 A;  5M5R A;  3EWE A;  5EML B;  4X3E A;  5H14 A;  3DM0 A;  3MUN A;  4N14 A;  3DXK C;  2PM7 B;  2I0S A;  4H5I A;  5EMJ B;  3EI4 A;  5SXM A;  3RRM C;  4D9S A;  3IJ0 A;  5IJ8 E;  4ES0 A;  1VE6 A;  4CZV A;  2MTA H;  1VZ3 A;  2I0R A;  2HU8 A;  2J56 H;  4NSX A;  4CZX A;  5M5T A;  1RI6 A;  4PSX B;  3VI4 A;  4ZOY A;  5M5S A;  4ZOX A;  4A09 B;  1L0Q A;  3NIG A;  5HE0 B;  5JWZ A;  2IWF A;  3K27 A;  2JKX A;  4E54 B;  3CFS B;  3EQ7 A;  4Z8L A;  1B9X A;  5K19 A;  2HU7 A;  3EQ8 A;  1ERJ A;  3MZL A;  5HE3 B;  5THA A;  4AMZ A;  1OMW B;  4GM3 A;  5CXB B;  5HE1 B;  1SQJ A;  3C99 A;  2CE8 A;  2IAA A;  2VDP A;  4HDJ A;  3PE7 A;  4J79 A;  1R5M A;  5FKT A;  4CI1 A;  4AN0 A;  1M1X A;  1UOO A;  2H3X A;  4O2W A;  3VA6 A;  4D0K A;  5EMM B;  2CO0 C;  5CYK B;  4A08 B;  2Q7Q A;  4R7A B;  3MVD K;  2QR5 A;  3I7O A; 
#chains in the Genus database with same CATH homology
 2AH0 A;  2H6N A;  1B9Y A;  1JJU B;  5FQD A;  3IIW A;  2H9M A;  3MZK A;  1U4C A;  4PC0 A;  2CO0 A;  3I7L A;  3F3P A;  3MKQ A;  3SLE D;  2OVQ B;  3SBR A;  3KRW B;  4JT5 C;  2P9K C;  3N0E A;  3OW8 A;  3ODT A;  3SHF A;  1XKS A;  3I7H A;  2AGL A;  3CFV A;  3JZG A;  3DWL C;  5GXI A;  3GFC A;  4FA5 D;  4J78 A;  4GQB B;  2Z2P A;  1OLZ A;  3I8C A;  3RN0 D;  3SBQ A;  3UVL A;  5IT9 g;  3RN1 D;  2H14 A;  4FB1 D;  3OKY B;  2H6K A;  4KFM B;  2GC4 A;  4U1E I;  2H9L A;  2EBS A;  4A09 A;  2AQ5 A;  2YMU A;  4O9D A;  2YNP A;  4E54 A;  1N6F A;  3KRX B;  2AGX A;  3SXT D;  1P22 A;  3ZWL B;  5EAP A;  2IUV A;  5CXB A;  2P9I C;  5C2W B;  2B4E A;  3PSL A;  3UVK A;  2XYI A;  4GMB A;  5H17 A;  3AFC A;  4J86 A;  1XHM A;  5IGQ A;  5CYK A;  4A08 A;  4ZOV A;  5TEE A;  4QL1 A;  2P9P C;  2H6Q A;  2PM9 B;  2OJY A;  4I79 A;  4K3J B;  4FA1 D;  5I5M A;  2W18 A;  5KDO B;  4LG8 A;  1GP2 B;  1N6E A;  1A0R B;  2CN3 A;  3DXM C;  4GM9 A;  3V7D B;  5FA5 B;  4L9O A;  2CN2 A;  4FHL A;  3PVU B;  5C9Z B;  3JRO A;  2CE9 A;  3PSC B;  4JSN C;  5FKS A;  2AGZ A;  5B4W A;  5H1M A;  1NR0 A;  4QQE A;  1MG2 A;  3OKW A;  3NVN A;  4JT6 C;  2I3S A;  5C2V B;  1SQ9 A;  2HXC A;  3SJL D;  3I8E A;  3OKY A;  3UR4 A;  2Z2N A;  4JSV C;  3I7N A;  4PNK B;  3FGB A;  2PM6 B;  3F3G A;  4A7J A;  3JB9 L;  3AH8 B;  3I89 A;  4D6V A;  1GXR A;  5FLX g;  5AMS A;  3I7K A;  4PSW B;  3FRX A;  1VYH C;  5HYN B;  4GGA A;  3UVN A;  4GGD A;  4GQ1 A;  4IMM A;  4X61 B;  4O1Q D;  3EI2 B;  3B7F A;  1MG3 A;  4L3G D;  2YBA A;  4O45 A;  2B5L A;  3ORV D;  3NVX A;  4BUJ C;  4J73 A;  5CXC B;  4CZY A;  3RMZ D;  4A2L A;  4EWR A;  3EI3 B;  3EG6 A;  2UZX B;  5EAL A;  5EMK B;  1Q47 A;  3A0F A;  2PM9 A;  4J81 A;  3OL2 B;  4ERQ A;  1GOT B;  5IC7 A;  4JXM A;  2IWK A;  2OIZ A;  1U2V C;  3RFH A;  1PEV A;  1QNI A;  4J84 A;  3I2N A;  3JAM g;  2I0T A;  4K3I D;  4MK0 B;  3U4Y A;  4OZU A;  1TYQ C;  5TF2 A;  4CY2 A;  2H68 A;  4OWR A;  