3BWSA

Crystal structure of the leptospiral antigen lp49
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
407
structure length
407
Chain Sequence
b'GTEIVKFSIHPYKGTVIRLGEEILPFKVLEMDKNIALVEMAIPVYKDEKEIELKLSSPGFQNSSYRIRKPEELNEKLIALDKEGITHRFISRFKTGFQPKSVRFIDNTRLAIPLLEDEGMDVLDINSGQTVRLSPPEKYKKKLGFVETISIPEHNELWVSQMQANAVHVFDLKTLAYKATVDLTGKWSKILLYDPIRDLVYCSNWISEDISVIDRKTKLEIRKTDKIGLPRGLLLSKDGKELYIAQFSASNQESGGGRLGIYSMDKEKLIDTIGPPGNKRHIVSGNTENKIYVSDMCCSKIEVYDLKEKKVQKSIPVFDKPNTIALSPDGKYLYVSCRGPNHPTEGYLKKGLVLGKVYVIDTTTDTVKEFWEAGNQPTGLDVSPDNRYLVISDFLDHQIRVYRRDGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Lp49
publication title The leptospiral antigen Lp49 is a two-domain protein with putative protein binding function
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Unknown function
total genus 105
structure length 407
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bwsA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bwsA02
2CE9A 4QL1A 4J77A 5HE0B 5EMKB 2OVRB 2G99A 2Z2OA 3I7PA 4A0AA 4O45A 5FQDA 3RFHA 1MDAH 4Z8LA 3NVQA 4JT6C 2OIZA 2H14A 3IJ1A 2P9IC 3RSEC 3SLED 3FGBA 5FLXg 3AL8B 3ODTA 3EI4B 3UVMA 3RLMD 4ZOVA 5A2Qg 4XYIA 4CZXA 4R7AB 1B9YA 2AGZA 3EI3B 5EM2B 3UVKA 1OMWB 3I7HA 4FB1D 3SFZA 4FHLA 3P4FA 1NR0A 5EMMB 3JB9L 5EARA 4L3GD 3AL8A 2CN2A 3EI4A 5GXIA 2OVQB 3EU7A 3CFVA 2XL2A 3U4YA 2CO0C 1XHMA 1TBGA 2GC4A 3IIWA 2CNXA 2P9LC 3JZHA 4GQ1A 4BL0A 3IKOA 3EI3A 2P9UC 3OKYB 4H5JA 4J0XA 1N6EA 2PM7B 2IUQA 4LG9A 2B5LA 4KFMB 5K19A 5H17A 4ZOZA 1QNIA 3J81g 2H6QA 2Z2NA 1SHYB 4ZN4A 4PNKB 3GREA 2OJYA 1K32A 3SWSD 4J87A 4JSVC 2J55H 2IWFA 5FKQA 2AGYA 2P9SC 1N6DA 3OKYA 3SXTD 3DXMC 5C9ZB 3NVXA 1U2VC 4GZ8A 1JMXB 2XU7A 3EG6A 4A08B 5IGOA 5GSAA 3JZGA 3I7LA 5EMLB 3F3FA 2HJBA 4J73A 4PSWB 5B4WA 3C99A 2EBSA 4A7JA 3K26A 3B7FA 4ZOXA 2I0RA 3ORVD 3EI1B 3VH0A 3C5MA 4CI2A 2YMUA 4L1QD 1XIPA 2P9PC 1GXRA 1ERJA 1FWXA 5FA5B 5HYNB 2UZYB 2IUPA 1MG3A 3JRPA 1N6FA 2J56H 4CC9A 3MMYA 3IJCA 1JOFA 3V9FA 5I5IA 5EALA 3C9CA 4CY1A 5TEFA 3EI1A 2CN3A 3I7OA 5IT9g 1GOTB 5HE3B 2IAAA 4GGAA 4Y7RA 4L3HD 4K3JB 1P22A 5EAMA 2H9PA 1GG2B 1PGUA 3OKTA 1OLZA 2AQ5A 3E0CA 4J86A 3RMZD 2AH1A 3I8CA 2H47A 3BWSA 4XEIC 2B5NA 3I7KA 3SVWD 4X61B 3RN0D 3PSCB 5H14A 4BUJC 5HE1B 4FAVD 1JMZB 4GGCA 3PSLA 3KRXB 5I5JA 5AFU3 4CI1A 3OTTA 4PBZA 3HFQA 4TZ4A 3C75H 3UR4A 1B9XA 4JD2C 3RRMC 3UVLA 3CFSB 3VA6A 3FRXA 3SMRA 3J80g 5IGQA 4O3UB 4JT5C 4K3ID 3MKQA 3DXKC 5EMJB 3UKRC 5K1CC 4X60B 3RFGA 3SCYA 1RI6A 2W18A 1K8KC 1A0RB 1R5MA 2GNQA 3PVUB 4FAND 3PVWB 2J57G 3GFCA 4IA9A 2HYEA 4QT8A 4FA9D 2I3SA 5AJAA 3SBPA 3AH8B 3PXTD 4E54B 4O9DA 2P9NC 4QRJA 3CIKB 4GM3A 4FA4D 2AH0A 3DSMA 4D0KA 1NEXB 5FKTA 4HDJA 3V5WB 4AEZA 4CI3A 2H3XA 5C2WB 2HXCA 4J78A 3DM0A 3K27A 4A0BA 3OKWA 3FM0A 3SJLD 3A0FA 4O1QD 3W15A 3RN1D 3PXSD 3JAMg 2HKMA 5FKRA 4E54A 2YNOA 2IURA 5AMSA 3IJ0A 3N0EA 4JXMA 2P9KC 4X3EA 4GM8A 1PI6A 2HKRA 2QXVA 2TRCB 4XYHA 1JJUB 2H9LA 1Q47A 5GXHA 4UI9R 5HE2B 4OWRA 5THAA 3SBRA 1PBYB 3KRWB 4E5ZA 4N14A 3MZKA 4GQBB 4PBYA 3EI2B 5TDHB 4A11B 2G9AA 3F3GA 3EMHA 4PC0A 5GMKn 4A2MA 3UKUC 4ERYA 2H6NA 2AGWA 4J8GA 4GGDA 2I0TA 4GM9A 3VGZA 3IIYA 4PSXB 2OK4A 4FA1D 2PBIB 1U4CA 5IC7A 2PM9A 2PM6B 5CXCA 4CZYA 3BG1A 3JPXA 5TF2A 2H6KA 3BG0A 3MXXA 4EWRA 3F3PA 3EI2A 2H68A 4A11A 5EAPA 4CY2A 2BCJB 4CI8A 3SHFA 4JSXC 2H13A 2CE8A 4J81A 4ERQA 4A09B 3NVNA 3SN6B 4H5IA 2GC7A 4OZUA 2AGXA 3I89A 2OK6A 4A2LA 2H9NA 4U1EI 3DWLC 5SXMA 5IJ7E 4X63B 4J84A 4D6VA 1XKSA 3L4OD 4LG8A 3MKSB 3PE7A 4A09A 2H9MA 2IUVA 4L9OA 4GQ2P 2I0SA 4A0BB 2Z2PA 3AFCA 2IWKA 5IJ8E 2MTAH 4I79A 5EM2A 2YB8B 3OL2B 4JSNC 5KDOB 2XL3A 3UVOA 4FWWA 3I8EA 1YFQA 4IMMA 1VYHC 3N0DA 3JROA 4J82A 5FXYA 3V7DB 1TYQC 1PEVA 4LGNA 3UVNA 1SQJA 4GMBA 4AOWA 5TEEA 3PXWD 4YVDA 5H1MA 1SQ9A 2UZXB 5CXBB 1L0QA 4ESGA 4E5ZB 3SBQA 4J8BA 4JSPC 2QC5A 2BBKH 4NSXA 3OL2A 4MK0B 4QQEA 2B5MA 2YBAA 4ZOYA 4G56B 2O9KA 1MG2A 3I7NA 3L4MD 5CYKB 4J0WA 4FA5D 2PM9B 3MZLA 5CXCB 2HESX 5JWZA 3I2NA 1S4UX 4U7AA 2YNNA 1GP2B 4CZVA 3AL9A 5FKSA 5HQGA 3ZWLB 4Y5RD 5CXBA 3ULEC 4PXWA 2Q7QA 2AGLA 4O3TB 4A0AB 2XYIA 4ES0A 3OW8A 2CO0A 2I3TA 4ERZA 4BH6A 5I5MA 4CY5A 2HJ4A 4A08A 4J79A 3EWEA 2B4EA 5CYKA 4CY3A 5C2VB 3JZNA 2OVPB 2YNPA
chains in the Genus database with same CATH superfamily
1KIUB 3KPSE 4UT9H 4N22A 1JWSA 4AL8H 4APQD 3GMOB 1SEBB 3ZDXA 3JYBA 4PD4K 1G7MB 5C9JA 4YHZH 4P2OC 1BLIA 4HWBA 3JV6A 2DKMA 5FCSH 4EVNA 1SY6H 5GGTA 2OVRB 3D39B 4NM4H 4OLXL 3HE6D 1PZSA 3QCUL 1A4KA 1E5BA 3B9AA 3CFEB 3QUZB 3RLSA 1E4KA 3GSNB 1BG1A 1KGWA 4JT6C 2YXFA 4R4BB 4F3FB 5D4IA 5EUOE 2P9IC 1E8WA 3QUKB 2C7UB 5D93B 3IFLL 3ASNB 1SHXA 2PW1B 3FQXB 4MNGA 3U2JA 3N41B 2GJZB 3TWYA 5L4FA 4D7PA 3ARPA 5ERWB 3O9WC 4FQ2L 1JBJA 1JGIA 2Y7QA 1T5XB 5D5MA 2ZUTA 3ULUF 2DWDA 3ZTJG 1ILUA 4IIQA 3R1GH 2MCPH 5EWIH 5KTEL 3WGVB 5J6HA 2XA8H 4F1SA 2HRHA 1AO7B 3W5NA 1SOSA 5DDHA 2PUQT 1YN7A 4OD3L 4QTIH 3IJYB 4XMLL 3IJ9A 1MFEH 1ETB1 4TSBL 1IBDA 3IMRA 1JGUL 3GM8A 1Q9OB 5EUKB 5KVFH 4PJDE 2APFA 2CBOA 3CSPA 4XN4A 3ULSA 3JVGA 1PYWB 4L3GD 1RY7B 1S7SB 3HBZA 5F70A 3RWEA 3EI4A 5IVOA 3MGOB 4GP5B 3VD4A 5L4JA 1HZLA 2XL2A 3U4YA 1HESA 4DN3L 3TJHC 1NBVL 3TIEA 1KFAH 3FQ1A 4MLSA 2NXZD 4LPUA 