3BWSA

Crystal structure of the leptospiral antigen lp49
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
407
structure length
407
Chain Sequence
b'GTEIVKFSIHPYKGTVIRLGEEILPFKVLEMDKNIALVEMAIPVYKDEKEIELKLSSPGFQNSSYRIRKPEELNEKLIALDKEGITHRFISRFKTGFQPKSVRFIDNTRLAIPLLEDEGMDVLDINSGQTVRLSPPEKYKKKLGFVETISIPEHNELWVSQMQANAVHVFDLKTLAYKATVDLTGKWSKILLYDPIRDLVYCSNWISEDISVIDRKTKLEIRKTDKIGLPRGLLLSKDGKELYIAQFSASNQESGGGRLGIYSMDKEKLIDTIGPPGNKRHIVSGNTENKIYVSDMCCSKIEVYDLKEKKVQKSIPVFDKPNTIALSPDGKYLYVSCRGPNHPTEGYLKKGLVLGKVYVIDTTTDTVKEFWEAGNQPTGLDVSPDNRYLVISDFLDHQIRVYRRDGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Lp49
molecule tags Unknown function
source organism Leptospira interrogans
publication title The leptospiral antigen Lp49 is a two-domain protein with putative protein binding function
pubmed doi rcsb
total genus 105
structure length 407
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bwsA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bwsA02
4HDJA 1B9XA 4GGAA 3PXTD 3SFZA 2P9IC 3SXTD 1SQ9A 1K32A 2IWKA 3I7PA 2HKMA 4J79A 4O45A 3JAMg 4J87A 4ERZA 2J57G 2I0RA 5AJAA 1OMWB 5EAPA 3E0CA 3JB9L 2TRCB 4CY1A 5C2VB 4FAND 2PM9B 3FM0A 3FRXA 4J86A 4JSVC 3UVOA 5CYKA 5CXCA 4LGNA 4JSPC 5SXMA 5KDOB 4A0AA 4AOWA 3RLMD 2YNOA 4KFMB 3SCYA 5IT9g 2GC7A 4CC9A 5K19A 3EI3A 3SHFA 3W15A 3F3PA 4A0BB 3OL2A 3EI1B 5AMSA 4ZOYA 1R5MA 5TF2A 4CY5A 2I0TA 1OLZA 3JZGA 1N6EA 2YB8B 2OJYA 4J0XA 2Z2PA 4OZUA 2H3XA 5H14A 2AGXA 3K27A 5H1MA 3EWEA 2QXVA 5HE1B 4J78A 4FA4D 3IJCA 3AL8A 2AGLA 3ORVD 4A08A 4K3JB 4OWRA 4FAVD 1JMXB 5H17A 2B4EA 3CFSB 4XYIA 3AL9A 4FA5D 4A2LA 3RN1D 4D0KA 3F3GA 3VGZA 2W18A 3DXMC 3ODTA 3GFCA 5I5JA 4ES0A 2P9KC 2OK6A 4A09B 2XL2A 5FQDA 2PM7B 3IKOA 3I8CA 3EG6A 4X3EA 3UKUC 2UZXB 3SN6B 2CNXA 1Q47A 2G99A 1PEVA 3OKYA 4A7JA 4PBZA 4J82A 4GMBA 3I8EA 4YVDA 2B5MA 4ZOVA 5IJ7E 4A0BA 3DM0A 3SJLD 2B5NA 4J8BA 4L3HD 2PBIB 1JJUB 2IUQA 3RFGA 2OVQB 1SHYB 2Z2NA 3NVNA 4GQ1A 2MTAH 3C9CA 3V7DB 1QNIA 5EMLB 4FA1D 2H14A 2H9LA 5EMJB 4JD2C 2G9AA 2BCJB 1SQJA 4ZOXA 2YNNA 1U4CA 4JT6C 3EI3B 2H47A 3K26A 1B9YA 4H5IA 4R7AB 4Y5RD 5EAMA 5EARA 2CO0A 3RFHA 5IGQA 3BG0A 4L9OA 2Z2OA 1NR0A 2XU7A 2AGZA 2H68A 3PXWD 4JT5C 4GM3A 1TYQC 3IIYA 1A0RB 4GZ8A 4FHLA 4QRJA 4FWWA 3MKSB 2H6NA 4L3GD 1NEXB 4H5JA 1JMZB 3BG1A 2IAAA 4XEIC 4X60B 3RSEC 5C9ZB 2IWFA 4IMMA 3N0EA 3I89A 2P9UC 1S4UX 4JSXC 4A2MA 4D6VA 5IGOA 5FKQA 4PXWA 3PVUB 5JWZA 3JRPA 3UVNA 2HKRA 4CI1A 3SLED 4TZ4A 4O3TB 5EMMB 2J56H 2OVPB 3HFQA 3SVWD 3SBPA 4BUJC 5FXYA 1GOTB 4J8GA 4EWRA 3U4YA 3DWLC 3RRMC 3UVMA 3C99A 2P9NC 3UKRC 4GGCA 3IIWA 2OIZA 4K3ID 5FKTA 1VYHC 3EI4B 2HJ4A 3MZLA 3OW8A 4GGDA 2AGWA 4U7AA 2P9PC 2P9SC 3MMYA 5EM2A 4ERYA 5HQGA 3EI4A 3AL8B 4I79A 3SBRA 1U2VC 2XL3A 2UZYB 4A08B 5EM2B 3F3FA 5FKSA 2H9MA 3JROA 4J81A 4NSXA 2PM9A 3IJ1A 4CI2A 3JPXA 4E54A 1XIPA 3PXSD 1P22A 5I5IA 3VH0A 2PM6B 3I2NA 4MK0B 5FLXg 4CZVA 2H6QA 2XYIA 4LG8A 4A11A 2YMUA 5A2Qg 3FGBA 4GQBB 3AH8B 3DSMA 5FA5B 2H6KA 3UR4A 4PSWB 1XHMA 3PE7A 3P4FA 5CXBA 4A0AB 3EI2B 3GREA 3I7LA 4CY2A 3C75H 2CN2A 3I7HA 4UI9R 4AEZA 2AQ5A 3V9FA 5GSAA 4JSNC 4X63B 1TBGA 3MKQA 2GC4A 3PSCB 5EMKB 1ERJA 3EI1A 2IURA 4L1QD 5B4WA 3ZWLB 3OL2B 2OVRB 5GMKn 4ZOZA 2GNQA 3JZNA 5GXHA 2Q7QA 4QL1A 2I0SA 3J81g 3NVXA 5EALA 1PGUA 4LG9A 1GG2B 2O9KA 3SBQA 5GXIA 5TEFA 3KRWB 2HESX 5HYNB 4CZXA 5CYKB 5CXBB 1MG3A 2CE8A 3V5WB 2H9NA 3PSLA 3OKWA 3OKYB 5THAA 1XKSA 4E5ZB 4FB1D 4E54B 3RMZD 3L4OD 2CE9A 4BH6A 5HE0B 5IJ8E 2QC5A 4J84A 1PBYB 4ERQA 4Y7RA 2HJBA 4J0WA 2EBSA 4G56B 1FWXA 2AGYA 3N0DA 5TDHB 3SMRA 5C2WB 4U1EI 4GM8A 2I3TA 3PVWB 4ZN4A 2CO0C 3MZKA 4GM9A 2AH1A 4QT8A 5TEEA 2HYEA 4PC0A 3I7KA 5HE2B 4ESGA 1N6DA 2B5LA 3I7OA 4O3UB 1MG2A 5CXCB 4A11B 4CI3A 4PBYA 3EU7A 1GP2B 1GXRA 2CN3A 1JOFA 2H9PA 3CFVA 4PNKB 2YNPA 2H13A 1MDAH 4A09A 5AFU3 3EI2A 1L0QA 4Z8LA 5FKRA 4E5ZA 2IUPA 2P9LC 2YBAA 2HXCA 3C5MA 3UVLA 1RI6A 2J55H 3A0FA 3BWSA 3OKTA 4PSXB 4BL0A 4GQ2P 4X61B 3I7NA 4O1QD 1PI6A 1N6FA 5K1CC 4J73A 5I5MA 5IC7A 2IUVA 3CIKB 4J77A 4IA9A 3J80g 3OTTA 1YFQA 4JXMA 4CI8A 2OK4A 4O9DA 4XYHA 3AFCA 3L4MD 3EMHA 3NVQA 4QQEA 3B7FA 4CZYA 3KRXB 2BBKH 3MXXA 3SWSD 2I3SA 1K8KC 2AH0A 3JZHA 3VA6A 3IJ0A 3RN0D 3ULEC 4CY3A 3UVKA 5HE3B 3DXKC 4N14A 4FA9D
chains in the Genus database with same CATH superfamily
3N44B 1TTFA 1W72B 2AEPH 1FZJB 1TQTA 4L8BB 2D03H 25C8H 2K8QA 2A4ZA 3P9WB 1OP5H 4XO5A 2C1PA 1U3NA 1JF5A 3CDFA 3H53A 3VFGH 5HGAB 3S98A 4NBMA 4OCXH 5BUPA 1HSBB 1MFDL 1PU0A 3UTSE 4P46C 3U46A 1VEPA 3CH1B 4YSQA 5BRZE 1B0GB 1E3XA 1XD0A 4MRCA 3RX5A 3BDXA 1S7RA 1TYRA 2V2XB 3DK2A 2P26A 4KTDH 4KI5F 3U0WH 3RWFB 3WHE1 1O7DC 2FUQA 3O41B 4A7QA 2X0VA 4PY7A 3QT2A 4RFEB 2WQAA 5LGJA 4OF0A 4XP9H 3ZRFC 4FQ2L 2RBLA 3DSNA 1PEWA 2PM9B 3D25B 4MJHA 3UJTL 5CYKA 3BYTA 1DDHA 3N41F 5HI3D 1CI3M 3OGOE 4CNIA 1Z9NA 1IEHA 5C2BH 3ZMEA 1F8TL 3DA0A 1A9EB 1U0QA 2J20A 4AX4A 1A47A 2X4PB 4ES8A 4ZXBA 2CZNA 1MW1A 5GRUH 3B9VA 5K69A 2YKLL 4RNRA 2CHZA 3KM2A 3ZPDA 3A21A 5DDHB 4JKNA 1ZLVK 2F8OA 4NXKA 4YSAA 5HHOA 1UZ6E 1VFAA 3ZKMC 1DBJH 1UWGH 4PJGB 1GGTA 3OL2A 2NW3B 4XMPL 3EI1B 3G5XA 3P4MB 5L8LB 1R5MA 3IGFA 2XQYA 2NNXA 3IJHA 2QV4A 2EEAA 3JTTA 1I9IH 1DQKA 3NGBB 4LDOB 1AGEA 3ZTDC 