3BWSA

Crystal structure of the leptospiral antigen lp49
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
407
structure length
407
Chain Sequence
GTEIVKFSIHPYKGTVIRLGEEILPFKVLEMDKNIALVEMAIPVYKDEKEIELKLSSPGFQNSSYRIRKPEELNEKLIALDKEGITHRFISRFKTGFQPKSVRFIDNTRLAIPLLEDEGMDVLDINSGQTVRLSPPEKYKKKLGFVETISIPEHNELWVSQMQANAVHVFDLKTLAYKATVDLTGKWSKILLYDPIRDLVYCSNWISEDISVIDRKTKLEIRKTDKIGLPRGLLLSKDGKELYIAQFSASNQESGGGRLGIYSMDKEKLIDTIGPPGNKRHIVSGNTENKIYVSDMCCSKIEVYDLKEKKVQKSIPVFDKPNTIALSPDGKYLYVSCRGPNHPTEGYLKKGLVLGKVYVIDTTTDTVKEFWEAGNQPTGLDVSPDNRYLVISDFLDHQIRVYRRDGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The leptospiral antigen Lp49 is a two-domain protein with putative protein binding function
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Unknown function
molecule keywords protein Lp49
total genus 105
structure length 407
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bwsA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bwsA02
3UVNA 3SXTD 1U4CA 4HDJA 3SCYA 3I7LA 3RSEC 2YNOA 4FWWA 3IIWA 3KRXB 1XKSA 4O9DA 4O3UB 3W15A 2J55H 1OMWB 1GOTB 2IUVA 2H68A 2XU7A 3JZHA 3AL8B 4CY1A 1OLZA 4Y7RA 4GZ8A 5EAMA 2OVQB 4ERQA 5CXBA 4A08B 2AGWA 4K3ID 1N6EA 2UZYB 4L3GD 5EM2B 2AH0A 2BBKH 3IIYA 1PEVA 3RFHA 4FAND 2Z2NA 1NEXB 3PE7A 4PNKB 5B4WA 5AMSA 2AGXA 1JOFA 4ESGA 3AFCA 3B7FA 4MK0B 3BG1A 4UI9R 2OVPB 4FA1D 4Y5RD 4X63B 4PBZA 5CXCA 4LGNA 4J86A 4JSVC 5H1MA 1N6FA 4GM3A 4ZOVA 3ODTA 1SQ9A 3EU7A 5FQDA 2YNPA 4GM9A 3OKWA 5GXIA 5TF2A 2P9KC 4A09B 1VYHC 4GQ2P 4ZOZA 3RN0D 2B4EA 4PXWA 5H14A 3V7DB 2H3XA 1U2VC 4PBYA 4O3TB 3RFGA 5A2Qg 3SJLD 2XL3A 5GXHA 3MZLA 4FA9D 2OIZA 4J73A 3ULEC 4JSXC 1R5MA 1N6DA 3SLED 4JT5C 2AQ5A 4CZYA 4CI2A 1PI6A 3K27A 4J81A 3SN6B 2B5MA 3F3PA 2HKRA 4K3JB 4XEIC 5EM2A 4CI1A 3PXTD 4J8BA 1S4UX 2Z2OA 4XYIA 2J56H 2CN3A 5GSAA 3A0FA 4R7AB 3C75H 2AGZA 4D6VA 5IJ8E 1A0RB 3I8EA 2CN2A 3PVWB 4X61B 5EMJB 5HE2B 3VA6A 3OKTA 2P9LC 4A2MA 2G99A 3I7PA 4H5IA 5K1CC 3SHFA 4QL1A 2IAAA 2YNNA 1Q47A 4A11A 3SWSD 3RN1D 1JMZB 5IJ7E 5HE1B 3SVWD 5C9ZB 3JPXA 3IKOA 3V9FA 5AJAA 4NSXA 2W18A 3VH0A 3PXWD 3IJ0A 2QXVA 4LG8A 4PSWB 3L4MD 3JB9L 1L0QA 2H9MA 2HXCA 4GMBA 3AH8B 2IUPA 3CFSB 2H13A 4J77A 1MDAH 2CO0C 5EMMB 2BCJB 5FKQA 4CC9A 5JWZA 4JSPC 2IUQA 4O45A 5EARA 2YMUA 5IC7A 2TRCB 3UKRC 1XHMA 4TZ4A 2P9IC 4E54A 2OVRB 5C2WB 4A7JA 3U4YA 1JJUB 2I0TA 4ERYA 3OTTA 1FWXA 5KDOB 4L1QD 4U7AA 3MKSB 3OL2B 5CYKB 4J87A 5GMKn 3N0DA 2I0SA 3GFCA 3I8CA 3CFVA 4EWRA 2Q7QA 3UVMA 5IGQA 5IT9g 4A0BA 4J79A 4A11B 2AH1A 4CZVA 2QC5A 4ZOXA 4D0KA 3F3GA 3EI1B 3UVKA 3ZWLB 4JSNC 5EMKB 1SQJA 3DSMA 3EMHA 2H9PA 3SMRA 4FA5D 4IMMA 4G56B 4J0XA 1B9XA 3FGBA 1NR0A 3C5MA 4ERZA 5TEEA 4PSXB 4E5ZB 3ORVD 2MTAH 5IGOA 3EI1A 3JZNA 4CY2A 2PM7B 3DXMC 3F3FA 4GGAA 4IA9A 4GQBB 4AOWA 3IJ1A 4OWRA 3RMZD 2P9UC 3AL9A 3PVUB 4ES0A 3PXSD 4FHLA 3MZKA 4JD2C 5I5JA 2PBIB 5I5MA 4A09A 2IWFA 5EMLB 4U1EI 2OK4A 1MG3A 3JZGA 3P4FA 5HYNB 2OJYA 3PSLA 3I89A 4Z8LA 2PM6B 1XIPA 2GC7A 3CIKB 3FM0A 2H9LA 3DXKC 5CXBB 5THAA 4GGDA 2I0RA 3RRMC 2J57G 4J78A 2AGLA 3JAMg 1K8KC 1TYQC 3EI3A 3VGZA 3MXXA 3EI2B 5FXYA 4BUJC 4OZUA 2H47A 3UR4A 4A0AB 5H17A 2CE8A 3RLMD 2P9NC 4BH6A 4A0BB 4N14A 4CI8A 2H6NA 2HYEA 5CXCB 3I7KA 3NVXA 2XL2A 3JROA 3EI2A 3DWLC 2I3TA 3JRPA 2CE9A 4J84A 4YVDA 4XYHA 3C99A 2H6KA 4QRJA 3N0EA 2EBSA 2Z2PA 4GGCA 3DM0A 3OKYA 2G9AA 3UVLA 3EWEA 2XYIA 3I7OA 4ZN4A 4QT8A 4E54B 1QNIA 4JT6C 1JMXB 2CO0A 3UVOA 4X3EA 1ERJA 5EALA 3SBRA 2PM9B 2HESX 4ZOYA 3E0CA 5K19A 2B5LA 4BL0A 3OL2A 1PGUA 4GM8A 1SHYB 2YBAA 3IJCA 3SBQA 5FKTA 2HJBA 3L4OD 4CY5A 3I7HA 4J82A 2OK6A 4JXMA 4L9OA 3SBPA 3EI4A 4J0WA 1B9YA 3BWSA 2PM9A 4CZXA 4CY3A 3AL8A 3EG6A 5HQGA 5AFU3 3BG0A 5TEFA 1TBGA 5FLXg 5HE3B 2O9KA 4QQEA 3MMYA 5TDHB 3EI3B 1YFQA 3NVNA 3NVQA 1MG2A 3OKYB 4FA4D 3GREA 5FKRA 4LG9A 3K26A 2P9PC 2GNQA 4A2LA 3C9CA 5FA5B 3EI4B 4A0AA 3MKQA 1GP2B 4GQ1A 1GXRA 4KFMB 4PC0A 4E5ZA 5CYKA 2UZXB 5EAPA 5I5IA 4AEZA 3HFQA 2GC4A 5SXMA 3V5WB 1RI6A 2I3SA 2B5NA 1PBYB 3FRXA 4J8GA 5FKSA 2IURA 5HE0B 1GG2B 4O1QD 3J80g 4CI3A 3OW8A 4H5JA 3I7NA 4FAVD 2P9SC 2CNXA 3J81g 4FB1D 4A08A 2HJ4A 5C2VB 3KRWB 4L3HD 3UKUC 4I79A 2H6QA 2H14A 2IWKA 3PSCB 2HKMA 1K32A 3SFZA 2AGYA 2YB8B 1P22A 4X60B 2H9NA 3I2NA
chains in the Genus database with same CATH superfamily
4I9WE 1RFDL 3VYNA 2PO6D 5L4JA 3GXMA 4UUJA 3I6LD 4FNQA 4HQQH 1BZ9A 2H2SC 4CC1A 1RMFH 1KXQA 5B1KA 4D0DB 3CG8A 3MRJB 1FC2D 2BRRL 1SY6A 2OJ1A 4XBPA 4PR5B 4P5TB 1BF2A 1S7QA 4HIXL 1R3KA 3WFHA 3SKUD 3WY1A 1ES0A 4N0YL 1AIZA 4APQB 4QOKB 1LO4L 4WI4A 5EWIH 2ZUTA 1CGXA 3HKFA 5IM7A 3TCLA 1SBSL 1U6AL 4UT6H 4YHZH 4FFYH 2OYKA 1E5ZA 4MJ6A 1PSKH 3N40F 5HDRA 5T1LA 2XN9A 4L3EA 4GMSL 3OLDA 3E8VA 4HWNA 5JO5A 2ZXCA 3ROLB 4I48B 3S96A 1AJ7H 1EAJA 1N8ZA 2K78A 4RZKA 4DNLA 1IU1A 3VRLF 1H3GA 3TPUA 3ZXAC 3L4WA 5JIIA 2WLLB 4OVVA 3M1OA 1E8WA 4B9GA 2JJTC 1UOOA 2ITCA 4ANUA 2QSCL 2Q3XA 3N91A 2ICWB 4NUJB 3PABA 1T1ZA 2P52A 5DO2C 3B9VA 5C0BB 2GAZA 3I75A 3MUGB 3V4VH 2VSKB 3FOMB 1KPRB 3KLQA 3I02A 4X98B 5C2UB 4UI9R 4KQ0A 5FUOH 4MCNA 5F3HB 1N70A 3H8NA 3V0HA 1CICC 4FNSA 4F2EA 1AZUA 4X63B 1PLAA 1DP0A 3F85A 5E9AA 3A4AA 3BVXA 3DO3A 3CDCA 1T66D 4QNPF 2HTKC 5GQBA 3FZUD 4AUYA 5TE4L 