4QXTA 4X8GA 1FHGA 4R7NA 4GQ1A 4JPIA 3KYNB 4A63A 3T3PF 3NAAL 4N9OB 1R5VA 1CL7I 1IBFA 5D1XA 4E5XB 3HLAB 4K8RC 4ANXA 1NCWH 1KYOK 2GSIA 1MCJA 3DOIA 4HEPA 1MHCB 4K5OA 3FRUB 1M7IA 1YO4A 4MNQB 3N44F 3O41A 4WUKL 1BM3H 1CPUA 2ZOKB 3RWGA 4JHWL 3O6MH 4P2CG 4X4XA 2B9AA 2WJ7A 2B59B 1Z9MA 2DI9A 3ZDYF 1UYWH 3B2XA 4RAHA 4ZQKB 4ZN4A 2NDFA 3GREA 1KXHA 4M6OL 4MB3A 3UTQA 4F8PA 1G9MH 2MCG1 3C5ZB 3KHQA 4J27A 1SPDA 3RJDA 2BPBA 1JP5A 3D18B 2Z92B 3SCMA 3KGRA 5FKQA 2E7MA 2H4EA 3HNSH 3TFBA 3L3IB 5KSVA 1NGPL 4A39A 2DMKA 4Z1PA 1YYMH 3FT1A 4BFRA 2VM9A 3DUUB 3B7RL 3B7UX 3LZRA 4YSOA 5IGOA 3TT1H 2AK4B 3R0NA 4FLSA 5ENWB 2XWCA 2G4GA 4EN2A 4PH8A 1S3RA 5B4WA 4LMQE 3P3SA 3W81A 3WOVA 3LXUX 2D31B 4Q89A 5J89A 4TVPL 5HDBA 1U36A 1IVTA 2NLJA 2WD0A 4EIUA 4NN5B 4N20A 1USQA 4I87A 5LQBL 3HNTH 4Y5YC 1FAIL 1MFAL 5FWQA 3VXRB 4XWOC 2FX7L 1CICD 1RIHL 3WN5C 4C55A 3TF4A 4PP1C 2AQ1A 5LCVH 3CCHB 4GJTB 3NIGB 4M29A 1P1ZA 3NN8A 4YFLI 3U48A 4HPYL 4FQIL 4DNUA 1PLGH 1M3JA 1YRKA 4NWUH 4POUB 3O8XA 1YR2A 4CC9A 3MMYA 4MJHA 2FEDD 4Z3JA 3IJEA 5FWRA 3SIKA 1NZRA 4AXWB 4E9TA 4PFEA 2H0EA 1FZJA 4KO5A 2PO6D 4G1MA 4K07A 4TS6A 2VQTA 4AM0Q 4HUVA 2WWMC 3D30A 1WFIA 4FLQA 4X7TB 2I07A 3JTSA 5KYUB 5IT9g 5IMOB 4HSCX 1A3QA 1N59B 3UBXA 3DO7B 2W8CA 4TRPL 1G94A 4I18C 5F3FA 2UZPA 2VXQA 4Y2LA 4L3HD 3O4GA 1J9QA 4LXFA 4Y5YB 1PZ3A 2DQMA 3LAFA 1E67A 1MFVA 4FXTA 2A5UA 5TDOA 4LSPH 4A7UA 3P2BA 3WN5B 1ITCA 1MELA 5ACZB 1TKWB 4KJYB 3NPSC 1IX2A 3QEQA 3ZDZE 4KY2A 1ZVYA 3FZUD 3CVHA 1I75A 5D7IB 1UCBH 1UOOA 1P4LB 5IBUB 4N0YL 5DJCB 5GISL 4ZOAA 1U8JB 2B4CH 5HYQB 5G2NA 4ELMF 1U8CA 4KJWD 2A6DB 3QI9C 3GPSA 1MJ8L 4Z7OE 4JKMA 5DCCA 4XNMB 1NC2D 4IOIB 1HWGB 1EDQA 3JV5A 4FQQA 2DDQL 2QKIA 3FT9A 4I18B 5A6IA 1ZCRA 3MZTA 2R69H 1J0HA 4HK0A 5DC2A 2A9NL 4FLRA 4PTTA 4X42A 5IGQA 2WQAA 4J4PD 5HPMA 3T3MF 1J0JA 5MEOA 3TF7C 4JDTL 3E3QE 5D2LE 4OCWL 1CGSL 3DXAD 5C09D 3ESUF 2FYYB 5ETUA 3LEVL 4G7VH 4GQRA 4AOFA 1ACZA 2E27L 2IGTA 1NFIB 3HC2A 2VISB 5I1KH 1WHPA 1UEYA 2IALA 3QXVA 1MNNA 2NQ3A 15C8L 4NZDA 4ODHH 3MXVL 3U4EA 1FL3B 3F7YA 4O2EA 3RFRA 4JFYB 3C8DA 1R24A 3L7FB 1E50A 4L5FH 3PVUB 4AG4H 1FHNA 1H3TA 3U7WL 4YS4A 5CJXA 4JFVA 5J9PB 2OTUB 3VFOA 2BJML 3EGXA 2ZUXA 4FA9D 5AJAA 3S35X 5T1LB 1T20B 2WLIA 2X6AA 4XMVA 5KOVC 4WW2A 1WBZA 2DW5A 3DX7B 2XN9E 3FT3B 5SWSE 3T08A 4K94L 2UXTA 1FO0L 4I0PA 1L5GA 3ABLB 4HJUA 4MA3A 5JHAA 1NEXB 1KBWA 1P5UA 5C6TL 2UWEB 1I8MA 1U3JA 3OR7B 1EDHA 3QIBA 4PY7B 3M6DA 2YD3A 1VPOL 2D4FA 2GJPA 1IC0A 3Q2NA 1DN0A 1I7TB 5I6NA 1T80A 2FBJL 3PGCB 4XN9A 2H9GA 1A3ZA 4JFFE 3DUSB 1D9KA 4UINL 4LCCC 3OGOE 4F58L 5E2VL 4WWNA 4IEFB 4KOBA 1EIBA 4W70A 5H35A 1CD1A 4OFVA 1JD9A 1UJ3A 3I6GA 4EXKA 4G71B 4JXMA 2VITA 4RCAA 3QA3A 2CKBA 4AYID 4HKJB 4DCQA 3UZVA 1PI6A 1KGYE 4Z5RB 1VFMA 3D6GA 4ZODA 4PG2C 4V33A 1IKNA 1MWAA 4LEBA 4KKPA 1U8PB 1J11A 4EI6B 3I3DA 1E90A 2MFNA 4N90D 1S5IL 3QR2A 3QQDA 1DFXA 2X2HA 3BVUA 4QHPA 1M71B 1NQBA 4NQEE 1BQKA 4WLCA 3LMJL 1S7UA 5DD1L 3SPIA 2H8PB 2ZF9A 3H0TA 2F7PA 4ZMOA 2NNXA 1MCNA 3NGBB 5EF2A 3VGGA 2OQJA 4LGSB 4NPKA 1DQQB 5KVDL 4LCCB 4M9PA 4P4RA 5J13C 2C4FU 4G6JL 2QPEB 2BRRH 2H0FA 3H7LA 1E9PB 1CGVA 3WJMB 5I1HH 5DO8A 4MJ4A 1PBYA 4CMHC 3DNKA 1AP2A 1QLEB 3HE7D 4GKNA 4HPHA 5HVFB 4F5CA 5D7JB 1T03H 4L1BA 4WWOA 2H3XC 3GIVB 1BVZA 2AV1A 4MVBC 4B9IA 4RAVA 1G4MA 2NZIA 2OZNA 2Z9TA 3UZEA 1G7QA 1GKOA 1OF2B 4GH7B 2O26U 1U30A 4BBWA 1PG7L 2CE8A 5EBWA 1AS6A 1KTCA 3OXSA 5IW6A 3TZVA 3OHXA 4L0PB 4ODVH 1J0KA 1SOXA 2DEXX 2CGRH 5BJTA 4H5IA 4MCYA 2WMPA 5D1XD 4JPKL 3NFPA 1JPFA 4ZMTA 2AJ3A 5EFIB 4YLCA 3I89A 1GYVA 1YNTA 3EYSL 3D05A 4QRSA 4GAYA 5J13B 1TYEA 1RZFH 3WUWG 4OJYA 5C0NC 3SE3C 2ZOOA 1G1OA 3QH3B 1AI1L 2VZUA 4EZMA 4AJ0A 1BA9A 4LLMB 1MCWM 2F68X 3S48A 1UXWA 4CMHB 4AGQA 3JZYA 5HGHB 3T2OA 3PDOA 4BH8A 1RJYB 2BVPA 3OJVC 3F83A 5GRYA 5INDA 3SCMD 4BRVA 2VJ8A 4PI0A 2DICA 5I16B 1KC5L 4GBXD 5I6MA 3ARRA 1YSOA 6PAZA 2WBJA 3MGTB 4R96B 1R5WB 2ICEC 1TMCB 3P4NA 4B9KC 3OL2B 5KDOB 4WUUE 4NT6A 3K2MC 4WQOA 3RUGA 1G1YA 3VGAC 4DK5A 4FJ6A 5C0FA 1DLHA 4U6YB 2BY3A 2FQEA 3QG6A 2NPLX 1CFTB 2Q3ZA 1TYQC 3PHOB 3G7TA 5C1MB 3SYCA 1ZTXH 4TXVB 2XQYK 5LXGH 4J3OC 5D6DC 1CD0A 1U2YA 3VXOA 4DKTA 5C3IA 5E1AA 5JOFB 4Z7OA 4ZZFA 4XNUL 2NYYD 1L0QA 2PCFA 2AJXL 4GYBA 4H0IA 3V5DB 2VM3A 4I13B 3WHE1 3ME0A 3FQTB 3GFUA 4BE6A 1MH5B 3JQOB 4UTAA 4BSWA 1CXEA 2HSIA 4ACTA 1AY1H 3O8XD 3QRGL 2VZ3A 3WD5L 4L0YA 3NCCB 3D8MA 4ODWB 1RZIB 4DIXA 1E4XH 4Z0BH 5D2LA 1PQZA 2N7BA 2ICEB 4QHMA 3WFBH 1OLLA 5TPWL 3AQZA 2ZG1A 4NM8H 4YSPA 4FKEA 4LSTH 2VDKB 3VGAB 5GGTL 4CMMA 1VLXA 4K9EH 4I48B 3VAEA 4XCFL 2ESVA 2EXTA 3UDWC 5C0CA 3LNDA 3BEVA 4DK3A 1YC8A 5DQJB 5DSCA 1JZDC 5ANMB 4A7TA 2BY2A 1AGEA 1Q72L 2TAAA 4XRCA 5LGYA 4GRLC 2BHYA 5F7LB 4GKOA 4H8QA 4BCXA 4PLNC 1GZHC 4FZ8L 1H8NA 3BQUA 3GJFH 4K7FA 4AC4A 1CDBA 4E42B 1A8JH 5BZDB 3KYKH 2W0FA 5KS9B 2XN9A 3IDXL 3KAAA 3QEQD 5I0ZA 2ZX7A 3O2DH 1AD0A 5DJ2A 3VXQA 1GHFL 1RL1A 2HXAA 4YFLF 1L7TL 5EORH 5AW7B 1DQML 4B5ZA 4QF1B 4IBUA 3KPQA 2YNPA 2TRHA 3Q8FA 4WDIB 4ZSOA 1Q90A 1O7SA 3UBGA 4BK5C 4KZ0A 4WTXA 3E6FB 1TQCC 5CF3A 1KXTA 1ZE3C 3IMSA 2VABA 4JFFA 4AT6A 1FIGL 4ZUVB 5BVJB 5DJZA 4O45A 3B56A 3OG6B 5KSBF 4LBEB 1BFOA 4NRYA 5A6LA 4PJAF 3LRLA 5FUCC 1I8IB 1BF2A 4Y16C 