3BWSA

Crystal structure of the leptospiral antigen lp49
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
407
structure length
407
Chain Sequence
GTEIVKFSIHPYKGTVIRLGEEILPFKVLEMDKNIALVEMAIPVYKDEKEIELKLSSPGFQNSSYRIRKPEELNEKLIALDKEGITHRFISRFKTGFQPKSVRFIDNTRLAIPLLEDEGMDVLDINSGQTVRLSPPEKYKKKLGFVETISIPEHNELWVSQMQANAVHVFDLKTLAYKATVDLTGKWSKILLYDPIRDLVYCSNWISEDISVIDRKTKLEIRKTDKIGLPRGLLLSKDGKELYIAQFSASNQESGGGRLGIYSMDKEKLIDTIGPPGNKRHIVSGNTENKIYVSDMCCSKIEVYDLKEKKVQKSIPVFDKPNTIALSPDGKYLYVSCRGPNHPTEGYLKKGLVLGKVYVIDTTTDTVKEFWEAGNQPTGLDVSPDNRYLVISDFLDHQIRVYRRDGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The leptospiral antigen Lp49 is a two-domain protein with putative protein binding function
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Unknown function
molecule keywords protein Lp49
total genus 105
structure length 407
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bwsA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bwsA02
1FWXA 4CY1A 5C2VB 4PSWB 3EI4A 3MXXA 3JZGA 4LG8A 3RN1D 4A11B 2OVRB 4UI9R 4J84A 4GGCA 4MK0B 2H14A 3SN6B 2XL3A 2J55H 3SMRA 5HE1B 4FA1D 4XYIA 4KFMB 3J81g 2P9NC 1QNIA 2IURA 4Y5RD 5TEFA 4YVDA 4TZ4A 3KRWB 4GM9A 5C2WB 2B4EA 3OL2A 5HYNB 5KDOB 3B7FA 3I8EA 3IKOA 3PVWB 4FB1D 3OKYB 4D0KA 5AJAA 4CI2A 2MTAH 3VA6A 4AOWA 2P9KC 4QT8A 4D6VA 1JMZB 3OTTA 4PC0A 4GZ8A 1B9XA 3EI2B 3VGZA 2YNNA 2HKRA 3I2NA 3IIWA 2H9PA 4ZOVA 4CZXA 4GQBB 1JOFA 5CXBA 4PBYA 2P9UC 2HJBA 4JD2C 4Y7RA 3UVNA 4O45A 1VYHC 2HXCA 4PSXB 5K1CC 4CZYA 3E0CA 4L9OA 2OVQB 5IGOA 4JSNC 3SCYA 2OIZA 3EU7A 4PNKB 3VH0A 2AH0A 4O3UB 5EMLB 3V7DB 5GSAA 2H13A 2XL2A 4CZVA 1TBGA 3RSEC 4A0AB 1K32A 4A11A 4CI3A 3MZKA 2H6NA 3K26A 4IA9A 3EI4B 3J80g 4BUJC 3SBRA 3NVXA 1XIPA 2CE8A 2YNOA 4O3TB 3RFHA 3EG6A 2XU7A 5AFU3 1PEVA 2I0RA 4OWRA 3L4MD 3FRXA 4L1QD 3CFVA 4A0BA 1NR0A 1XHMA 3OL2B 1MG2A 2TRCB 3UVOA 2AGWA 2IUVA 3GFCA 2J56H 3SHFA 1MDAH 3MKSB 3FM0A 3A0FA 3UVMA 3JAMg 4ZOXA 4GGDA 4J82A 3ULEC 2CN2A 2YBAA 2QC5A 2P9SC 5B4WA 5AMSA 4J78A 3DSMA 3EMHA 4QL1A 3PE7A 3SLED 3AL9A 3CIKB 3W15A 4Z8LA 1N6DA 5IJ7E 5GXHA 5I5IA 3MZLA 3DXMC 4JSPC 4E54A 1N6EA 1RI6A 5FKRA 5IJ8E 4JT5C 2P9LC 2BBKH 5FXYA 2H9NA 3EI1B 3GREA 2H6KA 3PXSD 5TF2A 2GC7A 5TEEA 2IUPA 2G9AA 2OK6A 4XEIC 2IWKA 1ERJA 4O1QD 2CN3A 2AQ5A 2I0TA 3ZWLB 2QXVA 2CNXA 5H17A 1TYQC 4JSXC 4ERZA 4A09A 5IT9g 1S4UX 3I7PA 4ZOYA 4NSXA 1N6FA 2P9PC 2J57G 4AEZA 2H9LA 2I0SA 3C75H 3IJCA 3I7LA 3OKYA 3JRPA 4U7AA 5CXCB 3AH8B 1PBYB 3MKQA 4ES0A 2Z2OA 3IJ1A 4X60B 5SXMA 3JROA 2HYEA 1R5MA 1U2VC 3F3FA 3UKRC 2YNPA 2CO0C 1SQ9A 2OVPB 4XYHA 1A0RB 3I7OA 2HJ4A 5CXBB 1GOTB 5TDHB 1SHYB 4GQ2P 1PI6A 3OKWA 5JWZA 3K27A 3EI2A 5FLXg 2AH1A 5HQGA 3SVWD 5C9ZB 2XYIA 2B5MA 4CC9A 1JJUB 4BL0A 3C99A 1SQJA 4A0AA 4L3HD 3L4OD 2UZYB 5H14A 4ESGA 5FKTA 4E5ZA 4A08A 3UR4A 3I89A 1YFQA 3NVNA 4X63B 2IWFA 1U4CA 2I3SA 2YB8B 4FA5D 2CE9A 1P22A 4A2MA 4E5ZB 3RN0D 3I8CA 2Z2NA 4ZN4A 3PXTD 3SJLD 2PBIB 4N14A 2IUQA 3NVQA 4FA4D 4PBZA 2O9KA 3ORVD 3V9FA 1GG2B 4J0XA 3I7KA 3DWLC 4JT6C 3PSLA 4ERYA 3BWSA 3JZHA 3DXKC 5FA5B 1NEXB 3BG0A 3RRMC 2H68A 1XKSA 5GMKn 4IMMA 1JMXB 3SBQA 3CFSB 2AGLA 3C5MA 4H5IA 1OLZA 5HE2B 4J73A 2W18A 3MMYA 5FQDA 4GGAA 4FAND 4A08B 3SFZA 3SWSD 5K19A 4J79A 3EI3A 4J86A 4CI8A 5H1MA 5CXCA 3EWEA 3C9CA 3U4YA 4A7JA 3KRXB 3AFCA 3PVUB 1L0QA 5IGQA 4PXWA 4LG9A 5EM2A 3I7HA 5GXIA 2AGYA 4GQ1A 4A09B 2B5NA 4HDJA 4A0BB 3RLMD 3PSCB 4GMBA 3HFQA 4A2LA 3FGBA 3SBPA 4QQEA 3OKTA 2PM6B 2H9MA 3N0DA 3EI1A 2HESX 4BH6A 5EM2B 3N0EA 1MG3A 4CY3A 2OJYA 2PM9B 3F3PA 4J8BA 2UZXB 5HE0B 4CY2A 4R7AB 2YMUA 2GNQA 2I3TA 5EMJB 5A2Qg 1Q47A 2H3XA 2AGZA 1PGUA 5FKQA 2H6QA 3RMZD 4X3EA 4H5JA 2AGXA 2GC4A 2Z2PA 2H47A 5HE3B 4ZOZA 3JB9L 4J87A 4JXMA 4EWRA 5EAMA 4G56B 4CY5A 5EMMB 3UKUC 5I5MA 3IIYA 2Q7QA 5I5JA 4ERQA 3V5WB 2BCJB 3IJ0A 4OZUA 5THAA 2EBSA 2IAAA 1GXRA 4CI1A 4J81A 4E54B 4J77A 3I7NA 3OW8A 1B9YA 3F3GA 5EMKB 4J0WA 2B5LA 5EARA 3AL8A 4FWWA 5CYKB 4JSVC 1K8KC 3EI3B 3AL8B 5CYKA 4GM3A 3SXTD 4GM8A 5EAPA 3UVKA 1OMWB 2PM7B 4FA9D 4X61B 2PM9A 3BG1A 4I79A 2CO0A 3ODTA 5FKSA 2HKMA 4K3ID 2OK4A 4K3JB 3JPXA 5EALA 3JZNA 3UVLA 4FAVD 3PXWD 4LGNA 4FHLA 4L3GD 3DM0A 4QRJA 2G99A 4O9DA 3RFGA 4J8GA 2P9IC 3P4FA 4U1EI 5IC7A 1GP2B
chains in the Genus database with same CATH superfamily
4MQXC 4CY1A 3T8VA 4FZEH 3VXTB 4GW5B 2VXQA 1MJJB 3MRBB 1AGBB 3BX7C 3ZYZA 2I5YH 3WFCH 1CS6A 1G7MA 1IQDB 1KFAH 3WNKA 2BNRD 2DEXX 2MOQA 2BIQA 1BMZA 1I1FB 2ZP0T 5DUBB 3T6XA 5DUMH 4J84A 4L9LB 4Y7OC 1YNTB 4ELMF 2HFFA 5G55A 5E08H 4E9VA 1TYJA 4QHKI 4ZMTA 2WYIA 3GTTA 4DKAA 2BVQB 3DMMC 2GIMA 4FMFA 1RHFA 1TYRA 2DQFB 3AQDA 3HG4A 4XBMA 4ZQKB 1CDJA 2R0WL 2AV1A 3BJ91 5C7XH 4XYIA 2Y25A 3RBGA 4Y5RD 4GRMA 1MJ7L 4KZCA 4P59L 1TO4A 3QNXA 5IT2H 5FKPA 4KJQD 4S1DD 5KVEH 2OMZB 1RH8A 3S0PA 2OMBA 3M8OH 1LEGA 1FZOB 1I1FA 1W91A 3PWUB 5E6IC 3M46A 2GEEA 3SDYL 3KWUA 1CE6A 5EEZA 2XXMB 2NQ3A 5C0CA 3LZLA 2VT0A 5K1NA 5LNGA 5E2UL 3K6DA 3O41A 2BWDA 4XNUH 1JHTA 4R7NA 5T33L 5I1IH 5AAWC 4GEIA 1ZSDA 4FX5A 5KVFL 5EBWB 2HMIC 5EOCJ 5BO0D 3W39A 2DQIH 2VR4A 2TSAA 4WQOA 1QOKA 4JNXA 1W0VA 2KI6A 2W0LA 1KBKA 4WENB 2I32A 3QA3A 3MUUA 3KPTA 3NCYS 4Y2OA 3OKKA 3WTUA 2BOCB 4UQ3A 2CBPA 5IG7B 