3BWSA

Crystal structure of the leptospiral antigen lp49
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
407
structure length
407
Chain Sequence
GTEIVKFSIHPYKGTVIRLGEEILPFKVLEMDKNIALVEMAIPVYKDEKEIELKLSSPGFQNSSYRIRKPEELNEKLIALDKEGITHRFISRFKTGFQPKSVRFIDNTRLAIPLLEDEGMDVLDINSGQTVRLSPPEKYKKKLGFVETISIPEHNELWVSQMQANAVHVFDLKTLAYKATVDLTGKWSKILLYDPIRDLVYCSNWISEDISVIDRKTKLEIRKTDKIGLPRGLLLSKDGKELYIAQFSASNQESGGGRLGIYSMDKEKLIDTIGPPGNKRHIVSGNTENKIYVSDMCCSKIEVYDLKEKKVQKSIPVFDKPNTIALSPDGKYLYVSCRGPNHPTEGYLKKGLVLGKVYVIDTTTDTVKEFWEAGNQPTGLDVSPDNRYLVISDFLDHQIRVYRRDGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Lp49
publication title The leptospiral antigen Lp49 is a two-domain protein with putative protein binding function
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Unknown function
total genus 105
structure length 407
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bwsA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bwsA02
5HE1B 3MXXA 4FHLA 3EG6A 4LG9A 3I7KA 3CIKB 2P9IC 3JAMg 4A11B 5I5MA 3PXTD 3ODTA 3J80g 4A0BA 1L0QA 4PC0A 1NEXB 5IGOA 2XL2A 4BL0A 3PE7A 3UVMA 3E0CA 4J82A 4J78A 3L4OD 4MK0B 5FKSA 1JJUB 5I5JA 3EI4A 3RRMC 4FAND 3NVNA 2OIZA 3MKQA 4J8GA 3PVUB 1PGUA 3SMRA 4ZOYA 5TF2A 3RLMD 4GGCA 4J0XA 4X63B 4E54A 5IGQA 5FLXg 1JMZB 4J87A 3I7HA 3ULEC 4ESGA 3UVLA 3JZHA 3V5WB 4K3JB 1K8KC 2I3TA 2CE9A 3FM0A 4BH6A 1JOFA 2GNQA 3V9FA 3SCYA 5FQDA 4CI3A 1QNIA 1XKSA 2UZYB 3OL2B 4A08B 4GQ2P 3EI3A 4L1QD 2AGLA 4H5IA 5TEFA 5TDHB 3SHFA 3IJCA 5IT9g 2AH1A 4J84A 1GG2B 5AFU3 4GQ1A 3UKRC 4ZOVA 4J79A 3KRXB 3IKOA 2G99A 5HYNB 3J81g 4X60B 1OMWB 2CO0A 5K19A 4GQBB 4J8BA 5FA5B 2P9KC 5TEEA 2J57G 2IUPA 2YB8B 1NR0A 2P9UC 5EMKB 4JXMA 4N14A 5AJAA 4CZXA 2PM6B 4PNKB 4XYIA 3UKUC 4LGNA 2IUVA 2XL3A 4GM9A 4IA9A 4AOWA 3I8EA 2B4EA 5FXYA 3I7LA 3SBPA 3L4MD 3DSMA 4ZN4A 4U7AA 2AH0A 2CNXA 4FWWA 3MMYA 5GXHA 3DM0A 3BWSA 4A09A 4JSPC 5FKQA 2PM9A 5K1CC 3EI2B 4OWRA 5AMSA 1U2VC 1K32A 4L3HD 4J73A 2B5LA 4ERYA 3GREA 4FA4D 4A0AB 3I7OA 3JROA 4GM3A 3JZNA 1PBYB 2PBIB 2AQ5A 2CN3A 2G9AA 3F3PA 3MZLA 4TZ4A 1MG2A 5EM2A 2UZXB 4O1QD 3PVWB 4A2LA 4CZYA 2OVQB 4PBZA 3I7NA 5A2Qg 4A0BB 1ERJA 4CY1A 2H9PA 5EMJB 3RMZD 3N0EA 3JPXA 1MG3A 3EI4B 3OW8A 3VA6A 5B4WA 3BG0A 1VYHC 2IURA 4G56B 4E54B 1FWXA 3ZWLB 2P9SC 5JWZA 1XHMA 2B5NA 1SQ9A 2YBAA 4H5JA 3IJ0A 5C2WB 2OVRB 4AEZA 4YVDA 2OVPB 5SXMA 2QXVA 3SLED 3F3GA 4OZUA 3K27A 3SWSD 4O45A 2BBKH 5CXCA 4CZVA 3FGBA 5EALA 2BCJB 2H6KA 3F3FA 2YMUA 1MDAH 2AGZA 3EI3B 2B5MA 2OJYA 3IIYA 2H14A 1SQJA 2H9NA 4D0KA 3SVWD 4CY3A 3B7FA 4ES0A 4PBYA 4U1EI 5HE2B 4Y5RD 3MKSB 4ERZA 2H68A 4J0WA 4JT5C 3SBQA 4A2MA 2IWKA 3K26A 2HXCA 3OKYB 3RSEC 2EBSA 1RI6A 3SXTD 3C5MA 3EWEA 5CXBA 3OKYA 4GGAA 3AL8A 5C9ZB 2OK6A 2Z2OA 1R5MA 5HQGA 4FAVD 3UVOA 4EWRA 3SFZA 2I0SA 4KFMB 5IC7A 3CFSB 3JRPA 3DWLC 3UR4A 1Q47A 3CFVA 4Z8LA 3RFGA 3IJ1A 4QL1A 2HYEA 5HE0B 3BG1A 3PSCB 4QT8A 4A09B 4E5ZA 3JB9L 2PM9B 3FRXA 3EU7A 2QC5A 2O9KA 2H9MA 2TRCB 4IMMA 3JZGA 4NSXA 4I79A 3SJLD 1A0RB 3SBRA 4HDJA 4QQEA 5HE3B 3EI1A 5EM2B 3DXMC 2J55H 1GP2B 1S4UX 2I3SA 2YNPA 4GZ8A 3C9CA 1JMXB 5CYKA 3PSLA 5IJ8E 2HKRA 2CO0C 3I2NA 3AH8B 1YFQA 5H1MA 4CI2A 1N6DA 3NVQA 5IJ7E 1SHYB 2YNOA 2IAAA 2H9LA 3I8CA 2HESX 3U4YA 4QRJA 2P9NC 1PEVA 3NVXA 4ZOXA 5THAA 4GM8A 4L9OA 2GC4A 4ERQA 4JSNC 4PSWB 3N0DA 5EMLB 2GC7A 2MTAH 3UVNA 2HJBA 2H47A 2H3XA 5EAPA 4D6VA 4FA1D 3SN6B 3KRWB 2J56H 3GFCA 4A11A 5CXCB 1P22A 4JSXC 1B9XA 4XYHA 1XIPA 4GGDA 4K3ID 2P9PC 5EAMA 3PXSD 3IIWA 1N6FA 2CN2A 4CY2A 3W15A 4Y7RA 4J77A 3EMHA 5KDOB 3DXKC 2W18A 4UI9R 3V7DB 3VH0A 4CC9A 3ORVD 4O3UB 3RFHA 5CXBB 3AL8B 4J86A 3AFCA 2I0RA 4FA5D 1GOTB 2HJ4A 3VGZA 1N6EA 5EMMB 5EARA 4CY5A 3C75H 4CI1A 4CI8A 2YNNA 2HKMA 1B9YA 3OL2A 4BUJC 4A08A 5FKRA 4FA9D 3OTTA 2AGWA 4E5ZB 2AGXA 2P9LC 2Z2PA 3PXWD 3HFQA 1PI6A 4GMBA 5GMKn 2H13A 4X61B 2IWFA 2I0TA 2AGYA 3C99A 3RN0D 4JT6C 3OKWA 5H14A 1U4CA 2CE8A 5GSAA 4PXWA 2Q7QA 1GXRA 4LG8A 4FB1D 3EI1B 4O3TB 5H17A 2XU7A 3I89A 4PSXB 2OK4A 5GXIA 3I7PA 3MZKA 1TYQC 5CYKB 4A7JA 2PM7B 3UVKA 1TBGA 3OKTA 4L3GD 4R7AB 4ZOZA 5C2VB 3A0FA 4JSVC 1OLZA 4JD2C 2Z2NA 3RN1D 3AL9A 2H6QA 2IUQA 3P4FA 2H6NA 4XEIC 4J81A 4X3EA 3EI2A 5FKTA 5I5IA 4A0AA 2XYIA 4O9DA
chains in the Genus database with same CATH superfamily
