The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
105
|
sequence length |
407
|
structure length |
407
|
Chain Sequence |
GTEIVKFSIHPYKGTVIRLGEEILPFKVLEMDKNIALVEMAIPVYKDEKEIELKLSSPGFQNSSYRIRKPEELNEKLIALDKEGITHRFISRFKTGFQPKSVRFIDNTRLAIPLLEDEGMDVLDINSGQTVRLSPPEKYKKKLGFVETISIPEHNELWVSQMQANAVHVFDLKTLAYKATVDLTGKWSKILLYDPIRDLVYCSNWISEDISVIDRKTKLEIRKTDKIGLPRGLLLSKDGKELYIAQFSASNQESGGGRLGIYSMDKEKLIDTIGPPGNKRHIVSGNTENKIYVSDMCCSKIEVYDLKEKKVQKSIPVFDKPNTIALSPDGKYLYVSCRGPNHPTEGYLKKGLVLGKVYVIDTTTDTVKEFWEAGNQPTGLDVSPDNRYLVISDFLDHQIRVYRRDGF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
protein Lp49
|
publication title |
The leptospiral antigen Lp49 is a two-domain protein with putative protein binding function
pubmed doi rcsb |
source organism |
Leptospira interrogans
|
molecule tags |
Unknown function
|
total genus |
105
|
structure length |
407
|
sequence length |
407
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2008-01-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10282 | Lactonase | Lactonase, 7-bladed beta-propeller |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Mainly Beta | 7 Propeller | Methylamine Dehydrogenase; Chain H | YVTN repeat-like/Quinoprotein amine dehydrogenase |