2QPSA 3ESMA 3FUIA 3KVPA 1BQKA 3VH8A 2OJZH 1Y0LB 1F11A 3BP6B 1CD1A 1RERA 3BPOC 1J12A 2AVFA 4WWKD 1ZHLA 4J3OF 5F0JB 2Z31B 4ZX5A 3U4BH 1DN0A 4BIKA 4NQVA 2HLFC 2O5ZL 1O9WA 3QC6X 4PV8B 2BX5A 4HOMA 2X1OA 2CUHA 1EJ8A 2X44D 2W9EH 4PRIB 4PTTB 4YZFE 5ISZA 3VXOA 5CCHE 2L7EA 4XPBH 1MVYA 3UO1H 4L3FA 4BQBA 4XVJH 3WAKA 1EAPA 3D4CA 5T3ZL 1UGKA 1VKXA 4RE6A 3H9SE 2G3XA 3SBRA 2NY4C 3O0LA 2X40A 4NQTA 4O2FB 4XP9L 1ZSDB 5D6CB 1FZKB 3KJ6L 2YXWA 1BHGA 3O41B 43C9B 4HWBA 1FNEA 2DS4A 5F9WC 5DR5H 1OGAB 1NANI 4OWRA 1QFHA 1SNRA 3DHJA 3F7LA 4PUBL 5DTFA 3FRXA 3OKLB 5JW4M 3X14A 1AO7E 3V8OA 1H3UA 2ZX7A 4N9GB 4LPUA 2WO3B 5FS5A 2VDOL 1E4XI 1PF3A 2XKSA 4GXVH 1FHNA 2WMPA 4XH2B 4K8RH 5E6ID 1U8IA 2CK0L 2VXUH 4FQPA 5DRZA 4YJZL 2J56H 1QSZA 4FF9A 5LXGH 4CVZA 3VGBA 4KX7A 2DYSB 4MA8L 3UVMA 4KROB 3HG0A 5DYOB 3CSYA 5D2LA 5FYKD 4QRQB 1H2XA 2CIIB 3B56A 3V0WH 3MV01 1Z5LB 4NKOB 1RK7A 1NFDF 2OMYA 4X6BB 4TQPA 5AMSA 2YGVA 4YWGH 3WV0A 4I77H 3VRLF 2FATH 2PPDA 4Q14A 3BI9X 4QL1A 3WUWB 1A7RH 1LVEA 5B1KA 1VJSA 3EYVB 1CICD 1N19A 1QUPA 1U58A 3H9HB 4NIKB 4UQ2A 3DX2A 4GKZB 4TVPL 3UJIL 4NUJA 4I2XB 4LBEA 5HP5A 1R9FA 2FH6A 1EVUA 4H8UA 2F9BT 5IQOA 1DQIA 3MGAA 4Z7NA 1R75A 4RH4A 4YHMH 1JXDA 3PXSD 2YO3A 2H1PH 4I0PD 2N4IA 1DVFC 2HU8A 1BQ5A 3U4EB 2R27A 4GUPA 4RFNC 3GMMB 2E9JA 2APVA 2I07B 2CCVA 5KN5B 2C9RA 1LO5A 3GMLB 1H8NA 1PL3A 1C16A 1L6PA 5DGRA 1PD1A 1T21B 3UO1L 1HXYA 1PG7W 2HMID 5E5RB 3X1GA 1A9EA 3CVHA 2UY7A 4XNXH 4F37K 2XN0A 3A5VA 4ZSOA 2NR6A 1I75A 2H0JA 4P23B 3KPMA 5GJSH 4W4OA 2WP3O 4KKNA 2Q2EB 1MFEH 2VTFA 2ZCHL 1N59A 4F7TA 4C83B 1AANA 2ZX8A 4FABH 1U58B 1KSRA 1NMBH 1FL6A 1AGCA 4G2AA 5CJOL 2QVIA 4JG1L 1NBCA 2J8HA 4UM9D 5C6TH 4R0LB 3EHBB 2OMYB 1B9KA 1HKFA 1S6NA 3RL2B 4FXKA 5I1DB 1IGYB 1AYRA 4NHUB 2WLLB 2BVYA 2OP4L 3EXLA 2B15A 1FQ9C 4KKBD 1V3JA 3S48A 1QHOA 3ARRA 4RRPA 3ZSSA 1KYUA 1JGDA 3SYPA 3DXAA 2A0LD 4AE1A 1T3FA 1QLEH 2VLME 5GGSB 4IYKA 5F9JB 1GJUA 3OKLA 3F12A 2X1WL 1TQCC 2VXVH 4OJDH 4ABQA 2RH0A 1RZIB 3LVEA 3JUZA 4X0NA 5T3ZE 3EGSB 4X6FB 5E2TH 3RWFB 4NQXA 5CJOH 5T3XE 1AI1H 1S7TB 4MQXD 4W6XB 3WN6A 1ZIAA 3P0GB 4KY2A 3D51A 4NO0D 4XMVA 1YEFH 1MCPL 4K23L 1T7YA 4YDVA 5ICUA 5G4MA 3LRMA 3VSTA 5BUAA 2AC0A 4AX4A 3QZPA 4LLAA 3TBTB 2R2CA 4DZBA 4UQBA 2WLHA 4ADJA 5EO0B 5EH1A 1N70A 2X7LA 4L0ZA 4PJGF 3CC5A 1E5AA 4GH7B 4R7VA 2FB4H 2R4RH 1G7QB 3H3KA 4E36A 3HMWH 4E5ZA 2C4FT 5ALCL 1II4E 3U30C 2V7NA 4X63B 3DMMD 1ZWIB 3GWJA 1JZFA 2FQFA 1F6LL 4MLSA 1U4CA 2F19L 3OZ9H 4NAAA 2A73B 3SKOA 2VDRB 4H0HB 2VXVL 2XETA 4P5MA 1LP9F 4UZGA 1J8KA 3UAJC 2FHBA 5GGVY 1JWSA 3O3EA 5BW7A 1E8XA 1SUHA 1IE5A 5BUPA 3TN0A 3CZKA 4LLQA 3DJRA 1QRNE 3I2CH 1BIHA 3BAYA 3OQRA 3KYMA 4MCZB 3GMPB 1Q1JL 4J6RH 2DQDL 4PLJC 3ORVD 1ERNA 5D1XD 5J1TC 1YR2A 4QRRE 3KDPB 2A83B 2X3BA 2NYZA 1DJIA 3CN0A 4QKTA 4V2BA 4BDVB 5TDOB 2EE6A 3MLSH 4ETQB 5ICXA 1LO0L 1B4TA 1YYMH 1A7PH 1N4XL 5TPWH 3A47A 2FEEL 2OQJB 4O51B 3KWXA 2KUTA 2PUQT 3U7YL 1QABA 1EXHA 3I9PA 3CFSB 4DP7X 2YMTA 3UCQA 1RUMH 3C5MA 3KPQA 1WFNA 4MD4B 2VDRA 4LRNL 4IDJL 4L4VA 1YPZF 1ZGLB 3Q6GH 1U6AL 1KZYA 2OSYA 4AYEC 4JO8A 5HVWA 1AE6H 2HVKA 4M7KL 1MWAH 5F1NB 1A1NB 1FLTX 4U05A 5DSCA 3UBFA 2ETWA 4QRPB 4AQAB 1NC4B 3T1FA 2Y3NA 1CTMA 3KCWA 4QF1A 1OY3B 4HUWB 2J5LC 5DZ9A 3AAZA 3HI1A 4IS6B 1IKNA 1QASA 2VDQB 5ICXB 4EQ2A 1L0QA 4QRSB 4ONHA 4TMPA 5LG1A 1UXSA 4LHUD 2AP2A 4UT9H 3NJFA 4E9LA 4WW2A 1AFVH 3UP1A 1C5DA 5F97E 2CLVA 4IEFA 1SFDA 4JFDE 3VDBA 4NQUA 3ZJAA 3AG1B 3B9DA 1ZSHA 1BVKA 2DQIL 1H3GA 2EEFA 1GSKA 2GHZA 2MWCA 3GKZA 2Y1AA 2A9MH 3RLMD 4N2HA 4F15B 5GS2D 4RRPM 4A6YH 2EVJA 2CA3A 1XL6A 2MIZA 4BSWB 3FT9A 2XDHA 4OJFH 1CB4A 1QUNA 1DE4A 1QNZH 5EU3B 3T04D 4J3OC 4TOYH 3F64A 4JFFD 1SXAA 3BUPA 2ZSVA 3H2WA 1X5XA 3LXAA 5KAQG 2FHFA 1OE2A 4JY4A 3FU0A 3WGVB 2ED6A 3VXMA 3K2UH 1IU1A 4XCNB 5TDNA 3TZVD 1DQLH 3BVTA 3MYZA 4EKJA 3MRJB 1AC6A 1BAWA 4RX4D 3TA3A 4FHJA 4JRXB 2DQJH 3JQOB 3AXLA 4XPBL 5KSBE 2VISA 5GJTL 1IEAB 4AENA 5B39A 4HUMB 2JCCF 2GNQA 5A2Qg 4WW1A 2W65A 2ZXEB 1EDHA 1DVTA 1Q47A 3FT4B 4J3OH 2OZ4H 3GBDA 4AT6A 3K6SB 5DJDB 3MODL 5GSRB 2D7OA 1KCUL 3OF7A 3K6OA 1E6JH 1Z0MA 4URKA 2DZEA 1O6GA 4WDIB 3T4AC 4B41A 3BAXA 4M1CC 1U36A 4PJIE 3BH9B 4U0RB 4MDJA 3SPHA 1KGCD 1WWCA 1N8ZB 2OXGB 3RVXC 3LQZB 2VDPA 4TUOB 5D96B 4QHUA 2YZ1A 2WNGA 4JQIL 4HP5A 3S4SB 2WVSA 3AFLA 4PN6A 1CI3M 3P9MB 2YBRB 4FCHA 3QJQB 4UV4L 1J1XL 3CLEL 3K3QA 4M7ZB 4OCYL 4IGBA 5J6HA 1QHQA 1DBAL 3OSVA 4XBPA 4DEUA 5BS0E 4EMZA 5E2VL 3O4GA 1IC5H 4HOZA 3QEHB 3MJ7B 4Y1TA 4P05A 1RZ8B 4I85A 5L8JB 4HUKB 4WV1C 2EE0A 2O6CA 2V3EA 4M6ML 4PJ7A 4QRPA 4XXCC 3RKPA 3TT3L 1RK1A 3QG6B 5D7LB 3U1SL 4A6YL 2MOVA 3IRPX 3N85H 3RIKA 4JRWA 2DEYX 1NIAA 4RZKA 2RQEA 2TRYA 2VZVA 3BG1A 3TN0D 3WE6A 3D0AA 2CDFB 1G5AA 4FOMA 1R34A 5DR5L 1SN2A 4IHOB 2W0KA 5J1SC 2OK4A 5JZ7C 1BPLB 4UB0H 4Y9GA 1GTNA 3Q01A 4WY7L 5MI0B 2ZD0A 2Y7SA 4YHML 3BCFA 3ZE1B 5E8OA 1RUQL 4QRFA 5FWRA 5KVGE 3K1KC 3MJ8A 4J23A 4H8WH 4XNYH 3HG1B 5HHOA 3HC0A 4EDWH 1T5WA 3S3DB 4GXUM 5GZND 3Q05A 3HUJB 3UERA 2RB8A 2P5WA 2E7LA 5E99H 1A9BA 2EYTB 2Z0UA 2PLTA 5AAWA 1IGIH 4H1LH 4KO9A 1OP3H 2FECL 3LX9A 5CF3A 3FC8A 3NRQA 4Y4KC 3K6IA 4FQQA 4NQCE 4TULL 1SM3H 3EUDA 4LOVA 1OL0A 2NQDA 4PJXA 1YJDL 1JZ2A 4W4OC 3FQNA 1TTAA 3WSQH 