5CHNB 4CVZA 5GRYA 2BMKB 4AEHH 4ELDA 2YARA 3I7KA 3C6EA 1RXLA 4NM4L 1AHMA 4KVNH 2CR6A 4U1MA 4XCCL 1N64L 4Z0XA 3FSOA 4LSTH 4EN2A 3B5TA 3CZJA 3U7YL 4F92B 4XNQB 3TF4A 4O02B 3BESR 4LKXA 4PC0A 1L6XA 2KS0A 4UM9A 4EE2A 4J2XA 4URTB 1FZMA 4J82A 4CVXA 5FKSA 4XO3A 2XVLA 3X17A 4Y1AD 1XL4A 3HJEA 4MD0A 1U8NA 1TTGA 4GT7A 2OYKA 2OIZA 4PD4K 2CM6A 3RPIB 1DQLH 4APXB 4U33A 3QFDA 5E9NA 2JB5L 3ZE2B 3VB8A 4QCIB 4GGCA 3Q13A 2BNUA 3NMEA 2I9LB 4X80L 3QXDB 3RWJB 3C2SA 5K9QI 4PJHE 3F84A 2P7TA 1JXJA 2X53A 3QDGB 3PHOA 5EU5B 1I1AD 3QUKA 3EYUH 1ZLEA 5IT2L 1A1OB 5DMJB 2YMOA 4KRPD 3H1ZA 4WKZA 3STZA 2CAKA 3B7UX 2GNQA 1SJHA 1RD6A 2V9QA 4JCWA 1CDHA 3U0WL 3OMZA 4EVNA 1UM6H 1PYWA 1FO0B 1P1VA 1I4FB 2FO4B 1I7RA 1XKSA 2UUDK 2EUXA 1KT2B 4H5IA 4G9FA 1PZAA 3QAQA 2YK1H 3SODB 2O5ZL 3NCCB 2OXHB 3DDGA 2X88A 4G8IA 1E2VA 5M95B 3QR1A 5ID1B 3OKNA 4FLSA 4FXGA 1ZXKA 3C8DA 3FTWA 2EEBA 4J3OD 3B9DA 5M61A 2Y7OA 4G43A 3NJLA 2CLRA 1EX0A 3CG8A 3WFHB 3FSZA 4LPTA 2R59A 1MFDL 3IGLA 1YPZE 1F4YH 3IK2A 4H8WC 4HIIA 2B59B 5D55A 5DUBB 2NY3B 2X4SB 3KR3L 5IHUL 4PWJA 3KVDD 5F9DC 4FMFA 2UWEA 3GMOA 4JQXA 5EF2A 2HN7B 4OZHE 2YSTA 1CGXA 2XN9D 2EILB 3UKUC 1E9PB 3N85H 1NIBA 3H42L 2FJHB 3W11D 2ZAIA 3WMSA 4PJHB 3DBXB 4HIEB 1OQOA 1PLCA 4EIGB 1JGIA 1U21A 1J0HA 5AALA 2M2DA 3SBPA 4YHPB 5A7BA 4WI0B 3T0ED 5H8DA 4FC3E 3AT8A 5F96L 4ATWA 2AH0A 2XFXB 5DI8B 3QEQE 1GGIL 3DM0A 4HHWA 2GCYA 3NIDE 3LKQB 4TLSA 3SKNB 5I0DA 4YH6A 2GPZA 5DJDB 5KJ7E 2DYPD 1XH1A 4Y5YB 1EAOA 1WZ1L 1A64A 2HKFH 4E5XA 1RIVH 4GKNA 3NJJA 5D71H 4N5EC 4GW1B 4I87A 2WXPA 5HHQA 2EIDA 1VENA 3GC3A 3CPLB 1RJLA 4Y5XC 3KCIA 3GSUA 4FMKA 1QWHA 3ILPB 4EXKA 4TTDD 3IMWA 2QKIB 2BNQA 4DF9A 3JWDL 5FF6A 2WKLA 3HI5L 2D31B 2DQ6A 2XTSA 4LQ1A 3OKMB 4QTIL 4FULA 3S4SG 3LKSB 3ZVVA 2G75A 2H6PA 4L9LB 2A0LC 2QQQA 1NPNA 2DQUL 4FFYH 1M6OA 4JG1H 4M93B 5EPMB 4ZW7A 3V6ZB 1YPZB 4AL8C 1FZOA 4GW5B 4ZDHA 4DKDC 4CVUA 4JRYA 5D72L 1FZKB 4G5ZH 2WQXA 2H9PA 2ZX8A 2C34A 2DLHA 3NFSL 5MERA 2RGSA 2NY7L 3JPXA 3GXDA 3DVGA 4WV1B 4ZAKD 4DNVA 1UA6H 2PUQT 3RWHB 4DGIH 1YECL 4OZHB 4XAKD 4FNLH 3VA6A 1MFVA 2EIEA 4G11A 5DJAA 1DZBA 3D4ZA 3QH3A 1I8MA 4MJ4A 5A3IC 1JNLH 1S9WB 4LKCB 3CMOH 3ROOB 1XEDA 3DHMA 2H32B 5TDNB 4YFLI 4Q9BA 4OZIF 1QHOA 1IX2A 1WISA 5L0QB 2ZG2A 1IAIM 4MA3B 1DVFD 3L3OA 3QULA 3B3IB 1A9BB 1QFWM 1SGKA 3NIDB 3BP5A 4TQPA 3OZKA 4YNYA 3C08L 2OVRB 5TTRA 2OVPB 5SXMA 1E9OB 1ZT7A 2ADIA 2QHRL 4GMSH 3FHEA 5DRXA 3NJFA 3VU1A 2Y6SD 5MI0C 3MOQA 3N42F 2YD7A 1AXTL 2E7HA 3KH4A 4FQXD 2XXGA 4FG4A 2YMXH 4EDXA 2VB5A 1KCRH 2XKNB 2DI9A 4OJDH 1K2DB 3J7HA 2PCFB 1H5BA 5KVEL 1XGYH 3GSQA 2TRHA 3OAZK 4G3YL 3P2DA 5AVTB 2O61B 1MDAA 3T8VA 2ZT9C 4PBYA 4XX5A 5FO8A 3HC2A 3SEPA 1QFUH 1NCHA 4MJ5B 4PRPD 1D5IH 1ZA6B 1U3NA 3REVB 3H2WA 1AGFB 4UDTA 2LLNA 3MA9L 1UGNA 4PW4A 4UT7L 4NAAA 3S4SB 4M3JA 2RA1A 2O93L 2L7UA 3SXTD 1LO3L 3ECBB 3GSXA 1NANI 4FYRA 5KZCB 1JV5A 1WK0A 1MHCB 4W9GC 2XZCH 4PJCE 1ACCA 2VDNL 3M17B 1VFMA 3ATFA 2UY7A 5INCA 1ZHKB 1ZPLA 4NN7C 4ZZKA 4RRPM 2IQ9L 3MSPA 3UGXA 2XV6B 4J3UA 3DVNB 2J6EH 3PAUA 4YLBA 1R0AH 1O5PA 4ZX5A 1FL6B 1SYSB 2QSCH 1MJJA 4KUZL 3B7YA 3DMMD 3CFSB 2AV7B 5E8EB 4Z7VF 4O58H 2G9KA 3O4LD 2NYYC 3RVUC 3GEWB 3L5WB 4YBQC 3ARBB 1CGYA 3BT2L 1J9SA 2D3VA 2VLKA 4JQVC 1OB0A 3ZE0F 4LZKA 2H3NA 2OBGA 2WANA 1NSNL 1KCKA 2EDXA 5D4IA 4XCEB 1Q9OA 2V2XA 2Z92B 3IDUA 1NDMB 2VKWA 1XCQA 3EBAA 4HGMA 4KKNA 3TPUA 5HDBF 5IQMA 1JK8A 4LE8A 1UOPA 2VC2B 4FTVA 4NQXB 1YUHA 3FOLB 4ETQA 5E99H 5GZOA 5CJ8A 5I0VA 1J1OH 1QW8A 4PJ9C 4Y16A 1C16B 1WH0A 1WZLA 3FYIB 4Q52A 5E94A 1IBGH 2XWXA 5EA0L 3BUPA 1F00I 3OLEA 2FGWH 3G5VB 1CXHA 4PV9B 5CGBA 3UP6A 3QC6X 2DICA 3G6JA 2Y0SA 4GO9A 2YNPA 4ONGL 3C9CA 4G72B 4M7KH 3V0VA 4YFLF 4YHIB 3ESVF 3ZDYE 3B2VH 3RUGE 2J55A 2VMCA 1CIDA 3GGWA 5C7XH 5I76B 3ZDZA 4PJCB 4I8DA 5C6TH 1P1ZA 3MYJB 4GFTB 1TIUA 4P2RE 3VXPA 3TEWA 4AKPA 3KPSE 3HS0C 2K78A 5HGDA 2COVD 1IQDB 2AEIT 2OULB 5E2UH 3G5XB 3PL6B 3U1SH 4AQOA 1EGJH 3UBFA 2VITB 2AP2A 2LVEA 1IEBA 4N0UA 43CAA 5J6HA 5JR1L 5K33A 2HLAB 4J3OF 1JNJA 4LRNL 3LZQA 4H8WL 3VWJB 3WJJA 3NYKA 3DNKA 1BXUA 2BJMH 4JDZB 4O2CB 3V0IA 1B4TA 1H3PH 2QPDB 3EOTL 4P4KD 5DHVA 3HLAB 3DV6A 3BUQA 4L2LA 5DD5L 3V52L 3W9EA 2CD0A 1TEYA 2AJ3A 2VZOA 2R4RH 4OZFG 5GSRA 3K3QA 4K0OA 1B9XA 1MCKA 4JHPC 4U1LB 2AITA 4AYFA 4NQSB 2P9PC 2HTLC 4GKOA 5L6YL 3G08A 2WW8A 3NOIA 3EOYG 4KJWC 4WFGE 4YR6B 1JJUA 2V3DA 5IJVB 1URLA 1IM9D 2BHZA 1E5AA 4JRXE 1AD9B 2WLLB 3H4FA 1E27A 1HEHC 2VW6A 1HU8A 4K8RC 5FGCB 1GGTA 5GHWL 2WBJB 1H9DA 4RAVB 2IPTH 3E9UA 4WNQA 4WWNA 3EW3B 3ZDYB 4KNTA 5F1NA 1KGJA 3STLA 2W18A 3HHSB 3RUGB 2HMID 3VH0A 4N2OA 4IHOA 2N7AA 1T03H 5CSZA 4X4ME 5I0WA 2IFGA 2PTUA 1J5OL 1AANA 1ACXA 4P2RB 3BAYA 4N2GA 2EDNA 3DJTA 4N0FB 2FX8L 1ODAA 4ZS7H 2XWJB 3CH1A 2X9XA 1Q0YH 4UCFA 3GBNL 4G6FB 3LXCA 4PU2A 4EKJA 5DJ8A 4O9HL 1JRHH 1ZK9A 2MKWA 4NQEA 4Y5XA 4OUUB 3E1ZA 4YO0A 3X1FA 3ZIMA 2WYTA 1ACYH 4AL8L 1MCRA 1NGQH 3GT6A 2YNNA 5C08D 1A6ZA 2Q87A 1G7LB 4LAQL 4JGJA 4BUJC 2BNRE 1MFCL 5T3XL 3HC4L 5KOMC 2HRPH 4JO1L 4MVBC 3NGBC 4P3CL 2HU8A 3LSOB 1CK0H 3PAZA 4MASA 1BPLB 4G1EA 5CEYB 1MWOA 1A6WH 2BW5A 2OMXB 3N41B 4Y9CA 4Y2DD 5KSBA 3REWB 4MDJB 4NKQB 4M5YL 4XVUD 4XWOD 2ZUTA 3GLDA 1T1XB 4PJEF 4PJBF 2AJXL 2DBLH 4NWTL 4AZ8A 4EZLA 1SJVA 2WTRB 5BRZD 3K2UH 3O9WD 1CZ8H 4OZFB 4FE9A 3KLQA 4GBXB 2VN4A 1D5XA 2E27H 1BVKA 1A3LL 3VD9A 2W5PA 3N04A 3RWEA 3I89A 4XXCC 5IFHL 1HEZB 