3QDAA 3NZSA 3D07A 3SLED 4OLWL 3U4BH 4G55A 1BJMA 4AIZA 1NEUA 4XXWC 3P4OA 3CZGA 2J6WA 3QUYD 4BFBD 3OG4B 3PHAA 2AW2A 4IGBD 5F3HB 5DJDB 1R5IA 4NQCE 1EHNA 3F3HA 2AGZA 1YEFH 3ILEA 3L4TA 4O2CA 4FNUA 8FABA 1QG3A 5A2KH 1UOKA 4N0CD 4WI6A 2KDYA 5GRUL 3NSJA 3OKLA 4BIKA 5CN2A 2PMZA 1FNSH 3BPLC 3MBEA 1FFPA 4U1GC 1UD2A 5E8OB 4ATWA 4KTDL 1TQCB 3QUHA 3VG9C 3GHBL 5EARA 1GZPB 3IMTA 3QZLA 4EI5C 4PMEA 3E6HA 3CFQA 2CN2A 3CC1A 5GXIA 2W80C 4P3DA 4LEEA 4NC1C 4YDIH 5F96L 1XBRA 1WTGT 2AMUA 2Z7YA 1UCTA 2V6HA 1W0WA 2VO5A 4FMKA 4Y16B 1XAKA 2IOMA 4GT0A 4I0PD 4POZC 3DVGA 1N5AA 3T0BA 1OCOB 3GDCA 4FNLL 1QBLL 1FFOA 3IMBA 3QIBD 4NDMA 2GCYA 4LG9A 2Z91A 4HWUA 4UT6H 1FCCA 1CE6B 5FHBH 1T3FA 5I0VA 4NKOB 3AUWB 3ML8A 3ZSSA 1QUPA 2HH0H 3F05A 3X11B 1P2CB 1BZEA 4KXBA 4YPGB 5DK2A 1QAWA 1X5KA 1RMFH 3GRWA 12E8L 2PTUA 1UC6A 1QNIA 2W07A 2RACA 2RD0A 4QOKB 1HFUA 4BZ1L 5LDUA 4JFOA 2BLFA 2OCFD 4JDEB 4XP6L 4EI5B 4TUOB 1PY9A 1OSPH 2FGWH 3RA7L 1GGYA 4OR1A 2ZQKA 1NIEA 2JCCB 4AK2A 3L6FA 3SGKA 1WC7A 3P73B 2XBZA 3V4PH 3HZYB 3ZRFC 3HMXH 4A08B 3LZOA 3N50A 5B3NA 5EIIB 4EBQH 3HAEB 2EEFA 2SODB 2DYPB 1XMWA 4C47A 4JFDE 2XPYA 2OMYB 1JI1A 1QBML 3NTCH 3N43B 4YH6A 1HK6A 5ANHA 3DARA 3KYAA 5I74C 4IRZL 3KL3A 4XP9L 1BIHA 1JNHB 3C60C 2MJWA 3ULUE 5I6KA 5E2WL 2NY2D 4AIOA 3LXAA 5F1SA 4H26B 2YMTA 3G6JA 4HLZH 1MFBL 1IQWL 1NCJA 4R8WL 5HYSG 3H56A 1BWWA 4WUUA 2G2RA 4LPTA 5ITFA 5BS0B 4ADJA 1BAFL 3O6FA 4PVNA 5DK0B 2O61B 3SKUD 4OV5A 1NAKH 4BELD 4KRPD 1JGEA 1N6FA 2GK0B 2WQXA 3BSZH 3BN3B 3SDAC 4ZPTA 2X70B 4PRAB 5EZJA 5IGXL 3S8WA 2ZSVB 3TZVD 1VEOA 4UV4H 1HOEA 3T3PE 5CCKH 3VJ6A 2JXMB 2NXYD 5T1JA 4O51B 5I74B 3IPFA 2FO4B 4NKDB 4X8JB 3CHXA 3HB3C 4HXBH 3KW8A 4C83A 4WK4B 1N10A 4PJ8A 1T6VN 3FYEB 4K3JB 2NR6A 1TVHB 2UZIH 3QXWA 4WHYG 1EK3A 3ZDYE 4D0CA 3MRBA 5DGQA 4BGLA 4BHUI 1F3RB 1RHHB 3FULA 1OLZA 1UXSB 4NAAA 1A0QH 3RMZD 4IOSA 1ZT7B 3Q3GA 5IMKA 1XL6A 3I8CA 4R5XA 2J8OA 1TUPA 5PAZA 2ZSWB 1D7BA 3SDAB 2IANA 3WE6B 4D8PB 2B5NA 4OY9A 4NZ8A 4RMWA 4PJGA 5ICYB 4TPRH 1EGJH 4YC2C 1AGDB 4ZUSB 2WBJD 2X3AA 3EF4A 3N55A 1CI5A 3CFBB 4U6VH 3DA0A 1DEEA 3UMNA 3BD4A 5A7EA 4MX7A 1BD2B 3V10A 1OOWA 1XWVA 2PW2B 3CWGA 4JD2C 4NUMA 3GSQB 1IEAA 2Q7AA 1RZGA 4YDZA 5K39B 3QJSB 4N0RA 3RL2B 3WEAA 3UZQA 1A6VL 1L9SA 1EDYA 2J1YA 4TL5A 3HOGA 1A64A 2L7UA 2W9DL 3KYOA 5EO1A 2JTYA 3MA7A 1F4AA 2NZ9D 4E9SA 3RFGA 1W6WA 3VD3A 4F2MB 1RZQA 4MJIB 4BCYA 5LDSA 3DIDA 3P40A 1IEBA 2B8OT 3QIWA 4O58H 4GXUN 1RJZB 5J1TC 4PREA 4XBMA 1WUNT 2WLZA 2FJGA 4JFZL 1Q8MA 3WKMH 4FAND 5CFHA 4JFXB 5E2JA 5FKAB 1C16B 2HYEA 3GBNH 3LKOB 5HGAB 1PFOA 2QDWA 3NCMA 5F7EL 4LZKA 3AROA 2HTLD 3OXRA 4BZ2A 3U25A 1WWWX 2WK2A 1R9FA 1KCRL 4JFUA 2IBBA 1TF4A 3BO8A 3CSFA 4YDNA 2OMWB 3I9PA 1ZLEA 5ITBL 5FO7A 3MU3A 1A14H 1OAZH 2DQDH 2QSCL 4HDJA 3AWEA 4WI7A 1QWNA 5G4OA 4J78A 1OANA 4A2DA 3BQUD 1ROWA 3DX6A 4JFHE 3W57A 3WHXA 2HG5A 2MTAA 4M43H 1BZOA 3UYOD 2XN9D 5SWSD 2IC2A 1FH5H 2NTFB 1E7VA 4N2KA 4UM9B 1F4WH 4OAWA 3L4VA 4OI8A 5KVMC 2FZ3A 2Z64C 3EOTH 3QCTL 3GTNA 4KKBD 4ZW5A 1R3KA 5IR1B 3BZFB 4XAWH 4ELME 3QUML 4XB3A 2CRZA 4IRSB 1NCIA 4MHHG 3J7HA 5EIQA 4KTEL 3O4LB 2R4SL 5GS3A 3HC0B 4JFFD 3O4IA 4R90L 4LK4A 5GXHA 2E8ZA 2IXQA 3TBVB 5KBLA 1OTUD 4OWRA 4TLSA 1IFGA 3SBRA 3SJVE 1HSBB 2PNDA 5HJGA 1KGUA 2BS9A 2YRLA 3APDA 1GKEA 2EVHA 4YN3A 3I9AA 1ZLVK 3T3ME 3RHWK 1BQ5A 3D0VA 3V52H 4YR6B 5JXEA 1JZ4A 1NIAA 4L4TE 5LXVA 5I1IL 3VSTA 3H2WA 3L3JB 4QHLB 4R5TA 3ASWA 5F9JB 2IPKB 1NGWA 2RFXB 2EJ1A 4BKSC 1LP9B 1IC5H 2PM6B 3V4LA 3U82B 3QJRB 5IHHA 1KCSH 1KJ2L 3BAEL 1BZ7A 3MBED 4NQED 2HJLB 3GLAA 2OZ4A 1J9TA 5TE6L 2Y6SD 3VGBA 4PJ9C 4EWRA 2XQBL 5JIKA 3QR1A 4OZFG 2B3RA 5GSVA 3L16A 3MCKB 4PPTA 4Y5XB 1VCAA 5CP7A 1MAMH 2QQLL 4AJYV 4FJYA 1XHHA 2ZYSA 4ONHB 2P8MA 3S5LG 2HKAA 2VUKA 3BKMH 4YWGL 4ZMQA 1BPOA 3VD9A 1NC4D 5FLUA 2YN3A 2ZYIA 3K46A 1TETL 3GMMB 2VDMH 4GKSA 1TLMA 4N2CA 1E7UA 4ZTOL 3U0PA 3CSBA 5FM5O 3QWNA 1AGFB 4P06A 1JNNH 3NIFB 5HI4C 3C5SA 3MCLL 3MV9E 5A43C 1SY6A 2ZXWB 1UOPA 4HJ0C 4JQIA 4U1EI 2H32H 4M8UA 4PYGA 1ODUA 3RY6A 4GW1B 1AHWA 2BWDA 1TZHA 4LSSL 1G9NC 2J6EA 4LESA 4PS4L 3FTWA 4FQHA 5AL8A 4PV8B 1BYNA 3D2TA 3QQ9D 4F20A 3HZVB 3K8LA 1PW3A 2DKUA 2GY5A 4WWKC 5IQNA 3ZZ1A 4LG8A 4G72B 3KLHC 4M6ML 2IQAA 4V1DA 3PXHA 1NCTA 1B2WL 3CBRA 3E9UA 1BXXA 3INOA 4DJMA 1IEHA 3O2WH 4HX1B 1MUJB 1E27B 2EABA 3ABKB 4HPOL 3BT2H 3DUHA 5F6IC 4EUPB 1XR9B 1HS6A 5M5UA 1CT8A 4HJGB 4LVHC 5SV3A 4A7SA 4GKZA 3ZKXC 3RYMA 4F9LA 4M8RA 2E59A 4EEEA 1PPIA 1I1FA 2IOOA 2IFFH 3SQRA 1MCHA 4ODUA 1FVDA 2WXHA 2KQMA 4JQVA 5IBLD 3FONA 4FKHA 1RIUH 5GS0C 4AM0B 3PQYE 1A6AB 3GUTB 1QR1B 3B2UC 3LH8A 1T1ZA 3UTZB 4PGEB 2OM5A 4IBLT 2VDOA 2GPZA 4P99A 3JTTA 1RP9A 4RDQF 3QXUA 2VOTA 1KXVA 4UB0H 1SDDB 1UXMA 1LEKB 4WUUD 4WWKB 5CIPA 1SJMA 2J8HA 2R7EB 2UY6A 2NSQA 3I74A 3HI5L 2VQ4A 5FC9A 2ED6A 2BBKH 5TFSL 4NQSA 5KVEE 2J8UF 3F6LA 4NSXA 4P46A 3AT8A 3C2AL 5D1ZB 4XMUA 2GTQA 3FN0L 4LVHB 4DVBB 5HHOA 3ZKXB 5C97A 4ZS6D 5B4MD 3MOBH 4APXA 5HJ3B 1OB1A 3BZDA 5K9JH 3L4MD 4NUPA 3BW9B 3PPEA 3V5HA 5D2NE 3LS4L 5B3JF 4X4ME 2X41A 3P2DA 3MLZL 4FYQA 1MRFL 1DVFB 3BDXA 1N8OE 3ARBC 5GGSA 4YQXL 3MCG1 5J6SA 1GR7A 2Y22A 4QRTB 1ID2A 4XNXH 1AOZA 1ZJAA 3GZKA 2EVJA 4NPJA 3WJJC 3MROA 4FCHA 3MNWA 4GUPA 