3JZGA 1QSFD 4F9LA 3EOAA 5CN2A 4HUUB 1CFTA 4KDWA 5HXMA 3PWLB 2D7TH 5I71C 1BFVL 2O6EA 1X9QA 3VWJA 1KJ3H 5IW6A 3S36X 3IDYB 3LRSB 1KV3A 2X41A 2EDKA 1Z9MA 1OO2A 4F5CE 1HJCA 2Q6WA 2GYSA 3BP4B 1HE8A 5I66A 1KN4L 1JPST 1PCSA 4FXKC 4C8XA 4ODWA 4YLQT 3ES6A 5JW3L 2ILLA 3LKRB 3FT2A 3UYRL 2BW4A 3DYOA 1RCYA 3RVWD 4L5FL 4A2DA 1UD2A 1PZCA 5E6IB 2IURA 3KHQA 4PJ9D 1TZGL 3U0PA 4BWWA 4YVDA 4LLUA 1OAKH 2N7SA 4KKAC 4U1HA 3DSFL 1IGIL 2UZYA 3BKJL 1KTDB 3WY2A 4EI0A 3MNWB 4P4KB 1ZVYA 3FUNA 5JHLH 3I8EA 1FCCA 3UZQA 3ASOB 3QS3A 2BS8A 3RVUD 5CJ5A 4FB1D 1A5FL 4WEBH 3D7PA 1HX0A 2TSBA 2X2UA 1J0ZA 3U1SH 4F7KA 4ODSH 4Z0XB 1UWFA 2H2PD 3TPUA 3CH1B 2VC2A 1GW6A 3KGSA 1IAOB 1B0GA 4DOHE 2WSDA 4JX0A 4P23C 2VAAB 1TQVA 1USQA 4I88A 4GMTL 2GI7A 3NCJL 4O4YH 1B9XA 3ZMRA 2VW6A 1T22A 2QELA 1G9NL 3APNA 3I2NA 5FA3B 3IULA 3NTCH 1E30A 2ZXQA 2A6DA 3CFNA 2B1HH 3K5SA 1FI8C 3PL6A 4BWTA 1IBGH 1KTDA 4KQ3L 4NN5B 5DHVA 3ZZLA 4I3GA 1KXVC 5IGXL 3U0PB 4O45A 4BEIA 1HHIB 5T5FA 3UJTH 2DLFL 4TSAL 4EUPG 1J87A 3AG2B 2WYTA 2EEBA 4EI5D 2E7LC 5AVTB 1PIGA 2BOBA 4Z3GA 4Z7AA 4LDEB 5A16B 1RMFL 1EEZB 5JYMA 3LRSA 2AHIA 4ZMWA 2HUEA 4X4XB 4Y2OB 4MKMA 1OGTA 3EHBC 1UVQA 4AV0A 4A11A 4LLWB 1YYLH 1DJGA 4ZMLA 4MDIA 5D4JA 3GTNA 2EIDA 1FJ1B 1EIBA 2BC4A 3SJVA 3W81A 4MQ7B 5AOLA 3HBPA 1MJJA 4FMKA 2BOLA 2I60H 1AHMA 4ZNEA 2QLYA 1WHPA 3L3OC 5BQDA 1NCOA 3LHAA 4BFIA 5KS9A 4RWYH 1CGSH 2F58L 4DQOH 3KS0H 4E41D 3LPWA 2AAAA 5GISH 1FF5A 1JHLH 1JXJA 1CE6B 2QFPA 3MKKA 4XO3A 1L9PA 2BHZA 1ILSA 2Y1VA 3CMOL 1KCBA 3D85D 3H6AA 2IXQA 5IFJB 1QSFB 2VCOA 4QOKD 1P2CB 4XO4A 2FLBT 1NC2D 4JRYD 2XNAA 3FSVA 5I8EB 3GFCA 2AV1B 1C5CH 5CCJA 4MQ7A 1QVOB 4WUKL 4PJBF 3QPQC 3SDDB 3MRGB 1U2CA 4GG6F 2OX5B 2EYRA 3FS9A 2X4NA 3RZCA 4WKXA 1OIOA 1U8OA 4IRJC 4K4KA 5IB3A 3IE9A 1EBAA 4JUTA 1TUPA 2VUYA 3FUDA 3IGAB 4F93B 1L5GB 1JNHA 3VO0A 2VDNH 3DSMA 1NPUA 1FNSL 5FEBA 5E9DD 3QXDA 3FT1A 4FQJH 4ELDA 5AVRB 1D5IH 3MZLA 1GYWA 4XWOD 3DXMC 2CGYA 3BESR 3QJZA 3X1FA 1HEZA 5IBTH 1WAPA 2IIJA 4ZAKC 3U0WH 5C8JB 4Y9BA 1ZT7A 3UTSA 2X88A 1RIVH 1EDYA 1KCVH 3LEYH 2Y5QA 3IJ7A 2O5YH 4Q8BA 4JQIA 2G2PA 1CR9L 2GFBA 1TNNA 4G6AD 4K3EH 4LNRB 3ZRFC 1AY1H 1LK3L 5TE7H 3ZE2B 1KXTB 1N18A 4DNLA 1JRHH 2VMDA 5DDHA 5IVXA 1QFSA 3TVMC 1N6UA 3U4BL 2VDNA 2OFQA 4H5SB 1HSBA 4A2HA 3EJZC 3TWCH 5J13B 43C9A 4B6ZA 3FMGH 3L4ZA 5CKGA 4AYFA 1S4UX 4BE6A 1WD9A 5EF2A 3TCTA 2LFGA 1MEXL 1AC0A 1VADA 4KH2A 4QOKE 1HYSC 3D12B 1SDDB 5ALBH 2I0SA 5H35B 5IHUH 3WELA 1AO7A 4LPWA 2JNZA 4NERA 5E6ZA 3VCLB 4XAWH 4ZOBA 2J1XA 4MRCA 2EXSA 4BH7B 4HKZA 3KPSA 5AKVA 4XOCA 4WK4B 2ICWI 2OR7A 4QRUB 3VVVA 1PZ5B 3F3FA 3UKRC 1T2JA 2VXTL 1VADB 4J8QA 2L4OA 4PLJD 2JI2A 1E5BA 2Z31A 2JV6A 5EN2A 1HI6A 3NZ8A 5JIHA 3U7WH 4NC4A 1JV5B 2FLMA 1B3JA 2Q76A 3C6LC 4LPTA 1F11B 1GA2A 2VGLM 3BP6A 5IIEA 1BQHB 4NRXA 4HPOH 4LARL 4D3CH 3HHMA 4KUCF 1TTFA 3T4AA 2DJ4A 4K2UL 1X9UA 2ZOKB 2KERA 1QLFA 4YN3A 5C07B 5FGCE 1HVXA 4YSEA 1E4KA 3E9TA 5CMAA 2OS7A 3I9IA 1JPTH 1YJDC 1IKOP 5FLXg 4LK4A 3UTSB 4QJ4B 4JG9A 4R7NB 1J1XH 2FWLB 2XKNA 1R3JA 4TSBH 4OD1L 4L3EB 1HNGA 2XWTB 2B5MA 1XMWA 4P06A 4AJYV 5CHNB 1DVUA 3IU3B 3ZHDA 2PWFA 1U93A 4U6XA 1RIVL 4Q56A 4EN3B 4H8WC 3QO0B 3C99A 1VFAA 4G7SB 3CVHH 5GGUA 3F7PC 1ZLUK 3KYOA 4FQXB 1JXFA 1A4AA 3LQAL 5HDOA 2AJXH 2VN3A 5HPOA 1NBZA 1UA6H 1E6JL 5KUKA 5D2LB 2KL6A 5DVNA 3MRRB 1SY6H 5C0BA 2AQTA 1GZQA 2PXYD 1JNLH 3D85B 1FVCA 4N2CA 4GEJA 4ILDA 1HHGA 1U8IB 4OZGA 3A67L 5CEZL 3JV0A 1OP5H 3GMQA 2NY5L 3VRLE 4N9GA 1BBDL 2IJ0C 2FGWH 2WQWA 2VH5L 3LRGA 1UUSA 3QHTC 5G5DA 5CHNA 4YE0A 4K5NA 1XCWA 5K93A 2IDFA 1WVZA 4L3EA 2MKWA 1NMBL 2ORBL 2I26N 2Q8AL 2LR4A 2ZICA 3PSLA 1J5HA 4G6KH 1M05A 4PGEB 4DT2A 1D7BA 2R9HC 2CXKA 4M6MH 2HJLB 3F04A 1S78C 1OCCB 4JN2A 5C08D 4PJEF 3L3JB 1QTYT 2VLJB 3MMEA 2H68A 5DA0B 3L3IA 5KG9B 3VRIB 1RLWA 1YECL 3EQ7A 3O3EB 4AKPA 5HHME 1NAMH 3G5YA 1HYSD 3D07A 5C0RL 5BJTB 1AMXA 4N8PA 1AXTH 4J73A 3IRZA 4PTUA 4LCCA 3WU1A 3JT2A 3LHPL 3IDXH 4DOHB 2P8MB 1NGZA 3S35L 2WANA 2CJSA 4N8VA 3UBXB 2EXYD 2QSTA 4LHUA 5DJ2A 3GRWL 4M62H 4ZTEA 3ZN6A 4LIQE 4FE9A 5EORH 4UT7L 2EAEA 4HS3A 1YAIA 2J6EH 2HRGA 3LB6C 1OE1A 3LMJH 1KJ2H 1T4WA 3FRPG 2YSTA 4AJWA 3FO1B 2HH0L 2KLRA 2V8MA 1NCBH 3ATBA 3EO0A 3AY2A 1ZIBA 1SUJA 4X9FA 3D0VA 3ARGD 2OSLB 4ZFQA 1JZGA 3KCPA 2IALB 3MLZL 5CGBA 3GJFH 4OBRA 4XBEH 3A6BH 4G8GB 3PU7A 4BHUI 1YYML 2DQTH 4ZD3L 2EUZA 3WTXA 2JCCB 4AQEB 3W0WD 5JPMA 1MDTA 1TZHA 3PSCB 3CDYA 4IRZL 3IJ9A 3KPSE 3US0A 4XR8C 4G8FA 2EIJB 1JGDB 1DJYA 4NCDA 2WXHA 4YSUA 1DANU 3KBFA 2IALA 4M5SA 3O11B 4J27A 4KVCL 1J0IA 2ZAIA 4F8PA 3FFCE 1REIA 4RMSA 4ONHB 4PJHF 1E9QA 4QTHA 4GBXC 2HH0H 1RZGA 1AR1B 4X7DC 5AW1B 3HOGA 2NXZD 5DWUL 3VFRA 4YEFA 1J9SA 1MW1A 1ZJBA 3ILQD 3IDYC 2I3TA 3FCTB 1J05A 1W8EA 3G5VA 4D8PB 3A4EA 1E27A 3RVVD 1Q0YL 3MLSL 1UFUA 3BJLA 1OB1B 2JLPA 4EN2A 4FLRA 5C0BD 4M7JH 1ZLVH 2WNWA 2QSCH 2E27H 4UQEA 4YEEA 1A1MB 1RUKL 5CEZE 5HE3B 4ANXA 4HALA 1AQKL 2J5WA 4Q2ZB 3EHBD 4OZHE 5DO8A 3QC5X 3VU2A 2D03H 5JIMA 1UWEL 5T1LA 4TUUA 1TSRA 3IFNH 1N0LB 1NKGA 3KBHE 1KDJA 4IKIA 4C4BA 1AXSA 1R1CA 1HDMA 4H2CA 5BZWA 4JJ5A 2WLZA 3IN2A 1RMFH 1CVSC 1MWAL 3LDBB 3QWRD 1XXDC 1JYXA 3MX0B 3VXNA 3S97C 2YGOA 3HE6B 3H9SD 1F00I 3MDJA 4NCC1 4XWOC 3K2UL 1G9EA 3EG9B 