3ZIMA 3GIZH 4C4UA 2VDLH 1GOHA 1KN2L 1RP9A 4WV1C 2GC7C 2OZ4H 3B3IA 5GGVL 4WHDA 1P9MA 1IJNA 3PRZA 1KJ2A 5FPIA 5EEUA 2ADIB 3FXIC 3KM1A 4U1IB 3ZQXA 4BQBA 3BCFA 3ZGIA 3T08A 5C0BD 4Y19B 1PX8A 4YBLB 4EIUA 1F45A 3QS2A 4HS8H 4WJKA 3C6LA 2NY4C 3U0PA 2WSPA 4FD0A 1A4JB 4FA5D 3AL9A 4XB3A 3CAFA 1AXSA 3T8XB 5AD0B 3V7AG 1CD1B 3HRZC 5CCKH 1I7RB 1AH1A 1Q9LA 5HI4D 1OM9A 1TJGH 2X0WA 1NC2D 3OLEA 2FJHB 4M7ZB 1VB9A 4N2DA 3Q05A 2WQVA 2VUOA 3EG6A 2DQTH 4AEIL 3T2PA 1CQKA 2DBLH 2XTSA 1YZZA 2J12B 1ZHKB 5DJZA 3VFNA 1D7DA 1WD8A 4HK0B 1QVOA 4PJFF 4WK4A 2X28A 4GKSB 4OFKA 1UB5B 2UXGA 3WLWC 5EBMA 1KTBA 4KVCL 1H9VA 1DQVA 2MJWA 1AHKA 4BP9A 2F7RA 4JFDB 4BWUA 3PHAA 3GD1C 2IH9A 4U7KA 5DA0B 2GJZB 2EACA 4FNSA 3G5ZA 2FQGA 4N6RA 1LO4H 5B7EA 4JRYB 2Z2NA 4F33A 1KGCD 2NY2B 2I60L 3B9KD 4H0IA 5DJ8B 3RTQB 1NA8A 1U3YA 2XA8H 1CICB 2X4NA 4EVNA 2B4CL 3FUFA 4L5FH 2QVKA 1KEGL 2F7PA 4P2CG 4ZFZB 4ELDA 1ZPUA 4LGRB 2ZCKH 3BUIA 4KJPD 1RVFH 3ARED 5DJ0A 3EADA 4PB9H 4I9WE 1P1VA 2ARJQ 5AALA 4Y5RD 1YEGL 5CKAA 2NLJB 3VXQA 3QJOA 2EVIA 3JYCA 4K3JL 2YD9A 3AVEA 5I75B 3O4HA 1JFHA 1RK0A 1OGTA 2WYHA 4BP8A 3LZFL 1JZGA 1LE5A 4G9FE 3SCMB 3WLBA 4KKBD 3DHUA 3T0ED 1UD3A 3GF8A 3L3HA 5IM7A 4NQDD 3FH8A 1BGXH 4OTXH 5C3TA 4DPAX 3VXPB 5HHMB 1BAFL 3BZ4B 3WUWA 2A4EA 2QADD 4Q9RH 1NGZB 3HFML 3L16A 5B1BB 1KB5B 4AL8H 1BLNA 3L7EA 3RY6A 2AI0H 4P23C 3DXAB 1OCCB 1WZ1L 4NUJB 5ICZA 2YXVA 15C8H 2E4TA 2L7QA 4GAAA 1DJIA 3INUH 4LVHC 5EPMB 4BFJA 5A6IA 3UO8B 3V5HA 5IW6B 2WMPB 1HQRB 4KPHH 1D5XB 3QA3A 3QQDB 5HDBE 4JHWL 4Z7AA 3VRIB 5DFWH 4BBWA 4X4ME 3PHOB 5EMMB 2J56H 3HZ3A 3WJMA 4QT5B 2AK4A 4IIQC 2B59B 2O5YH 4B50A 2C7UA 3SBPA 2IBGA 5F1NA 1G7MB 3Q2LA 3FFCE 4F27A 4AE1A 2Q3AA 2M8XA 3WY2A 5F9DC 2ZX5A 2EH8H 1AHMA 5DD5H 2Q2LA 4HQQH 3SGEI 1QSFD 3TBYB 1IZJA 2VIRA 4TUJA 2N7SA 2EO9A 4LCCA 4DVRL 3MLYH 3VD5A 2O26U 3FU7B 4OZIE 3TZVD 4AQ1B 1H3GA 5BJTB 1GXEA 2V2WB 4KV5E 3D2UA 3CFUA 4IGBD 4KRMB 2HLAA 4AMZA 4XNUL 4YDMA 3OW8A 3ULSB 3TT3H 1EEUA 2VGLM 1QPPA 4KTEH 1FL5B 4PYHA 1WFIA 1QZNA 3VWKA 5HVWA 2XKSA 3HG1A 1J1PL 3M17A 4XX1G 2Z4TA 3VXMB 1EJOL 2GG1A 1Q94A 3BXNB 3E3QE 5GRJH 2FT7A 3DVIA 2P28B 4IHOB 5EIQA 3O8XB 3TASA 2FH6A 1MRCH 1ZVHA 2X4OA 3VGBA 1A3ZA 3Q6FB 1DLFL 2ZWKA 1PDKA 3PUUA 4RX4D 3DOSB 4K8RC 2F53B 4LGSB 4P5KA 3DUSB 2NR6C 2OMUB 4O00A 1CBVL 4E54A 4RZCB 2K3HA 1SQMA 3A6CL 4KRPC 3ZK0A 1FFRA 5B1JA 1LK2A 4AQZA 1H8OA 3DETD 3QCVL 4FLOA 4L3EE 3GXIA 5E4EB 3T65A 1ORSA 4FQPA 3RNKA 3U1SL 3K0YA 1F58H 3B9KB 5F3HB 3QORC 4UB0L 1QRKA 2X7LA 1AO7D 3L1OH 2BVTA 2O6DA 5GIRB 1RZIB 3NFPA 4GAGL 3ILQD 5BVPL 1BCIA 3T3PF 4IRZA 1OD9A 4NT6A 3GBNH 1S9VB 3CFTA 3Q9QA 2O5ZH 3O3AA 1XHMA 2OSXA 1FFOA 5FCUH 2I07A 3FL7A 1HTYA 3HI1B 4HPOL 2OW7A 2R4SL 3KMDA 4MQ7A 1U8HA 4PJIE 4OLWL 4U6XB 2OMWA 2F08A 1H6FA 4WWNA 1MY5A 4OLZH 1UG9A 4E68A 2D0GA 3H56A 1JZ5A 3P3RA 1MVUA 5BV7H 3FOLA 4WI0B 3GMLB 4EEEA 1UWFA 4OQTL 2RB8A 3IDYB 4H8QA 1KB5A 3GEWB 4M3KB 5KS9A 5KTEH 1VZGA 4LCWE 3OAUL 5B4WA 5DMIL 4OJCA 1U2YA 2W60B 4ZOZA 1CYGA 5KZCB 2X70A 4XNQB 4Y89A 1G9HA 4J3SA 2FBJL 5CR1A 2GNQA 3APCA 3P9LA 4KKPA 1OAKL 3OKOB 1KBBA 4JO2L 4LHUB 1DFBH 4QRUA 3RIFK 5HHXH 2FWSA 3ULUD 1FIGH 2I0SA 3F3HA 3BO8B 2UWEE 4ONOA 1PGUA 3V4VH 4Z78B 1BZ9B 2LU7A 3ARXA 4PJIB 3KRWB 3BPLB 2LU3A 3UYPB 3HB3C 3PABB 1ZTXL 3MRFA 1SHWA 4CZXA 4EN2A 2BXZA 3ZT5A 4PIBA 3QWOA 4KMTH 3RX9A 4OD1H 5HGAA 3OKYB 4YJZL 3CHXA 4XHQA 1NBVH 2HH0L 2WTPA 5IROA 3RA7H 5KVMC 2P1YA 12E8H 3N1GC 4M5YL 1CN4A 3QWRA 1CMOA 3HMXH 2DYRB 2Z31D 2JIXB 2Y7QB 2I9LA 5HTSA 3RMZD 5C0CE 1UOOA 3SGJC 5T3ZL 5EUOA 5CHNA 4UCFA 5E0QA 3EBHA 1JGLL 1WIOA 3RWCA 5KBLA 3QXWA 3S0PA 5IMLA 1WA0X 3K0WA 1MUJB 3FUNA 2H0PA 1IBBA 2DIEA 2IXQA 3Q3GB 1FNFA 4LEOA 5GGRB 2RCSH 1NIAA 4ETYA 4POYA 4G56B 3GBML 3HRZB 1FWXA 3OAYH 3QDJA 3T1FA 5C09B 4JY4A 4LAQL 5KYUB 2AGYA 1I8KA 3CPLB 3BVXA 3QPQD 1N2RB 3EJCA 4K55A 2J8UB 2DTML 1XF3B 3TO2B 2BKLA 2WZ0A 2X44D 3AU1A 4IGBB 3NESA 4GM8A 4Y4HD 4CILA 5LUMA 1T7VA 1R9FA 3RZCB 5I1EH 2HFFA 1TNNA 4OZHF 1Q0YH 1OIOA 4YZFF 4LL9A 4G6AD 3LKRB 3F05A 3CVBA 1DCLA 2FX9L 3QIUA 4HEPG 4ODTH 3WY3A 1BVNP 2FJHA 3V95A 1CI5A 4M7JH 1CIDA 4PJ9A 4C54A 3RIKA 2CE6A 4P46A 2EIKB 1PG7X 4OQTH 5EB9A 2O72A 3M1BA 1ZHKA 5DJZB 5EF3A 3JTTB 3VWKC 4YEFA 3FN0L 1UXMA 3CVHH 5GGUB 2J3SA 1EV2E 2C9UA 1HVXA 3BEVB 3OKLB 4LARL 1A8ZA 4G8IA 1OTUC 2YWYA 1MN4A 4WNQA 3V0VA 1G94A 3QI9B 4QHPA 1BZ7B 3ETBJ 1L0QA 2I07B 3F7RA 4JFUA 2HP4A 3L3GB 3PWLB 1XCQB 1YVLA 3KYKH 4X8XA 1I1AB 2Y36L 1ZY9A 3UIYA 1DJXA 4CKVX 4D7PA 3VDCA 5HD8D 1VFMA 1G0DA 2VUKA 3ES6B 5GJTH 5E4IA 3GMLA 3TZVA 4F80A 1M05A 3ARGD 3ZHDA 3ZU8A 4Z7QA 3S37X 4RFOH 5I5MA 4WHYG 2J44A 4PJEF 2OI9B 4JB9L 4MA1B 4AWJC 5I6LA 1CGTA 3PWVA 4OJAA 3J80g 2WUCH 4PJAF 2AJUH 3SCMC 2ZAGA 1F86A 4I0PB 4JPWH 3HC0B 1E4XL 2WKLA 2R1WB 3LPGA 5TQ0L 5ACZB 5I1GL 1LDSA 3EYSL 5CZVL 1FL3B 2OK4A 3HI5H 3L9YA 2CIKB 4PB0L 4DVBB 1ACYH 5HI5D 4LKCB 5IEKB 1XIWA 3GMMA 3NFNA 1NCCL 1JD9A 4NZRH 2PXYB 3UXFA 2I3SA 1UACH 1Y7VA 2Z93A 2LVCA 4J3OC 2VXQL 3KPSD 3RU8H 3VWJA 1VFBA 3PU7A 5DEFB 2XACC 3LPWA 5F7MC 4CY3A 1A6UH 1UVQA 1V7MH 1HNYA 3TLRA 5EN2B 4FCHA 2AGJH 2AMGA 1RIUL 4RAUB 3ZE2A 5K39A 3NPSC 2OCFD 1BQLH 4DCQB 2WQ8A 4FQJH 5IK3B 5B39A 5DO2C 1AZUA 5D5MF 1D6VH 5K9KA 3MUGA 1U3HB 