3UTSA 5FYLH 1BX2B 4N8VB 2J8UA 4NFBA 5F88A 3WEOA 4Q9CA 2D9QB 4G71B 2VOTA 2FYYB 2UV3A 4MS8D 2NY5L 5F93C 1E27B 2C7UB 4Y1AB 5ISZE 3MCLH 3I75B 3MUGA 4QD2E 4N8CH 4LVOB 4X83A 5GXIA 4MJ4A 3MA9L 3QUHA 5TF2A 4XWOD 3MHZA 1A8ZA 4LHJB 1BVNP 2PTUA 4NJAH 3TEZA 4QYOA 3L1EA 3TV3L 1DFBH 4KNSA 3VYPA 4W93A 1XFPA 4KRPB 3IKCA 4H26A 4LPVA 4DFIA 1FO0H 1MCDA 1OZUA 2BMKA 3IN2A 4U33A 5IB5A 3OWRA 3U0WL 5D2NE 5EIQA 1A9EA 3E6HB 1BXUA 2JCCF 4G72B 1PS3A 1WFNA 5E9NA 3P9MB 4BEIA 3K7UA 4CADB 1SRDA 3EJCA 1XL6A 4YDLB 1WBZB 1H3TA 4AGMA 2IAMB 4Z77A 3JVFC 3LH2L 4J81A 1INQA 1FO0L 4ZW5A 3H7BB 3BZEA 2HKRA 4WHTB 5EM2A 4I4WA 3MRBA 1U33A 1A64A 4JPQA 4HK3J 4NSKA 2XPGB 2E27H 5GIRA 4EZKA 1HIMH 3RIFF 1BQHA 2LLLA 4FJ6A 2APFA 2UXFA 3WLWC 3E6FA 1VPOH 2VDRH 1L9NA 2EDFA 3KGUA 3L3KB 2JIXB 4HD9A 4J4PC 4M9OA 3D25B 4JDVA 3VMNA 5INDA 1CTNA 5I8KH 1U91B 5IJ8E 1A0RB 1QEWA 3VW3H 1U3ZA 5IKCA 1MJ7L 3D2UA 2O5ZL 4BXVA 1JPST 2KHAA 2ITFA 4U1SB 5B39A 2DD8L 2IAMC 5EMJB 3AACA 1KC5H 1UXLA 1UB6A 3SHFA 4R96B 3CTTA 2I24N 3MLXL 4UDUA 4WW1A 3SSGA 2IAAA 2JIXA 5FHBL 5I18L 2E9GA 2B1AL 2ZT9C 4Z8FL 1SN5A 3D33A 4L9LA 3RTLA 5M95B 2GFBB 2OR7A 3QIWA 1PZCA 3CFJB 2BOLA 4JQIA 3UCRA 5IB2B 2JKJA 3NGBC 1WZ1H 5DJYA 4HJUA 3LAFA 4X9FA 4A7SA 4OV5B 1JI1A 2WM0A 2W18A 5CD3B 3ZQ9A 2MKWA 1WIOA 1KIPB 1ZS8B 4Z7IA 2YQ2A 3L5XL 2W9DL 4IMLA 4JRXD 3ZQXA 1BVKB 4BZ1L 1AACA 3LEYL 4OKVB 4ZMNA 4Y7OC 2BC4B 2FGZA 3IDMB 5DJ2A 5IHHA 1YNLL 3FBQA 5DMGD 3LN9A 3TTSA 4JB9L 4M02A 1X6NA 1CGVA 4FXLA 1TTBA 4XXCA 1A14L 3MOAH 4V33A 5A2BA 5C1MB 2YO3A 1MDAH 3C6LD 4RFEB 4CC9A 2CRMA 2VAAB 2CNZA 1AO7B 2IDSA 2EICA 2VLRE 1P9MA 1U2YA 3DV6A 3FQ4A 4G11A 4NYLB 4PRAA 5JXAH 3T0EA 3SDXB 4NC2B 3AG1B 4WFHE 4NN5C 4PD4J 3T8XA 5ICXA 3B7UX 3FRPB 4E41A 3FT3A 4K3GA 3MRLB 4P5TD 1FE8L 3WEXB 1XGUA 1NUDA 1LK3L 3CFDA 1EGJH 3TBCA 2JJVA 1U8IB 5AVXB 3FN0L 5IFHH 1FWXA 3M7OA 4LDEB 3QQ9C 5H4ZA 4U7AA 3C60A 3AB0B 1RZQA 1AD0B 3V6FB 1NOLA 2HG0A 4JANB 5EZIL 1X5AA 5CYKB 5C0IA 4K8RH 2VZ3A 3F5WA 4HIIA 4UAOC 3VXRE 3AREC 2FX7L 1NGWB 3KL0A 1DJSA 1GAFL 2UX6A 5I16A 2E7MA 5F1OB 3ZKSD 1FJ1A 2FNBA 4P5RA 3P9LA 2D7TL 2NOYA 4LSDA 4TQEL 4XNYL 5C0CD 1P7QD 5MI0B 4ZOXA 1XH3B 2CM5A 2WUBH 1J0ZA 2I5YH 4MD4A 5F7KC 4A7GA 5EMKB 3RVVC 5AWNL 4U1KB 1M3IA 1C16B 4HMDA 4UU9B 3IVKA 5D4HA 2VL5A 4PRHB 4WEBH 4M61A 5EU6E 1J5DA 5DZNA 5D7LE 4XCYA 2CWRA 5DJYB 1Q1JL 4OAWB 4Y5YC 1GJUA 3EDEA 4ODVH 4NCDA 3MVSA 2HKHL 4OD1H 3QWRA 1IARB 2PCPB 5BRZE 3JTBA 1Z3GH 1OAJA 2YJQA 5KYXB 2YFOA 1ILUA 3HNSL 2YBRB 3VI3E 3VG0L 4AVHA 4AOWA 3CFQA 1AS6A 2DQHL 3SDAB 4ELMB 1I1AD 3AQXA 5JDSA 3VXNB 5DJAB 2CLVA 3Q1SH 5IJDC 1DL7H 4F8LA 3FTSA 4A09A 4RSVA 5ESVB 2X9WA 1QI3A 4PRIE 3NH7L 4WV1B 4X8JA 1EHLH 3LPFA 1GTFA 1AO7A 3DV6B 3F7KA 4K94H 3L3OC 2KLTA 3ZTDC 3HRZA 4ZUUB 1SLWA 4JHAH 3HE6B 5HGAB 3IB4A 3VI3B 2JKTM 2WLIB 3ULVE 3IETA 2AI0H 2ZCHL 2VLKE 3SN6N 2ATAA 4NPJA 3WNOA 2WVVB 3T6XA 4FABL 3VH8B 1JDAA 1Y6NR 2J8UF 2FJFA 1QOKA 3TONA 1EHLL 2MCG1 4WI2A 5E2VL 3O8XB 4W68A 4EBQH 4TMPA 3M07A 1V3KA 1K8KC 3SO5A 3CZLA 2APWA 1M1XA 3L5WB 4Y89A 5DD5L 1W15A 1LK2B 2WKOA 4MA8L 5JHDE 1DE4A 4NZTL 1RK1A 2CUHA 3WJMB 5I19L 4J3UA 3Q43A 4KXZH 3NJKA 4OLUH 1GMEA 1WO2A 4FNLH 1MW2A 1GPOL 3UTPE 5IOPB 1F4YL 2YGPA 3EH2A 1GY2A 2YKLL 5K9KA 4JM2C 3IJHB 3ZKMD 1RAMA 2G2RB 1EBPA 1FNEB 3NVXA 1G7MA 3IBEA 1VA9A 2WXLA 3G5ZB 5E1IA 3T1FA 2B20A 3SE9L 5L8JB 3IAGC 2WKLA 3QHYB 3SPHA 4DIXA 3EUDA 3I9AA 4PS7A 4UMSA 3FQTB 4JFFA 2AJYL 3FQWA 1QHQA 3QDJD 4LLMA 3FNKA 4MZ3A 4RGNB 3UL4A 3K46A 5HHXH 2X7LA 4B7LA 4P2AA 3KPMB 2CE6A 2YOAA 1U8NA 1U8MA 1VGEL 4XXDA 3ARTA 1E40A 3SDAA 2PYEA 2XYCA 3QQDA 4DESA 2PW2A 5F89A 4UM8A 4QKTA 1JGLH 3K71A 4QT5B 5DRWA 3MR9B 5BRZD 5I2IA 2KT6A 2P28B 4JT6C 2Q7NA 4KO7A 2P5WB 4GKOA 4JFFB 3UVOA 1OD7A 2CLVB 3VTAA 1HQRB 3QIUD 1DBAH 4ZOYA 2WWKO 3E0CA 4K9EC 2Z7ZA 2J43A 2Z92A 1NCIA 3OL2A 1RHFA 4A7QA 4WK0B 4F5CE 4G80A 2K6ZA 1KUMA 3HZKB 5FKTA 3AWEA 3GRWH 4F8TA 3D18A 3EYVB 4JRYE 5F44A 4MB1A 1SVZA 5JXAL 1MIML 1SOKA 1YMHA 3LXAA 4J0WA 1BEYH 3LZLA 4KDWA 5E1AA 3VXUA 4BGDA 2FZ3A 1SDDA 3Q8EA 1YA5A 1CLZH 2GABA 2P9RA 3LV3A 5D4IA 1D7BA 5LQBH 4JR9L 1FNAA 2QFRA 1FVCA 2VXVL 3BT0A 2PNDA 4PRPB 5E2WL 1ET7A 3GMQB 1ZMYA 2R0ZL 2VMCA 2EIBA 5HYJA 5FW6A 1PEZA 4Q9QH 2V37A 3QQ4B 4DKAA 2Z93A 3BZFA 2YMXL 3FTYA 1CPUA 1IC1A 4OM1L 1D9KA 3CZSA 4S2SA 3VE0A 1XGZA 4CAGA 35C8H 2G75A 3QJHA 2O30A 3QG7L 4QY8B 3VB9A 3H9SD 5I1IH 5I1JH 4PU2A 1MCBA 1W8EA 2ZCKH 5EAPA 4LU5L 2KQMA 4YDIH 4BWTA 4LL1A 5IHWA 5C0BA 4W9IC 2QSVA 1ORSA 2RQEA 3FRXA 3BP7B 4HHWA 2ZIDA 3B2MA 2AITA 2HT4C 4Y2NA 4PJXF 3GLAA 1N10A 2F68X 4GQPH 2BVOB 2FAUA 1W6WA 4M8UA 2AJSH 2VDQL 2CNXA 1G1OA 2OSYA 2Y36H 3O2WH 5IQNA 3EOYG 1FSKB 1N64H 5CLXA 1E8NA 1A6ZB 5DVPA 3UEZA 1U92B 1NC2A 3VXMB 3F05A 3V4LA 4ZUWB 3RX9A 1T2XA 4YFLF 1J5CA 4UM9D 4JB9H 2ADJA 4ODSL 1FIEA 5FYJE 3HPLA 2BRQA 3P77B 1VRSA 3L5IA 3LQAH 2VGLM 3NDZE 2Y36L 2EAEA 1IC4H 4JFHE 4ALAL 4NQXA 1SN0A 3P3TA 1LHZA 4OCWH 5IB5B 4PIBA 3KGTA 5DZOA 4MLSA 1RIUL 3VACA 4HDJA 3N1PC 3OMAB 3MRKA 1UZ6F 3L5XH 1YEWA 4MDIA 2RCSL 3IIWA 3R0NA 4ZOAA 3OXRB 4N90D 1J88A 1DQKA 4ZXBC 3NCXA 4M5ZL 1GPOH 1LEIB 2DJMA 4GYBA 1CE6B 3VXMD 3K0WA 3JZHA 2H1PH 3EH4B 4GW1A 2N0KA 4OB5H 3NZHH 3GI9H 3V4VB 5HHME 3AUWB 1FL3B 2XKSA 