3MLTA 3EDKA 4XB8A 3A23A 4LFHG 3HG2A 3D39A 3N1GC 4AQ1B 1CU4L 4XBEL 1RK0A 1U9KA 2TRHA 2UX6A 3MLVH 3D25B 4X80H 3V10A 4A6YA 2E8ZA 2LU7A 3BCDA 3PWJA 1WITA 5E51A 3AL8A 4XC3H 2OMTA 4BM7A 1I2MB 1HINL 2XCMC 4BQ6A 3VFRB 3SXTD 4Z76B 1MCOH 1S4IA 1M3JA 2HLAA 1PU0A 3QQDA 4PD4K 5J5EA 2Z8SA 1ZY9A 4I0PA 4HEPG 3WTTA 3H9SA 3QAZB 3DURB 4PJBB 3JPXA 3PPEA 1NQBA 2W95A 4ZNEE 2DWXA 5DZPA 3RZWA 5FFGA 5EDSA 3RUGA 4FHLA 3L5XH 2VZ3A 2ESVA 4HGMA 4WVRA 4QRJA 4RQQB 3IE4A 1K8DB 1KB5B 3PP3H 4PI0A 5FYLL 4ZFOB 1WZ1H 5JPMB 1U3YA 3E1ZA 1E4JA 3BLKA 3BVNB 4LOUD 3DSNA 2DBLL 2R39A 4N22A 1UT2A 2Z92A 1VRSA 2YQGA 4YSOA 5HYEA 1HC1A 1SFHA 3ZHFA 1HZHL 3CNKA 2VMCA 3BISA 3ULSA 3QG7L 1AIFA 3H85A 2JFCA 2J57A 3QIBD 5HDBF 4AQOA 5C7ZA 3LQMA 1QFPA 4U1LB 3GKWL 4KZ0A 5FFOA 1IEAA 1WTGT 4AENB 2G2RA 2FVNA 2YWZA 3ZDXB 1X9RA 1QR1B 2H47C 4FFTA 5C0GB 4YHZL 1TJIL 5A1AA 2CK2A 1YY9D 4XAKE 4DPAX 2NYYD 4RNRA 3WDIA 5HDBE 3U82B 1G87A 5IVZA 1P5VB 5FM5M 5D2NC 2AGJL 4U7MA 1GPOH 1SMAA 2AQNA 4RLDA 3QYNA 4HPOL 4JDZB 4LARH 4LT7A 4GM9A 4OLWH 1HQRA 1FVEA 4LSQL 4Y16B 5KDOB 4RE5A 4FFZH 1LJMA 5DURB 3H54A 4U1LA 5E8PB 3OKYB 3T77B 1DCLA 1ZGLP 1TMCB 5ABDE 4BSVB 2VLLA 5T1KB 3BSZL 2X6UA 5GRWA 4B0MM 4HU2A 4DKFH 5E6UA 4HLZG 4PRDB 4NP4L 4MB4A 1SLWA 2VDLA 1L9NA 3IPBA 5D8JL 5F9AC 2XOTA 4HFUH 4LB8A 4OZHF 5CLWA 3VGZA 1SHMA 2HKRA 5I5RA 1ND0A 2YAHA 2Y36H 4HG4K 4E9TA 2IADA 3CFMA 4X4YB 2IFFL 1FNAA 1I9IH 4KJQC 3UH8A 1NGQH 2VXTH 5IB5A 1QATA 1K72A 3CFEB 3DVGA 3NAAH 2ZSWA 4AUYA 5GZOD 5I28A 3NIDA 4PSXB 4DESA 4PJXE 3UG3A 3H3BC 4H2AA 2N01B 2RFXB 3L9RB 2X05A 1BMGA 2FTAA 1HXMA 2YQBA 1TENA 4M3JA 3RKDD 3TYGH 5L8KB 5HHQB 4FADA 1K5WA 4JFED 2BNUB 4XE5B 4YDIH 5EO1B 1T5XB 2GAZA 3QIBC 4GAGL 4M7LL 4KXCA 4OF3A 4WO4B 2QR5A 5E6SA 4GUCA 3D4GA 1A6TA 5EC1A 1DBMH 2FECI 1Q38A 1QPPA 3O2DH 4B9ZA 4MS6A 3BZDA 5LGJB 1YJDH 1P1ZA 4Y5YB 1D5BB 4N0RA 1QWUA 3ZKMC 4ZFGH 3BPNB 1TFHA 3DECA 5T1DH 2GTZA 4I18A 5AKTA 3TO4A 5CZKA 4N4YB 3NIGB 3WEXB 4F7CB 1Z9OA 2ZNXA 5AFAA 7CGTA 4HIPA 3U9PH 5IQ9B 5KVEE 1WF5A 3C5JB 4Z3HA 3EO1B 3SPVA 1WFOA 5KZCB 1V8HA 1I9EA 3M88A 3T2NH 4JM2F 1UOLA 2BRQA 3IFPB 5JO5A 1PZBA 4PG9B 4FC3E 4XXWA 4CDGC 3F00A 3NJLA 1KTLB 5AWNL 5A3IC 1YC7A 4XWGH 3QDJA 3T0AA 1GRWA 3RIAK 5JZ7D 4ICXA 4UV7H 1C08A 2KZWA 5FKAB 3RWGA 1I8LC 3VXRD 3X12A 1NBYB 2XZCL 5T5NF 4H1LB 1A9VA 4QRAA 5I15L 2BC4B 1HH9A 2DWYA 3JAMg 3J8F7 3TLRA 4FAAB 4ZPTA 3GSVA 1M1SA 1Z66A 4AE0A 2Z4QB 3LKSB 2D3LA 4P2QB 4X8XA 4J82A 4G8GE 1ONQA 2CNZA 4LSUH 5A2BA 5B4WA 3WJMA 3DPDA 4UU9B 5H8DA 3WJMB 5FHBL 4BCYA 2OAAA 3SLED 4JRXA 3MV9B 1EEZA 2QGBA 3AADB 2OMXA 3DLQR 4Z78B 5GXHA 5I5IA 4HC1A 2H8PB 5FYJE 5DQDL 4E54A 1HH9B 4HK0B 5DMKB 1WBYA 4YHOL 1T7XA 5E6RB 5JHDA 5SX4I 1LEKA 3RWGB 5GZOC 4TLTA 4ANVA 5DFAA 4KZEL 3BHBB 1JHLL 1DFXA 1T66C 5TF2A 4Z3EA 3MLUH 3QP3A 2H32B 3I6LE 2QDVA 4MS8D 3WFBL 3SQRA 3LPGA 1G6RA 4JL2A 2IWKA 4JVPA 4OF5A 4I7ZC 2I0TA 4WHYG 2NY3D 3D9AL 4OIAA 2X6CA 5TE6H 2RHEA 3HI5L 3B6SB 2Q7YA 4P2CG 5I1GL 1H19A 4JSXC 5IK3A 3B4NA 5JPNC 4AVJA 3S35H 4PJ5B 4OSUL 1S7QA 2N0MA 4AEZA 4WZ9A 1CFNB 2NY7L 5C0CB 2BXYA 2MRYA 4G1EB 3VFTB 3Q5YA 4FQHB 3SYOA 2NX5E 4JO3H 1R3KA 3TO4C 4ZO7A 4AUJA 1E3XA 2LLNA 1WS8A 3NOIA 4FLQA 4DP4X 2XYCA 3QFGA 1T5XA 2GAZB 2WGXA 1G1CA 4XXCA 4MNGA 3SOBH 5F1SA 2OP4H 5JXAL 1A7BA 1RY7B 2P5PA 2X3AA 2WZPD 5HYSB 1MPAL 3I3BA 2AEIT 2J88L 1R5MA 3U4KA 2WIIB 2DQTL 4ZD3H 1QVOA 3WN5A 5HGAB 4JN1H 4KHTL 5IP4A 4U1JB 3ZVVA 2EH7H 4KKZA 4CBPA 1SPDA 2ATPA 3GXIA 1RZ7H 5EA0L 1M2VB 5DEGB 2IPTH 3RG1C 2IDCA 1AQKH 4L9LA 5JMOC 1S5IL 4PWGA 2CJ3A 3KW8A 4BZYA 1DJWA 3I6KB 3MNMA 1KXQA 5IUSA 3UTQA 4PJ6A 3UTTA 4PYHA 1CLOL 1MFNA 3GSOB 4EIZC 3VD3A 3OKWA 3KPNB 5JWZA 2C4XA 4PRNB 3EI2A 1E2WA 2IH3A 1U3HD 4G9FE 4NOFA 1F97A 2FQEA 4LSPL 5AW3B 1CF8H 2YFOA 4PJCA 3CDGA 3WY1A 1DSYA 2R51A 4W9DC 2X0UA 5DUML 3NJIA 1VAHA 3M6DA 1JZJA 1WCBB 1KBPA 1NCUA 2DWDB 2E4TA 2F54A 4PJEB 4WGVB 5ECJE 3SPCA 3MVDK 3I6SA 3WHXB 2F1BA 5K9KB 5F6HI 2ZWNA 2GTWB 4N6RB 4IRSD 6PCYA 1MSPA 4TLUA 4J6IA 4NKOA 3OKOB 4A08A 1T6WA 1ZA3B 3EOYG 5EOQH 4LRNH 2Y2WA 3CXDL 2OYMA 4JHAL 4O2EB 1N64L 3ZT5A 2FJUB 5AZUA 5CJBA 2W88A 4BFRA 4ZX6A 1GGBH 4BH7A 4GUOA 4A67A 4EZKA 3I3DA 4YLCA 2FX8L 3LPOA 2CUAA 2W07A 1ZV2A 3RDTD 3G6JA 3FCSA 4GUQA 4Y2DD 1M6OA 1KGXA 3C2SA 3V9FA 3N44F 3E1F1 5DRNA 4JFUA 3TBVB 3CFTA 4JDTL 4TUKH 2WKLA 3MFFB 4TSCL 2NYYC 4JKPL 1FN4B 5ES4B 1M6OB 3G6DH 1HAWA 1EUTA 5C07A 1RZ7L 1A4JA 4G42A 2ZOKA 1J7VR 3PREA 1LILA 2VB5A 1LO2H 4HS3B 3L1EA 5CJQL 1BOYA 2VL5B 5JLZA 3K46A 3ZE0F 4OGYL 4N0CD 5L2JA 5DLML 3NFPB 1ZT1B 3MV9E 5SWSD 2B39A 5I1CH 2HJKA 4H0IA 3VU1A 2NX5A 3N04A 3RFZC 3S3CB 3H55A 1KJ2B 1JV5A 4BCCA 5CBAB 3RI5F 3D0LB 1EHKB 5FOJA 1NCDH 3RUGF 3D0LA 5HVFB 4QRUA 2NOYA 4ZDHB 4J39A 4AEIL 2WB1A 3AITA 4NQCD 1A7QL 5HYJA 5LNDA 4DPRA 5IG7A 4UT6L 1HOCA 1R5WA 2QVKA 2MCAA 2LV4A 3CHOA 3FDWA 3H42H 3PWVA 4N8UA 4RVBA 3REVA 5IB3B 5H1MA 1NC2B 4JN2B 3KJ6H 3GQFA 3MLYL 4X7TA 4WWNA 4RCAA 3RY6C 3PVUB 1MCKA 2HG5B 1RZKL 2BDNH 2I69A 2FNBA 2AK1H 3HRPA 3PWPB 4FFWC 3VGFA 5CZRA 1TJGH 3EYOB 3SE8L 3UIZA 3QHZH 2VC2H 3QJVB 5JOEA 3TBVA 2VLRE 3T2OA 1P6FA 4GMSL 2ZTBA 2EDMA 3V6FA 1VB9A 3HJ0A 3OMZA 5IF0B 1T21A 2R8SL 1V54B 1TVHA 2ALAA 1Z9SB 5TE4L 2YPKB 3UTPE 1TJIH 5DDHB 5KN5A 