2JMRA 3D5OF 4R0LB 4XN9A 2FGZA 2EH8L 1QSZA 4PJDB 1HQRA 4LU5H 1KB9K 2D3JA 1A7OH 4H8VA 5AAWA 5J11C 1HZHH 4E9XA 2N7AA 5IJVB 1HAWA 4HCFA 5EUOF 1DE4A 3RPKA 4OZIB 4ANWA 2ZAIA 4F2FA 4BFRA 4MD4A 3JAMg 5JQ6L 1CTMA 5FIEA 1KYAA 2B1AH 5CZRA 4Y9FA 2ADJA 4I3RL 5LBSL 2TRHA 4ICXA 4M6OH 2WN2A 2IJ0C 3KLKA 2QSCH 1OMWB 3SZKC 4JHWH 4FA8A 2TRCB 2EIDA 1ZD6A 2BP5M 3BWUF 1U8JA 3BT0A 3VE0B 3L3HB 1A6VH 4PGEA 2R69L 4NIKB 5E00A 3OSVA 4AL8L 1A4KA 2YPLD 4LZKA 2OP4H 4P4KD 4WEEA 4Y4HB 2XTJE 2YR3A 4TPRH 3QC6X 1GR7A 5D7LA 3LXBA 3CFJB 5PCYA 4GW1A 5GISL 4ZPTB 3KPRE 2BK8A 1YMHB 1F4HA 3U36B 5B3NA 5DQ9A 5EO9A 3WTVA 5IT9g 3V0VB 1Z9MA 3BGAA 5DI8B 5DHVB 4UUJA 1A1NA 3SDXF 2Z0BA 1KYDA 1AGDB 3ZDYA 5K19A 4A6YL 2Y1AA 4U1HA 1A2YA 1U8LA 1JG9A 5C0CB 1YAZA 2JE8A 3AJ7A 4AMKH 5DVPA 3DI2B 2IANE 4O2EB 2Q10A 4KVPA 4CY5A 4K3JH 5IFJB 2QVIA 4N0CC 2YA0A 4UAHA 3CZSA 5AVZB 1KMGA 2B7DT 2WAHA 4M8RA 3IETB 1PKQE 4FXKC 2JB5H 2O6FA 5EUKB 1NLBL 3KH3A 1E67A 5HD8C 5EF2A 5IV2B 1NAMB 3MV7D 1TQWA 3N1FC 1CDBA 4RMTA 2W9EL 3ULUC 3ESOA 4U7SA 2UZYA 1HI6B 1NSNL 3EJRA 4Y9EA 1PZUB 1XWVA 3TJHC 4A7UA 3BH9A 4LOEA 3DX8B 1J8HD 4KK6D 3PQYD 4FTVA 5F0MB 4JFEB 3ARGB 1ND0A 4YO0B 4A2LA 1K2DA 1UB6B 1RZGB 4MNGE 3LD8B 3WDHA 1JXKA 3UTOA 2WBWB 3TA3D 5I0YA 2CM5A 1IGML 2GSIA 1CXFA 3KPSE 5D93B 5EWIL 4AKQA 3ZVVA 5I1LA 4HPOH 2OK0H 2I27N 2XA3A 4FNPA 4ES0A 1T66D 4KQ4L 4A09B 3ZHFA 2XL2A 4UU9B 3E2HB 4M7KL 4WGVB 4YR6B 3V52L 5KYNA 1DSFL 1W0VB 2H2SC 3EO9L 2WD0A 4U3SB 4JBSA 4PJCE 5C0RH 5C07B 2DQIL 5C1MB 4NM4H 3OQRA 4RAUA 2YRLA 3TZVC 1EEYA 3HG0A 4HJJL 1U8MB 1IKFH 1ZS8B 3G9VA 4TUUA 3UTQB 1OEZW 4HEMA 5HPMB 4HIEA 2R23A 4XMZA 4A0BA 5DVNA 1AJ7H 4AE0A 3SJLD 4R0LA 4BGDA 2B1OA 3QZMA 4XRCB 3WLBB 3WKQA 4E5XB 3NIFA 1ED3A 3D39B 1IFRA 1QTYT 1INQA 4OGAD 3ZTCC 3RVXC 2W9DH 4L4VA 3FFDB 3QIBB 2WNGA 2ZKMX 3D50A 4P2AA 4QXUL 4OF8A 2XWXA 3UTSA 4N28A 1MCHA 5E8EB 4P5TC 4QRRA 5CILH 1A4AA 3MBEA 5I2IB 1H15B 3G6DH 3LH8A 1SDYA 3M7OA 4JM2D 4ZUUB 4Q58C 2G9AA 2BCJB 3ECVA 1FFOB 1XGUA 1SJMA 1U4CA 1CZ8H 4PRNB 4EI0A 5B1CA 3CSGA 1NBYB 1P7KA 5D1QA 1WT5A 1NINA 4F7PB 1NUNB 1CL7I 4HGWB 1FC1A 4Y9BA 1E27A 3X1FA 3MFFA 4PJ7A 5GZNC 5IGQA 1T3FB 3MX0B 1IC5H 2HN7A 4I4WB 2H68A 2EC9T 2KZ1B 3DMMB 2EDHA 2MPAH 3L45A 4YSEA 1UOVA 1XF5A 2W59A 4L1LA 5L2KB 3D0LA 4KTGA 5KVEL 5B3JE 1YPZE 4N0UA 2FYYA 3O3DB 1ZA3B 7FABL 3A6BL 1SFHA 2V3EA 4NHCH 3FQRA 4M1DH 2D8KA 2E6PA 1NCDL 4JQIL 2E6JA 2NPLX 1MRDL 1JNNL 3DC0A 4G6MH 4O4YH 1MRFL 1YUKB 3FT0A 5DUMH 2YD4A 3SQOL 4AMXA 5A3IC 2Q3XA 4AV5A 2YGPA 4P3CH 3UJTH 4PTUB 3OJ2C 4NHUB 1FL5A 3VWKB 3CFIC 1G7HB 3QIUB 4FNUA 3IU4H 5IROC 4P9HH 3E9UA 3T3PA 1ZVSA 2DIJA 4FFYL 1U92A 2D2CC 4PRPA 3VTMA 2WO4A 2CDEA 3NSCA 3WTUA 4O3TB 4WUKL 1X7SA 5BMFL 4YSSA 1H3XA 1R47A 3S35X 5D72L 2WP3T 3ZDWA 2AC0A 5E8NA 1WCBB 4TLTA 4ENED 5SWZA 3DHPA 2BC4B 2OMUA 3QUXC 3MV7B 4MSWA 5E2WL 2IQ9H 1KIPB 2BERA 1GHFH 4LCUA 5E6UB 1PKOA 2JKRM 3I50L 2BVUA 1XAUA 2VDMH 2BSED 5DD1H 3T0EC 3JV0A 2YGOA 4BKTC 3MOAL 3E8UH 3HS9A 4F2EA 3MRQA 4P9MH 3EDFA 4WAFA 1DN0B 2WVUA 3S35H 3WENA 3EYVA 3L8QA 3MZLA 2CJUH 4WK2B 1P6AB 2IAMD 3DSFH 3LZRA 5C92A 2JNZA 3L5HA 3UGUA 1MREH 1CFQA 2XSKA 4L1MA 3NCJL 1CLZH 2FIKB 2LAAA 3WKMH 4QRSA 4U33A 3P9MA 2JI2A 1AS7A 3MLXH 4J28A 1KENL 1ZS2A 2OAAA 2AJXH 2XA8L 4DNWA 4WFGE 3MNMA 4M43L 4IBWA 2DLEA 2DM2A 3H3PH 3Q48A 5D72H 1P69B 3MQIA 5IB2A 5F70A 2PPFA 3IJYA 1OGAA 4W9KC 3QYMA 4TRPH 5ALBH 3PWPD 4LSVL 1TSHA 3ABZA 4Y1AB 2K7QA 3LQMA 2UV3A 2PM6B 4GI9A 1XGRA 4ZAKA 5CCHE 3WJJA 3QIBD 1MCOH 1DSYA 2E7MA 2QQLH 3D08A 4TM9A 4MCYB 4CZVA 3ATDA 2NYYC 5K5YA 5EO0B 4NAJA 5DUML 1MW2A 4KROD 4LG8A 5IKCA 2LHAA 1JNNH 4PJIA 1Q9KA 1UD4A 3SOBH 1VE6A 3UOAB 2JFCA 3QR2A 4X6BA 3DSMA 2GAZA 2VQ4A 2WIMA 3BI9X 3IMUA 4NZJA 4OCRL 4ZMXA 1GMEA 2PTUA 2BW4A 3ZDYF 3QNZB 5I76B 4OZGB 5CGYD 2XVLA 3MLWL 4DQOH 5C6WH 4FJYA 2BXYA 1GCFA 3ML8A 1NFDE 2OULB 5ITBL 3K72A 5FW8A 4AIXA 4KFMA 1D6EA 5FA3B 5T5FA 1EHXA 2J7LA 3NJJA 2CJTA 4H44C 1PZBA 3QPQC 4AGLA 1KTJA 2H26A 1YEKL 2APXA 4WGWB 3WY4A 4X63B 2HT4C 4X6DF 3B2VL 1M71B 1HINH 1T2XA 3GK8H 2IURA 3HZMB 3JUYA 1YYCA 4C83A 4LSQH 5A2BA 5GXHA 3FJTA 1DBMH 1IT9L 1O7SA 4GKZB 3MKGA 4QTHA 1VSCA 2K1MA 5DFAA 3H9HA 4PJXA 1FH5H 2XICA 4YHMH 5IB5A 4UT6A 1TXKA 5EALA 4ZZKA 4LG9A 4XXDB 3K2IA 3SBQA 4M6ML 2X3CA 3GTVA 3FB7B 3WMPA 1C08A 5E51A 2PMZA 3MUGB 1UA7A 2CHNA 4FQQA 4AUUA 2VDQB 4UNTA 3FONB 3V5WB 2VWEC 2N1KA 5GS1A 3U7YH 1KJVA 3QRGH 4O02B 4P2YA 2QVTA 4JFQA 3TU6A 3EQ9A 1YAIA 3MCKB 1MF2L 5C0BA 3S3SA 4XTRC 5SWQB 2X88A 4UT9L 2OV0A 1MI5E 4JPVL 1CPUA 1PBYB 4ERQA 4GQQA 2R59A 1KGJA 3SY6A 3MNZA 1UH2A 4XN7A 2HXAA 4JFTA 5E70A 4QRSB 4DP6X 3L4VA 4OZHA 1CO1A 1K4CB 1XGPB 4IOFD 1GPOH 2Y3NA 3WELA 1SUJA 2X87A 4CSSA 5LWYH 3D3VA 3PP3K 3N06B 2A73B 1S7RB 3QAZC 3TURA 3VFVA 5IWLC 2VDRA 1QBLL 4G70B 4R8WL 2E4FA 5HDBA 3OJDA 4PJAA 4YSUA 1I8MA 5I1LB 4K3HA 5GS0D 2X2HA 1IC0A 3RGVB 2R0ZL 1P5VB 2Z8WC 5AYQA 2GIMA 3OKDB 1QZ1A 2XIDA 2KI6A 4H40A 1EQWA 5CSZA 4AYDC 1TCMA 2XG5A 1YY8A 1HSAA 3G6JF 3HG2A 1S9WB 3WFCH 2HT3C 4X83A 4BZ1L 1MG2A 2BOCB 3BDYL 2GABA 3QI0A 1OF0A 1GXRA 5JLZA 4FNTA 1YYLH 4AIZB 5IR1B 4RWYH 3GSXA 5ANMB 2F1AA 1ZIAA 3MLVL 1FYTB 4ZRGA 4N2CA 4NP4H 3C8HA 3HRPA 4ZW7A 1DVFD 2DY2A 4AM0A 4F37K 2ZX9A 3QXDB 5DR5L 