4CC0A 4LSRH 1QRNA 1MFDL 3WHE0 3ZE0A 3DDGA 3MN8A 1SXSA 1I8IB 4PJCA 5I73C 1K9TA 2N7AA 4L3GD 1KCKA 3IULA 3FPXA 4R2GD 2YMXH 3U7YH 3TBYB 3O6LL 4ESKA 4MXWL 3HG1E 4WKXA 1CXKA 3C6SA 4BZ2L 4TUOB 4I3GA 2MNUA 2CZNA 2VB5A 2ZYSA 4AQEB 3HUJF 4DO4A 4WGVB 1NEXB 2G3NA 1BW8A 2LR4A 2XWEA 3BDBA 3K6DA 4FXGA 4X6DE 2JWYA 4JFEB 4D7BA 2B1HH 4PV9A 4ZPTB 3B3IA 4YDVA 3HNVL 5CEZE 1SJEB 3DXAE 3WY3A 1MF2L 2IFGA 2UXGA 4H8UA 2QLYA 4GS7B 4BHUA 4GUOA 1KJ2H 4LIQH 1E4XI 3DSNA 4U3CA 2XZGA 4LCWA 4PJHF 4AE0A 3QDGE 3WSQH 3RL1B 4J86A 2VM4A 1T0PB 3FH8A 5H1MA 4D7PA 2KLSA 4G7VH 5GXBB 2MHAB 3MA7B 3KLLA 1NFDF 4R4ND 4JO4H 4ZUWA 5TH2B 5AAPA 1TJHL 4M5YH 3VXSD 1TKWA 3L3GA 4LCIH 3GIZH 4PV9B 1MWAB 3GRWL 3B3IB 4YDVB 1X5LA 1MCOH 1R0AL 1HL5A 1KEML 2AF2A 1A22B 1YNTA 2EIDA 2Q9OA 3IJSB 5TE6L 5SWQB 2P43B 2NY0C 1ADQL 3BH8B 3NFNB 4HWZB 4N20A 4ZOZA 4JMNA 3RI5K 1ZV9A 4I13B 4NQCB 5E95B 1X7QA 5KYUA 5TTRA 2ZICA 5L88L 4HJEA 3CX5J 3A5VA 3WU1A 2IAAC 4PBYA 2NY2D 3Q0HA 4GMTL 4DUVA 4HIEA 5I0YA 3V5HB 4H1LH 3IRPX 3FC8A 3OLEA 3BH9B 2J55A 3DUSB 3MUOA 2FJUB 1S7WA 3PXJA 1LD9B 5DJ0A 5GJSH 4G5AA 1JF5A 5F96L 4CDGC 1R5MA 3V4VA 2BRRH 2CD0A 3KPLA 4KMLB 3WDIA 1CE6A 1CFVL 1NC2D 3DX6A 3F62A 5E4EC 4ZUTB 1NUGA 3KNBB 5HYSB 2HFGH 2RGSA 4OFDA 3L3DA 4OFVA 4I5BA 5BZDB 3WEXA 1X5IA 3DURB 3DUSA 3J8F7 4HWUA 2FYYA 2ZZUT 4U1MB 4NEHB 3O4IA 1LO5A 1G7LB 5D72H 5EBWB 1NEZA 3GUFA 3E2HB 2EDKA 5D93C 4PG2A 4ATWA 1H2XA 2CN3A 1G9HA 3BKMH 1KB5H 4WK4B 5HDLA 3EFDH 3A0FA 4AC4A 2F53D 4B27A 4BP8A 2FQGA 2GC4C 5F1IB 5AENA 4D6VA 1L9SA 2JKSA 2OMUA 4P3CL 2CBPA 2IOIA 2I9LB 1GZPB 2W9LA 2HAZA 4G6JL 5JIQA 4JY4A 4OF6A 1NFKA 2CN2A 3ZE2E 4MKTA 2XNAA 4JBSA 1X3DA 5C0DB 1AAJA 4LCWB 3KXFE 4A2MA 4A2DA 1PKOA 2OSLA 1EVTC 1I8KB 1KF9B 1TCMA 3JWDC 4NWTH 4XHJD 3UBXI 4MD4B 4QF1B 2XY2A 3NIFF 3RHWK 3RZWA 1KTLB 4PMEA 3RWJB 3MLTB 2BIOA 3I3DA 3ATFA 1NFDE 3MRPA 5EZJA 3CZNA 1RVFH 4NRXA 2VQTA 1IQWL 1JG9A 3T3MA 5GRZA 3WKPA 43C9A 5JOFB 4A2HA 3NT0A 2DV6A 3IU3B 3F58L 3ZE2B 2WCGA 4U4IA 1MLCA 3O8XD 1RMFL 3L4MD 3QFGA 2YD2A 2ZX7A 5IEKB 2A6KB 3VXUD 3PWLA 5M5UA 3WKML 2L7UA 2M83A 4HUUB 5E1GA 3HR6A 1JXKA 5GISH 2GJZA 3L4ZA 2Y6SC 2VDLB 4OSUH 4MNQD 2Z91A 1DBML 5E9DE 3CBKB 4DF9A 4F9PA 4Y9BA 2CDGA 3QJRB 3BVNB 5F7DB 3FRPA 3NUKA 5DRZB 4P2RB 4OLZL 4NCC1 4OLYH 3CFSB 3MNZB 4AGQA 4ALAH 2VM9A 1XGYL 4P3WA 1P7QA 3QZNA 1J9CT 4GG8B 3C09B 1TJXA 2NY3C 4UTBL 2WGXA 4ZJ9A 5BS0A 4BCDA 5DD0H 2MQ3A 2ORBL 3OR7B 3P73A 4RA0C 3TIEB 4AYMC 4MAYA 4ZFFB 4KHXH 5HGGS 3J2PA 4M8QA 4FFZH 2TRCB 3UKRC 4JDTH 3ZYIA 5GGUA 1REIA 3BJLA 3QSKB 1F97A 3RVVD 2XJLA 4TSBL 4MD0B 4FTVE 2F08A 2Z9TA 3ZGHA 4O5LL 1IT9H 5JIKA 1MFBH 1LYQA 1OCRB 1IGTB 2GEQA 3VSQA 1CFSB 3A0OA 5IQOA 1ED3A 1DQIA 4JE0A 1NAMH 3QIUC 4M8QB 2I0SA 4PJ5B 2VLRD 3OC5A 4K23L 4ZZKA 4EWRA 3VXTB 4CVXA 1P2CA 4KZEL 3GXUB 5C0JA 5JXEC 4ZTPL 1YN6A 4GFTB 4FXKA 4NNXB 2AH1A 2Q20A 1OGPA 3E8UL 4F7TB 4QHLA 4FNUA 3W0WB 5HHPA 2P8LA 5FYJU 1UZ8A 2PYEE 2ZOLB 3TCTA 2XWCA 3MRQB 4CC4C 4L4TE 1OCOB 4KUCF 4TLKA 5CBEA 3SY0B 1UKSA 4PJFF 3NSFA 2FL5A 3C9NA 2YZ8A 3OF7A 3GHEL 5M5SA 3UPAA 1YEHL 5JOFA 1CE1L 3SDYL 3HI6H 4R84A 1MLCB 1D7DA 1I9JL 4FHJA 2C1OA 4WV1A 2AEIT 3BT2H 4EKJA 1HWGB 2HRLA 2R83A 1I1CA 2FVNA 2D4FA 3C2SA 3GHBH 4QRUA 4S0SD 1F56A 2BP8B 2E59A 3PGCA 2WJ7A 5D1XB 1NBCA 4G9FB 3EYOA 4LEXH 4I4WB 4WHCA 1NOAA 1Y0LA 5FKPA 5BZWB 4NSKB 4ES0A 3QUMH 5D2LB 3MZKA 1YEHH 1SOXA 5I1GL 2IGFH 3GSVA 1MCQA 4UT7L 3O3AA 1JDCA 5DI8A 2PWEA 5EMLB 5CAYB 4OCSL 1N59B 1KBBA 5BQ7B 1TVBB 5I1CH 4N0FA 1A3ZA 5IT2H 4OI8A 3AU1A 3L4OD 2ARJQ 5C0AB 3WNNA 3LRLA 5DC4B 1LMKA 5CXBB 4TNGA 3DXKC 4OW6A 5HYQA 1OAZL 3NRFA 4KKAC 3RIKA 3WELA 2UZYA 1CFVH 5IHUL 3D0VB 1X4ZA 5K9QI 4BA8A 4KWUA 4UNUA 2OV0A 4N0FB 1T6WA 3BVTA 4LARH 4MA3B 5DEJA 5DDHB 4EN2A 1G4RA 1K6QL 4L29A 4JHAL 4KAQL 2DM4A 3O6LH 3E9TA 3Q44A 1Q72H 3U46B 5I17A 5KVEH 2JCCA 5I8OH 1NC4B 1R46A 2B08A 2CBQA 2K70A 1CXEA 4LNRA 3MGTB 3O3UN 1UJ3C 2HP4A 2ZOLA 5ACLA 3LQAC 4BH6A 3UTZA 4HZLB 5E2TH 2B59A 3VWKB 3CK0L 3K6FA 2ZG3A 5D9SB 2NSXA 3IDMA 2QQLL 3V0WL 4ZZFA 3VFUB 5A2JH 5DJZA 2NX5D 3ILPB 1VB9A 3SHSA 4J84A 3ZKQD 4GSXA 3SDCB 3CE1A 4D94A 4KI5F 3OJDB 1JMXA 4HIJA 4OLZH 5H4YA 3S37H 4AVJA 3GSXB 3IJEA 1ZRUA 2VAAA 4YXKL 5C0FB 1JAEA 3UABA 4DP8X 4DAGL 4RAUA 4J3XA 3EYOB 1A4JA 3IMBA 1JTOA 4OT1H 1YYML 3OKYA 4UIKL 1ODUA 3WDJA 3UVLA 4Q97A 2NDFA 5KYNA 1Z66A 2H8PA 3VGFA 1PKQA 3OMZA 2VW6A 4NO0D 4KOBA 4FEIA 2XG5B 4QXUL 4Y16C 6FABH 4HIJB 2ZUYA 1R5WB 3TFBA 1RCYA 3HZVA 1JMXB 4G8IA 3BPLC 1A9VA 5LAXB 4X3EA 5JW5A 3LKRB 1BREA 2XQYK 2Y07H 5J13C 1NPUA 1X9UA 1PNCA 2F19H 5K19A 4KY1L 1LP9A 2XBTA 1EA9C 4GI6A 4ZMPA 2J1ZA 1GGBL 3UG5A 4UT9H 4YFDB 4LLDA 5F97E 1FNGA 3CFBB 1DEDA 3QH3B 4KDTA 2A4CA 2MSPA 2BDNH 5AAMA 4NNYB 4EUPB 2UYLB 3LSOB 3VFGL 3RWCB 3SBPA 1QPPA 4PGZA 5DHVH 5CP3H 5A43C 1J8RA 1WBYA 3HFFA 4XB8A 3ZHKA 2KH2B 4CY3A 4HCRL 2ATKB 5FLUA 4K3JL 1PFCA 2BFVH 4XBEH 2LTQC 5FA3A 3IGUA 1KLFA 3ECWA 4PPTA 4X9HA 5BOPA 4OZHA 3KPSD 2XN9D 3IXAB 2HWZL 1OGAE 5DQDH 3BUTA 1AIFB 4HZLA 3CH1A 1OW0A 3MYJA 4ANVA 3WUZA 3MKQA 4JS7A 1HEHC 1GP2B 4DGUA 4GQ1A 3VI3F 2HLFD 4HALA 4XHJC 4JR9H 2C26A 4PREB 1WBZA 2CQVA 3MNVA 4I9WD 4ZXBA 4QJ3B 3QJSB 3HFQA 5B8CB 2HMIC 2O6DA 3KDMB 5TDPA 3TWYA 4XPGH 4N2AA 5FYKU 3MFGB 