5HHNB 1ACXA 4OCNC 3ZL1A 4K07A 2Q5BA 5J1AB 3L45A 2XQBH 4G6AC 4NFDA 3GMQB 3U30B 5IROA 4Z7NB 2DMCA 1JP5A 3LKQA 3QWOA 5E4EC 4JE0A 1PQZB 5EM2B 3FQRB 2B7DT 3MR9B 3TZVC 3BRGC 5BRQA 1XHHA 1MNUH 3NIGE 5HPMA 1DEDA 3OD3A 3HPJB 4IRJA 2NTFB 4Z7UE 1COBA 4OZFH 2ESVE 3NCBB 4PREA 5KSAB 5GRJL 2ICEA 5I1KH 1FLRH 4PRPD 4YQXH 3Q8AA 3IMRA 4XPHH 4ZUVA 3N85L 2VLKD 2CBQA 3MR9A 4JFWA 3NIFA 2Y7NA 4H5JA 3BE1H 3LKQB 3TV3L 1AGFA 2QQLH 2WMPB 3BWUC 4H26B 2PYEA 4XO9A 2F7RA 1A2YA 3IUQA 5EMMB 5KAQF 2VRQA 1WG3A 1NCAL 5CR8A 4W9KC 5ITBL 4KTDH 2VLRD 3ULUF 1C8PA 3BIKB 1XVSA 4N2IA 3D39E 3T4AB 4NZ8A 4BWUA 4R8WH 5KYYA 3V6OE 4G8GA 4ALAL 4V1DB 1NL0H 1AP2B 2IBBA 1U30A 5D2LE 1UWGL 2BNQB 1JN6A 1PAMA 1CXEA 2FJHB 4NKDB 3CUPA 4ZFFB 5CKAA 3ULVF 4A38A 5L7XL 3PYCA 1JD9A 2DQEL 3FQUA 3RIAF 3G9VA 1NLDH 4GRWH 3GRBA 3JWNG 4OLYL 3STBA 3CX5K 2BKLA 4FQCH 3SDAB 1THAA 4BBWA 4LHUB 2VITA 1YY8B 3ME0A 1D2OA 4NLHA 5C0JA 2P8MA 3KL0A 4NCC2 4DNUA 1NEUA 1UCTA 3CZEA 4Y5YC 4X6DF 1L3WA 1J0YA 1NPJA 3QXAB 4Y2DA 1NCIA 4CC4C 4ZUWB 1AP2A 5BJTA 4KAQL 1B88A 2VLKE 3L3OB 3JZNA 4JPKL 5BOPA 2Z3FA 1RSYA 1L6ZA 4LGNA 4XWGL 4K9EC 2ZPKH 1ET7A 3N5AA 5BMFH 2ADFH 2BPBA 2X1PA 3SZ6A 5C09D 4LEEA 4CILA 2QR0A 3IF1A 1E4XH 2HJFA 2JCCA 4AQEA 4OI7A 1FLRL 4RFNB 1PD0A 2K3HA 2GJJA 4MSWB 4QNPE 2ZWSA 4OLYH 1RHHA 3RWCA 4GI8A 1IUZA 1DYZA 4AX3A 3T2QA 3TPKA 2V33A 4O58H 4NFBA 5M5UA 5GIRA 3EO0B 5DMIL 3CU1A 5MEOA 4WHYH 5E1AB 5BQ7B 3NJGA 2EDEA 5A6LA 1NPNA 1FBIH 1GS7A 3QUMB 2XE4A 1QRKA 3KPLA 3RX5A 2WV3A 4MK0B 1T80A 3IJSB 1KUMA 1SHSA 3BH8B 2NUTA 2A9AA 3BAJA 1SOQA 1CBVL 1UWXH 1LNUB 1NDMB 3VGGA 3PGCB 4AGQA 2EDDA 3PWPE 4LASH 4KROC 5E94A 5MP6L 3CN2A 2GY5A 3GMNA 4B53A 2YXFA 4M00A 2X4TB 3QUZB 2DJMA 5AOMA 3RQ3A 2RALA 1AE6L 2C7UB 4TZ4A 4AEEA 4FGMA 1G7PA 2BO0A 2GJZB 3IDJB 3BPCB 1J48A 1I82A 2VN4A 3FO9A 5KBDA 3PVWB 2CPUA 3TCLB 1FFQA 2J8OA 3C60A 5LAPA 3QUHA 2M8XA 4BK4A 4HK3N 4DW2L 3VGEA 5CSZB 3ZDWA 5E24E 1VIWA 1S5HA 4B3VA 1L7TH 2P9KC 1V05A 4D6VA 3LB6D 4AH2B 5DO2C 2WQUA 4PC0A 4LSSL 5EIIA 5H37A 4WCYL 2RJMA 5C3LD 3RY4A 1LEIB 4QLRA 5IHZA 1PZDA 5AZEL 1KPVB 2EQDA 3EZJB 3ZQWA 4CZXA 5EC1B 5F0LB 4PRHE 2BS71 2GJZA 3IDJA 4Q2ZA 1GKOA 3UL4A 3A3YB 4HKBB 3CMOH 4LEOB 4UTBL 3GXUB 5IBUG 2FEDD 1KC5L 3MGTB 5E8NA 3T65B 1LDPH 4AL8C 2ZNWA 3SKOB 4HJJH 4XNMB 5FO8A 4W9JC 5JMRA 1XF2A 2VO5A 5E2WL 4JSNC 1PLCA 4DW2H 3CBRA 4YDMA 5F3BB 2WCSA 4V1DD 4PCYA 4KBPA 5D1QA 5C0GA 1I7UA 2C9XA 1MREL 3QJHA 3K81A 5GGRA 3AXLB 2VZOA 3SCMB 1YDPA 4NRZB 5DJAB 4ESKA 2VDKA 4LSPH 3HB3D 1MXDA 4AIZA 4IA9A 2W60B 4O2WA 4JY4B 4DGIL 1J9TA 3FU5A 5D9SA 1UB6B 1N6QH 1AIFB 5LN8A 3DI3B 2BP8B 2XZAL 4WTZA 2BNQE 4Y19B 4JFTA 2YBRA 4LOUC 4MJ4A 2VLLB 2JI1A 5T1KA 3VWKB 1UM4H 3FB5A 5D5MF 1ADQA 2VXSH 1T83C 4GIOA 5EEVA 5E8PA 2VDPB 1KB5A 3W3BA 1RULL 2VOTA 2F7OA 3TXAA 5HYIA 5K5YA 1BXVA 3OM3B 4PD4J 4YDJB 4QRRB 4HJ0C 3THMH 2NSXA 1Y6KR 1N5YL 2AQ3A 5DJYA 4FQLH 4OFYD 2GY7B 4Q6IC 1MQ8A 2PP8A 2VDOH 4WW2B 2Z1PA 4AT6B 3D2TA 4B5EA 4KKLC 1ZA6A 2VDQA 3BP5B 3T6VA 4A1RA 1G0DA 4QDGA 3UJJL 2HKFL 4AIZB 4BELD 2BNRA 4WW1B 5DEZA 3VD0A 4JO4H 3WTSA 3FXIC 5C0AA 3FQ2A 1MFUA 2Y1YA 3LZNA 1F6AA 5KJ4A 2APBA 4D0DB 4LSTL 5JUEH 3EOAB 3L5WB 1SYSB 3MJ9H 3KXFE 1DQDH 2OW6A 3TX4A 3VXMB 4JSPC 3LKNA 4PJFA 4G8AC 4WSGA 1QI3A 3LV3A 1K2DB 5FXYA 3Q8FA 3KGRA 1QUNB 4I3RH 1FORL 4PJIF 2IAMC 1UQSA 3DSNB 3HMXH 3SDAD 4NI6A 3IB4A 3L3HA 4ZFOA 2GG1A 2YRBA 4PRAB 1B4LA 2ESVB 2X5PA 4GKLA 2QXVA 5C0FA 4LU5H 5IEHB 3EJJX 5DQ9A 3QEQB 3ARGB 1A6WL 1SXCA 3TYGL 2XZCH 4IMKC 1PNCA 4HVBA 4IRZA 3WEXA 3FAXA 1XDTT 1F90L 2PW2A 5IW3A 4PY7A 4FKKA 1XQ4A 4BZ1H 2CDFA 3OX8A 2NY5C 1Z9LA 2UZIL 4JJOA 4PAZA 4P5KB 2AJ3A 4ZAKD 4CADA 4XPAH 5GGQL 5I0VA 3DJZA 1A6TB 2G75A 3RZCC 5HJ3B 2JB5H 2E56A 3PWNA 4PJ7B 3MN8A 3MKQA 5HJ3A 3D4YA 3PQYE 3ARPA 1TCMA 3GJFB 3JROA 1KTCA 3L7EB 2J44A 1T2XA 3U0TB 2FZ3A 1AD0A 2HT3D 4HIHB 2PCFA 5D96C 2YNPA 1PY9A 3IFLL 5E0QA 5GS1A 2WBXA 1MN4A 2BP0A 1XB3A 1CTNA 1FPTL 3DX9A 3GBLA 3GRWA 3L3DA 2A4ZA 3B34A 4OZFG 4GYBA 1MFCH 2AEPH 2EUVA 1YEGH 3AT8A 4NXKA 5DQ9B 4BQ9A 1A0RB 3J7HA 3I7OA 4EIUA 3NYKA 1VFMA 2K45A 3CGTA 4MBOA 2ERJB 4WGWB 4NDMB 3V6ZB 2ZCLL 4TPRH 4F8QA 5FO7B 3TEWA 2DQUL 5ELIA 1MY7A 2H3NA 3FO2B 3OHXC 1N8OE 1BVLA 3GS4A 3BHBA 5DFTA 3SDDD 5D93B 3Q7JA 2WWKT 1MVFA 3K6SA 4MD5A 4ES9A 1E8NA 2X09A 3F7KA 4HK0A 2B1AH 5DMKA 2A4CA 1I3GL 3LRKA 3LYRA 4MQTB 1IFHH 2P5ED 4HKXB 2IBGA 1J10A 4I3RL 2QFRA 1UADC 5DS2A 1E90A 1MRCL 1FC1A 4HWEH 1OGTB 3MNWA 2R0KL 2XVGA 1RLBA 4P4KA 3X1EA 5EU6B 3WSQL 4HJGA 3DIFB 3CZLA 4U6HB 2UZYB 5B7MA 1OP3K 3QORD 4H4NA 2BSTA 4KHXL 5KS9E 1YFQA 1A7PL 2BFGA 2Y07L 3GI9H 1SLXA 2G3ZA 1NMAL 1H15B 3GJEA 4TLKA 4RNRB 5ACZA 5TQ0H 3NFSH 3X12B 5JHLL 1VF5C 4MDRA 4Z7OB 5MERB 3I8CA 5F3FA 4JDEA 3DIFA 4NEHB 4U6HA 1KTLA 5A2AA 4EF3A 3PWLA 3DX8B 5D7LE 5D1QE 5MI0C 4GW4A 2KLSA 1HTYA 2MCPL 4Z3IA 2D2OA 1WPCA 2DL2A 1Q72L 3ZDXF 4E0RA 4MD5B 3I7KA 2VAAA 5E8EB 5K59F 1OSZB 5I75B 4JRYA 2KZKA 4DPBX 6PAZA 3NQIA 5F8RC 2L0DA 5HHOD 3MLRL 3L5IA 4KTEH 1JD7A 1TQTA 3P0YL 4HEMA 4XGZA 4DN3L 1K85A 3DXKC 3R19A 3KPOB 4BZ1A 2CHXA 3T1WA 2Y1ZA 1KIRA 1OAXL 3G6AB 2EXWC 3POHA 2XZZA 1N67A 1JG9A 4BGDA 4NKIH 3NJMA 1XFPA 4U0QB 2VR5A 3OF6D 5CU9A 3D18B 1CL7L 5E8DH 4X6CF 5KTEH 3VG0H 2XA8L 1BXUA 2ARWA 