2BP3A 3GMLB 3GLDA 3TBYA 2ILLA 4G6ML 1ZLUK 4BH6A 3ZE1B 1BZQK 2BS8A 2EECA 4LP4A 1CFSA 1NSNH 2D9CA 2OW7A 3QQ4A 4IOSD 3RGVC 5ALBL 3NRFA 2DQ6A 3EJSA 4IKKA 1AJ7L 2WKLA 4NBMA 2IAND 1XL4A 3C6LA 3HUJA 5DYOA 1C9SA 5BPPA 1W15A 3EF7A 3RZCC 1KTRL 5J12C 5K93A 3SODB 5IHUL 3VQLA 3N0AA 2XLLA 1QR4A 3DV6A 1DQLH 3V9EA 4DP0X 4FNQA 2Z2OA 2Z65C 2YC1A 1UB5A 5E9DE 5CLZA 1LVEA 5LCVA 1R3IH 4OFYA 4PBVC 3ARBB 3QC5X 1KTLA 3EYOB 4C4KO 3GSNH 5FGBC 4ELMA 4RFEA 4NKMB 2ZUVA 4M7ZC 1B6DA 4P23B 1HHKA 2XVKA 3QDJB 4WI5A 5M61A 2D3NA 4FXKC 3GUFA 1PD0A 2OX5A 2YOCA 4FTDA 3EXLA 4Z7UA 4WK0A 4XYIA 3B2MA 3OF6D 3ILPB 4Y9FA 3RGVB 2DQFA 1LD9A 2D73A 4NN6C 3VM5A 2V2XA 2VIRB 3QG7L 1FL5A 3FUEA 3LKRB 4DPRA 2X1QA 3CHRA 4Q2ZB 3FCSB 1CURA 1I3GH 3QIWD 3T3MA 3RQ3A 3IKCA 2E4TA 4AI7A 5LBSH 4L4TA 4DEPC 3PWLB 5I8OL 1BQUA 4IHOB 1ET8A 2XNAA 3SE8H 5ISZE 4MQXD 4NQCD 1G7HA 1QNZL 2HRPH 4U7KA 5MEQB 3NDYE 1EHLL 3FT2B 1U95A 1XDTT 2V9UA 3NACL 2VWEC 4NO0D 3SDCC 4IKNA 4OW6A 4AENB 3LY6A 4GSDH 4PJFF 4DAGH 3IIWA 2OFQA 3KE0A 2E4FA 1A4JB 3O11A 4WGKA 5GGQL 4WW1B 1SJXA 2NY0C 4NNPH 5D55A 2AEWA 3MVDK 2VE6A 4LCWA 4FXKB 3DV4B 2EO1A 2F8OA 3TLRA 1JPTL 1VEPA 3L3DA 1BOGA 4KTYA 2VDLB 2PM7B 3EYUH 2F15A 2CHXA 3ILQC 2RQ8A 2J5LB 4M5YL 4R0LA 2HVBA 2YJQA 3LKPB 4BFKA 4UIKL 2WQVA 4JFWA 4FFZL 5F3BA 1QFOA 3G6DL 4AMYA 1JIBA 3SPVB 5LGKA 3OPZH 4HIHA 3V0WH 4FL4C 3T0EE 5ADPL 2BSEA 4DEPB 2VN5A 2ADIA 3S3CB 2DL2A 2ITCA 3AT0A 2XPGA 1YECH 4H0GA 3A22A 3IB4A 5CZVH 3SDYH 5KYWB 4KNQA 2JLPA 4JHUA 3T4YA 4D9RE 1KLUA 2J55H 5LO7A 3PDGA 3TA3A 1OM9A 2RJMA 3GXUB 3SDCB 3T2PA 5KSBE 4KZDH 1ODAA 5EOCL 4PJAE 4PGDA 4H2AA 1H6EA 2EZ0D 3T09A 4F57H 5F1NA 2EEAA 2NY0B 1D5IL 1T5WA 2Z7WA 1CIUA 1E5AA 1ONQA 4OJEH 4YBLC 1UA7A 3RDTD 1M42A 5AYQA 3VM7A 4ZD3H 2DM2A 1EEZA 5GRZA 4NZJA 4J73A 1DQDH 4BKLA 3OAUL 4K8RH 4GINA 2VN7A 1ACXA 3M1CA 2I9LA 1V3MA 5FCUH 5I1DA 3EBIA 3L4CA 1FF5A 1T7ZA 3S37X 4RFOH 3VFWB 4NBZB 4S2SA 4Z7NA 4PTUA 1S9VB 5LGHL 1SXCA 2YMUA 3AG3B 4FD0A 3ARSA 4LLWB 4GIOA 4N2EA 1F6FB 3ZKND 4U3XA 5CLTA 2P9PC 5BRZB 3S88L 1JDAA 1NDGA 3FU3A 1NMBL 4NIYE 3PQYA 4D0BB 2XICA 3PGDA 3VD1A 2WTRA 3HNVH 3GRBA 4ZNEA 3VGFA 4OF5A 4HV8A 4X50A 4YGVA 1EJOL 1GC1L 4HS8H 5DJ8A 2F58H 4LF3B 3CVBA 3ARDA 3COOA 4E41A 5DR5L 5EG6C 2BWQA 4HZ1A 1IZJA 4OB5H 1H6UA 1O5PA 4PJEA 4YBLB 5DMIL 4EMZA 5IVZA 2BSRA 5FYJL 5DWPA 1ET7A 1LWHA 4DGVL 2P44B 1DLFH 3AY4A 5EBGA 3FCGA 2A4ZA 2QVFB 1DE4B 4UANA 3MO1B 5JDJA 1H2WA 1EV2E 1J1XH 3KXFB 5HE3B 3ZQXA 4U1NB 2V7NA 5CP3H 5EOTB 4NS0A 4RBPK 3UGUA 3LD8B 1OP4A 1V27A 4I5BA 2W92A 4O2FA 4XBGA 3VYNA 3HE6B 4Z3GA 2G9HB 3ULVF 5EU3B 3V4UL 3ZHLA 4RGOH 5LBVA 2PPAA 2X53A 2OJZH 3SQOH 2J1KA 4X4MA 3AC0A 4MA8L 1VZIA 2DL9A 2GJ6E 3RVUC 4YJZL 1YEHL 4Z78A 4W9FC 3BESR 1RVFH 2WGXA 4M4RB 2APTA 4XEIC 4UZUA 3DURA 3K6SA 1BQRA 4X7EC 3GMRB 3GS7A 2X4TA 4RFNC 2ZKYA 1YMMB 3CK0L 3D69A 5KW9L 5H14A 1QI3A 1NEZA 4BUJC 3QNYB 1MRDL 2CXGA 1PZAA 2I7SA 2H3KA 2NZ1A 4MDIB 5J3HD 3EH5B 1N4XL 1Q94A 2OYMA 4NXSA 1JGVL 5SV4A 1UD3A 3RU8L 2ZNXA 3R06B 2WCGA 4BV1A 4MCMA 3BH9A 1DSYA 3H42L 1HL8A 2AXJA 3NCFB 3VE0A 3O4HA 1Q9KA 4AQZA 1DJXA 2BC4B 3IDGB 3ESMA 2F6AA 1E2WA 4W6WB 1HQRB 3D87B 1KEML 2WIIB 1BX2A 1EHKB 2VH5L 2NXZB 3OJDB 4W93A 3V0VB 4RQQA 4EDWH 3GMPA 4QKXB 5IWLA 4XNQB 5C9KA 4P46D 4LCYA 1PVHA 3E80A 4RFNB 4X7FC 2DPKA 4TSCL 4JEGB 2XHNA 3FXIC 5HHOD 5I28A 4G11A 3D34A 5FV1L 1WSST 5I6XC 3GHEL 4TTDD 5FF6B 4ZOBA 2OTWA 1OPGL 3X13B 3VTTA 4DEWA 4WFGE 4FQCH 4P57A 4QRJA 2BNQE 5E6UB 3VFVA 3A21A 2D8KA 4WNSA 4GM3A 3Q05A 3QO1A 4FG6D 3BP4A 3US9A 3F6IA 4CI3A 4NERA 2Y06H 3AVEA 1PLBA 1H0DB 2N7SA 3KWTA 1Q9WA 3MJ9L 4JM4H 5JLZB 4BFJA 5FFLA 3IFOA 2OJEA 2BMKA 3WNIA 5ILTH 4RSVA 3HRPA 4I3GA 1NGZB 5DGRA 4RSYA 3T77B 4JDZA 1FLTX 2HTKD 3O3DA 4LSUH 2IURA 3SQBA 2ALWA 5AMSA 5I6XB 2VSDA 1LL1A 1QFWL 3W0WE 1YPZF 1YUHA 4W9CC 2CLRA 2W88A 3CX2A 1MHPL 3EOAB 4H5SB 3QAZB 3EZ8A 5GZNA 5IP4A 1I7ZA 1FL6B 5C8JB 5JOPE 1OP5H 5GGSY 3AW5A 1CICB 5T1DL 1RK1A 2GUYA 3T0EA 3BWAA 1RZ7H 4GEJA 2JJVA 4NP4H 1OGAB 4W81A 1AC6A 5D70H 4HFWA 5DVNA 1KCUH 1U91B 3IUQA 4UT9L 3H9YA 4AL8L 2H6NA 4Y0GA 1HTYA 4YHZL 3H3PH 4J12A 2VW6A 5KSBA 4R7VA 5E5UB 4YDKH 3F7LA 1P7QA 4Y4KA 4Z76B 5IB5B 1SY6L 4NENB 4NM4L 2PM9A 1M1XA 4KKLD 5MENE 4FC3E 2IWGA 5DQ9A 3MXXA 4L4TD 4HAGA 3QZBA 4TULH 2ADJB 5IMLA 2BKLA 4UQ3A 4S0TD 1KEGL 1DHKA 1TOXA 3UPRB 2C9UA 2MNJB 3QZOA 4N2OA 1WRFA 3GJFA 1QLEH 2LR4A 4HS3B 4ZBJA 4DN4H 3HG5A 3KBHE 4WO0A 3INUH 1RZJH 3O2DA 3RWHA 3R1GL 4XZUA 1CI3M 1AR2A 2XA8L 2PTTA 3NVNA 2P49B 2D3JA 4LCWD 3OKDB 5CJBA 1REIA 3UIYA 4OLEA 2K6WA 4FLHA 2OL3A 1MFEL 1V7NL 4Z3EA 1I4FB 5KVFL 2B15A 1SXAA 1RSYA 4QDGA 2AV7B 3FTSA 3PPSA 5IB3B 3C9NA 1F18A 4ZFGH 5I1EH 4DGWC 5DJ6A 4J84A 3IPBA 2BSED 2OI9C 1AQKL 1UM4H 2JJWA 4Q9QH 4YGAB 4Y5VC 3B3BA 3G04A 3SPHA 1KFAL 1LK3L 4IU3B 3MV9D 2XWJB 3FO9A 2IPTL 4X6EB 5DK3A 2RMNA 1A6ZB 4ZFOA 1UWEH 3TA3D 4F7MA 2X88A 5C09B 1ZLSL 3SPJA 1NCWL 4NUJA 1AIFA 2LVCA 3CZFA 4JM2C 4OFIA 4W9LC 4A0BB 5FHAH 1D6EB 5T33H 1BM3L 3KPPB 4Z7QF 1KLGA 1ORQB 3WUWB 3X12B 3O6ML 3QIUC 2DLIA 1IVLA 5FO8A 4N6RA 1WO2A 4KXCA 1CR9H 4JFPB 1N6UA 1ZT4A 1Z1WA 4L4VA 2UYLB 4QRUA 3OX8B 1IC7H 3GXDA 4FJZA 1R6VA 2CO6B 4NO5A 2ITDA 3QNZA 4XCNA 4WKZB 1GGBH 2YQ2A 5E1IA 1AZBA 3B37A 