3U79A 4ODUB 4AE1A 4J8GA 3K5SA 3LKSB 1YCSA 3RAJL 4EI6A 4CI3A 2OTWA 1DL7L 4Y19E 4AN0A 2ROYA 3A6CL 3QJZA 3RJQB 2Q0ZX 1IGMH 2OMWA 3PCYA 3U9UB 1TZ8A 4UQBA 4FAVD 4Y88A 4BSVA 3N2JA 1F13A 3IETB 3SGKC 3QFDA 3ZE1A 4O2EA 4FG0A 1ZVNA 4KUZH 1W0WB 3IXTB 4GLRH 5IF0A 3VXRB 5IG7A 1WJ3A 1KIQA 4MQXC 3UKUC 1TTCA 2DKSA 3IGAB 4FQPA 1G1YA 5AW5B 1SMAA 5B4MC 2R39A 4NGHH 1TU2B 3TURA 5JW3H 3CFMA 3PSCB 2EYTA 5MEOA 1YDPA 1UCBL 1M05B 1Q4NX 3DOHA 3TZVD 1LEIA 4WTZA 2VDPL 2FQFA 2WJ5A 1U8KA 4ZMTA 2WTOA 4OZGF 2GFBA 3QIWB 3VFRA 2Y06H 2YPLE 4Z0BL 3NG5A 5IF0B 1CG9A 3GRGA 4YFLI 5CFHA 4HBCL 3ETSA 2IG2L 2GUYA 2OYMA 4KVNL 3BD5A 5FYKH 1PU0A 2N56A 3GEWB 1R34A 2EYTB 2IUVA 2ADGB 3MCKA 5I6XB 4A2EA 3CLEH 2BS9A 1J8SA 3QIBB 3AL8B 1VFMA 3MLPA 1NQBA 4PIRF 3JTTA 3K6SB 3N9GL 1Z5LA 1G9NC 4N1CA 4JG1L 2OR9H 1BFTA 5JQ6L 5BVJA 2AGWA 2J6EL 3QWOA 1DBBL 5IR1A 1BVNT 1K3ZA 1KBWA 4XNZB 1AQ8A 2D31A 1CVRA 2VRQA 2BZ7A 5AKSA 5B1JC 3DSNB 3RPIA 3DMMA 5BJTA 1RERA 4NAMA 5F1KC 1JPEA 2DQEL 2OTUB 3NJFA 5EZLB 1HYRC 2I7OA 3P77A 1FBIL 3ABMB 4L48A 4Y5VB 4JO8A 3QUXB 4OM0L 1J1OL 5EIVA 4YK4B 3TEUA 2NY3D 3SDDC 2XX1A 3WTTA 2XWXA 1UD4A 5E8DL 4P59H 3SYPA 2P5WE 1HQRA 2J6EA 2V5RA 2FSDA 2EE0A 3WCYA 3KG5A 3OWEA 3Q1EA 4C58B 4KJYA 1HFUA 1WWAX 5JPMB 1BHGA 4NM8L 4N2CA 4W1TA 4I1RA 5T1LD 5EOCL 4N2LA 1XHHA 2HA1A 5I1EH 1YG9A 2BVYA 2O72A 2B2XH 1OP4A 2GAZB 5DUPL 2CDEB 4BZ1H 1ZIBA 3C8HA 2DWDA 1FYTD 4XNDA 1UT2A 4A2GA 4AENB 2XTSA 3PWPD 1ZLWK 3OHXB 1T0MB 5FCUH 5IESH 1H3VA 4MCMA 3V7DB 3QJFB 4ODHH 1T5WB 5BXFB 5JIMA 1TZGH 3UZVA 1U95A 3CN3A 4X5PA 1INQB 3PLYA 1HOEA 4R26H 4P5KB 4G55A 1IEAB 1R3LA 5D6DA 3V8CA 4MJHA 5TJWK 2AABL 2NX5A 4JPKL 1TTUA 4UT9L 3RWGB 3WLBA 1A3QA 3W5NA 1XSIA 3ULEC 3IFNL 4Q6KA 5IROC 3IJ7A 5B3NA 2HXAA 3IDGB 3DJTA 1K4DB 3O4JA 3P54A 2FNWA 4WNQA 3CXHK 5I1JL 2ZONA 3K5RA 1NMBH 1MCKA 3SJVE 1ZHBA 3F3PA 3MV9A 3RGVD 1W91A 2YIHA 1IM9D 2IXQA 4WQOA 4JRYA 2GC7C 4X6CE 4F9PC 1R24B 1IM9A 5C0DA 4AGLA 5FW8A 5K9OA 1B2YA 3BDXA 2ICES 3T6ZA 5EBLA 3IMTA 2YSSB 1GSMA 4JPIA 3T6WA 4Y2OB 3SCMB 2B14A 2BK8A 4POZD 3OKNA 2Z6FA 3AMKA 3HRZB 4ZUUA 4Z7WF 2MTAA 5LNDA 2D8KA 5J9PA 4NRXB 3MV8D 1BJ1J 2JCCE 8FABA 3DA0A 1TEGA 3PHQA 4LRIA 3IU3A 4Q6IB 1EO8H 2L7QA 2P8LB 4WEEA 4HLJA 3L54A 2ZAIA 5GRVL 4OJEH 4H4NA 1MF2H 3FTUA 4XRCA 4ADJA 5GS0C 3T0EE 1GZHC 4GP4B 1O7SA 4CBZA 3ETTA 1EANA 3HZMB 4E9LA 4QTIH 3KPQB 5JW4R 5C9ZB 1NAKL 2VDNL 3HI6L 3T0BA 3IKOA 2O4EA 1SXZA 2VUOA 4KH9A 4NSXA 5AJAA 3LN5A 2R29A 4YPGB 1DVFB 1OK8A 4Y16D 4LG8A 5EO0B 1U41A 5AW9B 2R69L 4YGVB 1DBJH 3LHPH 1MW1A 2WNGA 4GW1B 3C5SB 2HN7A 2G2RA 4FADA 4PJ7F 4QAMB 4GRWB 4P5KA 4D9QD 1RSFA 4A37A 1CI3M 2X4TA 5BXFA 1HJCA 1XAKA 3PU7A 2CBMA 5GGUB 3AY4A 3QEQE 1F11B 1QLRB 4ES8A 1GYVA 4ACTA 4LLVB 4MMYA 1L9MA 4TPRL 5LUMA 2NY4B 1MQ8A 2CO0C 2J71A 5EUOB 5JWZA 4WNJA 3LEVL 1ITCA 1DVSA 4AQEA 1BEYL 5EN2B 3C5ZA 4QOKD 2TSBA 3B43A 5IC7A 3GPEA 4LVNC 1WV7T 5EFIA 2KLRA 4YK4C 1JZ5A 2W9EL 4CGUB 4OM0H 2W1NA 5E2VH 1P2CB 3S8GB 4PJIF 4A7JA 3BPNC 5DGQA 3QUKA 4DNVA 4NZTH 4F7TA 4PJ8B 4M7LH 1QHOA 1KYDA 1XQ4A 4KHXL 3TT1H 5I17B 3ARGC 2ITDA 1MZZA 2K3HA 2AGJH 2KPWA 3V0DA 4I85A 2VLRB 3RDTC 5JDJA 4ZW6A 5F9AC 4YFEA 2I85A 3T6QC 5MEPB 4LZKA 1ZEAH 5IMKA 4CL7A 5BO0D 1LE9A 2ATPB 1BV8A 1YMHB 1NCCL 2XYBA 2ZOTA 4MDRA 5JHDD 2VLJE 3TEWA 2DYPA 2CALA 2PCPA 3ZWLB 2Y1YA 3FU5A 3HC2A 2WQVA 3ZTNL 4A68A 1JK8B 1WCBA 2ZPKL 3S5YA 5IHBA 3BCFA 2J56A 2XV2A 1XL4A 4Z7QA 1SXCA 4EO5A 4F7EA 3ARBD 3LZFH 4G8AC 2OMZB 1I1RA 2A1WH 2X4QB 4PLKD 1UWGH 1DVFA 1RUQH 5JOPD 3JZNA 2MQCA 1FZKB 2DYPB 3FCUB 4NGHL 2A74B 4KNUA 4NQSA 1YEDA 5FYKD 1KTDA 5I0VA 3GEFA 5L2KA 1BYNA 4MS8C 2X9ZA 2Y6SD 2BNUB 2YQ3A 3CSGA 1URIA 4PGBB 1YECH 4RGOH 4QRBA 2PBIB 1YC8A 3BYYA 2R69A 3FO9B 1T0NB 4KMTH 5HJ3B 1T21A 4YQXH 2Y6TE 4K3EL 1PQZA 4QWWC 5IFJA 2EDXA 3DGCR 3ARVA 2NXZC 1D5RA 2V5YA 4JFYA 4N86A 2VDOB 4FQQA 3SDCC 3VGAB 3MRQA 5AFAA 4DEPC 3MLZL 4ELMA 5IJCC 3K4AA 3WS6C 3KLAB 5D2LF 3EBAA 5A16A 1F4XH 4PVNA 5THAA 1JTPA 3RWCA 1CLZL 3U7WH 1T03H 1OKEA 5HYJE 3DK0A 1JFQL 4OGYL 3FSZA 3HUJB 2Y7NA 4N8PA 4AV5A 4PGEA 2A0LC 5CEXA 3DTXA 4H0HB 2EEXA 3VWJA 3IUMA 1G9ML 4OZUA 3X1BA 2WXOA 1V10A 4EDXA 5CF3A 4JJ5A 1I7ZA 4KTGA 4N8UA 4NHCH 1B0RA 4AMWA 1I3RA 3RLMD 1OGAB 2YK1H 3LS5L 4ZFOB 2ICWI 4ZS6C 4O4YH 5CN2A 1FG2A 3VFWB 2P5PA 2YD1A 2LFEA 4Q74A 3BWAA 3NIGA 1H6EA 1DQLH 4B41A 1JGVH 3TCLB 1JK9B 1V05A 3HE7A 4QO1B 5FV2A 3DI2B 3MRGB 4LPWA 3BKJL 3KE0A 2X4OA 1AGCA 4IKKA 2XZQH 1UH2A 1A4CA 4FJYA 4Y4FA 1DANT 1FL5A 1TFPA 1CZ8L 4TTGA 1OCZB 4G7RB 3M45A 4HS3A 4NAAA 2JJSA 2Q8BL 3GHEH 3REVB 1MKFA 5IQLA 2F54A 4YN3A 3KMDA 1CL7L 1GHFL 3CN2A 3CXFA 2AQ1A 2DQJH 5KYYB 3EJTA 2C3HA 1NFDA 1TR7A 2JKRM 4QMEA 1I53A 4QT8A 2Z31A 3KM1A 1RIVH 2EDRA 3DGGA 4OZHF 5DVKA 4LEOA 1U4FA 2Z7WA 4X6DF 4B0MB 4WTQA 3O11B 2YXVA 2XDHA 1FN4B 4JN2B 4R7VA 4LPYA 1UFUA 4XMUA 3ARDA 3FN0H 3QZOA 1GJIA 3SGJA 1BZOA 3IPEA 2DQJL 4XNXH 1F8TH 5AOJA 4FZEL 4BH7A 3SPJA 1EFQA 4U6YB 3TPKA 4K5NA 4JRFA 4X7TB 2I25N 1DHKA 5FFOA 3BLBA 4KKZA 5E56A 3HUJA 3EYFA 2ENYA 3B34A 3RWFA 4PJ5D 4AEEA 3QEGL 4XMPH 4L9OA 3EI4A 3EOBA 3QI9C 2FSEA 4V1DE 3VM5A 3EG6A 2Q8AH 3QPXH 5AFU3 4FABH 2KUTA 5DK2B 4HDIB 2JV6A 4G80B 5DZ9A 1ETZB 1B4JL 2WQWA 3B2DC 1L7TL 1TYEA 1EGJL 2XICA 1T1WA 3VWJB 