3APMA 3R8QA 2AJYL 4PB9H 2DM3A 3SKUD 1VZGA 4A7JA 5D5MA 1HCYA 1KJVA 4HPOL 4Z7AA 2PM7B 5T1JA 2AXFA 1OGPA 4J3BA 3VG0L 1UM4L 5IHHA 1LQSR 4Z5RA 1QKZL 4G7VH 4GW4A 4L3GD 4ZOZA 2TAAA 3PP4H 4YAQA 1R3IL 3Q5OA 4HP5A 5DJXA 2ICEC 1E2ZA 1O6VA 3EFOB 4DEWA 1T2JA 2H6QA 3EQ9A 3FO1A 1U95A 4LP4A 1A4JA 3EZJB 5E6UB 3KPNA 5FGSA 12E8L 5HYFA 1QO3B 1Z9MA 4FABL 3FFCD 5B8CA 1RHFA 2YD8A 3TH4T 2WAHA 2DIEA 2BNRB 3SDDB 5DQJB 2FT6A 5FYJD 1R75A 4O2WA 3PGFL 4IS6B 4U7KA 4BSJA 2O5YH 2FQDA 3BPNC 4N9GA 2W59A 1TO4A 2B14A 2Q3XA 2DYSB 3DSNA 1L9QA 4DP0X 2DQMA 2Y22A 5I6MA 3L3HB 4MWFA 1F6LL 1ZY9A 4ZTPH 5TH2A 5E00B 2F9BT 4D0DA 3H3KA 4PLKC 2GEQA 4D9RD 1MVYA 4UDUB 1JE6A 4G80A 5J1SC 4AXWB 5BQ7A 4C83B 5AZEH 5EU3A 2WLMA 1SXNA 2DD8H 3BOVA 5JORB 1MLCB 1QPXA 2WB7A 4KJYB 3B43A 4HIHB 5C0JB 2SEBA 4KNSA 4JEGB 3FSAA 1LVEA 5I18L 4C56E 5SWQB 1U3HB 1KPVB 2NY1C 4KPHH 2W9EL 4GLRH 5SWZE 1TVHB 4YN3A 4YGVA 5GZND 3L7EB 4FQHA 3QZMA 3QI9C 5E5LA 1QAWA 4P2CG 5JIQA 2YSSA 5C09A 1S9XA 5DLLA 4Y4HC 4Y7MA 1RZIB 4S11A 2A73B 1IFGA 4KITB 3NT0A 4KH9A 4JBSA 1TVBA 2MQ0A 5AWNH 4OLWL 2DQEH 3WFBH 2R2EA 1ZSHA 5FUCC 5A43C 4JPIB 3I9AA 4JE4B 4HULB 2CE9A 4HJJL 4XNAA 1CFQA 4ERSL 4K3EL 4E0RA 3MI6A 2G4EA 2VLRB 5BMFH 2GSGB 5IG7A 3MRRB 1UD2A 3FQYA 4JFEB 5D7JB 3IURA 1RMFL 4Z0BL 3QDGD 2K7PA 4KDVA 1ZIBA 3MRLB 5KBMA 2OS7A 3VXSA 3VU2A 4ABUA 1RZQA 3JQOB 3RZWA 3P4NB 3UZQB 5AVVB 4MJIA 5K1VA 4FDWA 4PR5A 2ZWZA 4HVBA 4IU3B 4HOWA 4LQFH 3MJ9L 4FQQB 2R83A 3Q9PA 2IAMC 1YR2A 2HSIA 4JRLA 4GQ1A 2K0RA 2VMJA 4OF7A 2VN3A 3MUUA 1P4LA 2TSAA 3T65A 1OTTC 3O3BA 1OPGL 3UPRA 5GS1C 2LW3A 2BIPA 5ACMA 3PGDB 2HJFB 5AZUA 1TU2A 4OM1L 4J5VA 2VH5H 3MJ9A 2BOBA 5C0CE 2H0FA 1K5NB 1P84K 1DEEA 4PM1A 4K3HA 4UUJA 3T3PA 4F7CA 4C56B 1NR0A 3HS0A 1KCUH 2YB8B 1IBFA 4LCWA 3GMPB 1XH0A 4GS7B 5SWZB 3H56A 1LP9E 5D7IF 1JIBA 1EA9C 4RZCA 5LNDA 2AJZB 3FT1A 3KM2A 1G7PA 2PTTA 3D18A 3PHQB 2D7TH 4F2EA 1KNOB 2OI9C 4NENB 4A7SA 3BH9B 1N5AB 3S3DB 3VNZA 2BXYA 3EF7A 2WXHA 4NX0A 1I1AC 2MOVA 4M43H 2YPKA 3IKCA 3LQAC 4Z7UE 2NY3D 1IILE 3PABA 4WCYH 1EHLH 3FTGB 1AE6H 1SYVA 4KRPC 4L3CB 5L8KB 2FRGP 4MCYB 2WUCH 4NC0B 3BCDA 4YXLH 2X4OB 3AUWB 3TT1H 2HVKB 4ZUWA 1DBKH 2EEAA 3BEWB 1NGWB 3KL0A 3CDZB 1VPOH 3NPZB 4N2HA 5HI5C 2P5EA 2ZAGA 3B2UC 5FKQA 4K8RL 4JFHE 3BKYL 1UENA 3S37H 1E4XH 4OWRA 1E28B 2H6OA 3FC8A 5AMSA 2DWSA 4U3XA 2C9QA 1A2YB 4F7KA 3CZEA 4N2LA 3MACH 4FQIH 5E4IA 1FORL 4LSUH 4J3OC 4ZFFA 4GM3A 5DWUH 1WBYA 2DL9A 1FVDB 1JPSH 4PV8A 4HWZA 4LOUC 5FM5M 5ID0A 3U2SB 1S3RA 4M48H 1YEJL 1CE6A 5EWIL 4HIXL 4AK2A 1RIHH 5C0CB 5HHXH 3VI3E 2X6UA 4GXFA 1A9VA 4G6ML 1SVBA 1NEUA 2WWNA 3ARFB 3SDXB 1A6TB 1WBZA 2J12B 2O5XH 2R69H 3PS6A 5IB5B 2IBZX 1KYFA 2BP0A 2VQTA 5H2BA 1LP9B 1OGAE 4DKEH 4F15B 1BZDA 2ALWA 4PUBL 5DLML 2AHIA 2X7LB 3DX3A 5SX4H 4BM7A 4Q9QH 4NUGH 4HMCA 4C4KT 2O6PA 4PJGE 1ZLWH 1GTFA 4X6EB 1G7MA 5E4EC 1CDIA 3G3LA 3GJFH 3FQWA 4TPRL 5I1JH 1LM8V 2OJEA 1I85A 1FCCA 4DQOL 4FCAA 1QEXA 3IETA 2QPEB 4KTGA 4CN4A 4YGAB 4UOQA 1SQ9A 3QHZL 5FFGA 1LWRA 3QIWB 5KVFL 2OTPA 2PR4H 4WJKB 2Y9RT 3JWOC 2YD6A 4YVDA 1GKEA 1CGWA 3DO4A 2EACA 2Q3ZA 4TTDC 1QNZH 2KBGA 3K27A 4WGWB 1BX2A 1RUQL 4X7FC 4Y7OC 5F6IC 4LDEB 5EHFA 2ODIA 2VXTL 2EE0A 3BPLB 4YQXH 3I75B 1XCTA 2NMSA 3FFDA 3BGMA 4XC1L 2BWQA 1SN5A 1KG0B 2VDOH 3ZKMD 1NBVL 3ISRA 4KI5D 4XXCA 1GGBH 1SQJA 3F65A 1U4FA 2ZD0A 4CNIA 2BVOA 2CHWA 2ZXAA 1ORQB 2DTSA 2F53A 2GBVA 2GC4C 3VI3B 5B38G 3MV9A 2VM3A 4XT1C 8PAZA 4PGCA 2YOAA 3FQXB 3Q6GL 3QXUA 4JFPB 2HP4A 2A9AA 3AXLB 4DAGL 1CN4A 2CNZA 4P04A 3RSEC 5FHBL 1OGAB 4B6ZA 2UZIL 2G2RA 4TSAH 2ICEA 4TQIA 1UT2A 3DV4A 4EIUA 4X8CA 1BFSA 1FNFA 4P46B 3UJIL 5HVGB 4JM4H 1KGWA 4PJGB 1NGQL 4XMPH 4JPKL 2K8QA 3LJ3A 3R06B 3U0TB 1DVFC 2HRPL 3PDOB 4OZGE 5JHAA 3G5ZB 2I5YL 2XBZA 1RCYA 5KZCD 5K59E 1CE1L 1TQSA 3KLDA 4PGBA 3C5ZC 3RWCA 3OR7A 1BJ1H 1KUMA 1JZFA 3WS6C 5DJYA 2UXTA 4HH8A 2YUVA 1JFHA 5DRNA 2WMPA 1Z6JT 5IJDC 3FU6A 4YDZA 1UXMA 5L9DH 4XX1G 3MBWB 4GI9A 2HX9A 4XNBA 1HNYA 3VXQB 4R4ND 1D5MB 3S5ZA 4YWGH 3ALXA 1QACA 3ARBD 2CUMA 4I9XA 3BYTA 5CCGE 3GRGA 1Z0NA 4GSQA 3C5JB 3LXBA 3T6VA 3D7PA 2YEZB 4LDCA 4WVRA 5A2LH 1S9VA 4UOW1 3HG2A 4LVOC 4Q56A 1QI5A 3IT8D 3MNZA 4XX1E 1XO8A 3QI9A 5D6CB 2IEPA 3RNKA 3HBZA 5CEZL 1AS6A 3OKOB 4Y4HA 1GP2B 5FLUA 3RGVA 4G6JL 4IBSA 2ZYSA 3PP4L 4NKDB 3TVMB 1F4WH 3MAWA 4F7PB 5C3IA 4L8CA 1T6VN 1EIBA 4TNVF 4KC3B 3F5WA 5EEYA 1Z9OA 2Q76B 1I9RH 3RG1C 3QJHB 1NC4A 1SJXA 4RMWA 1YFQA 2FX9H 3WN5B 3NIGE 4A37A 2EKSB 1YN7B 5FUZH 3DMMC 4UILH 3CN1A 4JZNA 3DHPA 5FM5O 1FFTB 3WIFA 5AVYB 3JTSB 5CD3A 4OZGB 4RFEA 2H9LA 4RISL 3CLWA 4QRJA 4Z7VA 3ME0B 3AB0C 4MJHA 3CC5B 4KNUA 2A4EA 1JAEA 4GM8A 4OCWH 4GRLB 2Y1VA 4ERQA 4DO4A 5F21B 1XMWA 2CGZA 4G83A 4R90L 3F7YA 3FQTB 2GC7A 4FFVD 4U0QB 1GSKA 3TS8A 1RUAH 3EYQD 1I9JL 4Y2LA 4D0CA 4EN3B 5HYIA 2HJBA 4DEPB 1M7DA 3PL6D 4ENZA 5GS1A 1A47A 4G8FA 4D6VA 