1OAUL 3GHBH 2V7HB 4Y19D 1E65A 3AVEA 2Q9OA 2WTRA 1HWWA 4HHGA 4WI3A 3QAZC 3SPGA 3WJJC 1EUUA 5FQDA 4QNPF 4AW7A 4X6CB 3BFQG 3OKMB 4LGSB 1N10A 2FX7H 5BXFB 1U6AH 2G5BB 4JRLA 5KBNC 5L2KD 5DS8A 5JOPE 2PABA 2ZWZA 1L5GA 4N0YL 4R97B 5AOKA 3N1QC 4OM0L 4X6BA 4Z7WF 1Z7JA 5DT1H 1BX2A 2KYIA 4NQEA 3HRZA 1ZPUA 2WBKA 1PCXA 2XX1A 3QEUA 4P4KC 4YLBA 3INUH 1E5ZA 2P47B 43CAB 1PQZA 3JT0A 3TESA 5EM2A 4XMUA 3TO4D 4GQ1A 4PJ5E 4AVIA 2G0LA 1RURH 5FK9B 2O1AA 5J3HD 1I9JH 3L7FB 1OXYA 3ECWA 3CDFA 1LO4L 2B20A 3BXNA 3TVMA 5DJ8B 1A1OB 5CJQH 5B3JF 4XVTL 3IGFA 4S1RH 1IC7H 3QPQD 1XIWC 5GGTA 5GHWH 1X4ZA 1M42A 4YAQA 2VE6A 4NRXB 3UTTD 1OAQL 1JI1A 2BRRH 1YY9C 4YDKL 2V5SA 3QO1B 3CWGA 3EYOA 4JJHA 3T0DA 2VDMH 1ZTXH 3PLYA 4OJFL 4BK5C 3V52H 3C9NA 3IRCA 1VFUA 1WUZA 1O9ZA 4CSTA 4O02H 5CD5D 2PM9B 2YAMA 1WP6A 3APFA 4FXGC 2IAND 2YPVA 1DSFH 3FSOA 2XDWA 3V0IA 4LGPB 2I5YL 3WFCL 4QTIL 5AYUH 1WIUA 4BFKA 1HKLH 2CIIA 4TNGA 2P7TB 3MCKB 4MTMA 5T33H 2HPTA 4N9OB 4ZDHA 2E27L 3GNML 3O6FD 1FNSH 3VD4A 2WC7A 2H6QA 1N6QL 3GTVA 3IJYB 1F6FB 1X3DA 5D4HA 4L3CB 2FEEI 3A22A 1E3FA 3EW3B 2BY1A 4O9HH 4RAHA 2YPLD 3JB9L 3ISRA 4JXMA 3CLFL 2XU9A 2VDML 4WWOA 3VXSE 4PJ5D 1QTSA 1W0VB 3C87A 1IVLA 5GGSA 3M1BA 1RFDH 5CEYB 2NXZC 2CIKB 5F1IA 3WKML 3U2IA 5EU6D 4R26H 3LEVL 5AOZA 3O4LD 1J5CA 5D6DA 3JZYA 4MXQC 4OZUA 1PDKB 4OAWB 3KR3H 4YL9A 5D6CA 5BV7B 4OF0A 3FB8A 3NZ8B 4GW1A 3N50A 5CINH 1UOOA 1WYJA 4BINA 4D9RE 4GINA 3CLEH 3M17B 1BJ8A 3BAIA 4AXWA 3PWUA 5I1LA 4OJCA 4GBXA 2J21A 1DHKA 4Z5RA 1D9KD 1XF1A 3Q3GA 4PQXA 5CYKB 2K78A 4GT0A 2X53A 4WV1A 5HD8D 1IGCH 1BLNB 3DKHA 1CD9B 2JKSA 3PNWB 3QNXB 2H3KA 4O9HL 3GINA 4ELKB 5EAPA 2ENJA 4NM4H 2VUOA 4WNQA 5FDWA 1GOHA 3WKNA 4ZFFA 1XAKA 4TNFA 3GD1I 3PGFL 4J12A 1H6EA 1N5AB 1KCSL 2GKIA 2QSVA 4GNKB 5IBUB 3SKNB 2AS5M 1CGXA 2FBRA 4F7MB 4FAVD 1HH6B 4JKNA 4KJWD 4OD2B 3SJVE 3VXUD 4JR9L 1A65A 3PIQB 3QUYD 5DD0H 1HNYA 4F8OA 2EDNA 3WLBB 1P6AB 4WU7A 1IT9H 4Y4FC 3V5KA 2AQ2A 2FX9L 3G5ZA 3GGWA 4GUPB 4A7SA 4JKLA 3P4FA 3MRQB 4RGMB 25C8H 4H26A 5FO2A 3ZL2A 1F8TL 3AT9A 2EDQA 2IH8A 3HFFA 1R17A 3BAKA 4BKTC 4M02A 3AQXA 3GMOA 4EKXA 5J89A 2KDGA 3MU3A 5GRJH 5C2VB 3DBXA 2R83A 4YHYB 3N1PC 5I1JL 2J8UA 4UQ2B 5FHAL 5L9DL 3B43A 3L17A 3Q1EA 1ZLUH 1BFOB 1KG0A 3NCXA 4QLWA 3FO9B 2VM3A 2Z91A 4FQCL 5HI3C 1KWKA 2V9UA 1IAKA 2BJML 1ASOA 5DK0B 3O3DA 4TVPH 4GGCA 4JFOB 1I1CA 1IX2A 2G9KA 3LH2L 4A39A 3HFMH 4KI5E 1R5VB 2AJVL 2XL3A 4AN1A 3FQYA 3JSSA 4L0PB 4XO8A 3FQRA 4MD0B 4GG6E 4CVZB 3U46B 1UACH 4CSSA 1B2WH 5EUOA 1BD2B 4KFMB 2EILB 1S9WA 2MTPA 2WQVA 3EJTA 4LBAA 4P3DB 3W0WE 3K71A 1BECA 1GIGL 2AMGA 2EE2A 2BIOA 3G9AB 3C5ZB 2DQHH 1MW0A 2EDFA 3KPLB 4XX1G 3BDBA 3OKDA 1AD9B 1BFOA 5DMGD 2ORBH 3W0WA 4G80B 3LMJL 3K0WA 3TJEL 2YPLB 2DWTA 5IKCB 2OTUB 1A3RH 1X6LA 3DPBA 3IBEA 1DP0A 3IWUA 3GMOB 2A6IB 5EZIH 4BUHA 5IFAH 3LDBC 1TJHH 1I8KA 4GRLC 2WXKA 2R7EA 1VACB 3ARUA 4PBDA 3EGSA 4X6FA 3PGFH 3RWFA 4CW1A 1LD9A 2QV4A 3ULUH 3UABA 2OMUA 3B2UD 4NC2B 1FBIL 2J3SA 1TITA 3CVBA 3MOAH 1MRCH 1ZT4A 4OY9A 5DD5L 2MFNA 1Q9OB 3QWRA 5E70A 1OAYH 4K3DH 3N6YA 1TEFA 3CFBB 4DGVL 3F7VB 5J13C 4PTTA 3VXOB 4CSZA 1UD5A 5JYLA 4GQZA 5ISZB 4G9FB 5EOCH 2HXCA 1F41A 3TONA 4L9OA 3FOLA 5IGXH 4NWUL 1KJ2A 3N3EA 3TYFA 4TULH 1J8HA 3V7MA 2ZCLH 2GJ6B 4TPRL 4PG2A 4UOJA 1FNFA 1VA9A 4PR5B 1TMQA 1B2YA 2WJ5A 3EOBA 2X89A 3RBSA 3OR7B 4BA8A 5F7UA 4R7DB 3ZTJH 8CGTA 1FV1A 4WW2F 2X2IA 3U2JA 2XQ0A 4S1QH 5CIPA 1HESA 3IWVA 4E2OA 4JGMA 3CUPB 2XTJE 4W9CC 3US9A 4FG0A 1XWVA 3NN8B 3UYPB 3HS9A 2A6IA 2D3NA 5AAMA 2JF1A 4K94C 2E9WA 4Y4FD 3U9UA 2WLKA 2KLTA 5K39A 4M4RB 1JIBA 4GRWB 2M83A 1OAKL 3ZDZE 4IU3A 3TBWA 3VFMB 1FIGH 1R24B 1UOVA 2DQHL 4QRPE 3OKEB 3BIBX 4AIOA 1MG2A 3T8MA 1KC5H 5D7JC 3CFCL 3QDGB 3LY6A 4IEFB 4DGYL 5F7HA 4FG6D 5EUOB 4AZUA 1PKQB 4U6YA 4ZUUA 4BP8A 1ZHKA 2GABA 3MKSB 3S8FB 1MF2H 3NG5A 4APXB 1JDCA 4N1HB 3QJUB 3RA7H 4JM2A 3IXAB 4U1SB 2X4OB 4PJCF 1D5XB 3MRIB 5HY9A 5CP3A 1U8HB 4XN2A 1BBJA 2PKDA 2FJFA 4YBQC 5DXWA 5E2UH 2JVUA 2Q1EA 4AKOA 1KCWA 1WZMA 4BKLB 3W15A 5IQ7L 1N6DA 3BKCH 4NYLB 4I1RA 5DF0A 4PVBA 1NGPL 4GAYA 4TTGA 1F4WH 1ESOA 3QJXA 4TTDD 2YC1B 3OKNB 4HIJB 2WBJC 5F0PB 5AEAA 4PY7B 4ZO9A 3VXNB 1WBXA 1WIPA 2DLFH 3CSGA 1W0YT 1B4JH 3MGTA 4FZ8H 4TSAH 2FYYA 3RHWK 3QWQB 4F58H 2VN7A 3MGOA 4PJFF 2H6KA 3CVHB 1HYRC 3PUUA 4M8QB 4TQHA 2PYED 1OAJA 1MH5B 2ED9A 4G55A 2P8PA 4ISVA 3DVIA 3AU1A 4WKZA 3DHMA 4Q9RL 1CL7H 4QPEA 3A4AA 3GSRB 4HSQA 4MXVF 2Q8BL 4N2EA 5E8DL 4JREC 1EPFA 3HC0B 3UOAB 3EDEA 3B9AA 4MAYB 1ERJA 5E2WH 4WUUD 1EFXA 4MNQA 3THML 1N5YH 5G4OA 4XXWC 2ZOWA 4ZFOL 2WXFA 4ERZA 5DC4B 5KANI 1RZKC 1CU4H 3CSFA 1JSYA 3LV3B 4IIQB 5E4OA 1N6FA 4HIJA 1U2HA 4PJ8C 2A1WL 2DQDH 4A66A 4XNAA 2CALA 5AB0A 5I1IL 2KH2B 4OF8A 4OFQA 2K4AA 4HA1A 4OI8A 3IAPA 2ID5A 5CUSL 4L29B 3EOBB 4W6YB 1BF5A 2OCFD 2RGSA 4N2DA 4NO2A 1Z5HA 1BF2A 4HUXA 3TA3B 4X60B 1FIGL 3QUZA 4D7PA 3S2CA 5BVPH 3FU9A 5J6HB 1FNGB 2BH0A 4D0CA 3SE9L 1UZ8B 4UM9A 3ULAB 4QYAA 4UT6A 1YEEH 1OWWA 2LU4A 4MYWB 3IPEA 4BZ2A 2Z1KA 4KKQA 1QRND 4L18A 1OOWA 4QRRA 4Y5XC 4HGWA 3EF4A 1OTSC 1XCQA 4K7PY 4UNUA 2B4CH 5CXBB 1MWAB 1NSNH 2AJSL 1UD6A 3D48R 1U8JA 1CLVA 2X1XR 4TUOA 4WRLA 4KJPC 4JEGB 1GJWA 2EDBA 4MJIA 3WTVA 4PS4H 4KZDL 4LRIC 4GLRI 2XRAL 3CSTA 