5K9OA 1PZ2A 2ZOWA 4JM0A 2OR7A 3L3KB 3K71B 3HNSL 4Y5VB 3BFWA 4WEEA 3QJTB 1ZIAA 4AQ1C 3LOWA 5K9KB 1X5LA 4HSAC 4J8BA 3G5YB 1I8KB 3PQYD 3RWCB 4W9IC 1M6UA 3DOHA 3TT1L 4JPVH 4XH2A 5C3TA 4B9CA 3MGAA 1LO3H 4PJ6A 1AXSA 2CBMA 2NUPA 5D8JH 1Z9OA 3FBQA 1NKGA 4OZIA 4KFMA 2X7LB 3WIFB 2H1XA 4E41D 3K6OA 4JREC 1DQJA 1AR1D 3QIUB 5AW5B 2DQIL 4K23H 3O6LH 1IILE 4W9EC 1S8DA 5GZOA 1X7QB 1HCYA 4L3CB 3HNTL 4UU9B 1JWSB 3F58H 2VDKH 3NQIA 2OMUA 3DX3A 3UFIA 5C9JB 1LLAA 2WV3A 2GYSA 5D6CA 5KZCB 1N6QH 3FCBA 3JV6B 3ZXAC 4EVNB 1LEIA 1JZ3A 3B5HA 5HYJB 3HE7C 3GLZA 4N8VA 3UXFA 3L1EA 4NWUL 5L2KA 1A4KB 4J3OH 3V4PA 2QGDA 2AJVH 2CLVA 4AQ1B 5AZUA 2XSKA 3QULB 4RIRA 5J5EA 1BEXA 1KG0B 2EDEA 3VXPA 2Z0UA 5DFVD 3NP3A 4J2XA 3V0IA 1HT6A 2BSCA 2WSDA 2OVPB 2VCOA 1L9OA 1P7BA 4PJXA 5FM8A 4QL1A 3ISYA 2NY7H 5D7EA 3ZE0B 5HE0B 1YY8A 2DWDB 3S9DB 3POHA 4IIQB 1X3DA 2AKRA 2XFGB 3C6EA 2DQCL 2G2PA 3TN0A 3NZHH 3VXMB 4UILH 2WOYA 4OBSA 5DDHB 5FXCH 4G8EB 5C08B 4LSPL 1YN7B 1J48A 4DVRH 3KHOA 5ACLA 3LNHA 3U0WH 3QFJB 3HE7B 4P5RA 4PVBA 3W0WA 4GP4B 1ICTA 2JIXB 4Z95H 4EZJA 3EI4B 1UCBL 3AS0A 2XE4A 5E9DD 4GBXC 2QQQA 1GIGH 4B7IA 4QO1B 2B4CL 2PYEE 4UUJB 1H3WM 1H3GA 3OJ2C 4A67A 2SEBA 3U46B 4F8LA 3QPKA 4LLQA 2WGNB 3UTPE 1R5VB 2J8UE 4G70B 2ATKA 4GKLA 2QV4A 3SZKC 4NWTH 3ZX1A 5A7BA 5CCJA 5KS9F 4FB1D 1M7IB 1ZOXA 2R69L 5HVWA 3NZ8A 3RWGB 1ASPA 5I1CH 3HG0A 4J23A 4L9LC 4HD5A 4OT1H 5B3JE 1U42A 3IF1A 4ADIA 2OVQB 4ZAKA 3FO0L 1I7RA 3AITA 2BOBB 4G7VL 3UTQB 1WK0A 2E7LA 2GAZB 1EERB 3CLFH 3O3EB 2P9LC 2YGPA 2DI8A 5I1KL 3SCMB 2AXWA 4ODHL 3TYGH 2YPVH 4AGLA 4H4NA 3GSUB 1DVYA 3GSRA 2C9VA 4GBXB 1QKZH 3BDBA 1EGJA 4L5FL 3FUJA 1N6EA 4AG4L 1SN0A 4H7VA 4KUCF 1QPXA 3II2A 3KJ6H 3OV6A 5K19A 3W9DA 2XI9A 4IRJC 4L29B 4BJLA 4KK6C 1UD6A 3BFOA 5MI0C 3JV4A 3PIQA 1XH1A 2VN6A 1JYWA 1Z9PA 2FECI 3GMQB 3L95B 4N9GB 4L9LB 5HDBB 4L9DA 4AX4A 3QJVB 5GZND 5I1LA 1JZ2A 3RHWF 4ZG1A 2K3HA 3ETBJ 3DWTA 1NL0H 1J8HA 3PV6B 4W4OA 2CIKA 2WKOA 3WIIL 5F8QC 3T0ED 4X9YA 1P1ZB 3EG6A 3NN8B 3OLEA 3V0HA 4HK3J 2C9XA 1G7IB 1GYUA 3U30C 2XETA 1K8DB 4XGZA 5D1QC 3O8XB 4PMFA 4F8NA 2WC7A 4D9RD 3ENEA 1HH9A 3HAEH 4WV1C 2R2HB 2J1ZA 5DLML 1FZJB 2XWTA 2Z31A 1AOHA 1HEHC 2YD8A 4Y4KD 1WIPA 4IRJB 1ASOA 2R1YA 3CVIL 3CZKA 4KO7A 1FLRH 5KWYC 1R3LA 3EW3B 5JQ6H 3I85A 1Q9LB 5MI0B 3JTSB 5FFGA 1JK8A 4I1PA 4KRNA 3WFEH 3EUDA 4I9XA 4N2FA 5KAQF 1PDKA 1WWAX 3SN6N 5FA5B 1Q0EA 3TEXA 2IIJA 2CGYA 1D5ZA 2B20A 4OI9A 4F33A 2PXYC 1DTUA 4NCDA 1D5MA 3QUYC 1C1EL 4OZHA 1QA9A 4IGBC 3VI4B 1R3HB 3QEQB 3MRRA 4PJFE 2YK1H 3U30B 2AGJL 1B3IA 1KZYA 1TQBB 3P77A 2J4WH 3CXFA 4ZI8A 2JKLA 3P4MA 4WV1B 5I75B 2ZPKH 4E0RA 5HYSB 3RI5K 2JNZA 1IJNA 5GQBA 2O1AA 4JL1A 4KV5E 1LMKA 1A22B 2X89A 4OQTA 1UZ8A 1U8CB 5I1HL 4KDTC 3IMVA 1GOFA 3O2VH 4UQIM 1CTNA 4BRJA 1L9NA 4NNYA 1RH8A 3KPRE 4K3JH 4PJHA 3RTLA 3TYFB 1KLFA 2H9PA 4WW2C 4OIAA 1KDIA 2WLLB 3KPSB 2QKIB 2ZXGA 2YUXA 2C9AA 2VR8A 2N1TE 5EDSA 4HK0B 1WLHA 2XRAH 2BIQA 4ODVL 1YJDC 2JJUA 5HPMB 1JCVA 2V4LA 3HG2A 2CGRL 2AZAA 4PRNA 1HSAA 3QUYB 3U6RA 5KN5A 3CFDB 5KVGL 1I1AA 5ETUB 1XH3A 4IGBB 2DJMA 4U1KB 4RMBA 3D25A 3NDZE 3MLRH 1H9VA 1BFTA 4TLTA 2PYFA 4N3TA 5H2BB 1CBJA 4OGAC 3R8BB 2GJ6D 5EUOB 3U4EB 1IC1A 3QORD 3WO4C 4F92B 3QXAA 4L4VD 1R24B 2ADGA 3MLSH 3MUJA 4YBQC 4HJTA 4JGUA 1UJ3C 2P7TA 4M6NH 1H2XA 2CJUH 3QWOA 5E99L 1BZ9A 5AVRB 1FAKT 1T21A 4UQCA 2PR4H 5FYKE 2ZP9A 4WW2B 5JXAH 4CU6A 5CEXA 1SEQL 4Z0XB 5MEPB 4JZNB 1WA2X 1IMHC 5I1AA 2IDSA 5JW4N 3DXKC 3P9MA 4D2NA 1P5UB 3BUIA 3RG1C 2D2OA 1DUZA 4PJDB 2P8LA 5AUMA 4BH7A 1F6LL 2VDQL 1SHSA 3DX8A 4TN9A 5IJVA 1SZNA 1H2YA 2JE8A 4PWFA 1DN0B 3SB3A 3ZN6A 4GG6F 3CH8A 2J57G 1TJGH 1HHGA 1O0VA 2EDNA 2PYEA 3B8SA 4TQIA 1ZTXL 1P7HL 2KHAA 3V2AR 3VYOA 5GZOD 1W8NA 1V3JA 3QVAA 5I6OA 2J8UA 2UXVA 4KMLB 2VTFA 1J87A 4WTQA 5GRXG 3FU7B 5H35B 4F7TA 1UJ3B 1IBHA 4EQ2A 5F2FA 2H41A 4FEIA 1WHOA 2Q6WB 4WFFE 4GRWF 2Q87A 5CLYA 3JV0A 4KRPC 3UZVB 3ULVE 1EPFA 3UEZA 3FF7A 5C2WB 1AY1L 1OE3A 4PV9B 3WMPA 5L2KD 3HS0A 1IQDB 4M48H 4XN1A 1MWAB 2OSLA 4ZUWA 2EH7H 1E4XL 3MRDB 2VLKE 2BNQD 3B7YA 4JHVA 1JPSH 3DSFL 1W0YT 4OJDH 5FOJA 3WFBL 2XV2A 4GW4B 4NM8L 2QVTA 4FX5A 4AGNA 3RN1D 4K9EL 4Q6IC 3SE4A 1S7UB 2CIIA 1C8QA 4AITA 3H0TB 3ZTCC 4L2LA 5ABDE 2YNOA 4BINA 2YEQA 1QPKA 2CU9A 2QSTA 4G8AC 5F9OH 2ROYA 5EZLB 1U8HB 4P4RB 3TN0D 2DTMH 2AK1H 1XB6A 3L1FA 3HC4H 4PJBF 4TVUA 3FB7B 3MRHA 3TEWA 1O9ZA 4NJAH 2CCWA 2UZXA 3QXDA 3TJEH 3KYKL 4K73A 1PBYB 1HNYA 3T1WA 4N14A 1MEXH 1AP2B 4L3EE 2CUMA 3V5KB 4KRPB 3B3IA 4GQBB 4LQFH 3UCRA 4K3DL 3W0WD 4BDVA 2CE6A 5EORL 3VD5A 2AV1B 5FW8A 4L1SA 4R7DA 2V5YA 3CMOH 3DRQB 1G7QB 5B22A 5JOPD 2XY2A 3FB5A 3BKCH 2NX5E 5DRZA 1S7TA 3EO0A 3LN5B 4HYTB 5F6HI 4KH2A 3TZVB 5IW6B 3ATDA 4OGZA 4HLJA 5FYJU 3STLA 4G42A 4ZX6A 4K0OA 2YAFA 2NXYB 4MCYB 2WMPB 4ZUTB 5BJTB 3NFPB 4S1DD 2PBIB 4G7YH 2AJ3B 5CUSH 3U2SB 1TTUA 2Q5BA 1YNTB 3PHQA 3CGTA 3KVQA 2HMID 5JW4R 2H6KA 1Z3RA 3RNKA 4GAYB 4Y7MA 4GI6A 1TYEB 1SLVA 2A9BA 1U3HD 4HIQA 3IGLA 2Q76A 4BHUA 2MPAH 2P80A 3LIZL 5KBKA 2QVKA 2HAZA 1WDAA 4ZAKD 2ZP0T 1Z9SA 2MHAB 2Q86A 5MEND 2X44D 1X5FA 2R1XA 2BVPB 1N0LB 1YEFL 2FX9H 5INDB 1E5UI 3QYNA 1RPQA 3VFSA 1U92B 2GC7A 2H0PA 2FNBA 5BUAA 1SEBA 5FV2A 1FNSL 3ZTNH 5BRPA 5B7FA 2W9LA 2WQSA 5DZOA 