3IDJB 1S7SB 4HCRL 1IX2A 3Q2CA 3TTYA 4DEWA 1I9RH 5L88L 1XEDA 2APSA 3BDBA 4ISVA 3W9EA 2H6OA 2GKIA 4ZQTA 4OIFA 5E2TH 4PP2A 5KVGE 3C87A 4R4BB 4XP6H 3CIKB 4S0SD 2HRLA 3NP4A 1ILSA 3KPRB 1CGUA 3O3BB 1MCLA 4PRAA 3LPFA 3FQNA 1FGVH 4XMLL 4BA8A 1I1RA 4EKJA 3HVDA 2FATL 5IBLD 1DDHB 1WSST 3BJ91 3EJZD 5MHSE 2X1XR 4CADB 2APVA 3ECBA 4UILL 1A6PA 4FQCH 1WC7B 2EXSA 3D25A 3ETSA 3M46A 1ZLUK 1RJLB 1XQ4A 4U1JA 1PJ9A 3P4LA 3F7YB 3NDZE 4M1DL 3RP1A 4BCXA 3C75A 1CFTB 2WLLA 1KJ2H 3KRXB 1A7NH 1EAPB 2EH7H 2RACA 3QJTB 4JZJA 4PPTA 4X0NA 5EOQL 5HI3C 4EXPX 2OXHB 1P7QB 3VO0A 3GMRB 2VDLA 2OMZB 3V4LA 5B22A 3L95B 1IMHC 3P2BA 5GSRB 4H5SA 3DXKC 1MJ7H 2B3IA 3P11L 3D09A 4PLNC 4H1LA 1K5NA 3ARFB 4HDJA 3RPIA 1BMGA 3MRCA 4P2RD 4DGWC 2L7UA 1R4XA 2X9XA 2WNWA 2B8OT 3C08H 1A9BA 3RVVC 3TBSB 1HJBC 5ESQA 3G6DL 3P2TA 5ERWA 3KXFB 3EGDB 1AI1L 1EERB 4BINA 1G6RH 4R2GC 3QYNA 4GYBA 4UI2A 5HYSG 4MAZA 4P9HC 2YD1A 1ZT7A 4H20H 2NY0D 3HKZA 1ID5I 4A2HA 5EAPA 1OPGH 2E7LC 1E6JH 4MLIA 3WFBL 1QA9A 5JHDB 2EXWC 3QDGA 4Q89A 2XV3A 3P54A 3VYNA 3MZGB 2VDKA 1RQ5A 4ZO8A 3BN9C 4P2QE 2BY3A 4XMWA 1SHSA 1MHCB 1KYOJ 2BVPB 3CCHA 4PBVC 5C7ZA 4TVPE 1YQ2A 1M7IA 4GUCA 1FNGA 1TJHH 3PL6C 2Z0UA 1ND0B 4YO0A 4XNZC 4ZYKA 1URZA 1WF5A 2QKIC 4YWGH 2DDQH 1VFOA 2ISDA 4ELME 2D9QB 4MD0A 4KQ0A 5FOBA 3IGLA 2N56A 2KPNA 1FYHB 1O6TA 2CG9X 5FYLL 4M5ZH 5IFAH 1IM3B 2JB6A 3W38A 5IB3B 4HJ1A 2G75B 4JDVA 4P05A 5I6XC 1RZJH 2BWDA 1GC1H 3VFPB 1UKQA 2A6DA 3WLWD 1A12A 2Q2EB 5GS0H 3MLZL 1XXFC 1WBXB 3OR6A 3CN2A 2HX9A 3MNVA 5DUBB 2AGXA 1Z9SB 5IWLA 4FNRA 6FABL 4UT6L 4BELD 3FUKA 4Z5RA 3HCVB 3ZHKA 1CL7H 3F5WA 1FLRL 1EHLL 2CMRL 4MJ2A 2P5WD 5F7UA 3VRJB 1DANU 4I87A 2FSDA 2Y6SC 3MO1B 1JMXB 1GC1L 1AG0A 4PWFA 1KIUA 5IKCB 1MLCA 4OLZL 4UYQA 3WEXA 2CKBA 1E9PA 1D5MA 5K9QI 3BQVA 2FHBA 5FO2A 4QO1A 4M61B 1XGYH 4X6CF 4GAFB 3WNLA 5HHPA 2O5ZL 5D7SH 2DQEL 4LGPB 4K3GA 2VLLA 2UZXB 4LLQB 2ODHA 4YDIH 3SQBB 1NIBA 1RK7A 2NUPB 4KXDA 4WWID 3SCMA 3SDAC 2JF1A 2GJ6D 3L6FB 3I6GA 1MF2H 2P45B 3VXOB 3QEUA 4X7TA 4N8VA 2VDNB 2B5MA 2IV9A 5JW4Q 4CN4A 4DW2L 1KCKA 2C5DC 3QRGL 1I31A 1S78D 2OL3B 1XGYL 3AWGA 3I6LE 3ZKMD 5E5RB 3M17B 1CBVH 5I5RA 3EJJX 2GI7A 4ZX5A 1P5UC 1YEWA 4ODSL 1DZ0A 3B2UC 1FGNL 1HH9A 1WGOA 2FH8A 2VXSL 3QA3B 1I1YB 1PPIA 2VLKD 3LV3A 5C3IA 3UYOD 5DRZA 4GBXC 3DTXB 4OGYL 1JHTA 2HWZL 3SKMA 2GY7B 3FQWB 1Q9OB 3LMJH 5LBVA 4Z3HA 1NEZB 1KZQA 3NZHH 1UGNA 3SKJH 1CL7L 4F7EA 3TVMC 3P30H 1IC7L 1IAOB 1WWCA 2P4AB 3SYCA 5I1AB 1XO8A 4O02A 3KXFD 4PW4A 1AS8A 3TT3L 5IUSA 1WFMA 4UOZA 3GZPA 2VOTA 2UWEB 3FYEB 4PJXF 5FYKH 3DBXB 1QR1B 2FSEA 4YC2C 5C0BB 4DKFL 2P7TA 2WLKA 4W6WB 5DZOA 5AAMA 3TT1L 4JW3A 5HDQL 2NY0B 5J1SC 1EBPA 3ZE0E 2EDDA 1N9PA 2AJZA 3QO1A 4OLWH 3WEOA 4N2KA 5B8CB 4YXHH 2EKJA 5IUCA 1A0RB 3FPYA 3LPOA 5I6OA 3K71B 5C6TL 4QRJA 2VDKH 4YOKA 5KVDH 2Q9OA 1NEXB 1OL0A 5B38G 4PTTB 4K5MA 4K0OA 1JGEA 2CLRA 1HHHB 4N2BA 3DX7B 4DSYA 5A16A 4YSDA 1CTNA 1WS7A 4IMMA 2E7LA 4O51A 3HNVL 3N0EA 1IB5A 1EMTL 4R7LA 3IRZA 5JPNA 1ADQA 3EHBC 5C0ND 2Z7YA 1GCYA 5CEXB 2YD8A 4CJ1A 3CQQA 4D6VA 4ZOBA 5F7LB 5IGOA 5AOIA 3QFJD 3HNTL 4LO9A 1F56A 1IBZA 4GRLA 3RBGA 3W5MA 4APQD 4HKJB 4WQOA 4LSVH 1JBJA 2HKRA 2ZX6A 3JV6A 1Q1JL 4KTYA 5CUSL 5I16B 4JFDD 5DRWB 3VRJA 3FT1A 1WGVA 5TD4A 1DQIA 3PAUA 5EU4B 5KBPA 4BJLA 5DJ6A 1BAFH 1ZE3C 4GKSA 1R0AH 1JK8B 1CFMA 2YLHA 1FVEA 1TOXA 2LU4A 1R5WB 1RIVH 2RH0A 2Y7NA 3FK3A 4PG9B 3OLDA 3VI4B 4NP4L 3U30C 4G80B 2YQGA 2V7HA 2Q8BH 1TVBB 4F58H 4JR9H 4LNRB 5MENE 2A99A 3VD1A 4UM8A 3C99A 2AQRA 3Q2VA 4JRWA 4L3ED 4JKLA 4J3OF 4PUBH 4Z7IA 3T0DA 3MFGB 4QY8A 5F7YC 5LGHH 2DMCA 1XCWA 1MJ7L 2HSIA 3MLYL 3CSYA 5FUOH 3MSPA 5HYJA 2OX5A 4UNUA 4RDBA 1BAGA 4HH8A 4KY1H 4MNHA 4HLEA 1JFQH 2DJMA 2A1WH 3NJHA 4YN3A 3SE8H 1GH7A 1NCJA 3BEWB 1HXYB 4Z23A 5BS0B 4D0CB 1LWRA 1LO0L 1RZKL 5I66A 3BUTA 5F96H 5FGBC 1HCZA 5I1IH 1U2VC 5I8EA 5I1EL 4A68A 4L1SA 4N0YH 4LF3A 4G7SB 4RQQA 4FQCL 2H9MA 2O5YL 4L1TA 2VITB 3SKNB 4HJ0D 3NACH 1B2YA 4WKZB 4FL4C 5F6IB 3N55A 4Q0XL 1H3UA 3C5XA 3TN0A 4U7MA 3V2AR 2DI7A 1G7JB 3VH0A 5I1CH 5MEQA 3D33A 3FT2B 2F5AL 5I73B 3BKCL 4HWZB 1LO2H 1R17A 4HX1B 4Y7OC 4H5SB 3QORA 4QHUA 5DGRA 3TJPA 3S9DB 3UTTB 3IGUA 4EI6B 1GGIL 2Q76A 5IW3A 4ZDHB 4YFEA 4NFDA 1IE4A 2VT0A 2HVJB 1F1AA 3UR4A 1CIUA 2JIXA 3PE7A 4YBLC 5ICXA 3D4YA 5TDPA 5DXWA 5AKRA 3TTSA 5KOMC 2GW5A 4Y9GA 3HAEG 1UD8A 2K6YA 2OXGA 1VPOH 3BZ4A 3PGCB 4M5SA 4XBPB 5IOPA 2AQ5A 4M6MH 3V9FA 1QSFB 3WIAA 1P6WA 2KERA 2C3HA 1YNLH 2B0SH 2BSTA 4OV5B 1X9LA 1JTPA 1TTBA 3AXLA 3F62A 1RUMH 4NOFA 5GMKn 1YQVL 5DZJA 4LLMA 4IBLT 5BCAA 2IEPA 2OSLA 3MVDK 1AIFB 2VB5A 4XO9A 4PGBA 4GSUA 1O0VA 4UTBL 3TH2T 3VXRB 1OPOA 5CILL 3MJ6A 5D7IB 3EYUL 4CBPA 1KCWA 5E4AA 3RIAF 1NFDA 4PS4H 2FR4B 4JY5L 2KPWA 4OD3H 3NCMA 3O8XD 2AVGA 2CIIA 3PLYA 3F58H 3OJMB 3QUML 5FYLH 1JOIA 3EFOA 2QQKH 1I7TB 4XCCL 3EBGA 3WSQH 1V3LA 4BQ6A 1TENA 1MXDA 1UD6A 2F53D 2VDOL 4JO1L 5JIHA 2H9NA 4D9LH 2WCPA 4U1LA 1DL7L 1T1YA 4K3DH 4N0UE 4WNQB 4GS7C 1PMYA 4M8QB 2PR4L 4IIQA 4X98B 1PG7L 2AFNA 2ZG2A 3IFNH 4UOW1 4HYTB 3EKCA 3EH3B 3ZOAA 3L1OL 2OTUB 4HA1A 4PJ5D 1ONQB 3GSUA 4WUUD 2Q6WB 5GGSY 3CDGA 3H9SE 3RJOA 5DUPL 3S3PA 1T7ZA 5IJ8E 1J8HA 3ZKNC 3ARQA 2R2HA 4JVPA 1E8WA 1BPVA 2OMYB 3PWJA 1FSKB 2QKSA 1TJGL 