1NGPH 1WZ1L 2J1KA 3ULSB 2BIIA 4BUGA 2UVFA 1N3NA 4WUUE 4GKNB 4FMVA 1FFNA 4UQIM 3EYFA 2B16A 5JUEL 5CP7A 3BKYH 1L9RA 3LS5H 5JXEA 1F02I 2WOYA 3TNNB 4UU9A 4ZW7A 1URIA 5B38A 1KFGA 2BSED 4BCDA 3CIQA 4DP5X 3GHEL 2BSRA 2PP7A 3EDJA 3I89A 2HT4C 3FU7B 4Z95H 4XCNA 5TDNB 1NSNL 1MWOA 1MHHB 1RI8A 1W72B 3H9SB 1NEZB 3ZZ1A 2E9BA 4FA5D 2AEPL 5E8NB 3GZPA 3IGLA 5SWZA 5EZPA 5JIIA 1LP9E 5DHYB 1FYTA 3GJFA 4KMQA 1X5JA 1AHWA 4XN8A 3BAWA 1RPKA 2CSPA 2VABA 1CYWA 4GRWE 5FO9B 2E6QA 5JQ6L 4M3KB 4M29A 4OCXH 3W5NA 1QX1A 1KELH 1HN1A 1WFUA 2WWKO 3DDUA 3T3PF 2VLMD 4LSQH 5FOBB 2QPEB 1KN2H 2JMRA 3TA3C 2DF3A 2BZ7A 3PPSA 4YSAA 5E2VH 2WZPA 4F7CA 4NNPH 4YX2H 1MCQA 5JIKA 1JZ5A 1BVLB 3BWSA 4QAWA 3RI5K 1I9IL 1J5DA 4Y5YA 1XBDA 4Z7WB 2WQRA 3EBGA 1MELA 3RRMC 2AQQA 1XKSA 1DBJL 4L1TA 3EH4B 5I1CL 3QZLA 3E6HA 1ZXKA 1XGUA 3QRFM 2VO8A 2YD9A 1YEGL 2ADJA 3UZEC 4JFHE 4UOZA 3HE7B 5HGAA 2ZKHL 4TNVK 1RSFA 3DETC 4H25B 4M7LH 2FZ3B 5HYSA 2CJTA 2IANA 3NIDB 3ZK0A 1G9ML 2XVKA 4QI3A 1UH3A 2HT3C 4KKRA 1OCRB 4TVPE 1IGMH 1Q9WB 1YNKH 1ZVSB 4JFYB 3E6HB 3F2LA 5E99L 1D7FA 4KKLD 3RIFF 3ZKMD 4K5LA 2DY2A 4X4YA 2HSIA 3KDMB 4U4IA 5DUBA 3ZHKA 4Z77A 3EWEA 3W11D 4OZHA 1X4XA 1IQDA 1ZEAH 1BGXL 4M8UA 2BY2A 4Z7WA 3VWKD 1UD8A 4PV1C 3RB5A 3UTOA 1LYQA 2QDWA 3PAYA 4NO3A 3NSDA 3MRCA 2VC2B 5D1XE 3O0RH 3R7QA 3TPUB 2N7BA 1F86A 4HDJA 4ZTOL 1NM4A 3WFEL 3VGHA 5KVDE 2DM7A 3OXRB 1SEBA 1T83A 1F4AA 1V7NH 2DDQL 4UB0L 5HI5D 3RAJL 4APQB 5JPMC 1CFQA 2KZBA 2FR4A 3EJSA 3OR6B 3KWWA 3OB0K 3H8NA 5DA4A 4AI7A 4P46B 5I15H 1OTUD 5DZLA 2FRGP 3DHPA 2H9MA 4M1GL 1RJLB 5E6IA 3N06B 3ZDYA 1LK2B 2XHNA 1A6PA 2DQMA 3ZKQD 3PDOA 3LKRA 2NYKA 3VFNA 5C0NC 2PTTA 4I89A 2JLLA 5L2KA 4KDTC 1ZEAL 3CV5A 3CFJA 4J8RB 4NM8L 4PB0H 2X38A 1FZJB 3QDJE 3O6LH 5F96L 4GKSB 1BQSA 2CKNA 3BMWA 2YMUA 4TN9A 5M5VA 2FWSA 4E5XG 1U4EA 1V27A 4TTDC 4W1TA 4P07A 4XP1H 3VFNB 3E6FA 4PJXB 2P80D 2G5RA 3EGXB 1G7JB 4P57B 4PIBA 4PP1C 5LBSL 1UZ6E 3FB8B 4GW1B 2NQCA 4ZTPL 1ECYA 2UWEB 2YAPA 4ABVA 1P84K 1U92A 1RJLA 3B2VH 3PXLA 2VRKA 2AGXA 1S7UA 2J72A 3OZKA 5SV4A 3HR5A 1MJUL 2QSCL 1NFAA 2V9TA 2HLEB 2VE6B 3O2WL 3FO2A 1TFPA 3C08L 3KPRE 3OGCB 2CBOA 1DLFH 4X4KA 1E7VA 4XPFH 4HUVB 3O9WD 5EU5B 4CNIB 2OXHB 3K72B 3WAJA 1RAMA 5EWIL 3ARVA 5IW1A 1WK0A 2CH8A 3CK0H 4NO3B 1A6AB 4HIEA 4RIRB 2DI7A 3LIUA 2BVOA 4N86A 4RGNE 1F3DJ 1M7DB 2V9RA 1TIUA 4WK0B 3T8XB 3VDAA 4F7EA 5KVFE 3NABL 1FVDB 1KBWA 3RURA 3HRZB 1Y7VA 2WXPA 3MBWB 4S11A 1RZJC 5KSUA 1I9RH 5I8OH 4KUZH 3VQMA 2ZJSL 3KDMA 3QXDB 2NUPA 3HPLB 1AQDB 4ODXB 4Z77B 5LG6A 1MCNA 4Q0XH 1JNHB 3NCJH 2W0FB 3TCXA 2Y3AA 4S0SD 2HVJA 3HBZA 3HZYB 3OLIA 5D2LF 3MBWA 4NN6C 3CCHB 2PM9A 3Q0HA 4CAGA 2PCYA 3C9NB 4OQTH 1BWWA 1J1OH 1VGKA 4TKWA 2XWJB 4HAGA 4W68A 2RD0A 2AZAA 2OMVA 3U2SB 1OF0A 3FUHA 3PL6C 1OVZA 4RIRA 1QA9A 4UQCA 3S6CA 4FD0A 2DYPB 3CZFB 4AQ8A 5JPNB 1DUYA 2RCSL 3UAAA 4YXHL 4DVBB 1KXVA 1HILA 3KYAA 2M2DA 4N6RA 3QZWG 4YSSA 1AJ7H 4DO4A 4O02A 5MEPA 1J5OL 5DURD 3WHXA 5K9KA 5BRZD 6TAAA 3DV6A 4Z7VB 4M7KH 3EH5B 2F54B 1FH5H 3ZTNH 3LN5A 3IFOA 1PS3A 4ATTA 4UM8B 4YSPA 1FNEB 4JCLA 3FQXB 3PHQB 1NGWA 1S7UB 3MBEB 4WTQA 1OSZA 1GP2B 5JDJA 5AOIA 2XBZA 3NJJA 5HTSA 2X28A 3KXFD 1S7VA 3LNHA 4LBEB 3PFQA 2N59A 4EI6A 3OXSA 4RFEB 4PP1D 4PSWB 5TDPA 1VERA 4YL4A 3ZGIA 5IQMA 1PZ3A 1RUKH 1N6VA 3O2VL 2C3XA 5T8IA 4A11B 1RPUA 3RWJA 5KSAC 3ILQC 2NY3B 4K3JL 3TU6A 2AMUA 3HHSB 5DJCA 3V55A 2EKSB 2DKMA 4LHQB 4X6CA 3VI4A 2IPKB 3JWDL 1JDAA 3QRGH 4RDQF 4KXAA 1DN0B 3GXNA 4M48L 1E43A 1GYVA 5E2JA 2K0RA 3Q1SH 3V7AG 4N5EC 2ZP8A 4PG2C 2YS4A 3NCYP 2V7HA 3J81g 3BPLC 2NX5B 2XYBA 4Y2DC 5TEFA 2YKKA 3VFSB 3RL1A 4GS7B 3NFPA 5KSVB 4POUB 3DTXA 2H1LM 4KC3B 4WI4A 4N3UA 5HDQL 3ARDA 1YN7A 3DUSB 1DFBH 1OT4A 5BUGA 5E5MA 2FSDA 2MQ0A 4F8TA 5I8KH 2YD6A 4MQSB 2VWEE 1RZKH 2BDNL 4RMVA 4G6ML 2ZCKL 4NUPA 1AS6A 4YDLB 4LLYB 1KGJA 5AZEH 2CRIA 5D70L 3QR1A 3F62A 4OQ1A 5GRUH 3UBGA 3PHOB 5GS1C 5TD4A 3JWDH 1YQ2A 2AQ1A 1KT2A 1AD9A 4IOFC 1JZHA 3QZWB 1T4KA 1YG9A 3FQ1A 5A7BA 5I1EL 4ZUTB 1DR9A 2IFFH 4P3DA 3ETBF 3SHSA 3H9YA 4XMTA 1NAKL 4G70B 4QOKA 4FRWA 3KNBB 4L4VD 4UBDC 2BVQA 1ZHLB 4WUUA 3BN9D 2LLLA 3QG7H 5E9DE 1IT9L 1JZIA 1ZHBA 3VH0A 5I1DA 3FMGL 3RRQA 3LNGA 5I6XB 1EANA 4GXUN 2XL2A 5HVGB 4PJGB 1H9DA 4A7UA 3IJ8A 4XMPL 1GOFA 2DTMH 4CVUA 2BY3A 3DO7A 4K9JA 1CE1H 2WBJA 3L95B 2J8UB 1LD9B 5DUPL 4PJAF 3LPPA 4AL8L 4RFOL 1S7VB 4UDTB 1B0RA 2ICWA 4K55A 1K4DA 2X6MA 4AIEA 1GL4B 3ARFB 4NQDB 4I18C 4KO5A 1P2CA 2WXOA 3MVSA 3B2DC 4DGWC 3DETD 3PJNA 5D72H 6FABL 3GGWB 1QLRA 3L4MD 2FWOB 4X50A 2HRLA 5HHNA 5D2NA 5ITBH 1QRNB 2FWOA 4FA8A 1X5GA 1M4KA 3BXNB 5IF0A 4RISH 3MUOA 1H9VA 2CRMA 2OA9A 4M56A 5F9WB 1AG0A 1HH6A 3JWNH 2EO7A 5KS9F 2WSKA 3GPSA 4ZNCD 5BRZB 5I17A 1KF9B 2N1TE 3VW3H 1NOAA 4I2XA 4ZZFA 4XVOA 4XCCH 1R5VA 3K2MC 3QW9A 3EYVA 2DQEH 4XC1L 3CFDA 4MZ2A 1BMWA 4XP9H 3TTYA 4G8IA 5D1XB 2P9SC 5HHOE 4OGAD 5I6XC 2Q10A 5DK0A 1UYWH 3QIWA 3T5WA 5GGRY 1X5LA 3FU3A 4GBXB 4PWIA 5HPMB 4YK4B 4PW3A 5E1AA 5BQ7A 1Y1UA 4XX5A 4ZMNA 1PYWA 1YPZB 1FORH 4XPHL 2XKNB 2F6AA 1KN4H 4HLJA 4C58B 1KXHA 3IU4L 4JGJA 3DX3A 2BWQA 3MNDA 1YUHA 2J6EA 3HAEG 3I85A 1SLVA 2N1KA 2QMKA 3FHAA 3HZ3A 4LKXB 4UBDD 4N0FA 1NWPA 1U8QB 4Z7UA 3F12B 1OSYA 3AY4A 2OK6A 2CO2A 2FWUA 3BD4A 3ARDD 