2GBTA 4FQ1L 1AANA 5FC9A 3JV6B 2VJXA 3VXQA 4D0BA 4OD2B 4GG6E 3A3YB 8CGTA 4JFXB 1OM9A 1S7WB 5LXGL 1M53A 3EI4B 1VKXB 4E5ZA 1CXHA 3MBEC 4JKKA 4DSYA 1M42A 4LAQH 3AT9A 3RX8A 3DTUB 4PP2A 4Z78A 4ODVL 2QR0A 4N0CC 4CSPA 2UZXB 3EO1A 1MH5A 4ZUTA 3G5XA 1SXBA 3VFTA 2BKLA 2GC4A 3CLFL 4ZTOH 1JWUB 2VDML 2GITB 3BIKB 4KOCA 3UBXG 3RWDA 3J80g 5I6MA 3OAYH 2VUKA 3LSOA 4OIAA 4Y5XA 3FOLA 2YPLB 4H8HA 1NIDA 2XWBB 1JHTA 4HJ1A 4XPAH 3EADA 5F3HA 2Q8BH 2GCYB 1JP5A 3IFPB 4PRNB 1SOSA 2ENJA 4ZODA 5I15L 5M5RA 4APQC 4BFIB 5EO9A 5KSBB 4EUPG 3HHMA 3LNEA 2K4AA 3NCJL 1MCRA 1JZGA 3ELQA 1I8LC 5E6SB 3DBXB 1E9PB 2FHFA 1JGUL 2F1AA 3ARRA 4KJWC 4Z7VA 2BJML 2XCMC 3H9SB 2AGYA 1MRCL 3O41B 1HL4A 4RFOL 1X6LA 3CGTA 1A7NL 1KTLA 1WEJL 1H6UA 2GQHA 3AWGA 4PQXA 2X05A 4S0HA 3CX2A 4OGAD 2EVHA 3CDGB 4B0MM 1NWPA 2X4SA 1G7JA 4BH7B 1UWXK 2AKRA 3ENEA 3NZSA 5JO5B 3U1SL 3OKKB 3NYKA 4YMPA 1WQVT 3WKQA 5JA8B 4FX5A 1QP1A 2WQ8A 2ADJB 4HK0A 1HH9A 4GOSA 1RZJC 3ESUF 3EW3B 3AXLA 4L3AA 3JWOL 2APXA 4ETQA 5BV7L 5KW9L 4ERQA 3VM7A 3P9WB 1ZVSB 3LKNB 2Y5TA 3WIHL 5I5RA 2KBGA 4U0RC 1IM9B 4MDIB 2ZSVB 3Q2CA 3KL3A 5DRXA 5HDBB 3RPBA 3O6FA 4N25A 5CZVL 4JM2A 4AL8C 2AH0A 2BBKH 4PRHE 4ZO8A 5EC2A 4M1CC 3T3PF 1VKXA 5I8OL 4LGSB 4MAYD 4FAND 1WCQA 2KI6A 4PUBL 1O6VA 1M05A 3QUYD 1H8LA 3MU3A 5C0ND 1VGEH 4F7CA 2E75C 2OPCA 1NGQL 2WCSA 5ICYB 3M17B 1PD0A 5GPRA 1RU9L 3SDDD 3FBKA 3OKEA 3F64A 4MJIB 4ESGA 2IBBA 2EH8H 2P3YA 3PPEA 4WCYH 1EXUA 2ZXEB 4V1DA 5CGYC 1T83A 4FQCH 5TE6H 5IVXA 2R1WB 4EVNB 5ADOH 4X7DC 2R0LH 1OAXL 1L5GA 3HS0B 4FTVA 4JJOA 4YJZL 2LU3A 1VEOA 3Q5TA 2J73A 5E4AA 4PBZA 4IKNA 3S8WA 3TBVA 1IEBA 1KCSH 4QRRA 5BNXD 4PJDA 4GM3A 4JKLA 2Q7YA 3ZKXC 2IC2A 5L0QB 4WRLA 4CC4A 1PJ9A 3UGXA 3ULUE 3D34A 5E6SA 1AP2B 1R3JB 2NTFB 1QNZH 1I1YA 2WLNA 3B9AA 3NSCA 4BQBA 5IFAL 4YZFE 4FA6A 1BSIA 1KY6A 5BVJB 3FUIA 3MNWA 3U2JA 3LB6C 3VFGH 3VD0A 2MWCA 1WGVA 1MNNA 3OVUB 1BJMA 3RN0D 3F84A 4OCLC 1WTGT 5D1ZD 1MWAL 2EVJA 3MV9D 3FONA 4JM2F 4MAUH 4NKOA 1PY9A 1HHJA 2D7MA 4XVOA 4HETA 3LRSB 5D2NB 2FGWH 1TTGA 4L4VB 4FFVC 1NMBL 2DIJA 2MRYA 4E9WA 3FB5A 3EJPA 4UF7C 2VW7A 1MREL 3HG0A 3A4DA 3MRRB 4G6KH 3PP4L 4PJHA 5FUCE 1ZY9A 3FB8A 3MRDB 4UTBH 4W9DC 3IGKA 1HWHB 3EBHA 3L4YA 1IFRA 4GS7C 2XA8H 3OPZH 2AQ5A 4HV8A 4HIXH 1UH3A 1U91A 4E9QA 4O51B 3H4FA 2ZX9A 3H85A 4C59B 3B9KD 3V4UL 2XV3A 3LKOA 4B53A 2CBTA 5IQ9A 4ENEC 3MGOA 3RURA 4XEIC 2GJ6D 1AE6L 1HXKA 3BVWA 1NLBL 4XWGL 1VJSA 4QGTA 1UB6B 4RAHA 4HLZG 1TUPA 3OGCB 2OSLB 4YSAA 2Y2YA 2K9UA 5H37H 3D7PA 1HS6A 3U9UA 2EJ1A 5B3JE 3S48A 3QAZC 1CTMA 4HJGA 3VG9C 1E4XL 5TPWH 4QDGA 2IH3B 4F3FA 4OV5A 2VERA 2LTQB 1MNUL 2DMKA 4XPTL 4LLUB 3ULUH 2ED9A 2KERA 2ICWA 5LCVH 3VA6A 4AC2A 5DRNB 3FCTB 3FTVA 2MQ0A 4O2FA 5C07A 3MV8A 2FJSA 1OWWA 4XP1L 3ESPA 3NJLA 4P07A 1TZHA 1ACXA 2YNNA 1VFOA 1A1OB 3T4AB 1E6JL 1Q72L 4G6FB 5FYKE 2EUWA 3TBVB 2EIEA 3F7LA 3FTGB 2V7HA 4G8EB 1UB5A 2Z91B 4F7EB 1AR2A 5EU7E 5F7HA 2Y06L 1AS8A 3LS5H 4QJ5B 2D3LA 5I1AA 1A6UL 1E0OB 4XR8C 1B9ZA 4UB0H 3O3EA 3ULUD 4KTEH 1HSBB 4PLOB 3OBAA 2BIHA 1CK0L 4WWPA 5CD5D 4TSCH 3VWKA 5FKAB 2JKIS 1WWBX 3FB5B 3RWIA 4FCAA 1NFIB 3H6AA 5AG8A 2V2WA 3GXPA 3TYFB 3ABLB 4PJCE 1AXTH 3MRLA 1SBSH 4UT6L 2X4NB 4JZJB 1NCWH 1TCRB 4YHZL 4PGDA 4KUCD 2VDLL 3DDUA 2XU9A 5ID1B 4ZYKB 1JZ6A 4KGLA 1BWMA 4FF9A 1FO0B 3QDJB 3CVHL 3OZ9L 4H2AA 5F6HJ 2XXMB 4A2FA 1F3JA 3FT4A 2YMUA 2IAMA 1CT8A 2IH8A 4JJHA 4FLHA 3G6JA 2IPUK 3HMXH 3DXAB 2EKSB 2VQ1A 5T33L 4N0YH 3HPJB 2YMOA 4QHMB 4E9YA 4S1RL 4G5ZL 5I1LA 3PWVA 2YPKB 1TETH 4ERYA 1CO1A 2A77H 3LPPA 1XEDA 5HHOA 3GWJA 4FTDA 4FZEH 3FXIC 4JFSA 2ITEA 3BQUB 3MJ9A 3F83A 2W9EH 3FFOA 3ULSA 5KSUA 4AYDC 5GGVL 5D4QA 1WC7A 4Z3FA 1FFNA 2YN3A 4X9BA 4X42A 2HFEB 4Q7DA 3QQ9D 4LASL 3ZUCA 4WFFD 4H7VA 1CLYL 5HGBA 4GG6A 4UTAA 1P7KB 1AQMA 2GTWA 5T3XD 1USZA 3TJHC 2WXRA 2G3XA 4UDUB 3LKQB 2C1OB 3W9EB 1HTYA 2H7WA 4WUUD 2DWEB 3RQ3A 1Z9SA 4JRXB 1KPUB 1RZJL 2N0MA 4K7PY 4D9QE 2IPTL 2FIRT 4WJKA 2W0FB 4YDZA 1OHQA 1V5JA 4PLJD 3AXIA 4ZTEA 1TQVA 2NW2B 1UC6A 1Z0MA 4F93B 3BEVA 3C6LC 2P48B 4KMTL 1OO2A 1YPZB 2J3SA 1UYWL 5D1ZC 3VMPA 2FBJL 1U0QA 3DXMC 1ITBB 4JE4B 4LLQA 4MJ2A 4KJPC 2ICEB 3ECBB 3GSUB 4NRYB 3F3FA 4UV4H 4ZX4A 4LK4A 5CO1A 2O5YL 1DZBA 1A25A 4HKZB 4E5XA 1DQVA 1BQUA 4YSDA 1EAPB 1H3WM 4ODUA 3GUTB 2AXGB 3C60C 3ASOB 1RJZB 5I71C 5DK0B 4ODHL 1YN7A 3AW5A 4XNXL 4RGND 1GSKA 3PRZA 2H2PC 1BCIA 2ZNXA 4JG9A 5DS8A 2IGLA 4CMHC 1YY9D 5D1QB 4PJ9B 2ZKXA 3QWNA 1UWXH 2CK0H 5EBMB 2AAVA 1BBDH 3AREA 4FLRA 4GAGH 2PCFA 4RZCB 1IGCH 4QHMA 3M8OH 5KOMC 3KPRE 3AFLA 5IGXL 3FU7A 5FDWA 5D2LA 3BGMA 4YVNA 4W6YB 4E5XB 3G6JB 2ZXGA 3W38A 2IDFA 1ODAA 2AQPA 2BJMH 3EGDB 4JPVL 5LO7A 3WN5C 4Y9CA 3TC9A 2DS4A 1H19A 3IAQA 2AGLA 1N5YL 5T1MB 3S3BB 3HHSA 3NAAL 4GJTB 4HW6A 2A2QT 1MOEA 2QPDB 2L3BA 1SDAB 3VFUA 4U1LB 4L4TB 4YSRA 5DD6B 3TBBA 3OM3B 1FLRL 5ABAA 2MMXA 1TF4A 1M6UA 4FQIH 1VADA 2IAND 4G9DA 5AOKA 3VRIB 4K23H 3M88A 3ZOAA 4GEJA 4OZ4B 3QC6X 3WTUA 4TQ8A 2V17H 4LASH 3O4OB 3CZUB 4QTHB 3VQ2C 3VD7A 4JHZA 2CIIB 2NY7H 5CINL 3ET9F 2XL2A 5IFJB 1PVHA 1TYRA 3NRQA 1WWCA 1ZTMA 3JRPA 3QNFA 1I1AC 1U3HD 1VAHA 4B9KC 1OK0A 1OAQH 1N12A 4PWGA 1A7BA 1G7QA 2VXQH 2IADA 4IBYA 4OR1A 4DZ8A 4UTAL 3VD2A 1HJBC 5CMAB 5D7IF 3DYPA 1S7RB 4L8DA 4BK5C 3ZT5A 