1RFDL 4R5VA 1DJWA 3VXMA 1J1OL 5I66B 3L3JA 3WIIL 4H20L 2ERJB 4KUZH 5G4OA 1V10A 2W92A 4YPGA 2AXHA 1MHCA 4PM1A 1G1CA 1WZKA 2YPVA 3TFKD 2GTQA 2ZUQC 4K8RL 4JY5H 1NH6A 1RZIA 2J6WA 5ACZA 1G7LB 1J0YA 5D9SB 1D5IH 1RZ8A 3S37L 3CFDA 3UAJC 1MLBB 1MFEH 1T0MA 1AHWC 3BGMA 4QO1B 1T20A 3DIFA 2F53E 3GMMB 4FFZH 1E5CA 3VG0L 4F15B 1Q72L 4MQ7B 4CMMA 4IOFC 4PR5A 1IGJA 4LKCA 1XVSA 2VR7A 3CFEB 3MRMA 1S7WB 5A2IH 1KG0B 4ONGH 3P40A 1SMAA 1VCAA 4EN3C 5B38A 4GRWH 3DO7B 3E7JA 3OF6D 3UL4A 3W0WA 3GNML 2QFRA 3FULA 3PNWA 4ONHB 3WE6A 4PNKB 4PLJD 4S1DD 4NO0B 4W4NA 4AVHA 3RE0A 4ZMOA 4BHUI 4Q6YA 4RGMB 5J5EA 1AMXA 1YDPA 3BX7C 2W65B 4Z8LA 4E5ZA 1OSPL 4MNQA 3WJJC 4DN4L 5K9KB 2GCYB 4QRBA 1ZOXA 2WV3A 3UVLA 4UNVA 3L95A 1RI6A 1BREA 3WS3B 5TPWH 3VXUE 1QEWB 3IRCA 4NKIH 4OZFB 5D2LA 3CLEH 3JT2A 1MCOL 2QQLL 1EHNA 2V4LA 3LZPA 1W0YT 2X70B 5CNHA 2A74A 2BZDA 5C9KA 5IV2A 5CLYA 1FHGA 3MGTB 4QRPD 3JZ7A 5GRWA 1UD5A 2E9WA 2JI1A 2UY6B 5JNYA 1P4UA 4KJQC 2IOMA 4Z7UE 4NKIL 2P8MA 2I9LB 2VTFA 3QQNA 3US1A 1PGRB 5F9OH 2LFEA 2H1PL 3DARA 4O9DA 1V05A 1DEDA 2XPZA 4WHCA 3FB6B 3B6SB 3PDGA 1A4KB 5F96L 4Z77A 2ZUXA 5A2CA 3SE8L 2DQFB 3EDJA 2G3XA 4HJSA 3LN9A 3VB8A 2ESVE 5DQ9B 1J5IA 4NO2A 2BCKB 3VI3B 1GAFH 3VWJC 5HE3B 3MPCA 1M7DA 2CGRH 4NZUL 4O9HH 2ENPA 2J8UA 1D5ZB 2NR6D 3C5SB 4TUOA 1EEZB 3NSDA 4X8CA 4DZ8A 2ZG1A 3K4ZA 1B9XA 2A9DA 4O2EA 5ABAA 4JRFA 2VKXA 4M93B 3FO0L 3MLPA 3IDXL 1JTTA 3X12B 5SWZD 1TF4A 1FAKT 3SXTD 5FGCB 4KJWD 1N0XL 3ZRCC 3VMPA 1HS6A 4DEPC 4ILDA 5LDSA 3OKEB 2HTKC 1WH0A 2G2NA 3KWUA 3LKQB 4J79A 1HESA 4WU7B 5F7HA 3AU1B 1AD9B 4PD4K 3T3MB 2W9DL 3AZUA 3DGDA 4CC4C 1XR9B 1HI6A 1I7ZB 1G5GA 1J1OH 5TFSL 2RTTA 4TNFA 1EWHA 3CZUB 3HNTH 4HOWA 3C12A 5D2LF 4YNYB 2VSDA 5IJDC 1E5YA 4JPVH 3F7VB 4K5LA 3VCLB 3V79C 4YHZL 3BRDA 2JCCE 3OX8A 3QDMA 5CXCA 5IVXA 3KPQA 3MX0A 5C0RL 4JFDE 5IHZB 1LXMA 1JI2A 1A1MB 4MA1C 4K23L 1NPJA 5JO5A 2WZAA 1DO5A 3IJEA 5IY5B 1CR9H 3DBSA 3QFJE 5DA4A 2W0FA 5GZNA 5H4YA 3F6JA 5ACMA 2D7NA 5EWIH 1F0LA 4ORGA 2BNRB 2VMDA 3ALPA 1S5IH 4HWBA 4MXQD 4WWKC 5AVXB 2N01B 2VITA 3JWNC 4ABWA 5JR1H 1J05A 4AEFA 2I0TA 1IC5L 2BP0B 4S1RH 3O3EB 1N6EA 2NZ9D 4R97C 4XTRD 4J8RB 2CRZA 4HJUA 1F1DA 1YPZB 1FFPA 3WGVB 4PG9A 2QZPA 4O2CB 3FUEA 4RGNB 5IG7A 4OU3A 4OFYA 1P4LA 5HYSA 3VACA 2Z93B 1BG9A 3MV8D 4N3TA 4TVPL 1ZHNA 3B2VH 2C9AA 2VDLL 1UT1A 3SE9L 4ZUVA 3TJEL 1F2QA 5CJOH 3NIDF 5HHOD 5JW4R 4MDJB 4L4VD 4R0LC 5F8QC 3WFDL 4P3WA 4AKOA 1NEZG 3AC0A 3GXMA 3O6FA 3CFCH 4MWFB 2OA9A 2NW2A 2JKWA 4NS0A 4IRZH 4OJEH 4AV4A 3BUYB 3UMTA 1DJGA 2BNRE 3D85D 4PRID 2ICEB 5E7BA 4Y19A 2X1QA 1MXGA 4DQOL 4EUPH 2PXYA 4C56D 4A39A 1VKXA 3ARDC 3GM0A 4WVRA 1S9XB 5FYLE 1H5BA 3B1UA 4DUVA 1OAXH 3CN4A 4MZ2A 4NCDA 1AGFB 2Q7AA 4L4JA 4JG1L 3UKUC 1GGIH 2JQMA 4BKLA 1ITCA 3VI3F 4XVTH 2EDMA 3J27A 4R84A 2WVTA 3QNXB 5K9QG 4M62L 3MJ9H 1E4HA 3T1WA 2YPLB 1GZQA 3S36H 4Z18A 1OE3A 5IJ7E 4UAOC 2O6PA 1PD6A 3V9EA 4JM0A 4XP9L 5AUMB 4AXWA 1EGJL 4TULL 3ZE1B 3UDWA 3SYOA 4P4KC 3WBDA 5TFSH 1T22B 4LBEB 1E2ZA 4M4PA 4W9FC 3C8KA 3U25A 5BOZG 1J86A 4G1MA 1G9NH 2VLJE 1HK6A 3AACA 3QUYD 3FN9A 4KKNA 4L8SC 3O6ML 1JGVH 5GJSH 4P5MA 5IB4B 2NZ1A 4B9FA 4LRIA 2B5IC 3RWDA 3UAJD 2PCFA 5I71B 4NWUH 3KPTA 4JO5A 3SDXB 3X13B 4LU5L 2FBJH 2HVBA 5BZXA 1SQJA 4JT6C 3W5NA 4U1LB 3L81A 5CP7A 4C59B 1GRWA 5EAMA 3QYCA 4IMLA 2AQ2A 5EC2B 3B5TA 1CLOH 1P0SE 5BRZB 5HHQA 4UM9B 2EIMB 5LKNA 1PZDA 5EO0A 1NR0A 2OTUA 5BV7L 1HQ4A 1KELH 3P4OB 4XN2A 3VMOA 1TPXB 1H8NA 4LP8A 2Q3ZA 3SDCD 2OI9C 2QMKA 4PVNA 3BPNC 4X6BB 3VI3E 3ZR5A 4E9SA 4IRSC 3TA3B 5AYUL 1OAQL 3OMIB 4XC3L 3ARBB 3PPSA 4H5JA 3QHFL 3KGUA 1E7UA 5EULV 5IFHH 5FA3A 3BH9B 1IE5A 4NZ8A 4FXGA 2NQCA 2FR4A 5E95B 1K8IB 3O11B 3MOBH 2NR6A 5C07D 3VAEA 1H0DA 1A25A 3HNSH 5J6HB 4CSPA 1JPTH 1S4UX 5I1CL 2XZCL 2WK2A 4MBOA 1CK0L 1GKEA 4LQFH 3UC0H 1E6JL 4A7TA 4GG6F 1NCNA 2B20A 3D39D 1EMTH 3FTZA 4LCWA 1XXDC 2F1BA 3QQDA 4N1EA 3LXCA 4E9QA 5FXYA 5F3BB 1E4XI 5ICYB 2F54A 1AHWA 3AQDA 4J8GA 3KYOA 1SY6H 5JW3L 3CX5K 4WI8A 1F4AA 1ODAA 5AW3B 4Y4FB 2H2SD 3MV9A 4YHOH 4RAVA 3W2DH 3CIAA 3GSWA 1BECA 1TMCB 1M2OA 3EO1A 4ERSH 4Z7OA 4OF6A 5CGBA 2ZKYA 1A64A 1GOGA 1VYHC 5ANHA 1RI8A 5AW8B 3SY0B 3GI9H 3D9AL 4DKAA 1Q72H 2JCCF 4TSAL 2NRDA 3NJMA 3QNFA 1WA1X 5LLIC 5TDPB 1NAMH 3D0VA 3FT9A 1IU1A 4Z0XB 1KJ2L 5T1MA 1JXGA 3S37H 3BIKA 3LSOA 4Z7NB 3K46A 4QRQA 5LCVL 5T1LD 4A08B 5DJYA 2YGQA 2DTMH 4MB5A 2OTWB 3QEQB 4X9YA 3WDJA 3L4ZA 4XMLH 1Q94B 3Q8CA 1TITA 5CSGA 4ZFOB 1X5ZA 2VXTH 4JZNB 2VLRE 1F5WA 3RVTD 3VM7A 5CN3A 4NRZA 5FWQA 3WHE0 2A5UA 2L8AA 2AV7B 3VWKD 1AXSB 3ATFA 3GKWH 1N0LA 3TBVA 2NNFA 4ZMVA 4G6FD 4IBTA 1T3FA 3U0PB 3LIUA 1QEWA 2FLBT 3GTTA 3MGOA 1YEHL 4J3TA 4TF4A 4JFQB 1PG7H 3IFNL 3QC5X 3SOTA 2XI9A 3AH8B 5M7QA 3HAEH 4LDEB 4PV9A 4XXWC 5FYJL 5I6KA 3QZBA 2PUQT 1DQJB 2QJDA 2Z3FA 4KMTL 2DD8L 3I7LA 4P2OB 2WGNB 4CY2A 1F00I 1BD2E 2WXIA 3VW3L 4AEZA 2A38A 1X5IA 2NTFA 3DVNA 2H3NA 3N1MC 3CXHJ 3BPOB 4WWKD 3T6XA 3FN0H 3MRRB 2HG5B 1YEFL 1G87A 3VFNB 1LVEA 3GSUB 1JS4A 2B1HH 2J5WA 1USZA 5LQBH 3CH8A 4I13B 4JLRA 3ZUNC 2PO6D 5EMKB 3OD3A 5E94A 1JXDA 1MWOA 1QFOA 2AJSL 3GJFB 2QFPA 1SZNA 3ECQA 3ARBD 3Q2NA 1KXVA 3AADB 4ODTL 1WQVT 5TQ2H 1HWGB 1TZHB 4MGXA 5H8DA 4D2NA 3SKJL 1LEIB 1MVYA 1FZKB 5KS9B 5G2NA 