1G5AA 1CBVL 4HUMB 1J5CA 3TWCL 4OZFB 4PJFA 4DP5X 3D39A 3ZDZB 1KPVA 4DGVH 3ARFD 3PP3H 2LU5A 4GFTB 2HTLC 4NT6B 4X6FB 4X63B 1BJ8A 3CFEA 3QUZA 5C0FB 1DLHB 3B9VA 4AIEA 1BQLH 1CF8H 2ICES 3QG6B 1OAUL 1KN4L 1NICA 1YPZE 2N0KA 4HUUB 4P5SA 4R4BA 4F3FA 3I50L 4V11A 4JO2H 3N42B 3WLBA 3QUKA 2R8SH 2WBKA 3ML9A 3LPOA 4N0FB 3VXOB 1ADQA 4MMYA 3VGHA 2GJZA 4MCNA 1DUYA 5E1AB 3UYRH 5IOKA 4ZT1A 4UT6L 5ERWA 4F15B 5FHBL 4Y19E 4EUPH 1T5XA 3MNVB 3EYQD 2EQDA 2AXHA 3ME0B 4YMPA 5LUMA 1MW1A 1MCRA 2H6OA 4N8VG 1RMFL 1AO7A 1G9HA 3WY4A 3TH3T 4LSRH 3W11D 1BVNT 5AAPA 2JB6A 1K5NB 5D2LB 4P2OA 2CHDA 5E4IA 4YPJA 3N3EA 2YAQA 4QHMB 5TQ2H 3FU5A 1Q9OA 2JSFA 2WXJA 1CLVA 4KO6A 1OSPL 2FGWL 5HDQL 1PYWA 2VR9A 1S7SA 4YVDA 3NIFF 3FOLB 3TNMA 1KGCE 3BAXA 3ZKMC 1XGZA 3KH4A 1SQ9A 3FJTA 3T8MA 1OTUC 2YIHA 3HMXL 4BFIB 1MCIA 3NA9H 3QZWA 2QBWA 1AGEB 1ZA3B 4EBQL 2OSWA 1LHZA 3V7AE 4X6CF 3SSGA 1J9SA 5EMYA 3DETD 5GGVH 3UACA 4B9JA 4E5XA 3O9WA 3H9ZA 5DUJA 4U31A 1KCVH 4GSQA 4GAJH 3Q9QA 1MXGA 2X0UA 3E1ZA 4AW7A 1MHCA 2W0FB 3FRUA 2XN9B 5SWSB 4X5RA 2ZOKA 1AD0B 5DJ2B 3JZ7A 3LEXB 4XN5A 2JB5H 3WHE0 4FA5D 3FQUA 3D3VE 1VGKB 5DO2C 3KS0J 4IDJH 2X89D 4Y5RD 4XX5A 4GQZA 1C5CL 1QYGL 1NAKL 1KXTB 2HT3C 3D18A 2Z92A 3U36B 4AGMA 3TNNA 1OAYH 3QFDA 2VABB 4JFFB 1RLWA 5HI3D 2LFGA 3HR5B 2WNWA 3KLQA 4XVJL 5DJZB 3VGDA 3ZTEA 4HCRH 3BSZL 3LQAH 4ZO6A 3L3IA 4QTFA 3U2IA 3ET9F 4OCXH 4DGIH 4JG0L 4NRYB 2XKSA 2FSEB 5G55A 4ERZA 2WXIA 3DUUA 4Z7IA 2HJ4A 4DF9A 5AOKA 3VRIA 3M46A 1UATA 5M94B 3MNZA 2XCMC 3QS2A 4UV4L 5CCKL 2AK4A 2WYIA 3MLWH 4AIZB 5D9SA 5DRWB 3AXLB 1J1PH 1I1AD 2ORBH 2CE9A 1LE9B 1KCKA 1OAJA 2XY1A 2BM3A 5EMKB 4F27A 4Z7QE 2VLKA 4YHIA 3GBMH 3OBAA 1I2MB 2UZIL 1FFNB 4Z9KB 2BIOA 4A2GA 3VXRA 4NQEB 3BMVA 2DQUH 3S4SG 1MDAH 1FFPB 2X28A 2ZKXA 1F3JB 3CCHA 1XXFC 1L7IH 3VRLF 1JD7A 1OIOA 1WCQA 2Q3XA 1KULA 1NGXA 5DWUH 3VH8A 1QW9A 1CE1H 2XQYA 4A37A 3UVMA 4QYAA 4GLRH 4DSYA 3V0DA 4LGRB 4FYSA 4TPRL 3QSKB 1NC4B 1EGJL 4R7AB 1DR9A 4ZFFB 1KWGA 1N5AB 1J5DA 4U6VL 2A9AA 1HINL 4XPTH 3V4VL 1N0XL 3PGFH 4X7TA 4NDMB 4H88L 2GCYB 4KROD 3JT0A 1N3NB 4XP5H 5IBLC 3I7HA 4HETA 3SFZA 3DO7A 4FXGA 5DK2B 2PYED 2NX5A 4RE6A 1EANA 5I1JH 1VDGA 4Y5YA 4PYHA 5ADOL 5EV7A 3D0AA 3UTPD 2W07B 1WYJA 3WN5A 5ACZA 1JFQH 1TKWA 3O3AB 5E6YA 5GS1C 1XHMA 1OTTD 4MYPA 3F85A 4OLZH 2LAGB 3CMGA 5HGBB 2A6JA 3ZTJH 4FFYA 2WXRA 4O58L 3L6FB 1P4LA 3WNLA 3ZBMA 1OOAA 5DJCA 4ALAC 1FBIH 1U8JA 3WKML 2ICWJ 2NY5C 3PFQA 4X5PA 2VDLH 2EIZB 1DFBH 2A6DA 3F65A 4JAMA 5IROC 3WTXA 1GY1A 4LSQH 5DFTA 4QXUH 4YSCA 2C26A 4A2FA 4IOIA 1RUQH 3JWOH 4PNKB 2OJYA 3K72A 3IAGC 1YEDB 4O02A 5A6MA 1A14L 1OAZL 2DQDL 2X9WA 2XZQH 3MV8E 1FZMB 1AYRA 2WUBH 2XZCH 5J6GA 4CKVX 1HXYA 3PAZA 2CK0H 2ZXDA 2IPUK 3DRTA 4CSTA 4WUUB 2G2RB 4E9RA 5GS1B 2Y4SA 1PLAA 3DXMC 2EUVA 4M43L 1PEWA 3BAJA 1NFIA 4FFVC 1LM8V 5B3SB 3ZL1A 4GNKB 1FH5L 1YPZA 5GSAA 1F4WL 4LCIH 2N7AA 2VZSA 5AKTA 4JFYA 3L7FA 4PSWB 2FRGP 3EOTL 2FWOB 2X6MA 4JQXC 4A7JA 1EZVX 3QI9A 1FGVH 2YSTA 1PJ9A 2P43B 4AEFA 3WL9B 5J9PA 2OTUA 1NIBA 2JH2A 1VB9A 3VJ6B 4NCC1 4PWGA 5B39A 2VDRB 5T1LA 1CG9A 3WFDH 4QTHB 3B9DA 3EDDA 2X9ZA 4F7CA 1MJUH 3R8QA 3FT3A 1IGIH 4PIRF 3ETTA 4KGJA 1A7BA 4C83B 4HKXB 4JG1H 2DLHA 3TO2B 2XN1A 1CDYA 4K4KA 1XH2A 2WUCL 3V52L 2RH0A 3OR7A 4HVBA 2IFGA 4NI6A 2C3GA 2WP3O 2QV2A 3Q8CA 3UCQA 2VNCA 4HULB 1I7TA 2BS71 3KNBA 3MUGB 2C4XA 4ACPA 5GHWL 5I9QC 3MC0A 3UABA 4AYGA 1IC5L 3DHPA 2YAEA 4WI8A 1ZS8B 3T4AC 4AKPA 5I71C 2ADFL 3MLUH 1KXQA 4LLUB 5ALCL 1CXFA 4IEFA 3IGUA 5TDNA 3B6SA 3FRPA 2Z8RA 3K4AA 3G08A 2EDKA 1HQ4B 3OAZH 2DJSA 2UZYA 4MQXC 4U1SB 1DEEB 3D39D 2YLKA 3KLKA 1MAML 5LJYH 3QEGH 3FSVA 3EJYD 3WFCH 4EI6A 1IBBA 3IDYC 2LLGA 5HVHC 4YDMA 2VDML 1HYSD 2YEZB 5AKSA 1ZT1B 1ROCA 2BXZA 3UZQB 1YA5A 1M71A 4YSTA 4NB7A 2MCMA 3JWNH 3I7KA 3OKEA 2H8PA 3OPUA 1JNNL 2R0WH 1QVOB 4XPBH 4I3SL 5EO1B 4RZKA 1E4WH 1QZNA 3DBXA 3MA7B 1DQQA 4HGMA 4LCCA 3T4AB 1JMZB 4QJ5B 4M93C 1IEBB 1FYTE 3KRXB 5I5JA 3LZPA 3T2QA 5AFU3 1WG3A 5FUCE 5CEZL 1E9PA 4L8DB 1NAMB 2FJGB 3ECWA 4P2OD 3WJMA 5DU7A 3FT4A 5MP6L 4PJ7F 5AVYB 1W8EA 4NQCB 3SE9H 4NRZB 3OXRB 5EA0L 4Z7QA 1AIZA 4JO3H 4PG2A 1UUNA 3O2WL 4P2RE 3GIVA 3L4UA 3BT2L 3KGUA 1QD0A 4NO0B 1XCTB 3BO8B 1X9LA 4K3ID 2DM4A 2H45A 3OGCA 4LIQE 1OF2A 3IDYB 4RMSA 5ECGA 3F8UB 5AW2B 5HVHB 3UKRC 4UZGA 3RE0A 4LAQH 4XVTH 4U3HA 4HF5H 1RI6A 2F53E 1R5MA 2IFFL 4ERSH 5G4NA 2AS5M 3RDTC 5GJSH 4C4KT 3O9WD 1T1WB 1SUJA 2IDUA 2YQGA 5FYKD 5BZWA 4NJ9L 1RIUL 3WHXB 3B1TA 2B1OA 2XPZA 2Y7LA 3QH3A 5M5SA 1IGTA 4AV4A 3TPKA 5DVPA 4UB0L 3A4FA 4NZFA 1OAXH 1TTBA 3FU8A 4NQUA 3Q06A 4D0KA 1RJYA 3V5WB 4Y1SA 3ULUC 2H3XA 5IJKC 4G5ZH 4QWWC 4ANWA 1L3NA 4U05A 5I16A 4CGUB 5T1KB 3Q13A 1NUNB 1B4TA 3MOBL 5K9JL 1FNEB 3MGTA 3NT0A 1R5WA 4R96A 5M7QA 1S7XB 2X4QA 3WNPA 3UOAB 5KJRH 3QHFH 3RDTB 1BMGA 5E5MA 4Q56A 4X5LA 3S0PA 3T0WA 4WFFD 5TDHB 2RIKA 3D1MC 4K8RD 2I26N 3MV7E 3L45A 3ULVD 1O5DT 1EZLA 1ZTMA 3OAYK 2DAVA 4P0DA 4U6YA 3BWUF 3SE3A 1CFTA 3GBEA 4G9FE 3PHOA 3T5WA 1NGWB 2WWKO 2VLKD 3W37A 1WD9A 3FC8A 4XNXL 4DFHA 4F1ZA 1FDLH 3DJTA 2A7BA 4N1CA 5FYLL 2ZWKA 3NJKA 4JANB 1JRHH 3P0VH 4XMWA 1ITBB 4JFDB 3P0YH 3ZMRA 1WV7T 3V5DA 1NSNL 3KMDA 1ZIBA 2DMGA 4OCSH 1KEGH 4MJ5B 3QDGE 4WVRA 3FQTA 2YZ8A 1TVDA 2GVYA 1MH5A 