3RAJH 1OGSA 5KYXA 4XNDA 1E5YA 4F15C 2CN3A 5ALCH 3MLUL 2EH7L 5L2KE 3PIQA 2EYSA 3QISA 5ICYA 2CNXA 5H17A 1TYQC 5DEFB 1SGKA 2QQKH 3NN8A 2AABH 4GRLB 3CMGA 2MJWA 2L7JA 3TBSB 3QXAA 3QDAA 3VXUA 5KJ7E 2YD4A 2GTQA 2XLLA 3EJRA 1CFSA 2C3HA 1R3HB 4K5OA 3MRLB 3A21A 5E4EB 3WUWG 1YY8A 5J8OA 3HKZA 1GTFA 3V4LA 4M5YL 1CPUA 5D72L 2IBZY 5DEJA 1FAIH 3KPRB 3IU4H 4PR5A 3HAEA 2AXHA 1NTDA 2XN9A 2YLHA 2K9FB 3B3IB 3MLZH 2JJTA 2YUWA 3TYFB 3QIWD 4TYUA 2WWMD 2OVPB 2BSBA 3D5OF 1F4YH 3PGDB 4PTUB 1QFMA 1QBML 5I24A 4RX4A 3TA3D 2ZX5A 3KPMB 2OZ4A 1QFWH 3GSQB 5IJKC 1USZA 5I1HH 4LCWD 5I2IB 3MRFB 3I74A 2VDQH 1KMGA 4NPYB 1ZK5A 1HOEA 3MMEB 2VDLL 1J8HE 2LVCA 4PU2A 3LS4H 4XHQA 1UYWL 1SLUA 3PS6A 1PI6A 4ADGA 4J3VA 4YHYC 2NY0D 4HIQA 2OCCB 2QGEA 1SJEB 1GGBL 4JG1H 1I8KB 2C9UA 2E7MA 2Q2LA 2UWEF 5C9ZB 1JWMB 3MJ6A 4MMXB 3GK8H 3DPBB 3B9KB 4NPJA 3L4XA 4IS6A 2GSGA 5EU7E 3SY6A 4NAJA 4JMXA 3TCLA 4B95C 1ZD6A 4DN4H 4F5CA 3P30L 3GLAA 1IB5A 1QQDB 4Q58C 1YEDA 1R47A 1NC4A 3DV4A 1BP3B 3HG1E 4NJ9H 3VWJC 1BBJB 1KBVA 4FYSA 2CBTA 1P4LB 1EQWA 3VXSD 5IR1B 1YMMB 1ROWA 4AITA 4PJBA 4CRPA 2IWFA 4FQXD 4I0PB 1OAZL 4K5MA 4RMUA 5TJWK 1IM9A 2HA1A 4L37B 1F1GA 1B9ZA 1I3UA 5DK2B 1WFTA 5JR1L 2CE9A 3NA4A 1I7RB 1YMMA 2E7BA 1J88A 2CDGA 1L9QA 2YMXL 4UCFA 4PRHB 1KB9K 2J1ZA 1NGXA 3FB6A 4CMHC 3QUMA 3WY3A 3MJ7A 1XAUA 1T7WA 2OQJA 3I9AA 4M5YH 3SGJA 2O5XL 5IT2L 3ULVH 1MIEH 4TVUA 3OWRA 4WEMB 1GZPB 5AVZB 4GSQA 3V4PL 1U95B 3VTMA 1J8HD 1J9QA 2RAMA 1I53A 2P43B 5EUOE 3DX4A 1KEML 3N9GL 3ARGA 2VDRH 1KGWA 1UT9A 5DFVC 1JHKH 3S4SA 1QI5A 4DETA 1T6VN 4NOBA 4CGTA 4K9EL 1T1YA 4GAJH 5DJXB 2EIEA 5ESVB 1B3IA 2NR6D 2OJZL 5IWLA 5GMKn 2OXGA 4LMQE 4AK1A 2O5YL 4HJJL 4L4JA 1D5ZA 1DO6A 4MBRA 1A7NL 3FUFA 4HBCL 1E2VA 2X0WA 2NRDA 2ZKWA 4HCRA 4RESB 1CZ8L 5FXCH 1H2WA 5HE2B 3ZHNA 1VGEL 4E41A 2BSCA 2C7FA 3V9EA 2GC7C 4A7GA 1DVFB 3RVTD 1R5IB 2AQRA 2W65B 3MBXH 2C9AA 2XQBL 4MCYA 4BFJA 3V6OA 3HN3A 5F7YC 2UY6A 5B38B 3C5XA 1JL8A 1DSFL 4JQIH 3L13A 4F2ME 3PP4H 1WICA 2HLFD 4HFWA 4MA7H 4L4TE 1TR7A 2ITEA 1ZA6B 5CEZD 2EXWD 2P28B 3B9KD 4R97C 1HINH 1XF4A 2VZTA 4QD2E 1GGCH 5DYFA 2Z6FA 3S5LA 2VDMA 5DJYB 4FN0A 5D5ME 5E00A 1Y18B 3DROA 4HPYH 3U7WL 4O2CA 2O6DA 4MX7A 1IC7L 4PV9B 4Y4HB 4WSKA 2ZWKA 1FNHA 3P3TA 5SX5H 1NLBH 4MMZB 5IHLB 2W80C 4A2LA 4PJGE 4LU5L 2V2XB 3FRPB 4LLUB 3SBPA 1XZ0A 3NK3A 2PM6B 2OBGA 4BH8A 5AL0A 3Q2NA 1UB5B 2D8KA 1JUFB 5JOFA 1DQLL 1H15A 2FLRT 3N0EA 3ECVA 3LNFA 2W60A 4JM0A 1AD0B 2Z65C 4I0CC 1QFWI 4JB9L 3ZDYF 2X0VA 3HEIB 4Z6AT 2VL4A 3K2IA 3B7SA 1UEYA 4ALAH 5J9PB 4L29A 2ZWLT 1GYUA 2AEWA 3ROOA 3SBWA 2OR9H 4CADB 5F7KC 2QTEA 1TU2A 4UNTA 4PJ9B 2PTVA 1XD0A 1M6UA 2CGZA 2H1PL 2HFEB 4H25A 1AKPA 2XI9A 5TF1H 3RFZA 1FUNA 3DVNA 1KCSH 3R1GL 1OALA 2H47A 2Z2PA 5JW4N 3CG8A 1KJVA 5C0FB 4YGAB 5FW7A 5D7IE 4J87A 4ZI8A 4P2AA 2CUIA 4JZNB 4Y1AB 3HS0C 4QXVA 1T1YB 2CAKA 2IMMA 2P8PB 2J73A 3CXHJ 1Q8MA 4ISVB 4WKZB 5HI4C 3T0ED 1EFXD 4MNQD 3ZIYA 5ADPL 2ZOLA 1FSKC 1XIWA 1RD6A 2GHWB 4K8RL 3SYCA 4ZMQA 4PRID 4HC1H 3RFZB 2KS0A 3P0VH 4CI1A 4WGKA 2BP0B 3DX9B 4JHWL 3DNKA 5CFHA 1M7XA 2JJUA 1I8AA 3TIDA 4U6VH 1RK1B 4FWWA 2YKLH 1IM3B 2UZIH 3NZHL 1BV8A 4GQPH 5F3HB 1N7ML 3EI3B 3SKUD 2EDOA 1BLIA 5D7EA 5FGBC 5HHXH 5T1DL 3RGVD 4D94A 4MMZC 4OT1H 1Q0XL 3DVFA 2DYPD 3V0VB 3N44B 4R6UA 3VFTA 2HKMA 4IJ3B 1NMAH 2AK4B 4WK0A 3Q43A 1JNNL 1JK8B 4PCKA 3QFJD 1N12A 4AYBA 5TQ0L 3C6LA 5EALA 2X4QA 3LSOA 1JTDB 3IFLH 4GQQA 2LW3A 2NSMA 4W9GC 5IB5B 2WY3B 1LO3H 4Y4HC 5TQ2L 1PZSA 1V7ML 3HS0B 1D7CA 4XGZB 5I9QC 1G43A 3EBHA 1X5YA 4E9XA 4JANA 2YLKA 1T22B 2NY6B 4LESA 2B1AL 2XIDA 2FK9A 1E4XL 1OPOA 5JW5B 1GC1C 3JV6B 5FYJL 3VTTA 3VYPA 2X10A 1PX8A 4XC1H 3JV6A 2QVMA 5HGHB 3HZMB 3C8KA 1S7SA 5I8CA 4P0DA 3EGXA 4TNEA 5AVQB 1FGVL 3MLRH 3FHQA 4P3CH 3MXXA 1BFVH 3CQPA 2XFGB 1AZCA 1XSIA 3RWEA 3C75A 3ZL4H 1U3NA 3O45B 1TZ8A 4H40A 4EBQH 3ZQ9A 1E9PB 4JDEB 1CQKA 3GSNB 3MREB 3OSKA 2QKIC 3MRJA 1DVSA 5DJ0A 5AVSB 4YBHA 3NFSL 4R8WL 3O2WH 1PEZA 3UGEA 3ELAT 4H1LA 2YEZB 2B0SH 5LDUA 3EBIA 4POZD 4ENED 5DJ0B 1IEBA 5BZDA 3VA2C 1BWMA 5F9DC 2B5IC 3QFJA 3WGUB 2A9DA 2WLIA 3MFGB 4MJ5A 4P59H 3U79A 3L5JA 5AVYB 3FUEA 1K3ZA 1IZKA 3UTTE 2VDLH 4JPWL 1NIBA 1JNJA 3BVVA 3TVMB 2D7QA 2Y6SD 3W39B 5KYWB 1UKSA 3L7FA 4KXZI 3LRHA 1IL1A 3HZMA 2K3TA 3MLVL 5CN3A 4B50A 4ONOA 3UBXG 2VZSA 4AG4H 8PAZA 5D93C 3VMOA 2YQ3A 3F5WB 4NQEB 4U1KA 2YSSA 2ATAA 3DV6B 4Z7VA 2UXVA 4X6EB 4R2GC 4Q6IB 5KTEL 4U3SA 3ZRSA 3O8XC 5CEXB 3J2PA 4L1MA 4XP4H 4GS7C 5DK3A 3A4FA 4CSPA 3OPUA 4Y7RA 4F3FB 4IMLA 1R3LB 4IOIA 2VKXA 5J57B 2VR8A 2JB6A 1N0XL 1HZLA 1DQML 1PG7L 5IY5B 1JYVA 2FIRT 3EU7A 4S2SB 2A7BA 4YVNA 4U1MB 4GIAA 4JQXA 2AH0A 2JIXA 1GHFL 3KG5A 3LN4B 3M8OL 5DFVD 5EU6E 3W2DH 1TBGA 1FG2A 1JMXA 3PL6D 4S1QL 3QORB 4EN3A 1UKTA 2VLJE 3MCYA 1BG1A 1ZS8B 3VXPA 4WI8A 5IQ7H 2ARJA 2JELL 1KNOA 3BVUA 4XVSL 1M7DA 3T8XA 4AV5A 4GJTB 4DSYA 1MCOL 1EHAA 2CWRA 2PW1A 2R56L 2WVVB 2GUYA 5C0EA 1ZHNB 2YGQA 4WK2A 5CMAB 5DJ6A 2BMKB 1KGIA 3GZKA 2TAAA 4JZOB 1KTBA 5EU5A 1O6TA 1RQ5A 4GW4B 3FB7A 3MCLL 5CXPA 3CZNA 3CFCH 3P9LA 3OGCA 1J18A 3CZGA 3MRKB 3Q1SL 1AHWC 4GY4A 1RULH 1YLBB 3UPCA 4OZ4A 4IKNA 1CBJA 2CLZB 1MDAH 2VXQH 3QCVL 4PS3A 4YXKH 3NJNA 4PRPB 1D6VH 5FDWB 4R90H 1EAPB 5LXGL 2V4LA 4P46D 4HS8H