2PBI B;  3CIK B;  5TDH B;  4A0A B;  4CC9 A;  4ERZ A;  3PXT D;  5FKQ A;  3EI1 B;  4GQ2 P;  4ZOZ A;  1GG2 B;  2OK4 A;  1PI6 A;  4CI8 A;  4YVD A;  2I3T A;  3GRE A;  2P9L C;  4O3U B;  3AL9 A;  3IJ1 A;  3IJC A;  3JRP A;  2QC5 A;  4J87 A;  3F3F A;  5TEF A;  1JMZ B;  3FM0 A;  3SWS D;  2XL3 A;  5A2Q g;  3J80 g;  4X60 B;  2OVP B;  2GC7 A;  3JZN A;  4CY1 A;  3C5M A;  3V9F A;  4J8G A;  3HFQ A;  5I5J A;  3V5W B;  5IJ7 E;  3ULE C;  3EI2 A;  3AL8 B;  2H47 A;  4J0X A;  4CI2 A;  2BBK H;  2TRC B;  1PBY B;  2AH1 A;  2H9N A;  4E5Z B;  4QT8 A;  5CXC A;  5HE2 B;  4Y5R D;  4U7A A;  3IIY A;  4CY3 A;  3JZH A;  3EI3 A;  2Z2O A;  3SCY A;  2P9S C;  3N0D A;  4QRJ A;  5GXH A;  4FWW A;  2CNX A;  4O3T B;  5I5I A;  3MXX A;  3SVW D;  2YB8 B;  3EMH A;  4GGC A;  4IA9 A;  2BCJ B;  3OL2 A;  2G99 A;  3C9C A;  5IGO A;  4CI3 A;  4CY5 A;  4J0W A;  4J82 A;  5EAR A;  2P9U C;  3J81 g;  4AOW A;  4J8B A;  1SHY B;  4JD2 C;  3I7O A;  2YNO A;  3NVQ A;  3RSE C;  3I7P A;  4A0A A;  3RLM D;  4XEI C;  3BG1 A;  4LGN A;  4XYH A;  5FXY A;  1S4U X;  3OTT A;  3PXS D;  4FA4 D;  3EI1 A;  3UVO A;  5AJA A;  3IKO A;  3JPX A;  5EAM A;  2HKR A;  4FAN D;  4XYI A;  1YFQ A;  2HJ4 A;  2IUQ A;  4Y7R A;  4BH6 A;  4A0B B;  1JOF A;  5GMK n;  4X63 B;  3SBP A;  3OKT A;  3VH0 A;  2OK6 A;  2HYE A;  2QXV A;  4A11 B;  3SN6 B;  4PBY A;  2YNN A;  3DSM A;  3AL8 A;  5HQG A;  1TBG A;  3UKR C;  2IUP A;  3MKS B;  2XU7 A;  5EM2 B;  4E5Z A;  4TZ4 A;  4GZ8 A;  4FAV D;  4ERY A;  5GSA A;  4JSP C;  3W15 A;  1XIP A;  2XL2 A;  3EI4 B;  5FKR A;  1K32 A;  1N6D A;  4ZN4 A;  1PGU A;  4L3H D;  4JSX C;  2J55 H;  1MDA H;  4L1Q D;  5AFU 3;  3C75 H;  1K8K C;  2B5N A;  4UI9 R;  4PXW A;  2J57 G;  3MMY A;  1NEX B;  3PXW D;  2HJB A;  4BL0 A;  3BWS A;  2G9A A;  3UVM A;  3E0C A;  2AGY A;  2AGW A;  2HKM A;  5K1C C;  4GM8 A;  3SFZ A;  4G56 B;  2H9P A;  2P9N C;  4H5J A;  4PBZ A;  3UKU C;  2GNQ A;  4J77 A;  2UZY B;  2H13 A;  4AEZ A;  2OVR B;  3PVW B;  2O9K A;  3SMR A;  1JMX B;  3VGZ A;  4A0B A;  3EU7 A;  3RFG A;  3L4O D;  4A11 A;  1FWX A;  4A2M A;  4LG9 A;  3BG0 A;  3L4M D;  3P4F A;  4ESG A;  2IUR A;  4FA9 D;  2B5M A;  2HES X;  5EM2 A;  3K26 A;  3EWE A;  5EML B;  4X3E A;  5H14 A;  3DM0 A;  4N14 A;  3DXK C;  2PM7 B;  2I0S A;  4H5I A;  5EMJ B;  3EI4 A;  5SXM A;  3RRM C;  3IJ0 A;  5IJ8 E;  4ES0 A;  4CZV A;  2MTA H;  2I0R A;  2J56 H;  4CZX A;  1RI6 A;  4PSX B;  4ZOY A;  4ZOX A;  4A09 B;  1L0Q A;  5HE0 B;  5JWZ A;  2IWF A;  3K27 A;  4E54 B;  3CFS B;  4Z8L A;  1B9X A;  5K19 A;  1ERJ A;  3MZL A;  5HE3 B;  5THA A;  1OMW B;  4GM3 A;  5CXB B;  5HE1 B;  1SQJ A;  3C99 A;  2CE8 A;  2IAA A;  4HDJ A;  3PE7 A;  4J79 A;  1R5M A;  5FKT A;  4CI1 A;  2H3X A;  3VA6 A;  4D0K A;  5EMM B;  2CO0 C;  5CYK B;  4A08 B;  2Q7Q A;  4R7A B;  4NSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...