5TGBA 3RFZA 1EZLA 2C34A 4EI5B 3W9DB 1NAKH 1ZSHA 4ZFQA 1KB3A 1XB3A 3O6MH 3NJKA 1SF5A 3C5SA 3MRKA 2FECI 2VN7A 2ZUSA 3OPZH 5GGTA 1I8IB 3P0YL 2GI0A 2BNQD 3T5WA 5D1ZI 4ODSH 4ZTEA 5HYNB 5DTFB 1RUPH 2JXMA 1I1FB 3CMGA 3BH4A 3W3BA 4FKHA 3KBPA 1XH3A 3GBMH 1MG3A 1JVOA 1KCSH 3HLAB 4H2AA 4YE0A 3OKWA 1CE1H 4WV1B 4Q2ZB 1MCQA 5HYJE 1RK0B 4JVUA 4XMKL 3F6LA 5F89A 5DHMC 2HKFL 4PG2C 3GLZA 4KKCD 2DPKA 4LL4A 1KGCE 4CMHC 1NGZA 1CD0A 3IDGB 1GYWA 2DQTL 1MNUH 5D6DC 3VXPA 4Y7RA 4L8SA 4BFBD 2YLKA 4KK8D 1HE7A 2AK1H 5D4HA 3MRHB 4OD1L 5EPMA 5KEZA 4J0WA 5FLVA 1Z66A 4IM8A 4Q0XH 2DH2A 5EUOB 1EJFA 3BMVA 3KYMA 1JPGB 4H13C 3NACL 4PHXA 1KCUH 4H1LH 2EDRA 1RERA 4HW6A 3V4VL 3WJMB 5K9OB 3GM8A 1J9QA 1QSEB 1YNTF 2HFEB 4WNJA 5J6SA 3VRIA 2EE9A 3RWGA 3GB7B 5E9NA 4RFEA 1A7OL 1QQDB 1PX3A 3TO2A 4NJ9L 2PWHA 2WMPA 1E7VA 2O6CA 2A0LC 1CLYH 2NSXA 5IVZB 2XPGA 4NZTH 2WLLB 4ESGA 3BQUA 3LQZB 2VC2L 4FFVD 4GRLC 4J4PD 2KZKA 1A6TA 1WUZA 3EU7A 4KWUA 3T6ZA 5C9JA 4KNUA 1JDAA 5M5SA 2PYEA 3GS4A 4G43B 4Z7VB 3SGDI 5KSVA 4JR9L 2H9PA 2VXQH 4ZXBC 3RU8L 2Y06L 3ARYA 3VQ1C 4ODVH 2ALAA 3BP7A 3DIVA 4Z7WE 2F8VA 2A3TA 2MKLC 4A66A 5FOBB 5A3ID 5I1HL 1OTUD 2YBAA 3QRLA 3OHMB 1IEBA 2GTZB 2HXCA 4PEEA 3TPUA 5CBAB 3SDDA 5B21A 2GJPA 3B8YA 1KGIA 4PSXB 1SBSL 4O58L 1YMMD 1GJIA 4I77H 1X4YA 1OARL 4AEEA 3FRUB 1UEMA 5EZOH 1HOCA 2B15A 4P2OD 2LTQB 1A6ZB 1YEDB 3HIZA 3WFBH 2EC8A 4GT7A 3ZHNA 5AVUB 1T0PB 2AI0L 2DL2A 1SEBA 3P2DA 5KS9F 3BD3A 2D4FA 4UM9A 3X14A 1SY6A 5FWRA 2IIJA 2YS4A 1HYSD 2X7LB 3OTTA 3FBKA 1FDLH 5DR5H 2BDNH 3GS0A 4FDWA 4S0HA 1QRNE 3RNKB 3L4MD 3ARVA 3R8BB 1XGZA 3QHFH 1EJOH 1R75A 4CZYA 1QUNB 1OAQH 4RZCA 2EDKA 3OAYK 5GS1B 4LSDA 3CSTA 1E65A 2HPTA 1QPKA 3MKKA 4HIXH 3CZJA 4MAYD 3SE4C 3M88A 1S9VA 3QFJA 3NZ8B 3ULEC 2DLFL 4LVHB 2X6CA 5E1QA 3STLB 5J7CC 2J6EL 3H85A 4BIKA 3K6DA 1V7NL 3HC3H 4LLWA 2IGLA 2VC2H 4NZDA 2VDRB 3VFVB 3RGVC 3VFPA 1HEZB 2VDML 4WHYH 2WVVB 5BZDA 4WI2A 4F5CA 3IKCB 4GXFA 3T0XA 2CA4A 2WZPD 3AM8C 2OR9H 1Z9SA 3HI1A 4V2BA 2HT3D 5E2WH 4TYUA 3K2MC 2Q5BA 3NZHL 4DCQA 5FM5M 3KL0A 3VJ6B 3K8KA 3C09C 4L5FL 2DEWX 4MMXB 2YEVB 2F8IA 2ENYA 2JJVA 4GXVH 2GK0B 3TPKA 4HH9B 3VD3A 2BOCA 1H6UA 1FV1A 4AW7A 1PQZA 5BMFH 3D69B 4P23A 2ED8A 2FATH 4Q74A 1MZYA 4XWGH 4F8LA 1NCTA 1KIQB 1UZ8A 4GO6B 3B56A 3KWWA 2DWDA 4HWEH 4JPIA 3S5LB 4AQ1C 1E2WA 3VA2C 3TONA 1HL9A 1P84J 4IRJD 1IAOA 5I1AA 5A7BA 1Z5YD 1PL3A 4AGPA 3CLEL 4F5CE 4JFFE 1IGFL 2CUHA 5AZUA 2D7TL 3LQZA 4DFIA 3FU0A 4PWEA 4X4ZA 3ENEA 2H0EA 3HN5A 5DC2A 3ZDXA 5L4MA 3OB0K 3PV6A 1F3DH 4GKOA 2B4CC 4U1GB 2DQEH 2XWBA 1G1YA 3NIGA 2BNQA 1WV7T 1OSPH 4UDUA 3A6BH 4MMYB 5IMLB 1KCSL 1KCLA 2ITDA 5EBGA 4LHJB 4Z0BH 2FK9A 2G2PA 4NQXA 1X5YA 3TN0D 1NM9A 3KPRA 5C0JA 3EI3A 2QLVB 3SD5A 5KYYA 4Q4IA 4HPHA 3EIFA 1W15A 1RCYA 2WKOA 3JVFC 4NQEE 5AMSA 1V3KA 2XN9D 1O9ZA 3MRBB 5AW2B 5J1TC 4CADA 3AS3A 2BRRL 2WQUA 3QORD 4QLWA 3SPGA 2VDMA 3RLSA 3QDGE 4CSTA 1LILA 1ZVYA 3V5HB 2QXVA 4J78A 2R0ZH 2Q87A 3T09A 1M42A 2BNUA 2VQ1B 2H9GB 3CBJB 3CSBA 4JG0L 4WGKA 1SXCA 2OZ4L 4Q7DA 5D7JD 5GGVH 3C6EA 1I7UA 4LSPL 4G8FB 4OM0H 2H6PB 3PHOA 3WNJA 5J3HD 4FAVD 1CGXA 2B1HL 3TO4A 5H17A 2B59A 3QP3A 5EU4A 2B4EA 2P7TB 2ED7A 4WY7H 2ADFL 1H3TA 3NCWA 4LCVA 5C0AD 4HG4K 1G9NL 2M1KA 1JZIA 3NA4A 5I74C 1LWJA 2VDQH 4M8UA 4WJG3 4NWTL 4B9IA 4Y2DD 2X4UA 5CIPH 2QELA 3SDXA 3V4PA 5DWPA 4WKXA 4G8AC 5DWUL 5B39G 2NXYD 2PPEA 4W68A 3ZKQD 3DLQR 5ISZE 1FPTL 4AYFA 4X3EA 4X8JB 1U8CB 4NN5C 3BUDA 5ELIA 3ZL2A 3FO9A 3CU7A 2CNXA 3SN6B 2G99A 3SJVB 1OP9A 4DNVA 4LPWA 3UADA 4S2SB 4EN3D 1TTUA 4KHTH 4NKOB 5TTRA 1UC6A 1DUYB 2EYSB 2PR4H 4PLKD 3QCVH 3RJQB 3KDMA 4MDRA 1Z0NA 2DQDL 2QPEB 3CHQA 3DRQA 3TA3A 1VZ2A 4QOKA 3NOIA 2V9QA 5T1DH 3N43F 3LKOA 3VX0A 4DESA 1TIUA 5FYJU 3S8GB 5GRXG 2MTAH 4HJGA 2D3NA 2AKRA 1UWYA 5JOFB 3O11A 4FFWD 4BFIA 1WAAA 2YD7A 5EO1A 4TVPH 5I16A 1V8HA 1RL1A 1RURL 1ZE3H 1XH3B 4PIRF 1SOXA 1CLZL 1TQCC 1ZSDA 3IS0X 3LAFA 3WKML 3C08L 4ANUA 3NQKA 4HUVA 3IGAB 4QRRB 5E8EA 1JK8A 4U0RC 4PWHA 1CDUA 1RUML 2BX5A 2ADGA 2W0LA 3RFHA 2APFA 2VXQA 1D5BA 3K80A 3PQYE 2J1KA 3VXTB 1TZIA 5C97A 1J8HE 4RWHA 5IMMB 1T5WA 6TAAA 1IQDA 5IK3A 3SGKC 4EOWL 5B39B 1CUOA 4NX0A 4PJ7B 3PF2A 5JDSB 1MHEB 4OFVA 2XZGA 3AS0A 1BF2A 2ZUVA 1UGKA 1SLWA 3KVDD 4FWWA 3GSRA 3TP4A 3L2MA 1VFBB 3OR7B 1NBZA 2DQJH 3O4LE 2JQZA 2H1PH 5DYOB 3VFOB 1JMXA 5CGTA 1G6RB 5C9ZB 1Q9WA 2WXLA 2QSTA 4ZW3A 1EFXD 5I0ZA 5INDA 2GIXA 4OGQC 4HZAA 4ODWA 3HS0A 4NQDA 1RZQA 3F00A 4P9HL 1SMDA 2YOCA 1JHKH 1DEEA 2HRPL 4ZSOA 4B7IA 4Z3TA 3BVWA 2X38A 2IH1A 4HUXB 1WZ1H 5F9WC 4ZXBB 3U4AA 2G60L 5L2JA 3PCYA 3STBA 4BK5A 1DJHA 3KYAA 4NRXB 4PHZA 3QI9C 4KJWC 4TZ4A 2X89D 3O3UN 4OCYH 4QHNB 5F7DB 3UEZA 2XHNA 4D9QD 5AW5B 4PJHE 1PLAA 4XVOA 3ZIYA 4FS0A 2O4EA 4NCC2 5CCGE 1B4RA 1JF6A 3C5ZD 5DO8A 4L4TA 3QGVA 2IVFC 2Y23A 4H7VA 4YDLC 5FO7A 4NKDA 5ECJE 1A9VA 4PGCB 4YLBA 5JW5A 2Z8RA 2GJRA 2ZSWA 3LZFH 4H8WC 2WLHA 1ZMYA 8PAZA 4KY1L 1BHGA 5C0CA 1ZEAH 4X8JA 4FQHB 1ZGLP 1F11B 1R5IA 4FQJL 5MEPB 3V10A 1V7NH 3HC3L 1RD6A 1E3FA 4KKCC 5LGHL 4OV5A 2QSQA 4ZPTA 1A6UL 1V7ML 2QADC 5IQMA 3QJHA 4LQ1A 4N8PA 2OL3A 1B90A 1CZ8L 1G4RA 4JDZA 2Z65C 1HNGA 1TETL 1KIRA 5D1ZD 2CPUA 3QDJB 4YC2B 4N2OA 4NIYE 3FTXA 4POZD 3KLLA 1U8OB 3KHQA 3NA9L 2UZYB 4R8WH 