4O9HL 4DP7X 1RUMH 1PIGA 2V9RA 4P2RE 4KK6C 4ES9A 3KYOB 4LHUG 1CCZA 1EZVX 4TVPH 2XBZA 4QHPA 2EE9A 3PL6C 5KZCD 5DTFB 9CGTA 3KVQA 1DR9A 4KI5C 4ZPTA 1OQXA 3N50A 2XFGB 3NABL 2VDNB 3H3KA 2FLBT 3GSXA 2E4FA 2LVEA 3IJEB 4BE5A 5EEUA 3BDYH 3ARPA 3P9MA 2EO1A 4Y5VC 1BIIA 1ZVHA 1NIAA 2B5LA 2A4EA 3PV7A 2F7IA 1YYMH 2YMTA 1NCOA 4K07A 4ELKA 3LRMA 4W9CC 3ZU8A 1A6TB 1INDL 4DVRH 1FFPB 1HDMA 1IC0A 2JKNA 5DQDL 4HAFA 3GIVA 4CY5A 3OD3A 2WAQA 4JFDD 4M48L 3I7HA 5IVOA 2OK6A 5JMOC 1LQSR 1GMIA 4ACPA 1QFWL 1NM9A 5T1DH 3T9WA 5HE3B 2ENPA 4B3EA 5SV4A 2BNRE 4S1RH 3WIAA 5E03A 3FUMA 3ZDXB 1HYSC 2PXYD 5KYYA 1Q1PA 2ZF8A 4DKEH 5IKCB 3GREA 1FFPA 2BDNL 4XPGL 2NY0D 4IBQA 4A2LA 1G7PA 4GW4B 3D0LB 2MPAH 1HQ4A 4HK3N 1F1GA 5F0PB 2YQBA 4M8RA 1MAJA 2GT9B 1QFSA 4O02H 1FLRH 1MHHB 5E70A 4GSQA 1EO5A 5J1AA 4E42B 1G9MC 5M5TA 2P5ED 2BSSA 3D12B 1BDYA 1KSRA 5F7FA 1J87A 2NPLX 3IS0X 5FO8B 4TNWF 2A74A 2VC2B 4I3SL 1K4DA 3TYGH 2Z8SA 3RUGF 1XIWC 3EOAA 5CZKA 1T3FA 3FN9A 4LKXB 1YY9C 4AYFA 3FB7A 4UMGA 4ANWA 1DQMH 1XSJA 4O2EB 2Y1ZA 1TEFA 4FXGB 4ABQA 2A38A 3MXVH 1KCSL 3MRNA 4ELMF 4WV1C 1I1FA 4G8GD 1Q0XL 2CK2A 2WWMD 4WSKA 3ZE0E 4BE6A 1LO2H 1CFQB 1A7PL 2YPLD 3PJNA 4X99B 5F21B 4IU3A 3O6FC 2BC4A 3IPBA 4Y1SA 3J81g 3BLPX 5I30L 1O5PA 2C9VA 4DQOL 3QQDB 4A39A 1OGTA 4AIZB 5GISL 2ZQKA 3S36X 3GBEA 1DLHA 4I2XB 4FQ2L 2IFFH 1U9KA 2ZTBA 3UMNA 2IWKA 3VD3A 3ATEA 2QGDA 3WFHB 1E27A 2C7UA 4L2YA 4Y1AA 4U6TA 4NENA 4JDEB 3D39B 4GMTH 4YWGL 3B7SA 4YSPA 1OF2A 3TNMB 4KO5A 2AQ3A 1I4FB 3UVNA 4B5EA 5CN3A 4ONHB 2ZWNA 3PAZA 5IG7B 1H3PH 3QDMA 5BV7H 3CVHH 2VDPB 3MXWH 1EHAA 1N5AA 3QEUA 3SCYA 2EUVA 2X0VA 3GFUA 5GRYA 5C08E 1FC1A 5MERA 2ICWJ 2XFXA 3FT1A 3DIVA 4GB9A 1DVXA 3RWDB 2AEOA 1OMWB 4U2YA 3HS9A 4X5QA 1HHKB 4I0CC 4PJ8C 1L0PA 2VLKD 1AH1A 4LCCC 4PI2A 4YDNA 1AXTL 3NZ8A 4JFEE 4PEEA 2IPKB 4G2AA 3BUIA 3HNTH 4D8PA 1F4HA 4PSPA 5FDYA 5JYMA 4Y4HB 1NH6A 5L2KE 1H5BB 1RK7A 4WHTA 5EM2B 1HZHH 4UQAA 5GS1C 4ZMWA 3IIYA 3K6NA 1YEKL 1MHHA 5JHLH 1J0YA 4OB5L 2TAAA 2DBLH 2ED7A 3PE7A 5CCKH 4HD5A 1FE8H 3QWQB 3QPQD 3CN1A 2GIMA 4WWKB 5SX4I 2V5MA 3BPLB 3RE0A 4LB8A 4NUGH 5E00B 3T8MA 2CDEA 4ZBJA 1VE6A 3BG1A 3ZPDA 4N8CL 2OVPB 1WAPA 4RFNC 4N9OB 3LEXB 1WZLA 4NQCE 1K5NA 5MP6L 5FUZL 5MHSD 3MZTA 1UUNA 1X44A 1S5IL 2FX9L 3FTGA 4F57L 1ID5I 3FONB 1PLBA 5KBLA 1GH7A 4R90L 3TO4C 2AFNA 5KVGL 4ZOVA 2E76C 2X28A 4IGBD 3WFBL 1FFTB 4HS6B 2AQRA 2QBWA 4PMFA 5EA0H 2VQ4A 5E4OA 1PW3A 3F8UB 4ONOA 3T8VA 3ISRA 4YZWA 1DQTA 5F1NB 1P84K 3MRDA 1MIMH 3TT3H 3FFCA 3RWGA 3WLBB 3QAZB 2XI9A 3ZE2A 3RFZA 4PRPD 3MRHB 3G7TA 4S10A 5IB3B 3THMH 4TUJB 4MMZA 4I1NB 1YR2A 2C9QA 3VD5A 5CU5A 1T5XA 3QYCA 2Z1PA 1UADC 2R2BB 2WINA 4W9FC 4WHYG 4X4ME 4E68A 1WEJH 1F2XK 3QDGD 2IH1A 3UOAB 5GRJL 1ZAGA 4XMZA 1EZSA 4NKIH 1JWSB 1BQHB 2CG9X 2QGBA 2XL3A 3QI0A 1LO5B 1OTSD 2DI7A 4AENA 1ZT4B 2DB8A 2HRGA 2YUVA 1KGIA 4U1NA 1QLFA 4PJGA 3NZ8B 4AKPA 2IANA 5HI4D 1CFNB 4H2CA 2NW3A 4QXGL 2HRPL 3HC3H 2WCPA 3KLSA 4OLEA 4XMKL 2BY3A 5FYLD 4PJXA 3UTTA 5I1IL 2ID5A 4BRJA 1A7RL 4FHKA 1LO4H 4G9FA 1BX2A 4J2QA 5L8KB 4QKXB 4CI1A 1B9KA 2XTJE 3QUYB 1PCSA 1IUZA 2N3JA 2V3DA 1CGYA 3JWOH 4FFYA 5SWZA 1L0XA 3T2QA 1U8LA 4R96A 4WW1B 5GSAA 2VLKB 1UCTA 3W9DB 2X38A 3RJOA 1WWWX 1TJMA 2O61B 1T7YA 3PQYA 4OFIA 4QRPD 1K2DB 2CGRH 4ZTPH 1F42A 4OF8A 3RIAF 1Q9KA 4HGWB 1A9BB 1UUSA 5C3TA 4NN7B 4J1UA 1UOKA 2XTJB 4BKTC 4YDLC 1EJOL 4JVUA 3D87B 2CR6A 4AYSA 2DQTH 5BUGA 4RIRB 3GDCA 1WT5A 4EN3D 4XMWA 3O4HA 1Q0EA 4FXKB 5FV1L 5FWRA 3X2QB 1JNLL 2I9TA 5JA9A 3SQOH 2QV2A 1CZ8H 3QS2A 3DYOA 1KEGH 1QUPA 4Z7UB 1WICA 4L3EE 2EEAA 5FGCB 3RKPA 1MJ7H 4HVBA 1N6VA 4JN1H 3QUZD 2JXMA 2BP3A 2EACA 3HE7C 3NK4A 4PH8A 2EE3A 2GI0A 3UYRH 4XZUB 3JPXA 2J88H 2AHIA 1PDKA 3L4TA 3PXWD 3BT2L 2R0WL 1TJIH 4KI5D 4ODTL 4IOSD 4L2LA 3RKDD 4PRBA 1YNTB 3IJSA 3GNML 4PY7A 4OAWA 2HKAA 4ICXA 2WO4A 4FQXC 5JW4N 2J5LB 1DQDH 1HCZA 4HJTA 2GHZA 2ZWZA 3ZE1F 3C2AH 2BSBA 1SFHA 3NCWA 4AMZA 5HI5C 2F8OA 3ZMEA 2V2XB 3ZRCC 3HE7D 1T5XB 1BOYA 3MDJA 3STZA 4R2GB 1CLOH 5EEVA 3D18B 3EYVA 3MYZA 4IRJB 3OJDA 3O6FB 4PJGB 4BSJA 1SEQH 3I50H 2G5RA 5IQ7L 3S88H 2YXWA 4LVNB 4DGIH 1UATA 4PJ9A 1CK0H 1CGSH 5F9JA 4F7KA 4TQPA 5CILH 3TF4A 2BNQB 2L8AA 5ESVA 5DI8B 3JWDH 4PJ9D 4XCFH 2DTSA 1WFUA 1V7MH 4U3SA 3HG3A 3ZHLA 1XHMA 2QVIA 4DP9X 2AXFA 2F6AA 3D08A 3ML8A 5HHNA 3U6XS 1UB5B 1KELL 3N40P 3PP3K 4HT1H 1MLBA 3QFJB 1C5CL 3FHAA 4KKPA 4UM9A 4NERA 4YEFA 5I9QC 4ZI8A 4OJYA 5DJCB 4XOEA 1QR1A 2I0TA 4JO2H 5HHPB 3W0WA 5I1AB 5KDOB 1AXIB 4WO4C 3Q8FA 1YRKA 2WBWB 5K39B 3PXLA 3WYRA 3QNXB 2D2CC 1Q9KB 2VSMB 1WTLA 3D3VB 3MROB 5KJ4A 4J87A 2R1XA 3P1VA 4OZFG 3Q8AA 3PQYB 2VDRB 2NMSA 4URTB 4Q0XL 4YL4A 5AEAA 5TPWL 4PRPE 3RWFB 2FDBP 1HI6B 5FPIA 3B5TA 5T1DL 1IVLA 5FGBA 2PO6A 3LD8B 1N0XL 3NIFE 1FNEA 3MBEA 2OA9A 2BX5A 1V7NL 4OGZA 4XXWC 1UTCA 1HKLH 1L9OA 2EE6A 3H7BA 4MNQE 5K9KB 3BVDB 5FOBA 1RURL 3EMHA 4R7NA 4S1QH 4ZQKB 3SMRA 4G9FE 1A1MB 3V52H 2DLTA 1PDKB 3UC0H 4N4YB 3EO0A 3MCG1 2OMNA 3OX8B 5L2KD 4FQHB 2TRHA 5MEPA 4DZ8B 4HH8A 3GGWA 4DW2H 3GMPB 1OGSA 2FBOJ 4LAQL 4OIFA 1VHPA 5TEEA 4BK8A 3NZUA 1KOAA 4NP9A 5JQIB 3ORVD 4DKFH 4CY2A 2EDDA 5DJ8A 4Y5XC 2TSAA 1F1DA 4WF7A 4K94L 3GNMH 3EO1B 3T3MF 4GQBB 1ESOA 2RH0A 4WO0A 3D51A 1JWMA 2YLHA 2Z34A 5D6CB 