2DD8L 3H7BB 4MXQD 4POUB 3MRIA 2VDLH 2R1XB 3DX6B 4XE5B 4Y1AA 5HDWA 3S8FB 2Z4QB 4JB9L 4JFWA 5K9JH 5K1JA 1QUNB 3VWJD 3BMVA 5JW5B 4YDKH 5IBLC 1C9LA 4NN5B 4PJIF 5F3BA 4Y8DC 2OSLB 4LEOA 1PZCA 4KXBA 1BOGB 2AF2A 2KH2B 5EG6C 2V2TA 2E5EA 5IKCB 2VR4A 4X9FA 3P9WB 2DDQH 2BFVL 2CA3A 2VM9A 4JPVL 3SY0B 5ICZA 4CY2A 1I1AA 2YQ2A 4KMTL 3SKJH 1M9SA 2PKDA 5B1AB 4HJGB 1HDMB 2WK2A 4J8QA 2OSWA 5IW6A 4JHVA 4F80A 1T5WB 1N6QH 3QWQB 2AJVH 1JI2A 3TNMA 4YDIH 3IDIB 4O4YH 3ZTCC 3NIGB 3SYCA 1XEUA 1DDHA 2A6DB 5EF0A 2WBJD 2R56H 3LEYL 1CLYL 1YYLL 4JFDB 3PJNA 1NFDA 3MJWA 4LSQH 4HETA 1FF5A 5C0IB 2XV2A 4I77L 3ZT7A 3HI1B 5F44A 5KBDA 1UTDA 3LNFA 1SM3H 4P2RD 1TQVA 2AGYA 3C75H 3C5SA 5D70L 3SE4C 4I7ZC 3BVTA 5I8EA 4YSUA 3BVVA 3CFBA 1RIUL 3KJ4C 4LIQH 5HD8C 4G6FD 4CC4C 4KUCD 3LH2L 3DIVA 4J6IA 3RRQA 4QKXB 4ZQTA 4YPGA 3GXFA 2AGXA 4HT1L 4O2FA 4P4RB 4AEIH 3IJSB 2GT9B 1W0VB 5D6DA 4PJ8B 4AG4H 3ABKB 5EC1A 2W60B 3FCTB 4NFCA 4MQTB 2F74B 4JT6C 5J9PA 4WTZA 3QEGH 4RMSA 2BRRL 4IRSB 5E7BA 1Q4NX 2XT1B 4GKSA 5HDQL 2OL3H 2HRHA 2H1XA 2E46A 2ICCA 3B7SA 3O41B 5C70A 3EI1B 1A6AB 3D30A 3UBHA 5H17A 4PP2A 3V6FB 3T0EA 2XU7A 1CG9B 3KPPB 3JWOL 4DT2A 4KQ3L 4QHLA 5BCAA 3CXDL 1CJYA 3CD4A 3EBGA 1J0YA 1BAFH 4DUXA 3J8F7 4QHUA 4CAGA 3RDTB 2OMTB 2W1NA 4O5LH 4L4VA 5F9OL 3ULSB 1LEGB 4YXLL 4KK9C 3AWFA 5AVZB 2IQAB 2DYPA 3DUUA 4XPBL 4X6BA 4GBXD 1OF2B 3FTVA 4TOYH 4UNVA 5J4MA 1GC1H 1V7ML 4L8SA 2DLEA 2OMBA 2Y4SA 4YHYB 2LAAA 1E6JL 4XPFH 1DVYA 1S5HA 4JD2C 4H0LC 3L2LA 4QO1B 1JFQH 3KPRA 3RN1D 1BQ5A 4S2SB 4ODVL 2Q6WB 5KW9L 1D5ZB 2XWTB 1QYGH 1WS8A 3MCLL 3CBRA 3NSYA 4ZMQA 1AKPA 4KI5F 4Z1PA 5SV3A 4XZUB 3A4EA 2YD5A 1RJZB 4JG0L 3K71A 4LP5A 4X0KA 4Y2DC 4XVUC 1PDKB 3AM8A 4R8WH 4M1GH 2CDGA 5CGMA 5HJ3B 1NBQA 5DUPL 4GAJH 1BM3L 3P3TA 4BFOA 3MNWB 1J5HA 2UXVA 4MTMA 2BNRD 2XVKA 3SDDD 3SPVB 1AGBA 3K8MA 4PJBA 3FTZA 4JPSA 5D1ZB 3BO8B 3P77B 4AYDC 4X7SL 3QO0A 1ZS8B 1J0IA 1FVCA 2PLTA 3JT2A 4XHQA 1NTDA 4M7JH 1OEZW 1E8NA 1P7KA 5GRUL 4LCVA 4XPAL 4CADB 3Q0HA 3L5IA 3WIHH 2Z7WA 4K55A 4AWJC 1DVFA 1UD4A 1Z9SA 2HFTA 3GLEA 2F2HA 3MREA 2Y36L 3QUXB 4H5SA 2AXGB 2JKXA 5KN5B 1KPRB 5AG9A 3X14A 5IGQA 4D3CH 1DLHB 4WJ5B 2VDOB 3L08A 4CMMA 2QQLH 1MJ8H 3B3BA 4JG9A 4XP6H 3HHMA 3WS6A 3UVLA 1A65A 1U3HD 4XHJD 1BBJB 2YD0A 4JJOA 3RX5A 6CGTA 1YMHA 1BZQK 4JREC 4Z8FL 3M46A 4FQXA 3T8MA 1D5RA 1DSFL 1K6QH 2UYLB 3DURA 4GI8A 2IH8A 3QUGA 1D2OA 1J1PL 4GP5B 1BVLB 4LLVA 3FM0A 4DFHA 4QTFA 2VE6B 3LD8B 4H25A 3WEBA 3GDCA 3V9FA 5EOCH 4QWWD 1DANT 1T7XA 3QG7L 3KCPB 1JWSA 3NEXA 4PTTA 2PPAA 3QNYA 1ZWIB 1MZZA 4NO0B 3HUJE 4PRPA 1MW0A 1UOVA 1WFMA 4GAAA 1TZAA 1IAIH 1NCWL 2B77A 3CWGA 4L1QD 1S8DA 4Z3IA 3K6OA 1MLBA 1P9MC 4QT5A 5EEZA 3V79C 1A3RH 1U8OB 2VLRD 1QFWH 5AFU3 1AO7E 2AJSL 4JFED 5D7JD 3C8KB 4GIPD 4AYGA 4PRHE 5JYLA 3I2CL 1IU1A 4I0PC 4UZGA 1WZMA 5F1IA 2HLEB 5CMAA 4Z3GA 2VOTA 2GJ6E 3FO0H 1U93B 2JCWA 5A16B 1KBPA 2XZAL 4RBPH 4LCUB 5DZOA 2MCG1 1MIEH 1ED3B 4J8BA 2FZ3B 3MRGB 4GG8A 4DW2L 3CLFL 3DYOA 4GRWH 1I8LC 5TE6H 1F90L 3DMMA 2B7DT 1CF8L 1U8MB 5DS2A 1AQKL 3GM0A 4Z3HA 4CZXA 5J5EA 3IDMA 3O4LA 3MRNB 4K2UL 2VKXA 1EO8L 3FL7A 1Q94B 3LMJH 5KOVC 1X7SA 2Y7NA 1WAAA 5D2NA 4J39A 3CCHB 3UG4A 5ABZA 1VE6A 5JOFA 4GM9A 2HVBA 3JYCA 2WJ7A 2GUOB 4W68A 3ARYA 1BEXA 4C56D 1KCWA 1LK2B 3OXRB 3EJJX 3P73B 5SWZD 2YZ1A 4OU3A 3N44F 2D7PA 5GXHA 5LGJA 3E6HA 5EU4A 5IWLA 2VQUA 4RMQA 1JGDA 4AQAA 2FH6A 1YY8A 4HXBH 5FB8A 3I6SA 2EYRB 3TA3C 3HUJB 3IDGA 3IKKA 1HKFA 2CUHA 2B5LA 1TTUA 4HG4J 4M4PA 2R39A 3B1TA 2VERA 3JROA 1PS3A 2ZCKH 3BUYA 3CZGA 3EGSB 1H2ZA 2FSEA 2GB2A 2ADJB 2Z93A 2RCSH 4PRHB 2ETWA 2QGCA 3TBVA 5ABDE 1GZPA 3RL1A 1Y0LB 2CN3A 2CBOA 4XN9A 2G9AA 4MB1A 4Z7NE 2BS8A 4FQ1H 4OSUL 5IQLA 4F33A 2GJ6B 3OAYK 1EEUA 1JERA 1HXYA 2L04A 1TYEA 1SRDA 2F58H 2ZQKA 2VZTA 1XR8A 3AREB 3T2OA 4F8PA 4AJWA 2X05A 4UILL 3ZDYF 4AQZA 4RVBA 1E4KC 4X42A 3RQ3A 3FQUA 1HXMB 1FE8H 2FECL 4XH2B 1OAQH 5FHAH 1AIFA 3UAJC 3O2WH 1T21A 5DGQA 4LHUA 1RFDL 2NY3C 3ARZA 4MJJA 2UXGA 5C0CD 3OJ2C 3P02A 4FQCL 5D2LF 3WXVH 3ARFD 3SE4A 4ILDA 2AK1H 4P4KA 3M86A 43C9A 3F00A 3UMNA 4ZUVA 1FHGA 1GZHA 5H37H 4GO6B 3T4AB 2XQYG 4OV5B 1LLAA 1XHMA 3LQZB 4JZOB 3ZTDC 5E4AA 1RZ7H 2W9LA 3NIFE 1JWMA 3EGDA 5E0QA 2MPAH 5LDSA 4YE4L 2ZF8A 3PFQA 2VM4A 3BDBA 4A7VA 1YCSA 1JXGA 4AGNA 4F8OA 4BFGA 3MZTA 4S1DC 1IM9A 2IDSA 5A6LA 4CZVA 2G5UA 4IQHA 1U41A 1N18A 1ITCA 1MH5B 2XACC 3N41F 3EYSH 3QIWD 1MHHB 2J2ZA 1ROCA 4ABVA 3SKMB 4JKPH 5F70A 2BCMA 2X0WA 3EH1A 3EG9B 3MOAL 1RH8A 1P5UC 4KH2A 4WW1A 2Z0BA 3IJ7A 4JFHD 4Z7NB 2PPFA 1I1CA 5E1GA 5CZVH 5DJ2A 2QKIC 2ZUXA 1QBAA 1A3ZA 3CNKA 3HPJB 3MKSB 4W6XB 3MUGA 1OE1A 5M5RA 2DQTL 5JW4N 1PLGH 5F7WC 1OWWA 4EUPA 2H68A 3QIBC 5F3HB 4GUPB 1RSYA 1A7PH 2C4FT 3H85A 4BFKA 3IJEA 4N2BA 4XNDA 3ALPA 1F45A 4M1DH 2BSSB 3OPZH 3W81A 4F9PA 3APCA 4JHAL 4WAFA 5HPMA 3RAJL 4PBVC 1S7SA 4Q8BA 2CJUH 4FFZH 5C08A 