2UWEA 3WYRA 2UYLA 3ALXA 2QKIB 5F9JB 1NJ9A 2PYFB 3QE5A 1NAMA 4KRLB 2YN3A 1A6TB 1Z9LA 3OKNB 3VXSA 1C5CH 5K1VA 2HFFB 3BZFA 1HSBA 2BSSA 2NX5D 3X17A 3NCXA 4IKNA 5EZIL 1YUHA 1WTLA 3EFOB 4FFYH 4NQQA 4Y4KC 3VQLA 4AL8C 1U95B 4KVCH 2V2XA 4AJ0A 4KUCD 4LLYB 4U4IA 2IH8A 1QO3A 1UB5A 1ZLDA 2CO1A 2GSIB 1DQMH 4MXVE 4P3CL 5D7JA 2AEIT 3VTTA 1KPRB 3EHBB 2FSEB 3HR5B 4OI9A 4KI5D 4X5QA 1DVZA 2XBTA 2NXZC 4FTVB 2ITCB 3U6RB 3B83A 5A2Qg 5J0BA 1DSFH 2MOGA 4H1LG 3HE7B 4JY6A 1I9EA 3IFLH 2HJLB 3PWNB 4NBZB 1KWKA 3P4FA 2YAOA 1RZJC 5KN5A 1JXJA 3WHXB 4XCCH 3ROOB 5CCKL 4M6NL 5DC9B 1T6VN 2QV2A 4ZZFA 4XCEB 2IDFA 3MBWB 3BZ5A 1BZOA 5AOZA 2GVYA 5DJ0B 4HS3B 2ENQA 2WSKA 5BXFA 1AP2B 3GMOB 3U83A 1QFUH 1B4TA 1AR1B 3QFDA 2X12A 2OVRB 4QHKJ 2VAAB 4E41D 3M86A 1RJYA 2ZX7A 3SDAB 3MV01 4IOSD 4L29B 1JYXA 3CFBA 3BISA 4G9DA 4TOYL 3K2KA 2MIZA 3VXSE 3TO4C 2AANA 1BMZA 3Q0HA 5T5FL 3ROLA 4HUUB 4URTB 3VGAC 2BRRH 2PCPB 4C83B 3AGWA 5AVWB 4NKQB 3ZDXB 1Q4NX 4E9RA 4EQ2A 5GXIA 5KG9A 4P3DB 2CDGA 4XPTH 1XCTA 2VMEA 2G30A 2Y6TE 1IM9B 4HK3J 4F2ME 1H3VA 1SDDA 1OAUL 4KKBC 3BPCB 4BCCA 3WG7B 1X4ZA 3FTWA 2FAUA 5DC4B 2VN5A 1S7UA 4K23H 5L2KA 1BOYA 3VTAA 4E5ZB 5EN2A 5ALCH 2Y5TB 2BCKA 1HIML 3VI3A 2EYRB 4KHTL 1NKOA 4HJJH 3FU6A 4DO6A 3IBEA 1FN4A 1PQZB 2D7QA 4BH6A 4OCSH 3SKOA 3E6FA 4ZFFA 4QYAA 4TUKH 3SJVE 2GBVA 4WEMB 3JVGC 1MAKA 2VLME 3MREA 3WMSA 3UPAA 1G0XA 4HXAH 2NUTA 4XGZB 1EUUA 3TBCA 4UT7L 5AZEH 2PO6C 5SWZE 2FYYB 1X5XA 2DLTA 3PFQA 3WFHB 5I74B 5JXEC 3T0EA 4K9EH 3GC3B 5FK9A 1GS7A 5CD3A 4X99A 2AK4E 2UY6A 4JHVA 4PGDB 1YR2A 2WKOF 3H3PL 3ZO9A 4WEBH 4DHLA 3S34L 2C9RA 2IDSA 4JAMA 2Z91A 4GIAA 2Y2TA 4ZSOE 1DFBL 3IVKA 2YK1L 1Y18A 4V1DB 4C57C 3FCUA 5DD3H 4KNSA 4HAFA 3L5WA 3PAVA 2ID5A 4U49A 5DMIH 2E5EA 4XCNB 4YBHA 3JBG7 1BVLA 4RETB 2PWEA 1EDYA 2YXFA 3EGSB 3QJFB 5AAPA 5KTEL 3TF4A 3C5JB 1IGIL 2IALB 5K9JH 5CXCB 1F41A 1UUSA 2ZF8A 3O4LA 3QQXA 2ZCZA 4GEJA 4ZFGH 3FU5A 1B4JL 2ITCA 2WN3A 1RAMA 2DLFH 3LKSB 4KXBA 5DJ2A 3X11A 1H2YA 2XWJB 2YARA 1MH5B 5JO5B 1VFUA 4S1QH 2ETWA 3EH1A 1MDAH 1EA9C 4PJ9D 5EF0A 4APXA 2I7SA 1A2YB 1U8LB 5KN5B 4KNQA 1SLVA 2H9GA 4MAUH 3OJVC 1YN7B 2VZVA 3QISA 3GSXB 3G08A 4YZWA 4JL1A 2BNRA 1QSFA 4W9ZA 3MBWA 4LLWB 3SE4A 2WXJA 3U30B 5FC9A 3DVFA 4BL0A 1GGBL 2P9RA 3F6IA 3ORJA 1JJUA 4UDTB 3FAXA 2OMVA 2I25N 4XZUB 3ASNB 2AXGB 4JFFB 1NIEA 1UATA 3U1SH 1E9QB 2BWIA 4XNXH 2VAAA 2K9FB 1FCGA 2M2DA 4NKMB 1ZXKA 2YAMA 1ZLSH 4X5XB 3Q5TA 1JUFB 4FQLL 3L7EB 3I6KA 4G6AC 3KWXA 2QSCL 1D5BB 3N3EA 5EOCJ 1KBGL 3CZNA 2BP3A 2HJFB 4L4VE 1SDAB 4ZO6A 4JFEA 4HUKB 5HBBA 4JHPC 2MPVA 5TDNB 3T9WA 1Z5LA 5LCVH 5DK2B 3PE9A 4HIJB 3H42L 4UQAA 3SWSD 4Z9KB 3SDAD 1G1KA 3IMVA 3KLSA 4YGAB 5F1OB 3ARRA 5IW1A 3FAWA 4L48A 4Z7UF 2A9BA 3OAZH 5TH2A 4DKEH 4JZOA 3GZOA 4XH2B 2MPAL 1BFTA 4O5LL 3DVGB 5KBDA 2UY7B 1CT8A 5DK3A 1JERA 4N14A 5F9WB 2YOAA 1GW0A 4H8WH 5F88A 4OKDA 4EVNB 2EZ0D 5TDOA 4PJBB 1SJVA 3DJSA 1HYRC 1JZFA 4NNYB 5EOQH 2AMUA 3QNZA 4WTWA 2W9LA 5E8DL 4NQXB 3AROA 3B2XA 2IH1B 1NGXB 4HUXA 4NO0D 4DIXA 2FWOA 5C8JB 4AYBA 2Z64C 5IBTH 3CK0L 2V9UA 4HKXA 5AENA 1A66A 1FGNH 3KLDA 4XXDA 4OZ4A 5CZXD 1KY7A 2I0RA 4GT0A 2XV2A 4B6ZA 4DP5X 5KJ4A 5TE6H 4NKDB 4N90E 1WPCA 5J1AA 1AD0A 1AZVA 4KO6A 3IAGC 2ITFA 3JT0A 4N2EA 3FQ4A 3OV6A 3RKDD 1JNLH 4JO8A 1H5BB 3KPNA 1NGWB 1T89C 4B9GA 1JPTL 2Z7WA 4JSVC 3N42F 3T4AA 3QO0B 3V0DA 2E56A 4JZJC 1SJHB 3Q5OA 3JUZA 3C5JA 4PCYA 1T7XA 4LSSL 2YO3A 6PAZA 3DYOA 4AGNA 4A0AA 2CO2A 1YCSA 2P52A 3Q01A 3ZDYE 1QWUA 1RK1B 3ZW3A 2EE0A 4F7MB 2BFVH 3PXJA 3SE3C 4NI3A 1B2WH 3ZE1A 2WUBL 4L23A 4TKWA 1ZTXH 4H0GA 4IK7A 1TG8A 2P24A 5HJ3B 2WXFA 3V9CA 4KZEL 4KBPA 4OD3L 1J5DA 4S1SL 2AJ3B 3EUUA 4BSWB 1MG3C 1QKZL 2P80A 1JK9B 4BXSV 5HHXL 4Z7UA 4PJ9B 3GS7A 4B9YA 1HL5A 1NCOA 4W6XB 2NXZB 4F8PA 3WN5B 3OZLA 3DRQB 4MXWH 4PGCA 5L4IA 2BW5A 1ZTMA 4N86A 3OR6B 4Y5XA 4F9PC 2YEZB 5IF0A 1K4CA 2A83A 3RDTD 4OGYH 3IU3B 5EOCL 5C08D 2WXGA 4JFOA 1UOPA 4P5SA 3FU7A 2VXSH 1WFOA 4HMEA 5L4FA 4DF9A 1KXVC 2WCGA 5I0WA 4JFFD 1AO7B 4MVBD 3VI4F 3WKPA 4F8OA 5B3SB 2AZAA 3F2LA 1UWXK 4WI5A 2BFVL 1CTOA 4MNQE 4TULH 2O30A 3IGAA 5C2UB 1BIIA 5FQDA 3GRWH 3IKOA 3LH2L 1T03L 1MNUL 2CKBB 1WG3A 3L2LA 3B9AA 2BHZA 4XCEA 3SDCC 4LSRH 2OKMA 3U7AA 5GGTL 1CT8B 2CSPA 5KVDE 5I9QC 2HKFH 3HZKA 1ANUA 1KDJA 1IIIA 1NDTA 4XXWA 3VU2A 1A6VL 3N40P 5F72S 1PJWA 1A7RL 3CDZA 1MHEA 3IN0A 5JXED 4N8VB 1MPAL 1XMWA 4IEFA 4ZODA 4HUUA 3UC2A 1O9VA 4AH2A 1MRCL 3SIKA 3C9CA 3GSQA 4TNEA 3B9DA 5A2FA 1C9SA 5EMLB 2MCMA 3Q8FA 3D3VE 3BIAX 1FIGL 2OMTB 1MHHA 2PWDA 5ICZB 3FO1A 4D0DB 5DJ8A 1ZA6B 4GP8B 3QEGL 2AXJA 4ZOXA 5H37A 4B5EA 2DLHA 3D9AH 1JE6A 1HC1A 2AJSH 5J12B 3DGGB 4XCYA 1L9TA 2BCMA 4NLHA 1MI5A 4NNXA 4EZLA 5JDJA 3BE1L 3H9SA 1MCBA 3GMRA 1TO5A 2X2IA 2GAZB 1YPZF 3R0MA 5D1QD 3NH7H 4OIIH 2IDTA 1TYQC 3ABMB 1EAPA 1PY0A 1RJCA 1C16B 1JDDA 1GY1A 4G7VL 1PY4A 2ORBH 1SY6L 1CR9L 1VENA 2Z31C 4L3GD 4XVUD 1X5MA 1OT4A 5C0FB 5LHDA 4AUYA 1T1WB 4N5UA 2DWEB 3MV9D 1F90L 5EZJA 2AAAA 1PAZA 1GOFA 1ROWA 4Z78A 4UQ2B 4JPWL 4XVUC 2AV1B 4YSOA 3MA9L 4X7DC 5ERWB 3HI6L 4RISL 5TF1H 2DQGL 2FWUA 3MMEA 4HV8A 2QBWA 4PJXE 3V4PL 4XAKD 1DANT 3RZCD 1O7DE 3INUL 4FFZA 5DMKB 4JJOA 4UTAH 2L7EA 1KBWA 3PNRB 5L88H 1SEQL 4I77L 1U8OA 4URKA 3WS6C 2HAZA 2X6BA 4XI5D 