2APVA 5HGHA 2P9UC 2QQQA 3TT3L 5D6DC 3STLA 4UILL 2O5NA 4MXQC 1NGXB 2L7JA 4LSTL 1KYAA 1JGEA 3QO0B 2BLFA 5E5RB 2C3VA 1I9JH 2VE6B 4IRJC 4P05A 5TK2A 1ZANH 2OMTA 4PJAA 4G8IB 1MZYA 1MAKA 4LPXA 3MRIA 3QG6B 4IHOB 1GS6X 2EDJA 1A6TA 3CIQA 3DETC 4MJ5B 5ILTL 1ZK5A 2PM6B 3QZMA 4NKDB 4IS6A 4K7PL 4P3CH 4XCCH 3C08L 3GIVB 3KPSE 1XIPA 4I18A 1LMIA 4DOHE 1MJJA 1ASOA 4AL8L 1AFVL 1B0RB 3MLUL 4C55A 5A7EA 1TZHB 1NBQA 2FO4B 1U30A 1ASPA 3CPLA 4KKCC 2J4WL 1BQLH 4BFRA 4DT2A 1AE6H 5KYWA 5DEFA 1M3JA 1UT1A 5IT2L 1QTYT 3T0AA 4W9KC 4GKSB 3FHEA 4J27A 1M57B 5SWSA 1KZQA 2Z8RA 32C2A 35C8L 4AL8H 2PO6B 3GZOA 4XAWL 5L2JA 3UR4A 2ZYHA 4KK8C 4GUPA 4IBVA 2XC8A 5F1SA 4LO9A 1NDTA 3LX9A 3RVUD 4B9YA 2FRGP 4HJ0C 2PWHA 4K15A 1S4IA 2O5ZH 3FQUA 4ZT1A 2NY5C 5C71A 4C56D 1A4JB 2R1YA 3T04D 5EBMA 2Y69B 1HAWA 3T2PA 2YPVA 1ZVYA 1ZGLP 1G7HA 2F74A 3MA7A 1WF5A 1XXFC 2F53B 2WBKA 3US9A 1MG3C 1RY7B 2BS71 5TDNA 3ESNA 4MWFB 2YKLH 3O11A 3Q6FA 4KKNA 4XHQA 2VDKL 4MB3A 2HFFA 4HX1B 4NZRH 5LBSL 4AEHL 1A4KB 3IEAA 2XWZA 1UWGL 2F8IA 3QNZA 3GB7A 5AW2B 5I66A 3APCA 4CNIA 1AXSB 3L9YA 5D7JA 4X9YA 3B9EA 2WHVA 4J3OC 4HIEB 1Z5HA 1F6AA 4MNHA 3QUXD 3RZCB 5HHQB 1KDJA 2CO0A 3WMQA 4HS3B 1NGXA 4NENB 1E5UI 4ZO9A 2Y2TA 1NGYB 3SBRA 3SYAA 5BW7A 4JFOA 3RP1A 1O6SB 4PRHA 3BWUF 3N1QC 4XMVA 1LWHA 3FN3A 3C5ZC 1IC7L 4HSAC 1FVCB 4YDJB 4OCSH 2GJJA 2WBJC 4ETYA 4HUKB 2HLAB 3KR3L 5CZXD 4ANXA 1WRFA 2YKKA 1CDBA 4FN0A 4OQTH 2EKJA 4QNPE 5FYKL 1L3WA 3WE6A 4FNPA 4C56B 1XTLA 2YRLA 3O2VH 4RQQA 2HT2C 4Q0XH 4JFHD 1B9YA 3KL5A 5FK9A 3BESR 3CD4A 2XKNA 1NGYA 1AR1B 3DRQB 1HHKA 1SJXA 5F9WC 1QMUA 3BPOB 1TBGA 5SWSB 3FYIB 4MNQA 3D39D 4H25B 4PTTB 4DKTA 2M1KA 1TMCB 5DFWH 4OZIF 1T3FB 4JCLA 4LKXA 4UV7L 1S9XB 3CLFH 1IMHC 4JFQA 4UM8B 1CFBA 3PF2A 4JFFD 1KJVA 1MVFA 4RQQB 2CO6B 1JYNA 4A0AA 3C6SB 3J07A 5ICUA 5TF1H 4Y4HC 4A7VA 1TJGL 3FOLB 3FH5A 5GGTL 2K4WA 3DIDA 2HKFL 4YHYC 1EHXA 2IQ9H 1F45A 2G2PA 1D5ZB 4WK0A 4ZMXA 4RE6A 1NLBH 4JGMA 1A6ZA 1FHNA 1OL0A 3QCVL 4NS0A 4XWGH 1SNRA 3HLAB 1KJ2L 2QZ5A 4P2QE 1PBYB 2IURA 4JQIL 2R8SL 3PPSA 4Z78B 1B4LA 3PWJA 1IQWH 4BKLA 3QARA 1CWVA 3GTNA 1ZKAA 2R2EB 3AVEA 3ARFB 2H41A 4AWJC 4YLCA 1K3IA 1CC3A 1QLEB 4MA1C 2X4SB 3GMQA 5HYJB 3MSPA 5F7LB 3S0PA 5JOPE 1SVCP 3ECUA 2F53E 2N7BA 2XY1A 4LLUA 2JJTA 4AIEA 1U3YA 4B60A 1FYHB 2R9HD 4YX2H 4Z7NA 4FC3E 3BZ5A 2H3NA 2HB0A 3NJGA 1YO4A 2X6VA 2X4PA 3VWKC 2J12B 2X6AA 2EDLA 3S6CA 3Q7JA 2B1OA 4YAQA 5LN4A 3GD1I 1J05B 2Y7QB 5T1LB 4A7TA 3KYKH 4L3EB 2DZEA 5B3SB 3TWCL 3AABA 4P4KA 5I19H 1V7ML 5E99L 3T4AC 4P2QD 4S0TD 1DBKL 4O3UB 5CM1A 2ZOUA 4YC2C 4JHPC 1UA6L 2FR4A 2H68A 4XVUD 1OLZA 5HYSA 1LJMA 4O02B 1Z9PA 4XVSH 5K59F 1YNKH 2NY1B 5KG9A 4Y8DC 4EUPH 4GZ8A 3EOTH 5CKAA 4IM8A 4N24A 5EAMA 1CJYA 2V2WB 3H9SE 3TYFA 1OT2A 2VN5A 2ARWA 1T2JA 2OMXB 3V0VA 4MMZC 1EHKB 4JZJA 3NACH 3MRMA 3G04B 1L4IA 1ULVA 2YHGA 1E8YA 2NY6B 4M7KH 4U1GB 2OXGB 2O6CA 5ETUA 4NNXA 1XB6A 1ZLVK 3PWNA 4FQJL 1OT1A 4DQAA 2CLRB 5EWIL 3BKYH 4YBQD 1K2DA 2WNKA 2VWEC 4PM1A 2Z2NA 1ICTA 2GTZB 1VLXA 3F6LA 3U4KA 5EN2A 5E8EA 1GZPA 4FNLL 5DO2D 2ROXA 3SCMA 1CR9H 4Y4FC 1MEXH 1DUZA 1E8ZA 3EGXA 4PCSA 4PS8A 3K2UH 4FG6C 2ZKMX 4ENZA 4EOWH 3Q3GA 2B1AH 5E6IC 4MX7A 3QCVH 5F7NC 1Y1DA 1XWVA 5C92A 2X6CA 1YMMD 1IAOA 3RB5A 3ISYA 3LNGA 1S8DB 3CMOH 2HT2D 4HU2A 1HH6A 4L1SA 1KCUL 2ZXDA 4K5MA 2NSMA 3P4OB 3C60D 4DPBX 4LLYB 4ELKB 4HKBA 3DVGA 4S2SB 3F58H 3VE0B 1J7VR 3UIYA 4P57A 1FNSH 3WIIH 1FVEA 3ZKNC 4Z0XB 5LBSH 4AEHH 1EXUB 4V1DB 2XJKA 5AKVA 3V6BR 5KANI 2ZOOA 4F7PA 1INEH 3OSVA 1EEYB 1UQSB 1WZKA 1F86A 3IRCA 2AJ3A 5ISZD 1N7ML 1VYHC 3O3AB 1IGJB 1JNNH 3QCUL 2P47B 1QRND 3QRFM 4F2MA 5H14A 3O3DB 3P4OA 2H45A 1OB0A 2X2UA 5JTWA 4UQ2A 1NWOA 2EXWC 4X5RA 5JIPA 3D0LA 2OW7A 4OU3A 5GXHA 1R24A 2Y3NA 3V9EA 1DN0B 4MBRA 5F9JB 2PWGA 1W80A 1Y07A 4N2OA 5CCGE 1PI6A 3IUQA 2EXYD 3FMGL 3BYTA 4BKSC 2O61A 1A3RL 3GZKA 3ESMA 4KQ3L 1QEWB 4W9HC 3ULUF 3SN6B 3MLRL 2Y5QA 4OUUA 2EC9U 3ARFC 3NSDA 1BQLL 4PJHB 5J89A 2DL2A 4WW2C 5I1GH 4N6RA 2A77L 1CBVL 1OLLA 2Z35B 1SUJA 1QR4A 1GGTA 3DGDA 3HAEA 3UZEC 3RVUC 2YEZA 1E7UA 4R7AB 3SDXE 3C75H 4J5VA 2AW2A 4KROD 4A6YB 4DNUA 4QIRA 4RNRA 4D3CH 4CN6A 1GAFH 2V7HB 4G8EA 1HZKA 5I6XC 1ZPUA 2DBJA 1QBLL 2DWSA 2NUTB 2VLME 4ICWA 3PVWB 4DVBA 3HAEG 3HZYB 3WMPA 3QIBD 4X4YB 1S9YA 2HU8A 3C5JB 1F41A 3EGDA 5J3HD 1SJMA 3HAEB 3D39E 4PJEF 3UTOA 2D0GA 3ZHNA 5CKGA 1CICB 2J8UE 3LS4H 4YWGH 3IMWA 1UZ6E 2R2HA 3PWPB 4KJYB 3E7JA 4HJIA 5DHDA 1FIGH 5DJ2B 3KXFA 3LOWA 3UPRB 2OXHB 3PIQB 4FG4A 5JZ7D 4JJ5B 2KDGA 2WB7A 2IWEA 3HC4L 4AQ1C 4TOYH 5DVOA 1IGYB 3S8FB 4RRPG 2BSRB 1NCTA 1T5KA 4XBGB 3I9GH 3CHXA 4RMUA 4N2MA 3QA3A 2FQEA 3GF8A 3LPOA 4ZUVB 1W0YT 2EIMB 3U4EB 1LQBC 2CHDA 3GXDA 3NCJH 1NKOA 4N2DA 3VI4A 3H9HB 1M6OA 2WTRA 3MV11 3T8XB 4KK9C 4DUXA 3H56A 2ICEC 3KPRD 4N0CD 5HHNB 3U0PB 1UXSB 4WW2B 2JE8A 4Y4FB 5IIEB 1MI5B 2C4XA 2HJKB 2OMTB 4PJAB 4BCCA 4XP5L 2BCJB 3RDTB 1AHWA 5BCAA 4XNQA 3MBED 1YEKH 4YSEA 5TH2A 4LDCA 1I1AB 4O45A 2BSTA 5C9KA 1JL8A 3DX7B 1MCSA 4JQXC 4WTZG 1EJFA 1IILE 1OAZH 1VGKA 4PCTA 4M1DL 2PW1B 4PTUA 4MXVF 7TAAA 3NIFB 1RK0B 3WFCL 2UY7A 1ZA3A 1BD2E 1EHNA 3NA9H 5FW7A 4U1IA 4YXHL 4I7ZC 4Z1PA 3INUL 1FO0A 3BFWA 4IMLB 4TVPD 5ADOL 4RDBA 4N9GB 2NXZB 4CA4A 4L1QD 4PY7B 1G6RH 