1IL1A 3ARDC 3GSVA 5AW5B 4U7MA 3CUPA 1R24A 3WJLC 4NIYE 5E8DH 4Q6IB 4LLQB 2YAPA 2F18A 3GIVA 1QVOA 3QG6B 4AGPA 2VJXA 2QSQA 2ZNWA 1SEQH 5GGUB 2NUTA 2I0SA 1IGYB 1OGAD 4UANA 1YJDH 3LKOB 5I16B 3OC8A 1GMIA 4QPEA 4UTCA 2AEPL 1QEWB 2FJSA 1R3LB 4P5MA 1FN4A 4Y2DA 3NIFB 3GUTB 3NBNA 4P46D 3T71A 3LRHA 1EHNA 3HZMB 5L0QC 1A7RH 4KVPA 3M7OA 4OJYA 1GGCH 3PSCB 5BRZA 5AAWC 2VXQL 3ZT5A 5TPWH 1OCWH 1NDGB 3P0VH 5I17B 1DYZA 3IJYB 2UUDH 4PJ7E 2DTML 4JO4H 4AIZA 1JSYA 1AD0B 3FHQA 5C92A 2FNWA 3U7AA 3MLRL 3HFFA 4KI5C 4JANB 1QBBA 4K3GA 4Q9RL 3S34L 3QUHA 4OLEA 2EDHA 2Z7YA 1KLUB 1UT9A 1EAPB 2VXQA 3JZGA 2CO1A 3IPEA 5B7EA 4JR9H 2VXUL 3FBKA 2O1AA 1NIEA 5IVXE 1JYXA 4HDJA 4HSCX 3UZVB 2FEEL 2R0ZH 5AKRA 5IR1A 5FM8A 3VFNA 2CGYA 2F54B 3O3AA 2GITA 3SPJA 1YZZA 3BWUF 4DZBA 4XP5H 3EGXB 3BWZA 3EOBB 5FYJL 4AMKL 4AM0B 4EBQH 3EDFA 1EZVX 3E2HB 4MA8L 2JK5B 1FBIL 2CO0C 4RFNC 3B9KC 2Y7SA 4PJFF 3GYRA 2OCFD 4FZEH 3FFCA 2HVJA 1MQ8A 1QYGL 2V0AA 1BF8A 1LK3L 3WY1A 4WTXA 4KO9A 5IJ7E 1FQ9C 3TVMD 2VMEA 1D7CA 1VZ2A 2FR4A 2QBWA 2YNOA 3ZHLA 2HESX 2APFA 4KMQA 3U4YA 3F62A 1UXSA 3CFKA 3N9GL 3ZZLA 4ZW3A 4UQIM 4R8WL 3IN2A 5FX3A 3BC9A 5CCKL 3X1EA 2QZ5A 1TZ8A 1T0NA 4BH8A 4YDJB 1IBYA 5CHNA 3KPLB 4X8JB 1RQ5A 3PXHA 2BMKA 1LDPH 1UASA 3WKYA 4PJ7B 2DLTA 4R4NC 2WLZA 1NGYB 3ARBC 1M6UA 3RYMA 5IP4A 1N7MH 1MW2A 4TUKL 4S0SD 5AUMB 3MBXH 4GRLD 4RRPG 4OH2A 1P6FA 1OAYH 4QXTB 2VN7A 1I8LA 5GZNA 2WXJA 3KWWB 1AJ7H 4XNQA 3AU1B 3KGSA 1O9WA 4O02A 4ZRGA 3FJTA 4EN3D 1FL3B 5AB0A 5IVXB 5DR5H 2VDRH 4R3SB 4AVKA 2CJ3A 4Z95H 5DRZB 3PWNB 1OKEA 5L2JB 1OAUH 2RALA 3BE1H 1JRHI 3CQQA 3IUNA 3RPIA 3KWVA 2W8CA 5GJSH 4APXA 3SD2A 5D9SB 3ZE2A 4ODXB 4QCIA 2AMGA 2B4CC 3RWJA 2I9LA 2ZKMX 3QXDA 3KGTA 5C0EB 2YLKA 3D6GA 2VDQH 2Y3AA 4KK8D 5CJXA 3QDGA 4R2GC 4MAYB 2MCAA 4JDVB 5EU5A 2BERA 4IOIB 3T04D 1PEZA 5AG8A 5GGVL 4LBAA 4OD3H 5C0AE 4LGSB 1Y18B 3F58H 4FA5D 3CDYA 4U3HA 2FO1A 1GPOH 1WT5C 4D0BB 5I74B 4FFVC 2NCMA 5I8OL 1G9HA 3B2PA 1FO0A 3WKNA 1I4FA 2FO4A 1N6VA 2NTFB 3K72B 4XPHL 5AKSA 2HPTA 3WELA 4MXQC 1KT2A 5IOPB 2NX5E 3BSZL 3V4UL 1KPUB 4JFDD 1TCRA 4A67A 1KN4L 3NCJH 3PJSB 2OXHA 4E5ZB 2QV4A 2PO6B 3PXWD 3MRQB 5E51A 4QJ5B 1MIEL 3NSDA 4RSVA 5ID1A 3BKCL 1TQWA 4FYSA 1UCBH 1B9ZA 2EE9A 4ZW8A 3BSZA 3WFHA 1YAIA 1IM3B 4DKTA 2CA4A 2N4IA 1U4CA 4X4KA 3UAJA 4HHGA 2B59A 2KPWA 5DUBA 1E5TA 2BS9A 2EEXA 2X4SA 2EUVA 1GXRA 4WQOA 1WS7A 1J1XH 3R4RA 5JUEH 4PJ8D 2HN7A 1T1YB 2VR8A 4P99A 1NLDH 4S1RH 2HTKD 4JFXB 2N59A 1E9PA 2R51A 3T1FB 3K74B 5CO1A 4YMPA 4IRSD 2FJHA 3QHFH 5CYKB 3TESA 4WSGA 3BVUA 4PJHA 1OP9A 3DBXA 4NQVB 1XGUB 3QJRB 2HZHA 1JDCA 4HIEA 5ADPH 1SY6H 4HUCA 5JIHA 2ZWNA 2QQKL 4TSCH 4YHPA 4WI0A 4JY4B 2QPFA 5C0AB 3A47A 5GS3A 3A0FA 1P4UA 2FQGA 5JA8B 4JJHA 1Z2KA 5M7QA 1WFIA 2CBQA 3GSRB 5DI8A 3FCUB 2CSPA 2WCPA 1COBA 3RDTD 1DLFH 3LKQA 3SKNA 4AYEC 5ACZB 5DJDA 3P4FA 4HMEA 1J8KA 4Y5YA 2G60L 3NH7H 2Y1YA 2EC9U 4ZMXA 2G30A 4U1SB 3PPEA 4GW1A 4JM2F 3PUUA 1KB5H 2NX5B 5DFTA 3CPLA 3OKDB 1ZVYA 2H26B 4R5TA 3OAUH 2X89D 2XYIA 2NXYB 3ILPA 2WQ8A 5FK9B 3GXNA 4UTBH 2QKIA 4GLRI 2F58L 1VEOA 2D31A 3OKMA 1N67A 5DVOA 2J5LB 3LKSA 2LR4A 3B8SA 4NQCA 1FHNA 3BAWA 1QA9B 2IXQB 5AVWB 4A11B 1KIQB 4L9LA 4QRBA 1OAQL 3V6ZA 4FI8A 3PXTD 1BHGA 4IMKC 5EPMA 1FA4A 3NCYP 2R7EB 2DQFB 1JYVA 3SYQA 1FZKA 2CO4A 2VR6A 1K85A 1TKWB 4M02A 4A6YH 5T8IA 1EDHA 1A7QL 4WV1A 4JFUA 5E5UB 2A1WL 3E1F1 4OCNC 2ORBL 3WJLA 3RWHA 2FBRA 2WBXA 4YXKH 4OZHA 4A2FA 1LYQA 2Q7NA 2ENPA 3NVNA 2A9NL 3LB6D 5F7YC 4GBXC 5D1ZD 1ZT4B 2CQVA 3KL5A 2DLFH 3F05A 4LKCA 1USZA 5DUML 3ROOA 3TJEH 1NCBH 3X3FL 4DPAX 5TDNA 5FLXg 4V1DE 2NY2B 4L1LA 3O81A 4NRXB 1KELL 4TNFA 3I6GB 4OGZA 1FGNL 4Y4FC 4MA3A 4IJTA 2E9WA 5AAWA 2QGBA 3QQDA 5E2TH 2Y5QA 3B3IA 1A9BA 2Z9TA 4MZIA 1V3MA 3QUXD 5I1GH 5EN2B 4JGNA 2AAVA 3MMEB 2ADFH 4PQXA 1UJ3C 4DTGL 3Q2WA 3SDYL 2GY5A 1E9OA 3HG1E 5AQ0A 3AT9A 4ZTOL 5T3ZH 5DO2D 4XI5D 5J6GA 2GJJA 3FQ4A 1NDTA 3QBTB 2AEOA 2UZYB 4X0NA 2OTUB 1UHVA 4DVRL 4A08B 2XKNA 4QXVA 4C4UA 2D4DA 5EZIH 4MBRA 5IBTH 2W81C 1K2DA 2PCFA 4WLCA 4BE5A 1ZVHA 3SDDC 3EH2A 3GINA 1YEEL 1E8ZA 2O61A 1TZIB 3OKKB 5IMKA 1RURH 4POYA 4NO0D 4U1GC 1QTYT 3OPZL 4K5LA 4MJ5A 4PVBA 1G0YR 1ZA6A 4P5SA 2CO0A 4P23B 3GEFA 1CL7H 4P57B 3REVA 1AGFA 2C3HA 4MMYB 2DQHH 2XA8H 1S9YB 3VMPA 1NKOA 5ALBH 3K4ZA 3S4SA 2G2PA 3UGUA 5TEEA 4ZYKB 3VAEA 3KZ8A 4ODHL 3ECBA 4LF3B 4TSBL 5ALCL 2WVTA 1MHCA 3S6CA 2Q9OA 5AJAA 4XYIA 4A2GA 3M17A 5JHBA 5IHZB 1NCOA 1ZHKA 3ZPDA 1E4XI 2O6EA 4XBMA 3BWUC 3JXAA 3DVNA 4H0GA 4V1DB 4F2ME 4J23A 4BJLA 1FL6A 1SYSA 3CTTA 5B1JC 5TPWL 1ML0A 3DOSB 2AV7A 5E8EA 2EYTA 4TTGA 2VWEC 4W4OC 3HVNA 4JAMB 4ELME 4N28A 3L5WA 1T89A 4QWWC 4U0RB 4HQQH 1KXQE 3ARBA 1MFAH 3HG1B 2R8SL 4R26H 3O6MH 3VM7A 4BDVB 4JSPC 4WU5B 4QXUL 2KDYA 3MXVL 3OKLB 5LBSL 4XCEA 1MNUH 2EADA 1NDMA 2Z92A 1E7VA 2ZCZA 5C0BE 5JPNB 5D7JC 2B4CL 3W5NA 3FFOA 2VC2A 