1L9TA 2P28B 3NFSH 1JL8A 3K2UH 4LNVA 4TQEH 4TSAH 5CD5D 4K55A 3F3GA 4PC0A 3CDZB 1CYGA 5JW5B 4ODWA 2P8MB 4EZKA 5DURD 1RUPH 3FN3A 1UWXH 4EDXA 2ICEA 3DHMA 4GKSB 3HS9A 1DQLL 1XSOA 3P3RA 1MHEB 2OAAA 4GQQA 4AUJA 3U0PB 5KVGE 2J20A 3IN0A 1AC0A 4L3ED 2VDKA 5E1QA 3L5IA 4I48A 3RRQA 2Q9OA 1E3FA 5DEFB 5C70A 1R3IL 1MPAH 4WHDA 4GG6E 1E5ZA 1YVLA 2IQ9H 1DANT 5DQJA 1PJWA 3GSNL 2NX5D 5ANMA 1BDYA 2A2QT 5D6DA 3MOAL 3T3PB 4XWOD 3SHFA 3B7TA 4PP1D 5BZDA 5H4ZA 3IXTA 1HL9A 5KS9A 2VR3A 3HBQA 4ZXBC 4FA6A 3N44B 4GRWE 3VFRB 1F8TH 3LTVA 4JRLA 3UC0H 1I3GL 2GTWA 2X1XR 5LAPA 4HA1A 4LOUC 3ZDYB 5LVEA 5LBSL 3NABH 3QZWG 3SE8L 3UG5A 3E6FA 4DWHA 3QP3A 1TQWA 2WWMD 2HRPL 1I1FB 3ECBA 4NI3A 2VXSL 3NRPA 3CHPA 4ODUB 1FNGA 5BVJA 4ZUVA 3UDWA 1MFCH 1FVDB 3ELAT 4NFDA 4LBEA 3FONB 3KWWB 4K71B 5FO9A 1JNLH 4GSDL 4DAGL 1T1ZB 3PREA 3C8KA 3UGXA 4GRLA 2VDOB 5E95B 4NNPL 1RZKL 3NIDF 2J71A 3JTTB 1GZHA 4PJBE 4YSQA 3CN0A 5ID0A 1NBYA 2PPEA 3CHOA 3HMWH 5CIPB 3EYUL 4AK1A 3PNWB 2UY6B 1YAIA 1WAAE 1KPRB 5CR8A 5DJDA 1BWMA 4LDLB 2IWKA 2WO2B 2IVFC 4M56A 4J28A 4P46B 1A7RL 3VU2A 3MRJB 1SM3H 3OPZL 4YVUA 3V0WL 3VD0A 4A04A 4BK5A 5I24A 4IMMA 4APXB 4EE2A 4XPHL 1OB1B 2E56A 2H7WA 1YECL 3QI9D 5CZVL 1L0PA 1T83C 4BFEA 1T2QH 3GRGA 1TTFA 3V5HB 4GMBA 1GZPA 1X4YA 1P4IH 1UTDA 3LEYH 4HIJB 3ZYOA 4EZLA 3EJQA 2A74C 4KZDL 3K80A 5AOLA 5CHNA 2XKUA 5T5FH 2YPLE 2ZUWA 3T8VA 2H2SC 2HLAA 6FABL 2R9HC 2YSSA 4G43B 2QC5A 1ETJA 1E30A 1TPXC 3FTUA 4XXWA 2CJ3A 3RI5F 2HPTA 4ZMVA 3S36H 4P2RA 3F04A 3MHZA 5AW8B 3TBYB 2O9KA 1PKQE 4MD5A 1CE6A 3LRSA 3OKMA 4OKVA 5CSGA 1V3LA 3QQ4B 3I7NA 1EQWA 3X11A 4RFOL 4C54A 1P2CA 1CLCA 3VH8G 2WXFA 1AAJA 2XQYG 5FGRA 3ZZQA 3NSFA 5CXCB 5KBMA 1EZSA 2CNZA 2F53A 4KKLC 5DYOB 4QOKA 2WVTA 2E47A 1HEJC 2XBTA 5BOZG 5FKSA 2AI0H 5CXBA 4JDEA 2DYRB 2NY1D 4J5VA 1MCKA 4TUOA 3ALXA 3ULEC 3AJ7A 3HG1E 4HWBH 3ZO0A 3DX9B 2X05A 2DWSA 5EH1A 2JCCA 2OXGA 3GO1H 1F3DJ 2A74B 4HS8L 2NNFA 2UUDH 4C56E 2F58L 2WOBA 1QSFE 1GJIA 3P73A 3D3VD 2L7QA 3X1EA 1KTLB 4OB5L 4Z3HA 4A08A 4ELMB 2C9PA 1TPXB 3TVMC 5CYKA 1F1DA 5EIIA 5IJDC 3GXTA 3HAEA 1HHKB 1DLFL 1CXLA 2B14A 2RA1A 2ZCHH 5H37G 1FGNH 3LCYA 2OX5B 1LO0H 1J1XL 1PD6A 1CXHA 4WK0B 1DVTA 1JNHA 2VDPB 2DQFB 3SJVB 1G0DA 1FL5B 4QRBA 4FF9A 4J3TA 3KPNB 4JM2F 2B7DT 4X9IA 4BCZA 3RP1A 2OJZL 3T3MB 4L8SC 3IKCB 1M6OB 4MD4B 5FQDA 3MV7A 4L4TB 2C1PA 1THCA 1DJHA 1QPPA 5DK0A 2NYZA 4FN0A 4BE5A 1G1KA 1NKOA 3TPUA 2CPUA 4PW4A 4AYSA 1RVFL 1U95B 2Y6TE 4FNSA 2OCCB 5AENA 3SD5A 4F7EA 1II4E 3DK0A 1GGIH 3WS6A 3WKQA 2X70A 4CZXA 1JXJA 1EHAA 2PETA 2V8MA 4ZOCA 2ZSVA 3R7QA 1INDH 1VEMA 5FUOH 1QTPA 5E9NA 4X6CE 1I9JH 3UADA 1UKQA 3L3DB 2VB5A 3H4HA 3C60A 3C8HA 2FO4A 4R0LB 4U6XA 1F90H 4K94C 4WK4A 1BXUA 3L1OH 1CD8A 4XMTA 2BSSB 4QI3A 4QHKJ 5EMMB 3JB9L 1TVHA 5KSAC 1N5YL 4L8SB 4HIHB 1BGXH 3A3YB 3ZE0F 4Y9CA 2ADIB 3RNQB 4WU5A 1UXSA 3MKGA 2XPGB 3CIQA 3MV9B 1DDTA 3WTTA 4GG6A 3O6KH 5F1OB 3APFA 3QRBA 1KLUB 5B38A 4ZMPA 3IKOA 4BL0A 5B39G 4MVBD 5AQ0A 2YRPA 1QHPA 3KCWA 3ESOA 3SDAA 2ZSWA 3TA3B 4D8PA 3WE6A 1FPTH 5JPNC 1G7PA 4J3SA 1A8ZA 3HZMB 5KG9A 2O30A 1UWFA 1B90A 2D3LA 1LO5B 3OC8A 2JKJA 3AM8C 3L2LA 4PGDB 4CVXB 3ZYIA 1YYCA 3GYRA 4ZUSA 1AR1C 3FPYA 4AEHH 3CN2A 4OZGF 3DVNB 2X6CA 1RUKL 4FQCL 4BKLB 5I30L 2Z2NA 4LLDA 5GRVL 2I9LB 1ECYA 2PW2A 4Z3IA 3GSQA 2HU8A 2GHZA 3MV11 5C0ND 1KGJA 3X3GH 3E8UL 2EKJA 4PTUB 1EO8H 5KSAB 4U4BA 3RL2A 3TEYA 2IWFA 4JM4L 3ILDA 3V7AG 2P9SC 5D2NC 1X5MA 1M05B 3FO1A 4I4WA 2YA2A 3WEMA 1NDGB 3P3UA 3PQYB 3PGDB 4F2MA 2WTRB 2QQKL 4HV8B 4YGVB 3GWJA 5ESQB 1WZLA 4MJ6B 3WS3A 2EYTA 3QCVH 1RJZA 5DJ8B 4PJBA 2G3ZA 1FIEA 4LSUL 2ICWI 4MAUL 1ED3B 2NT0A 3KPMB 5AB9A 4KZCA 1AR1B 2AFNA 4JFXA 3B7FA 4ZOXA 5FKAA 1C16A 2VN3A 5HGAA 4Q4IA 3WIHH 4KJQD 2GIMA 1YLBB 4JE0A 4OLUH 1DVQA 3K2IA 2V7NB 2OMWA 3QC6X 3NH7H 2VUYA 1RZ7L 4NP4L 2KQNA 4O2FB 5BW7C 2F5BH 4XBGB 1TNMA 4NYLB 5HYNB 5HDOA 1YEWA 4QHUB 1AXTH 2Z0BA 4J3OD 3JRPA 1J1OL 5D70L 1KCUL 1TQVA 5D2NB 3IJCA 4ICXA 3AFLA 3L9RA 3H3PL 3LV3B 4TNWK 1CC3A 5AEAA 1QRKA 4XCEA 4YDKL 3C9CA 4X2UA 5DFWH 4CY1A 2EICA 3LN9A 3HI6H 3KBPA 5A2FA 2NTFA 1CQYA 5DXWA 4POYA 1MJJB 1BEYH 4I77H 3ZJAA 3CVHH 4KK5C 1EAPB 5JIHA 4JCMA 4FXLA 4OCNC 1L9MA 5F8RC 3D69B 3BZFA 1XGYH 5IR1A 4ZTPH 3IEAA 4Y7RA 1PGRB 5EO9A 1JVOA 3O4LA 1OTSC 1QLEL 3G5XA 4DN4L 1CYXA 2YS4A 4ZX4A 2Y23A 3INUL 1FVEB 1RZJL 3TBVA 2XIBA 3G5VB 1HSBA 2OKMA 4ZPVB 3QT2A 3T2NL 2MOVA 4IMLB 4LO9A 3BH9B 3VE0B 4PJ5E 1JXGA 4WFHE 3F6JA 4KUCD 1U8KB 1QQDB 4GRLD 4PI2A 1A7NL 3JYCA 4E68A 4YR6A 1UH2A 3T6XA 5E9DB 1BX2B 1F00I 2HB0A 3PCYA 4C56A 1XO8A 4PW9A 3CDYA 3PL6C 3L3JA 4QXGH 3V0AC 4QHLA 2VLRE 5F9JA 2IPKA 2RFXA 4U3SA 3IE9A 2CA3A 4ZFGL 1YEEH 5I1EL 5FO2A 2WYTA 1UA3A 4WJKA 2DRUA 5I23A 4G83A 1UM4L 4KKZA 3HFQA 3C75H 1B9XA 4WEMB 2D7NA 5C92A 3EO1A 1A1OA 2O5YL 2VERA 2BDNH 2MKLC 4R6UA 3FRXA 1WIUA 3MCKA 4MXVF 4CUCA 5DS8B 1I8LC 3BVXA 2ZAHA 4FEMA 5DD3H 2HFEA 3QO1B 5FHAL 3IWUA 2ZG3A 3BP4B 5T33L 3GMMA 3SYAA 3ZRSA 3CN1A 1RJLA 1GMIA 5ISZB 4HEMA 4P4KC 5L0QC 8PAZA 1CR9L 3SD2A 5JPMC 2YXWA 3CX5J 3IFOB 4P2RD 1IC7L 3NIFA 1S7RB 3WSQH 3BGFC 4PCTA 5IHBA 1XZ0A 4FDWA 1CGXA 1EJ8A 2TSBA 1GGBL 1T66D 1H3VA 2C5DC 4BWUA 2NNCA 1OCRB 3O4OB 2R0LH 4GW1A 4NGHH 2VWEE 2B08A 2DYSB 2CG9X 2EADA 1JXDA 