3CMOL 1IAKA 5GMKn 4HEPA 2NNFA 3HBPA 3ISWA 2G9KA 2ZCZA 3C5ZD 3QXAA 3ZDXE 1GZQA 2W07A 4RE5A 3KD4A 1EMTH 4DW2L 3UVMA 1KN4L 5IEHA 5FHAH 4A11B 5BRQA 1EZUA 5A7BA 3T09A 3V79C 1SMOA 3CX5K 4GP8B 4LRNH 3O0LA 4XX1E 5D9SA 4XNMA 3GMNB 2BWQA 5C0NC 1YLBB 5E6RB 3TH4T 4BSVB 4BFEA 4HP5A 2HG5B 4OLXH 4MAUL 2QZPA 1HNFA 2DF3A 3HI1B 4Z95H 3GBNL 2RMNA 5M7QA 1UM5H 3FOMA 3BFOA 1CDYA 4B7IA 4Q4EA 2X4OB 3D06A 3KJ4B 1A7OH 4LRNL 1OVZA 4E5ZB 1QLFB 5ITBL 1ZHNB 4AMKL 5IBLC 1CD1B 4K3EH 3SPIA 1L3NA 4LBAA 1J8HD 4KTEL 2J8UB 4RISH 1M71A 1VZIA 2F54B 1UCBH 4BFKA 2GSGB 5AB2A 1HHIB 4QLWA 4HHGA 5LAXA 5C09B 1J86A 2N01B 2R59A 3CVIL 2SODB 3QORB 3QXTA 4LEEA 3STBA 5JW5B 5HDOA 1N6QL 2E7HA 4P49A 3SCMD 4BUGA 1M9WA 3RDTA 3RVWC 4KVCL 3T08A 3KPPA 1NCGA 1N68A 5CP7A 3P4FA 3OKOA 4FYTA 2A5UA 4JFZL 1CGSL 3L3HB 3QEQD 3DJSA 4XMTA 1YNTF 1XSKA 1OE1A 3IMRA 1F3DJ 4C56A 3SKOA 4UILH 3FM0A 1KACB 1FFRA 3FUJA 1RK0A 4LNRB 4X7TA 1I3RB 2I0RA 5IR1B 2P26A 4MD5A 2J57G 3CAFA 2BY0A 2X42A 1Z7JA 5AL0A 4MCYB 1ZANL 4O4YL 1RZFH 4TNVF 5D1QA 3WIHH 1CIDA 3QRBA 1PEWA 4N3UA 5I74B 4WTWA 1IC5H 1AQKL 4NWUH 3NDYE 3KWVA 1AR1C 1RUAH 3ILPA 5BW7C 3MLYL 3CN4A 1XF3A 5AALA 5GRWA 5EDSA 2W0LA 1WS8A 4N0RA 4P2QA 1NICA 3NTCL 1Z0NA 1XZWA 1WD9A 3S5LG 1H0DB 3MMEA 4NBYB 5DQJA 2ZUQC 1RU9H 3ARZA 4LHUA 4CVZB 5JHBA 5IVXE 2XV0A 4G6MH 2H32A 2OZ4H 4DZBB 1CS6A 3DROB 2BIIA 8PAZA 1FA4A 1CYGA 4UINL 4O2CA 1DQDL 1QSED 1RZIB 1A66A 4NQED 2DEXX 3LXBA 4PWKA 3NTCH 2WGNB 4F57H 4FMFA 2WUCH 5EEYA 3H0TB 2VDNA 1MHCB 1JVLA 3N85L 4NNPH 1JCVA 2H26B 4QRJA 3N0EA 5E8OB 3ILQD 1MW0A 3WS6A 5KJRL 4LL4A 3FUHA 5EOTA 2ALAA 5T3XL 4YO0A 1ET5A 2VDKB 5ITBH 4GIOA 5AKTA 3P3SA 1AHKA 2OMWB 4JUSA 2QADD 4QRQA 3O4LB 1X7SA 3SE4C 1DJGA 2OJEB 3IMSA 3QCTL 3VX1A 4HH9A 1ERJA 2R0KH 3X13A 1NCJA 3DO7A 1UKTA 2VR9A 1VZ2A 1FAKT 5AAWC 4JNXA 4GKZA 3QNXA 3UO1L 4BL0A 2BFVL 4P23C 2H47C 3QEQA 1PG7L 2VZSA 4N90E 4YNYA 1ET8A 2Z0BA 1OSZB 4DPRA 1VE7A 1ACCA 2CHNA 3ERXA 1JHKH 2GKIA 4A7GF 5G4OA 3FJTA 4YR6A 5KVMC 2XETA 3UTPD 3AG4B 1J0KA 3KLAA 3AC0A 2WXGA 5A16B 5DC0A 5D7IE 2Q76B 1HCFX 2IDCA 3KDPB 3CBJB 3QIBA 3QUMB 3AL8A 5TDNB 3OJVC 4MWFA 2NCMA 4EJ1C 3X11B 4S11A 4E9VA 2V2TA 4NI3A 4HK0B 2QKIC 4HMEA 5JORB 3NVNA 1MREH 1T1YB 4R97B 1J8HA 3VG9B 3KDMA 5TDPB 1H3XA 3FB7B 4HWBA 3IDIA 4XPFL 3K26A 2EZ0C 5DA0B 5JQHC 3MJGX 2GNQA 1OWRM 2PYFB 1JWSA 3ZDYE 1BA9A 4L8BB 4IJ3C 3DSFL 3DMMB 3K6IA 1CE1H 5IVXF 3L3OB 1QBLH 3D8MA 5DRXB 4ZD3H 4ZFOA 1XH0A 4X6CB 2YK1L 3NP3A 1FGNL 3ZX1A 4CN1A 2AJSL 1BEXA 1J0IA 4K8RC 4Z77B 4LESA 1LP9B 3AGVA 3NCFB 3RKDC 2FO8A 3NCYS 1DUZB 2AJXL 5LBGA 3NIGB 3IXTA 3UACA 3KPRB 2FECI 1MHCA 1SJVA 2OCCB 3QUXA 4I8DA 1D3CA 1NCDH 1JE6A 1KLGA 2DQIL 4P5SA 3BVVA 3VDBA 1OP3H 1KFAL 2E7CA 2QPEB 1JRHH 2BW4A 4YL9A 4H5JA 3K2KA 3I7NA 1YZZA 2C4FT 4U1KA 2ZCKL 1OF2B 2Z0UA 2LV4A 4EZLA 3VXSA 1ZV5A 4PJGF 1CL7H 1GHFH 1FVDB 1UD3A 4F33A 2DWDB 1LE5B 1MFVA 3TJEL 2HJLA 1UHVA 4GRLC 5CU9A 2D9CA 2VR6A 4A66A 1OTTD 1E5TA 1ZSDA 2G3MA 3RYMA 2ISDA 4HKXA 1TLMA 3POHA 2VDQH 1YEJL 4QY8A 4NKQB 5E6IA 3LTVA 3W39A 4G8GA 1YAIA 2V0AA 2XPZA 3SGDI 3BUBA 5EFIB 4YE0A 4IRZH 1XD1A 5DD0L 4ZXBD 3P2DA 4JZNB 2J5LC 4KVCH 1T04B 1OE2A 4FFTA 1U2HA 2AJZB 5JW3L 3A67L 4WGWB 3ZE0F 4YOKA 1S7XB 4PD4K 1E4HA 3ZSSA 5J5EA 5F7WC 2OTUA 2R29L 3IJ8A 3AM8C 3P30L 4HSQA 4MQSB 4G6ML 4AH2A 1R5WA 3HKZA 3KVPA 4Y2DD 1KB3A 1ADWA 2FWUA 2N7SA 2WV3A 3DV4A 1G6RL 3ZDYF 4ZMAT 5MERB 1R47A 2NCEA 3SQRA 2JQMA 1T04A 5IQ7H 4YHOL 4FGMA 5BVPL 2WW8A 3P2BA 4JRYB 3OZ9H 4Y2DC 2J57A 3I9IA 3L6FB 5DZLA 5FUZH 1HH6B 3DNKA 3BKCH 1E6OH 2H3NB 1F3JB 3FT4B 1E3FA 3UTSD 1Z3RA 4IU2B 5J13B 4ZOBA 4PW4A 3O45B 5H94B 2WN3A 3AUVA 5M61A 1JGIA 2J6EH 1AGDB 1CU4L 3HZYA 4Y4FD 2J2ZA 5IBTH 2ETWA 1JOFA 3M7FB 1F6AB 4LSVH 4B95C 2VM3A 1JWUA 4M3KB 5HHQA 3RZCA 1CG9B 1TO5A 2IH9A 4M7KL 4KKBC 3KCWA 3CSTA 3DUUB 4OIIH 5GS1B 1AKJA 3D07A 4ZQKA 1AY1H 1QSEB 3S5LA 4JQIH 5B38B 4ODBD 2EIJB 3V0JA 1T89C 3W0WE 3WTYA 1T5WA 3Q2VA 2IOOA 1SYSB 4Y9GA 2PWFA 5DT1H 3ULSB 3FCGA 3VFNA 1Z3GL 5FF6B 5E6UA 4HYTB 4M6ML 2DKUA 1SY6L 2OYPA 3EFFB 4WFED 4IOFD 4HIPA 1LD9A 1TENA 4OGXL 2XHNA 4MQXD 1JV2A 4QCIB 3EH3B 4XNAA 5DO8A 1DBMH 4JDZB 2F0CA 2NQCA 1F4WH 4J8RB 1W8NA 4GRMA 3UZQB 1LM8V 3E2HC 5F89B 3QCTH 5EZLA 7CGTA 2CU9A 4R0LA 3RFGA 3ZUNC 1SEQL 1YVLA 4FG2A 1BM3L 4EI6B 1VERA 2YGOA 1MDAA 2A1WL 2F5AL 3D1MC 3I74A 2APBA 1NAMA 1TO4A 2UUDH 2WQRA 4Y19A 4ZO7A 3EO9L 1RUPH 4GRWH 3V55A 4QCIA 2HMID 2X10A 3SLED 4H1LB 3IK2A 2RAMA 3DX7A 2VN7A 2VSDA 1CF8L 5F1IA 2R2BA 2FLMA 2OMUB 4FQXD 5E6ID 5EUKA 4D3CL 4NRZA 1GYCA 1QSFA 3KW7A 4YHKH 4I0PD 4J8BA 2APSA 5MEQA 5FLVA 3TASA 1OZTG 2X12A 3KLKA 5LG6A 4DPAX 5HDBA 1EBAA 5MENB 3CIAA 3TGXA 3BWZA 5IJKC 1KFAH 1XIWA 2WP3T 3CZJA 1EGJA 3CFKB 3M8OL 4L0PB 3GQFA 1A6WH 4M5SA 1QSZA 4FQJH 2ED8A 3NFSH 1MJUH 1YEFL 5D7LD 2ITDB 3W11C 2WIIB 3EJUA 3ZIMA 2BP8A 2PMZA 3M17A 3CDFA 2VRKA 2OSWA 3L9RB 2QSCH 1V7NH 3UDWA 3ZRSA 1KNOB 3FQNB 3CQFA 1ASQA 4M8VA 4XNMB 5TQ0H 2BNRD 3NCEB 5TDOB 3PWLB 2V3EA 5IWLC 4JFVA 2AJYH 4LGPB 5ISZB 5HJBA 5GSRA 4X8CA 4X6EB 3QQXA 1UM4H 3TP4A 5KJRH 2YXMA 3VXRD 3VX0A 4NN7C 4LKCA 1NA8A 5ALBL 4BYHA 1AOHA 1OB1B 5D55A 2QXVA 4AV0A 3N44F 1PY0A 4ZAKB 4GG8A 3VG0H 1NEZB 4PN6A 3CHSA 2Y22A 4ORZC 2MIZA 5T5FA 2H9MA 3TXAA