4NQXA 5T33H 1NKGA 2JQAA 2N3JA 5KJ4A 3FOLA 3WHXB 5TDPB 4Z7WB 5I19L 2VUYA 4I18B 1GYVA 5SWSE 5SX4I 3WE6B 1DJIA 2A6IB 5GRVL 1BLNB 1C16A 3B6SB 3GTNA 5LBSA 3BH8B 1MG2A 3SYOA 1WRFA 3G5VA 4HUVA 2AABH 4PV9A 3ZKND 4DN3L 1FLRL 4Q7DA 3NACL 4LCIL 4E9YA 3UACA 4KKZA 4YBLB 4YHIA 2YLHA 4PRHD 3ULUD 2JJWA 3FU7B 5JDJA 3OKEB 4F57H 2C3VB 5I76A 4PJCA 4GSRA 1BA9A 3IMVA 2GJ6D 3MYJA 4G8GE 3ZO0A 5JXED 4NBMA 1SBSH 1J87A 3QHTC 1WT5A 2MH4A 3ARED 4F2MB 3KVPA 3WD5L 1IQDA 4HIJB 1KYOK 4G56B 1FWXA 2DM7A 3G5XA 1JGEB 2XJKA 2Z8SA 3AROA 2VITA 3QPKA 5KVGE 2AERT 3VMNA 1TFHA 4XVTL 1WE5A 5EULV 4X7DC 4ELMB 5BOZG 2HLAA 1SN0A 2I60H 4YDMA 3MLXL 4UV4L 4X5WB 3TEYA 2WWKT 1G84A 4H8UA 1CGTA 2CKBH 4JDZA 3IJ0A 4O2CA 2HKHL 3MHZA 3MKKA 3QRGL 2GBUA 1XGQB 3HLAA 3ZUCA 1M4KA 1VGEL 3AQZA 1CLVA 4GSDL 1QI4A 3G7TA 5C0BB 5KYXB 3AUVA 4ORZC 2CG9X 4XMUA 4GEIA 4R7NA 4PIRF 4U1LA 4AENB 5SWSB 2AGZA 2YBGA 4BBWA 4NQSA 1B3IA 1B0GB 3EJUA 4JS7A 4YR6A 1XH3A 4BCCA 1RZKH 3TV8A 4ZO9A 5BVPH 1FAIL 5E9AA 3OQRA 2X2UA 4ES0A 1AD9A 2WLLA 3WMQA 1AOHA 2J8OA 1KJ3H 2WBJA 1EZLA 3EH3B 4TQHA 4X8GA 1GJIA 3ZDYA 3SN6N 1NBCA 2YN3A 3K26A 3RUGA 4ODSH 4TRPL 1SBBA 3ES6B 3LEXB 1MELA 1L9PA 4H20L 4Q0XL 2P9RA 3VQLA 5IFAL 4G8GB 2V6HA 3ARFC 4N0FA 1NMAH 1N59B 1XV8A 4FI6A 5C9ZB 3VGGA 2OR8A 2XWJA 3L81A 1Q9WB 2VXSH 4RMRA 5A2FA 1DQVA 1G6RH 5HHOE 4AX3A 2DJUA 1Z9LA 2DM2A 4OUUA 3CLEH 1S78C 2OTWB 3EFDL 3MXWH 3IULA 5EU7E 4C58B 1G7LA 1WBXB 3QJZA 3IJ1A 4K3DH 2XDWA 1G0DA 2VSDA 1V7NL 3LSOA 3LHPL 3TZVB 3K2IA 5CEYA 4IMKA 3BGFB 3E8VA 5DQDH 4GUOA 1WAPA 2OMXA 1K5WA 5I71B 1ET7A 2WXRA 3REWA 5KJRH 4MDJA 3UTQB 4PJDF 2XU9A 4JM2C 1T1XA 3Q2VA 2WTRA 2CUAA 1D6VH 3DHUA 3BPLC 4OZFA 4QOKA 4GBXA 5IHWA 3VGAC 1I9EA 3TTYA 5EM2B 1KC5L 5ADPL 4DNWA 1NL0H 5FA4B 2E7MA 4FNQA 3ZL2A 2DB8A 1HEZA 2NXZB 1DJGA 7TAAA 1JF1B 3GSOB 4MHHG 3M88A 1OY3B 3CHSA 3QXVA 1TJGH 4R4FL 3U1PA 1YEIH 4CI2A 1IGJB 4L1SA 2F54D 4TQEH 3KEHA 1MCIA 2V7HB 2JCCE 4DVBA 4M1CC 4LRIC 3ZZ1A 4PB0L 5C1MB 4GUQA 4FFYA 1Q9LB 4MX7B 3EFOA 4PS7A 1UM5H 2NT0A 3BZDA 4P46C 5E70A 5F88B 3V4VH 3ESOA 4ZZFA 1M7IB 2NY5H 2YGNA 1AFVH 1PKOA 1YG9A 3N3EA 2IOMA 4IOFD 3WAJA 5E6UA 3L95B 1A6PA 1QO3A 4HXAH 3O4GA 2FVNA 3L3GB 2BNRA 3SDDA 5DQJA 1YNTF 1VCBC 2ZKHL 4KTYA 3U4AA 4F8TA 1HZLA 1YLBB 4IS6A 1SDDB 4OZ4B 3E7JA 3UVNA 5LUMA 3FF8A 4ONFH 4XMZA 4JY6B 5KBLA 3L3HA 1DJHA 5E00A 4GXVL 1AS8A 1R5IB 5TE4H 3IJ9A 2PCYA 4LASL 2X6MA 4B27A 2OFQA 4UDUA 3QJOA 5ABAA 4LLMB 4AXWA 4PV1C 3MLSH 4C83A 1KF9B 4L18A 3A4FA 1G7JA 4HS3B 2J56A 4EIZC 5JORA 4JPWH 1KIPB 4KJYA 4HIHA 1QMUA 5C0JA 5ITFB 2HJLB 1S5IH 3S5YA 1E40A 1U3HA 5SWQA 1CXLA 1KPVA 4HBQA 4HS8H 1A14H 3QNXB 3WFCL 4AMZA 1TVHA 5E9DE 2YXFA 5B1JA 5CJQH 3R1GL 2CUIA 5TF1H 5BXFB 2VO8A 4GINA 3DXKC 4K3JH 3EJYD 5HDOA 5EFIB 1RZIA 4PJFA 3UTZB 3UAAA 2A73A 5L2KE 1A0QH 2IADB 4IRJB 4MA1B 4N25A 4DJMA 1EMTH 3RFZB 3WUWG 4R7DB 1ZAGA 4XP4L 4JPIA 3FH7A 1OLLA 1T5KA 4WHYG 5AVUB 4L29B 1JV2B 3WN5C 2FUTA 1HCVA 4MAUH 2VLRA 1EDQA 2GSGA 1RZJH 1ES0B 3ABLB 5KS9F 1RUKH 4HA1A 3MRRA 4JFEA 1T3FB 5D7JA 3AXIA 5MEQB 3R19A 1OSYA 4BHUA 4MAYD 1MPAH 5H4ZA 3MRLA 2K4AA 4LSDA 5F9WC 2YAOA 3HR5B 1SF3A 1I3GH 3SD5A 3P4NA 3UZQA 3X11B 4BUHA 3UYOD 1NIDA 2P1YA 1GIGL 3ML8A 3ZKXC 3HEIB 1IC4H 4IU3A 4MKMA 4FQQA 1RZ8B 2PXYC 4HZAA 2AGWA 3J27A 1E5UI 1FVEB 2XI9A 3ULUF 5I9QC 2Z8RA 5ALBL 5IEKB 1TNMA 4DEUA 4EN3C 1URZA 3D9AH 2VZVA 3VFUB 3X1BA 2HJFA 5I0YA 4XNYH 1BBDH 1IC7L 1T20B 5FYKH 3E38A 4N8CL 1K5NA 5M5SA 5FPIA 3MNDA 2JI1A 2PO6D 4PCSA 3SDXE 4DHLA 5A7EA 2HT2D 4C56A 3KWUA 4H1LB 3GMPA 5E9DB 3KPQB 4S10A 1JZ2A 2AJZA 1B3JA 1O0VA 4BKTC 2DQGL 3PHQA 4KK8C 2QELA 3GS4A 5GXIA 5F9JB 1IM3D 1KNOA 4NENA 4XCNB 3BH9A 1LXMA 1N5AA 4ZXBB 3TX4A 4BH7B 4XN2A 3ZLQC 1M1SA 2J8HA 3UIYA 1S3KL 3A3YB 5L2KB 4RQQB 4DKFH 3FTGA 3O6ML 5DFVD 4ZMPA 1TETH 3QA3B 1LO0H 4IGBB 4L3CA 5HGHB 4H8VA 2FBJL 1YEFH 1J8RA 2UVFA 3QDME 3M8OH 3DO7B 1YMME 1OLZA 3DETD 1F42A 4KK5C 2Z2NA 4PJAF 2X4OA 1JPTH 5GQBA 3K80A 2HVKA 3MRBB 5EIIG 4CJ1A 3BEWA 1BJ1J 1NGWA 3CDZA 2F8OA 3LKPB 3WUWB 3FTYA 4LDOB 1E28A 1PQZB 5EZPA 1A2YA 3O6KH 5C0AD 4APQB 1JN6B 1KLFB 5KYYB 1JHKL 4YHML 3TFKD 1FNAA 2AJUL 2FIKA 2P48B 1FVDA 1CXFA 2FJUB 4UB0L 3NABL 1DCEA 4OFQA 3MJ6A 3H3BC 3QZLA 2NX5D 1TJIH 2NXYD 2FT8A 3FU3A 5E95B 1AS7A 1ULVA 3ARFA 2Y23A 3OZLA 1A6TA 2IPKB 3I6KB 4MD0B 4PJ8C 2UWEE 2E59A 3BPOB 5IB5A 2HTKC 3W39B 5I6LA 2AQ1A 4BZ2H 4MK0B 5EZLB 3T8XB 1IIKA 1LP9A 5FM4A 3ZBMA 1GXEA 2NNRA 1AZCA 4IRSC 2X4NB 3C2AH 2H8PB 3DGCR 4J3SA 5I1KL 1F1GA 2X7LA 2X0VA 1NUGA 5TF0A 3VD0A 4I4WB 1KOAA 3LIZH 4X6EA 2CKBL 2K70A 1SMAA 3WJMB 1IAII 4A7GF 1MCOL 2EXWC 4N8UA 3RDTC 1GJUA 5DWPA 1L9RA 3QDMB 5J12C 3UMTA 1J10A 4PJ5E 4S1SH 1YMMB 1YUKB 3A22A 2D2OA 4WJKA 1JZ6A 4QRAA 4FZ8H 4UBDD 5EF1A 1P4BL 2YEVB 4WJG3 1MREH 1I7RB 3IDXH 4E2OA 4NZRL 4HG4K 2NY2D 3BAIA 2P5PA 4OCXL 4M56A 5A2CA 4QRTB 3ZRSA 4L0PB 