4ZS7H 2F53D 4PV8A 4Q0XL 3O3DB 4QOKD 3BIAX 5DC9B 2K8MA 4RMQA 4ES9A 4PJ9A 3SQBB 4KQ3H 4N2AA 1CCZA 4NHCL 4TKWA 5F9AC 5EUOF 2F8XC 3ZZLA 4XZ4A 1JK9A 2F18A 3FSAA 4CDGC 4ZMLA 5BCAA 3QXTA 4HX1A 2I69A 2OULB 4AEIH 1LO3L 2HXCA 2H47C 1E3ZA 1EJ6A 5D8JL 1XR9A 1NOFA 1YY9C 1WA1X 4RMRA 1RK1B 3T0EB 5M5VA 4IJTA 4XXCC 4HJGA 1MWAH 4YX2H 1RK0A 5C0BE 1MIML 1LYQA 4POZD 2WO3B 4K23L 5F7NC 3O6LL 4P4KB 5L0QB 1QEWA 3VB9A 2NRDA 5IW3A 2PCYA 3I84A 1N64H 1W0VA 3F58L 3KWXA 1IU1A 5KSBB 1MLBA 4AM0A 4M3HA 1NCUA 1QR1A 4Y4KB 1N6QL 4PJAB 2JLLA 2XWRA 3UTZA 3ERXA 2WAHA 3QJFB 4G3YH 1DP0A 3H3BC 4BWTA 4PGEA 3FO2B 2G5UA 3TBWB 1FVCA 3OLGA 1PY0A 1A6UH 1KELH 2AJVL 4WWKA 1LEKA 1HVXA 3ZT5A 1XCQA 5DQ9B 3MV7D 2XV6B 4LLVB 1AZVA 4PJ7E 2OR8A 4UQ3B 4DW2H 4KKQA 5DS1A 1J8RA 1ZVNA 1KCBA 4MNHA 5DD6B 4J3WA 3GK8H 5AL0A 3CZUB 3SPGA 1H5BC 1QUNB 1Y6MR 1FZKA 1ZD6A 2NOYA 3RTQC 2NY7L 2W0LA 4J8GA 3FN9A 4G82A 2FL5A 4P3WA 5HJ3A 3OHMB 4XZUB 1F1AA 2GW5A 4D9QE 4PSXB 3OKOB 3GXPA 3NZHL 3CFJA 1TXKA 4UILL 3UAEA 5I0YA 3U9PL 2BFVL 2A1WH 3QORC 1E0OB 2FD6H 3C60D 4ODTH 2OL3B 4JRXE 4DVRL 2BP5M 2EYRB 3QRFM 5I8KL 4OCMC 2H3NA 3VXUE 3F3PA 2A73B 3IXAB 2Z7ZA 4KWUA 3C9NB 4HCRA 2VSCA 4CADB 4Z95L 5CEZE 4R97C 4CY2A 4R83A 4UV7H 3GMLA 4KZEH 1GIGL 2BP0B 3CX5K 3K3QA 2H13A 3WJLC 1UVQB 4ECNA 2VM4A 3CSYB 5L8JB 1P53A 1MVUB 4TMPA 3LKQA 4F7MB 2AGXA 3CC5B 3DTUB 2ENQA 1HL4A 2H9NA 1EXGA 4NOBA 3DWLC 5I1CL 1U8LA 2GJ6B 1A3LH 4N6RB 3QORB 4OFQA 3KPTA 3LXCA 4H8HA 4OT1L 1MDAA 3ZOAA 4QRUB 1I9IH 3QJXA 1SFDA 1JGLH 3BVDB 1XGPA 3HB3D 2ITDB 4FQ1H 3ARBA 2BIPA 3CLFL 1B9KA 3BOVA 3EYOA 1EEQA 4S0SD 1R47A 2A6KB 2EDWA 4LRNH 4NKMA 4OLYH 3MYJB 3TYGL 2YPVL 1IGFH 3ES6B 5KANG 3WJJA 5K9OB 1M2VB 4WHCA 4XMPL 1JTPA 1MHHB 3ARWA 1QKZL 2JI1A 5F21B 3ILPA 1RQ5A 3RGVA 5TF1H 4UAOB 4B0MM 3TURA 3KJ6L 1T89C 3V79C 2VIRA 4XH2B 3LKRA 4A6YL 4PJ5A 4Q2ZA 4KVPA 1JZJA 2GIYA 4UTAH 5GIRA 1AXSB 3RZCA 4RESB 5BMFH 3V7DB 3NJXA 1DQJB 4KQ4H 5L7XH 3ATEA 5DHVB 4IHOA 4WAFA 3ZMNA 2ARWA 2VLRA 5MEQA 2DZEA 2CDFB 3FT2A 2FUQA 2OMUB 5IEHA 1M57B 5DYFA 3DPBB 4AENA 5FGBA 3C08L 3M8OH 4N28A 5FW6A 1A4JA 2YD2A 5DTFB 5FYLE 3WXWH 5F7AA 4DHLA 4N8VB 4WW1A 2V5RA 4FZEH 4MK0B 4TQHA 4FXKA 3DV4A 2ZD0A 3RAJH 2CLVB 4FTVE 5E94B 2VDLA 2WJ5A 4HGWA 2BNQB 5FOBB 3VXPB 4XO8A 3N42F 3VUAA 3ELQA 3LKPA 4MXQC 4G8FB 2AJUH 1FLRL 3EO9H 5JQ6L 3T0DA 3A4DA 5CXPA 1CK0H 3SPVA 4P8QA 3U7YH 3NJMA 3WFEL 4AT6B 1GP2B 1YY8B 4PM1A 4AMXA 2XDWA 2AKRB 2YGNA 3PWJB 5CN1A 4LQ1A 1U3HC 1ZEAL 1QFMA 3TN0B 3EYFA 5F7DA 2WLNA 3O4LD 5FX3A 2XYIA 3GSXB 3MOQA 5D7SH 3QPXL 1BXAA 3G5WA 2YK1L 3RB5A 2HYMA 4FFWC 3BLBA 1SXBA 1WCBA 5FGCE 2B4EA 4QXVA 3QQNA 2J4WL 5T3XE 3NIDE 4CY3A 3KCIA 2ZPKL 3OKNB 4JZOB 2X4PA 3FH5A 3BIKB 2KBGA 2KH2B 3K8MA 4C56D 5LWYH 1FFQA 1WFMA 2JJTC 1SMOA 4Y2NA 4HH8A 3VFWA 4LLQB 1IZKA 3IRZA 1F56A 3O2VL 3REVA 5JDSA 4URKA 4GB9A 3ARFC 3I7PA 4JGJA 5DHXB 2COQA 2N56A 4A0AA 2BX5A 4LLWA 4U1LB 4MQSB 1B4LA 5BRZA 3NVQA 1U3HB 4FULA 1KBGH 4S1RH 3NZ8B 3SDXF 2VZVA 4Y2DD 2XRAL 4D0BA 2OR9H 1OAQH 1TCRA 4LF3A 1I7RB 3D2UA 3RLMD 4ZOVA 4B53A 5MENB 4W4OC 4AGPA 1IAIH 4BFFA 3GSWA 1PFCA 1KPUA 4PJ7A 1B9YA 1ZSHA 1BREA 3E0GA 3VMPA 4N1HB 3GSRB 1DE4A 3RIAK 3MLSL 1IGYA 3BGMB 3KXFA 3S4SB 4U1NA 4KKNA 4M6NL 2CJUL 5JORA 4HOXA 4PP2A 2EDXA 1PSKH 1V05A 2Q2EB 3ARFB 3W9DB 2G9HA 5EU3A 4KXZI 3GRWH 2NW2B 1URLA 5JXAL 2I5YH 1P6FA 3KEDA 4LKXA 3GBDA 3PIQB 43CAA 2XU9A 1RURH 1GS7A 4PJ9D 2AABH 4X5XB 1X5XA 4F8QA 5E6ID 1VF5C 2PLTA 1NKRA 1SQ2N 2F7QA 3GD1C 2M8XA 4FQJH 3DETC 3A0OA 4N2DA 5DS2A 2RTTA 1YMMA 3H6JA 1FCGA 4M7LT 1TJGL 3D9AH 3QNYA 2NY6C 2V8LA 2Y7SA 3NEXA 4TOYH 5C0JA 1QHOA 4QGYA 1YN6B 4HJJH 3PF2A 5HI5C 1E2VA 5ESVB 4HJ0D 4PRDA 5C6PB 5PCYA 2R1YB 1KJVA 2QZQA 3WELA 1MCQA 1D7CA 5FGSA 4M48L 5ABAA 1DZBA 3NCXA 1HQRA 2EH7L 1PDKB 2WIIA 1ZPUA 4BGDA 3OJDA 3KLHD 2X1PA 1JPSL 3J2PA 2WXGA 2WQUA 4NFCA 5F1KC 1DBMH 1X7SA 4M5ZH 1AHKA 4QPEA 4P9HL 2HJBA 3FUHA 3SYPA 5EF0A 1EH9A 2VERN 4ALAH 4JKPH 4DNWA 4MS8C 5F9OL 2DLTA 1F5WA 1WZAA 2LLNA 4WY7H 4B27A 1AQMA 4JY6A 4W9ZA 1X6NA 3VH0A 1MN4A 4E0RB 1MVYA 2DTML 2G4EA 2AK1L 3HC3H 3X13A 4HU2A 2NNRA 2YO3A 3EFOB 3PLYA 1GYAA 5LGJA 2VDRH 5GS0D 1ZK5A 3TA4D 1GXRA 1UZ8B 5T3ZD 3B2UD 4Y88A 4BM7A 1MEXL 3H1ZA 2IUPA 4L8BB 1YZZA 4LQFL 2X12A 3CSTA 3V6OC 1M7DA 1ZPLA 1X5ZA 2XDHA 2E9BA 5JLZA 4B0MB 3ARYA 2X6UA 1UGNA 3ZE0E 3B43A 3CMOL 3V9FA 3L4XA 5I5IA 4QRAA 1VERA 1JDDA 3LS5H 1NGZA 2CQVA 4LEXL 4J3VA 2EVGA 1SF5A 4GOSA 3T6QC 4PRNB 1TVBA 5DD0L 4A2HA 4G7YL 1GW6A 4X8XA 4QY8A 5HHXH 5KN5B 3U6RB 2AQSA 1KJ2B 1XH3B 4AC2A 2W5PA 4H13C 3D25B 2P24A 4BKTC 4FG0A 3FFOA 2PYFB 1MZZA 1X4ZA 4H5SA 5TE7H 3BJ91 1CS6A 2J3SA 4OZGE 4JKWA 4OJFH 2B1AH 2CCVA 3X1GA 4HZLB 5C8JA 3DMMC 3X17A 5DMKB 1L9QA 2YUVA 1FP5A 3QAQA 1I85C 1CFNA 2ZWZA 1WT5C 2CK2A 3ARBD 4XN2A 1OGAA 4WSGA 1IBGH 3EDKA 4AN1A 1BZ9B 3IJSB 2MQ0A 3L2MA 3AADB 5GGUB 1U91A 1KNOB 5C0AE 5MHSE 5I1AB 2R39A 3ZTNL 3P9MB 2UX7A 1FFRA 1PD1A 3RGVD 4ABVA 3LQMA 4Z76A 2VT0A 4KMTL 5IB5A 2YJLA 2WY3B 1DUZB 4PWJA 1YQVH 2P8LB 3VQ2C 2VR4A 5AUMB 3ZT6A 4ZX5A 3BUYB 4ODBD 4BH7B 5BOPA 3FTZA 4PJ5D 1OM3H 4KROB 4CI1A 4XP4H 3RZCD 5IJVB 1CJYA 1CF8L 1IAOB 1M9WA 4MDRA 1LXMA 5EU6E 2X4OB 1NAMH 2PYEB 4XMXA 2ADJA 4W9JC 4K3HA 3PJSA 1KB5A 4IOFD 4JO2L 4M7JH