2BVPA 3CCHB 2R0LL 3O0RH 4M93C 2GTWA 3CZLA 4JKMA 3QUYB 4BH7A 3GSVB 2NXZD 3QSKB 5I1HH 3FONA 5AYUH 4QEGA 3CJJA 2WTRA 5E8DH 1T0OA 2L3BA 4QYOB 5JPMC 1SFDA 1AG6A 1S5HB 3UVMA 3GJEA 2IFGA 3UKRC 5E5LA 5IEKA 1MCSA 4MD0B 3DI3B 3HUJF 4DFHA 4YX2H 5BRZD 5SX4H 4XOEA 4JAMB 1C8QA 3TEWA 3FN3A 4ZYKB 4ZX6A 4NZTL 4LCCB 3DVNB 2JCWA 2Y1VA 1X7TA 5D5MB 1RJZA 1WBYA 2D3VA 2WWMC 3HVNA 5T1KA 1IC7H 5BVJB 1AZBA 2WYTA 5AG9A 3U9PL 1L9NA 1T22A 4LBEA 3ESUF 4YL9A 5JW3H 2VAJA 1E4WH 4RMQA 3REVB 4Z5RB 1J12A 4MDIA 4I79A 4JRXD 5BW7C 2HT2C 2WXOA 3G6JB 4I1RA 4JFSA 1U3HA 2B2XH 3FH5A 1ZANL 3JV5A 1ICTA 3D3VB 4UF7C 4IQHA 4R2GD 4OKVA 1BMWA 1T21A 5C7XL 1OGAE 2GJ6E 2F54E 3UZEA 5IJCC 2QR0B 1TLMA 2PM9A 4MJID 2OCCB 1FO0H 3RKPA 4LRIC 1XIPA 5LN8A 1TVDA 1EGJH 1HHKA 4QGTA 1BZ7A 2P47B 3L3GA 5FUCC 4KMLB 1A3RH 4R97B 3BGFC 1GGBH 1OANA 3DTDA 3T2LA 4AW4A 1UCTA 1S3KH 3UDWC 1IAKB 1N26A 1XDTT 3MRGB 3KJ4C 3FO2B 3MXVL 3QW9A 3T77B 2X4TB 2EIBA 5EU6B 5D7SL 3VFUA 5KVGL 3QUMA 3HZYA 3B3BA 3LZLA 3NSJA 4NSKB 3NK3A 4IGBC 4XAWH 2YRBA 1X7QB 4QR7A 4D8PA 5GGSB 3GREA 1PD0A 4JCWA 3MTRA 3UZEC 3LPPA 2CN2A 1WWAX 4PGJA 2HCZX 1HEHC 2DWEA 5G55A 1KJMB 4GRWF 4PCKA 3WFDH 2F0CA 1KELL 3HPLB 4F37F 1H5BC 4L3AA 2QVFB 4PRNA 2XBZA 5JIPA 1TBGA 3PSCB 2BRQA 4Y4FC 1OAZH 4J2XA 1M6UA 4TOYH 1QFWI 3G04B 4B95C 3WMQA 4DO5A 1NPUA 1Q9OA 2W95A 4NGHL 1EJ6A 4ODUB 3QUZA 1EH9A 3ATAA 2IGFL 3KCPA 4UIKH 3QIWC 4BFGA 4I9XA 4TTDC 2VSCA 3FQNB 3EH2A 2YK1H 3RWGB 1NGPH 3T8XA 3EGXB 4R9HA 1QBML 3KLAB 1J8KA 4XNQA 4FXTA 4Q52A 3NVXA 4FZ8L 3J81g 2BZCA 1TQUA 3ZE2B 1GG2B 4K8RH 3LV3B 1ZT4A 2I60H 2N4IA 1ZCRA 4P4KB 3GRWA 4IBQA 5J06A 3DHJA 5FUCE 4MCZA 1OKEA 4LMQE 4ZUWB 3S4SB 2D0HA 1G7QB 2OXHA 1XKSA 4UQBA 1JI1A 2ZPKL 1TJIL 35C8H 1FVDB 5LG6A 5DLML 4TUKL 3FQ2A 4HSAC 3WS6A 4XX1E 4Z7OE 2Q8AL 2QQQA 4MD4B 1D5RA 2EIEA 4L3CB 3PREA 3C6SA 3NRPA 2Q8AH 2XWTB 3MV9E 3STZA 2AVFA 2WOBA 3LKSA 2YAEA 2X6MA 4MA3A 1FPTH 5E4EC 3B9KC 5F0LB 2C3XA 2X0UA 1R24A 3IMWA 4J3WA 1U8JB 5DEGA 4M1CC 1U8QB 2VXTL 3SDYH 3IXAA 3TCLA 3V8CA 4DKTA 2VLRB 1IGMH 1SJEA 3H6JA 1TPXC 5FYKE 1JCVA 1MWAH 2DS4A 1C5CL 3FCSB 2H6UA 3F58L 4HC1A 4J8QA 4NN6B 3CFCL 4JMXA 2VC2A 2NNAA 3KEDA 3ES6A 4H88H 5JOPE 1N6QH 2NMSA 4M43H 1CFNA 4PS4L 1KBKA 1AQKL 3PVWB 3BD5A 1COBA 5EV7A 2DBJA 1GZPA 1JN6B 3K1KC 4HWBH 4OM1H 5T5FH 2NLJA 2QZQA 3I84A 3VXQB 3FQTA 3VFGL 4BSVB 2G4GA 2CO4A 3PDDA 1L3WA 5I28A 3HHSB 4P2OA 1M7UA 3EYVB 3GI8L 1GS6X 3OKMA 2BPBA 2W5PA 1E8MA 3L2NA 3FC8A 3ABGA 4U6TA 1N6DA 3K3QA 4O3UB 1OCOB 1DQDH 5ILTH 5JR1L 1P5UB 1ZLEA 4JJHA 4CKQA 4N8VG 4KVNL 4OF5A 4CMMB 5EEXA 3SD2A 2W8CA 2BNQB 3CFVA 2QPSA 2YNPA 1KG0A 1TMQA 1NUDA 4QY8B 4BK4A 5BZDB 3LN4A 3LY6A 4MB4A 2CUAA 4B9ZA 1XR8A 4R83A 2P9LC 3QIWD 2K4WA 3L3DA 1ZVNA 5EEZA 1YJDC 4JDVB 4FA6A 2HG5A 5DO2D 1QW8A 1LP9B 3Q6GH 1S3KL 4WUKH 5BUAA 5EFIA 5J12C 3IPBA 4MNQB 3ZZSA 4HWEL 3RUGB 4UBDC 1UZ8B 4BUHA 4L0YA 3LQAL 1LMIA 3VB9A 4FHJA 1GC1C 4JM2B 3MLTA 1PCSA 2D73A 4D0CA 1Q9KB 1A65A 2FO4B 2P42B 5F71A 3O41A 3UACA 3NJNA 1DE4B 5D71H 4Q97A 4RNRB 3SPVB 2B1AL 1SXNA 3IDNB 3S7GA 2WLNA 4WW2C 4XPBH 3EJYD 3BMWA 4ABVA 1S7VB 2DKUA 4L2YA 3AFCA 2V5YA 3KS0H 3NVQA 1BWWA 4CNIB 4XC3H 1BQ5A 4NUMA 3FQ1A 4OCXL 4IJ3C 3ZZ1A 3DPBB 3U9PH 3NJVA 4XRCA 5GSAA 1K8KC 1ULVA 3IDXH 3VA6A 3LJ3A 3MROB 1M71A 4OFPA 1MFVA 1BBJA 3QIBA 2EDFA 3I02B 3LCYA 3PHQA 3RG1C 2NYYD 4APQC 3N1PC 4Z8FL 2ZICA 4K4KA 2IF7A 2VR4A 5HY9A 4HS6A 4ZS6C 3X1BA 4FG0A 4FYSA 2VSKB 3TV8A 4CRPA 1NFIA 3VG0H 4F58L 4JCLA 5B4MC 3ARGC 3QCTH 2J71A 2OSLB 1ORQA 3PDOA 2J88H 4J3UA 1K32A 1UCBH 2OYMA 3O4IA 5DUJA 4ZMWA 1XF2A 1JGVL 4LLMB 1F3JB 4H88L 5EDXA 3REWA 4TVPD 5I8CB 1I8LA 5LWYL 3H9SB 3HBGA 1I3RB 1WS8A 3QWRD 5F7EL 4A37A 4LEXH 1JHTB 3SKMB 5BZZA 5AJAA 1KTRL 4GQPH 3GDCA 1CFSB 1OW0C 4ZOAA 4DP1X 5DSCA 5K59F 2VLRD 4N90D 1AIFA 4KK6C 3L3IA 1CXHA 4Y5YC 5E5UB 2NY7L 5F93C 5HHVL 4GLRI 5CJBA 2BSBA 2GTZA 3TM6A 3TBTA 5JZ7D 2P8LA 4OBRA 5SWSB 1MRDH 3QDGD 5K1JA 4K9EC 2YN5A 5KWYC 1OAXL 4N6RB 4DN4H 2GC7A 3FRUA 5L8KB 1AR2A 2NT0A 5D6CA 4UZUA 5DMKA 5KVFH 4NWTH 1SQ2N 3W15A 5E7FA 4NFBA 2XG4A 4BA0A 4D9RE 1D2PA 5IESL 3NIGF 2C4XA 3UG5A 3SDDB 3VFTB 4Y2OA 3QDHA 3RWJB 3VFOA 3BE1H 1TQBB 1HL4A 3G6AA 5CP3H 1RLWA 2PXYC 5EEVA 4KC3B 2ZOOA 4OM0L 3RHWK 1FNEA 2EE6A 3MA7B 5JHMA 3W0WE 4FP8H 1HSAB 1HKLL 1QFHA 3IE4A 4G82A 5ID0A 2BC4A 1NCUA 2CGZA 1G4MA 1M2VB 3EWEA 4GNKB 2XWCA 1NLBH 3IJCA 2EYTB 1YG9A 4N0RA 4WZ9A 3GSNL 5CEZE 3JV4A 3GHBL 5E9DE 3BWZA 4EUPG 2EINB 4KI5C 4Z3IA 4W9JC 2YPKB 4RAHA 2DJUA 3X1EA 3LDBB 4NP9A 4KZDL 1KCUL 3IDNA 4GOSA 4QXVA 3ASWA 1UOLA 3WXVL 5IQ7H 4KROB 3QUGA 3WIIH 2NY4D 3FU9A 3DXMC 5I5JA 4XC1L 1PEZA 5CM1A 1C9IA 1X7QA 2PP8A 3NIFF 4CU8A 1AXTH 3DUUB 4JRXE 4IRJB 1JRHI 1WEJH 3FPXA 4KOCA 3T8MA 4F3FB 4XN1A 3QIUC 4J6RH 5DUPH 3VYPA 5JDSA 2R1XA 1TVHA 3HPLA 4KI1A 3A4DA 4OR1A 1R3JA 4NM4L 4V11A 5AB2A 1VADB 3D69A 3D8MA 2ENSA 2CALA 3MJGX 4YDIL 1GIGL 3RWIB 3V7AE 2Q7YA 1NUGA 1MWAA 3HTLX 4ODXB 1SN0A 3IKCA 3TIDB 1Y07A 2FJUB 4AN1A 1A21A 5JTWA 2WYZA 4G5ZL 1HXYA 4I1NB 4KXZH 5AVQB 3D05A 4FFVC 1XF1A 5D96B 3WXWH 1LNUB 2BZ7A 1CXIA 4MA8H 4KTDL 1BFOA 4KGLA 4BCYA 2XU9A 2IC2A 2WQRA 2FZ3B 3CZFA 3P0YH 4LHUG 4KZ0A 3V7DB 2E74C 2P8MB 1H8SA 4WO4A 3FQXA 4YDJB 2AJXL 3TFBA 4RE6A 5EMJB 1VFAB