1NOFA 1SXSA 4FN0A 4NM8L 3V5HB 3I75A 3HE7C 4XN1A 5EIIB 3WTYA 3T0BA 1KG0A 3B8YA 5BJTB 2NQDA 3VW3L 1ETA1 2CLRB 2CHDA 3BPCB 2APWA 4ODSL 2OW6A 4KKAD 1J5IA 3TEXA 2G99A 1ORQA 1FL5B 1MJ7L 3EZ8A 3VI3A 4A38A 3D0AA 3IRPX 3WLWD 4ABQA 5BVJB 2R27A 3FQXA 3VYNA 4JFPA 5J8OA 3AXLA 4UINL 4B41A 4KHTL 4B96A 3LB6C 3MNVB 5CGYD 1T4KB 1OGAA 4LRIA 2P9UC 4GG6E 2GI7A 1T04B 5F72S 4YUEL 1XHHA 3CSFA 2KLRA 4AJVA 2Z31B 4LSVH 2VSCA 4P46A 4P23D 4PJGA 4XN7A 5ICUA 3R06A 3U0TA 2X6VA 1D5BA 3PDOA 3QUXC 1FFNB 3G5ZA 4AC4A 4PJ5B 4KJQD 1KEGH 3ZR5A 5E03A 2MPVA 2VDKB 1HJCA 2OYMA 3TBTB 4V1DD 3AITA 2X40A 4B9CA 5AW8B 5BUPA 3NZHH 2DQDL 3VTTA 3MBWA 4WEBL 4KQ4H 3S8WA 2ENSA 4G1MB 5M5TA 3VXQA 5D1XC 5C0RH 5DK3A 5T5FH 4Z7OE 1D5MA 4IKIA 5F7LB 4J73A 1HQ4B 3GNML 4YE0A 5L7XH 3HG1D 4JCMA 1AC0A 5DJCB 3C5JA 2YEZA 1C5BL 2IIJA 2NNAB 2UV3A 2F5AH 1PBYB 2WQRA 4FQJL 4FKEA 4PS3A 3F3PA 3MZLA 2XTJC 3MRCB 1EZSA 1FNGB 5J0BA 3HIZA 1BF2A 3U9UB 4F7EB 3K6IA 3OKOA 2OSXA 3HB3C 3VG9C 3ZHNA 2PYFB 3Q2CA 4IK7A 4NKDA 5ECJE 5DMYA 2YPVL 1UWYA 4L1MA 4F7PA 3QRBA 3QJUB 4UZUA 1F5WA 4HJSA 4GG6B 4YPJA 4M03A 3ZTEA 2Q76A 4G70B 4MB4A 3SQBB 5CIPB 4JDTL 5CP3A 2X87A 3H9YA 1JPGA 3QJHA 5B38A 3GMNB 3KEDA 3IUJA 1WF5A 3WN5A 2CGRH 1HIML 4LEEA 4N2NA 2MQ3A 2EKSA 3QJVB 1YN7A 1U36A 5FWQA 4HLEA 4ACTA 2WYZA 2YPVA 1B6DA 3EH4B 4ES9A 3NA9L 1KBKA 1OWRM 3JTSA 4PG9B 4UQ9A 2D7OA 2XBDA 1IVTA 2VZUA 3HRZB 1F58H 3MOBL 1WHPA 3NJNA 1L3NA 4HZLB 3V9EA 3FZUD 4LSSL 2D7NA 3ME0A 3HNTL 3ETBF 3QC5X 1IFHH 1JZ7A 4GRWF 4QMEA 1ZGLP 1YC7A 2WGXA 4ICXA 1KJ2H 2PXYA 3WXWH 4HSQA 4OD1L 1KEML 1RSFA 4GQZA 3EXLA 3QCUH 3FQTA 4OGXL 2C1PB 1T22B 3D8MA 4A7UA 2ICWJ 4OY9A 3QPXH 3VYOA 4EN3A 2GSIB 2ZOKB 3UBXI 4UQDA 2AGJH 3GLAA 1AH1A 1BMGA 1MFEL 3H7BA 4Y4KB 4CRPA 3DX6A 4FTVE 1QZNA 4G6KL 3C12A 4Z7OB 3IMUA 5GGQH 2BVTA 1R6VA 1IBDA 1QUNA 4JHZA 4MNGE 4WZ9A 1ZV2A 2KUTA 5HVHB 1NGPL 4TKWA 2OSLA 1GOGA 3RY6C 1NICA 1BOGA 2WTOA 3NFNB 5IKCA 2HPOA 1DJSA 3NTCL 4FQ2H 4PMEA 5C0BD 1Q90A 3SY0A 5HE2B 3ULUC 4DNUA 1O9ZA 2O4EA 2IO5A 4HJGA 5SWSD 4JT5C 2YO3A 3SBQA 3ZOAA 4U1HB 3K0WA 1XIWC 2OMVA 4OCRL 2P43B 3FT0A 1T5WA 2EVHA 3SGKA 4HBCH 3AREC 2IH3A 5CKAA 3L6FB 3NIGA 1Q0XH 1UYWL 1T66D 1WCQA 1ZLUH 3HZVB 2A6DA 3WCYA 5BV7H 5IM7B 1CLZH 4OB5L 4NUMA 2Z2OA 4N0UE 4JFDA 1OE2A 3QS2A 4B7LA 3A6BL 2L0DA 3ZHDA 4Z7QF 5KBKA 5E08H 1CBVL 1G9NH 2BY1A 2HYMA 5C0IA 3SQOL 5DMKB 4IOSD 4G8GD 1SXBA 1RHHA 1MHEB 4RFOH 4UAOB 3BAKA 3FB7B 1OOAA 5EOCJ 2CBPA 3T4AC 1YNKL 1XSIA 3F8UB 5CFHA 1PNDA 1BG9A 4YDNA 1BBDL 1FRGL 1B2YA 4A09B 4HV8B 2ZOTA 4NBZB 4P4RA 1YEDB 3ZDWA 3IJSA 2GT9A 4M6NL 3NN8B 4LCYB 4U6VH 3U4BH 4M62H 1FNHA 4PJ8A 3K2MC 2W60A 3FCTA 2FEDD 1ZHNB 5ILTL 4MNGB 3SDAB 2F74A 4LVNC 1TQCC 4HPYL 1CU4L 2DWEB 2EVFA 3LH8A 2H9MA 1OGTB 3OB0H 4IRSA 1PSKL 3GI9H 4ISVB 3F3HA 4HALA 3TZVD 1N4XL 2CHZA 2NPLX 4CSTA 2ZPKH 1JGVL 3CHRA 3M7FB 5HE3B 3O41A 5GRZA 3EI1A 1A6AA 3V6FA 3UC2A 1CG9A 3KPPA 1DUZB 1X5XA 1A25A 4P9MH 1XDTT 1BM7A 1N0XL 4HCFA 3RDTA 3QUZB 2OMTA 3ULSA 1LEGA 4FL4B 1RP9A 2IQAA 5EZOL 3TYFB 5GRXG 1SOQA 1OF2A 2ZX6A 4MLIA 3ALWA 3H9ZA 3GFUA 4HDIB 4DP1X 4L0YA 5AYQA 5ESAB 3T1WA 2X89A 2NXZD 3EJPA 1N0LB 2Q5BA 5CLYA 4MQ7B 1RJYB 4QO1A 1A7BA 1H9VA 3WFEH 3WKPA 2Q6WA 4S2SA 4XXWC 3ZX1A 4I0CC 1KB3A 1D5ZA 2XWTA 1D3CA 2J7LA 2R69A 4PJ6A 3JWNG 4BQCA 4BEIA 2XKSA 3NVXA 4Q6IC 4QYOB 1EERB 4YSSA 1MVFA 1RJZA 1MUJB 4CSPA 3DUSB 4FHJA 2J1ZA 1IT9L 4YSPA 3ZTJH 4YHLH 5HHOD 1CGVA 2QDWA 2NQ3A 2W80C 4ZFZB 3OPUA 2D9QB 1QSEE 1F1DA 1H0DB 2WLYA 1SDAB 3MA7B 1PDKA 4L3EB 3JWNE 2CH8A 5HJ3A 4M8QB 3A6CL 5DZAA 3WG7B 2Y2TA 3MNWA 4ANXA 4N4YB 4Z76B 3SPVA 1NWOA 4UT6H 3G08B 4N1EA 4NJ9H 5D1ZA 3BO8A 3P77A 4G5AA 5E8NB 4IDJL 4QRQB 1CTNA 4Z7IA 1GC1C 3SIKA 2J88H 4JK0D 1OM9A 3OAYH 4P3DB 2L7JA 4JO8A 4JKKA 3NFPA 2CHNA 4CADA 4H0HB 1KBBA 5HI4D 1HJBC 1YEHH 1KXTB 2DLIA 4JHWH 3W15A 5CF3A 3S36L 1B4JH 2WN2A 4YBHA 5D5ME 3QUXA 2ITFA 2X4TB 15C8H 2AXGA 5KN5A 5JW3L 1QBMH 1KPRA 3KCWA 1DLHA 4OTXL 4WJ5A 3BDYL 2VDOA 4WI5A 5IQOA 1TLKA 2WCSA 3KYNB 2J8UF 3S3BB 3CMGA 1BBJA 3KW7A 4MNQB 3VGDA 1A7OH 3E2HC 2J4WH 3VFMB 2EH7L 1NLBH 4ZOCA 4KX8A 4IOFC 1HCFX 2V3EA 1Y07A 2UYLA 2PCPB 1BVLA 2PWFA 3Q8FA 4GT0A 3WO4C 2VE6A 3T2QA 1HZKA 2Z1PA 1OT2A 4GQ9L 5FECB 1N6EA 1EAQA 3AG3B 3UABA 1GGUA 1XD0A 3KCPA 4XAWL 3QYNA 4IRJD 5D8JL 1ZWIA 4NO0A 4C57C 1CDYA 3UX9B 1PIFA 3HZKB 4HUKB 1UGKA 4N2EA 5FKRA 1QSEB 3LRGA 3DYMA 4Z7WF 1U8OA 5CGTA 1CI5A 2P9LC 1INEL 1O6SB 3GTVA 4Y2NA 5FOBB 4AZ8B 1TEGA 5EBMB 1ZA3B 4MS6A 1WWWX 4XBEH 1U93A 2N01B 2XN0A 3P11L 5A16A 3AW5A 4H40A 1U8QB 1ED3A 2FZ3A 1Q1JH 3MRGA 3DJSA 2V5SA 3T4YB 3GKZA 3L13A 3UIZA 2A2QT 3QJXA 1U8MA 4NRYB 3EJYC 5JA9A 1W72B 1LE9B 3CN0A 4PSXB 4CILA 2AXFB 3RIAK 1Q94A 3IXTB 4WTQA 3DO3A 4OF8A 4ZD3H 5HJGA 2LV4A 4GW4B 4A7TA 3CCHA 3VFGL 1DFBL 3L1OL 3UO1L 3QZOA 1BZ9B 2GUOA 2ZUYA 3QE5A 4ODWB 3SJVE 4BP8A 1LK2A 3OXRA 2XWEA 4IMLB 4OFVA 3DROB 5MI0B 3P73A 3EFFB 3QS3A 5E9DD 1XCXA 5C6PB 4HOZA 5DXWA 3F04A 3WFDH 4MAYC 4ZXBD 2CK2A 4N6QA 5CBAB 4H88H 5L2KD 3WV0A 1INDH 4X3EA 4IGBD 4N85A 2EYRA 5FS5A 1HS6A 4BCDA 4OQ1A 4A2HA 1BDYA 4JO5A 1UWFA 5CP7B 2PWGA 5AOKA 4XN4A 1U42A 2AQPA 4OM0H 3ILQD 3TBBA 1C1EH 2DIAA 4D0DB 3EGSA 2ADJA 3QNZA 2FWSA 4PRHA 4JHNA 4PYHA 1Y0LA 2VXVL 3U30B 3P2BA 2P9IC 1NAMB 1OCZB 1XIWA 2GJ6A 3WHE1 2EXTA 3B56A 2PO6C 3ZKSD 4F5CE 5C0FB 5JXEA 3S88H 4N0YL 4APQD 4DPRA 2YD3A 3KAAA 1J9RA 2UZPA 3AREA 3LPFA 3J80g 4LFHG 3APDA 1KY6A 3HG5A 4TL5A 5F93C 4LCWE 3NZ8A 1L0YA 1CD1B 4B97A 2HFGL 3COOA 3ZUNC 4XPTL 1F4AA 4FQHB 4NHCL 1HXMA 1HYSD 3CVBA 4XWGH 4JL1A 3N1QC 4XH2A 5DSCB 4BZ1L 4PWIA 3QRLA 3I9GH 4NAQA 5L4JA 4FAND 1O7DC 5LXGL 1RK0B 4MXWH 4WDIB 2Z4TA 3WS3A 1V8HA 1UZ8B 4QNPF 3SJVB 1L9TA 3H6JA 3AG1B 4WEUD 4YL4A 4K94C 3T4AA 5HYJE 5KVDE 1H2XA 4JO2L 4W9IC 3LQZA 3PF2A 4JZOA 4NT6B 1I82A 3SE8L 4KRMB 4UU9B 3UJTH 5IW3A 3V6BR 4A2DA 5JNYB 1M57B 2IALB 3BZ4A 2WUBL 3OJMB 5LG6A 4PJ9B 1CL7I 1WD8A 1NPUA 1PJWA 3QCTL 1ZDSA 3QDMD 4LCCB 1YMMD 3MLVH 1MH5A 4H26B 4PRBB 1MHHA 2ILLA 4FXKB 4DERA 1T6BX 3SKMA 1TQBB 2ZCLH 1ZLVH 1BPVA 3VJ6B 3UGEA 3EG9A 2C5DC 4IEFA 4Z7NA 1HC1A 3BVNB 3D85B 3HC0A 3HPJA 2X2YA 1UWEH 2ZP0T 3A6OA 3GPSA 4F7CB 2FYVA 5TDOB 4LCWB 4CU8A 3MCYA 3TU6A 5F3HA 5FCUH 4B95C 5FYLE 4BFRA 4GUPA 5FA5B 2I27N 3FBQA 1PMYA 4J3XA 5E08L 2BSSA 1Y6NR 4MYWB 4FX5A 4EJ1C 2AXJA 3NRPA 1VADB 4XO8A 4XXWA 1HWWA 3T3ME 4LARH 1OZTG 1HL9A 3ATAA 5JMOC 2F1BA 4LLQA 4Q6IA 4KNQA 3O2DL 2JELH 3QG6A 5LNGA 4GXUN 4BCZA 5GGUA 1IGCH 5HYJB 2X70B 1IGYA 3HJ0A 1XB6A 3LKOA 1DJXA 5MP6H 5I16A 2B4EA 4HIPA 2E8ZA 4N90E 5EZJB 1QEWA 2XXCB 2I26N 2R23B 4MA7L 5DMIH 1R3LA 4ZUWB 3GUTA 2Z31D 3NIFA 2NY2C 4KRNA 3UJJH 3WBDA 2IOOA 2A77H 2VDPB 1KN2H 3FNKA 3HZMA 4XMLH 5CNHA 1Q38A 3MMYA 2NYZA 5EORH 4LEXH 1MIMH 2PWDA 1YYCA 4OCYL 4IBVA 3WKML 4OJFL 2SODB 1NDGA 1P6AB 1K8IB 4U1NB 4MNHB 3MV01 4MMZB 5I17A 1PY9A 3IJYA 4EZMA 2LGNA 1MAMH 2JI3A 4PJ5D 3EI2B 1AD0A 5KYNA 5K9QG 1XF2B 3SOBH 3HBQA 1YQ2A 2WNKA 4QI3A 3V0GA 5K9KB 5J06A 4JANA 2R4SH 2QJDA 4A0AB 2AI0L 4R0LC 5FV1L 1KLUA 4KKAC 1EAPA 1UATA 4K71C 3TBSB 4KZDL 3LPPA 1UVQB 4D9QD 1ZTXH 2VSMB 1PU0A 1HZHL 4NNPH 3WLWC 1S6NA 3N1GC 3UZVA 1L9NA 2G3NA 5I26A 5CILL 3NJIA 1SOKA 2F54A 1HNFA 2WQUA 3BZFB 1NCCL 2ICWA 3G6DH 1OM3L 1KWGA 5CGYC 4DESA 1HHHB 3ZTNH 2MSPA 2BP0B 4E41E 3EGXA 5LWYH 3EOBA 1QLEH 1R4XA 1SZNA 2VDMH 3D09A 4YSTA 4AM0A 5L8LB 5EMJB 2QGDA 2JK5A 3OHXB 5HI3D 4ESKA 4ALAH 4P23C 3GSNB 3QIUB 4MB5A 4TNWK 3T3MB 2BVPB 1G7MB 3HOGA 2IBZY 4KKBD 4OZIE 1MFUA 4H8QA 1AI1L 1U6AH 1FDLL 1KV7A 1VYHC 2IURA 3HMXH 1M3IA 4HLJA 5EDXA 1JGUH 2JJUA 5AYUH 3BUIA 2VAJA 5AB2A 3BVDB 1NAKH 5CUSH 5LO7A 1J9QA 1MEXH 5G4OA 2XPYA 4LB8A 2IG2H 4YDJA 4J6RL 3KPLA 4X8JA 1MCQA 1UH2A 2MNUA 1Z9PA 4CA4A 4PJ7A 4F8NA 3SLED 3N5AA 4HD9A 2GI0A 1F8TL 1NGYA 3P30L 4KAQL 3TWCH 1V05A 2QT6A 1JBJA 1SMOA 5AUMA 2XG5B 3HR6A 5J89A 2MCPH 4CVWA 4D9LH 5FA3B 4WSJA 1FC1A 3OWRA 4QXTA 3ZSTA 5LNEA 1BQUA 1OARH 3AU1A 2BVOB 1PZUB 5IVXA 1FL3A 5F7KC 4ZOAA 3HTLX 4R3SA 4UMSA 2IAAC 5JPNC 3FAXA 5DRZA 3PWNA 4Y4KD 3IFOB 1WD9A 2EEFA 2FX7L 5I66A 5L2JA 35C8L 2F19H 4TUUA 3W0WE 3QPQC 1QHQA 4E41B 2I32A 1H15B 3QWNA 4M7LL 4N8VG 1BYOA 3L3JB 5D9SA 3BKML 2N1KA 4ODXA 1YYMH 1S4IA 4KK6C 2HXCA 3HE6C 5C0EA 5AB1A 5KBPA 5IESL 2JB6B 5JIDA 4MAYA 5HSFA 4JDVA 1C5DB 1DBBL 4YBLC 1PKQB 4IOIA 4OZIB 3TCTA 3MLZH 5FAAA 5EOTB 2OP4H 1DL7L 1VEMA 7FABH 4Z7VE 1Y18A 4FNPA 5I73B 3QUMH 3RWCB 2WCGA 1LWHA 5IVOA 2YOCA 4N0RA 4D0BA 4OFYD 1CT8B 3MDJA 4LPVA 5I30L 3ZE0E 4Z8LA 2WMPB 3CFVA 3K72A 4UQ2B 4DH2A 5HP5A 5EUOE 1H6TA 3RIKA 5IOPA 1FGVL 4BINA 3ULVH 4KFMA 1AR1C 1C08B 3GBLA 5HE0B 2IFFH 3PJSA 4Y1AE 3NSXA 2PO6A 5HDBE 3T09A 4E5ZA 3VFVB 3MRQA 5T1DH 5GJTL 4RE6A 3TYGH 2PM9B 1UG9A 2EO1A 2O72A 3GBDA 2NY1B 3LDBC 5CSBA 2LU3A 1IM3A 4AT6B 4DPBX 4IMMA 2YKLL 2PR9A 2DLGA 4HUUB 4PWKA 4K94L 4MS8D 3SDXF 4HWEH 4ZFGH 4RRPA 4NGHH 3V0FA 4OIIH 3W0WB 2XUWA 3W2DL 4DGVH 1HH9B 4YFDB 1HINL 2Z7UA 1T1YA 3SDAD 2I3SA 3SGEH 2W07B 4JFXA 2DQJH 1ZLWK 2OJZL 4GZ8A 1T66C 4ZPVB 1JMXB 2QEJA 5CYKA 4NQVA 3S3JA 2W95A 1EJ6A 4FLQA 1V10A 1LMKA 4MLSA 1G5AA 4ZMNA 1WO2A 5CD3B 5IMOB 3C87A 2AVGA 2PETA 4JY4A 4N8VB 5C0AA 4AEEA 3NJHA 3FQRB 5JXAL 4Z7VB 3N43F 3GSRA 3FCUA 1ZS2A 2K6WA 3QUZD 2V17L 1E4JA 5ACZA 2IAMB 1OSPL 1M71B 3ZE0B 1MAKA 4U1SA 3B7RL 5EUOB 5GS0D 2NX5A 2WWKO 3OKDA 2H26A 4OQTH 4UWQB 5F71A 4X7CC 5FK9A 5HDBB 3JV6B 2MTAH 3NAAL 2FEDC 3WDIA 1A1NB 4YHKH 2H2SC 5LDUA 2Z0UA 1DJWA 4FEMA 2G4GA 1QA9A 2IXQA 3L5JA 4JN1H 4A11A 1KIQA 4I48B 4QXGL 5ANME 5E8OA 4EEEA 4HKJA 1JZJA 3WL9B 3BGFC 2R7EA 2DQFA 3FMGH 4NC1E 5I71C 4PS4H 1TKWA 4L3ED 4ODTH 4PGDB 1PX8A 3UZEC 1MVUB 5IW6B 1XVSA 4L4VE 3MV7E 3K7UA 1ZT4A 3TV3H 2OK0L 5DZ9A 1THAA 2BXZA 5CR1A 4RGOH 2HAZA 4RGNE 4NRXA 1AXIB 4O3UB 2NXZC 3D0LB 3I6GA 4OBRA 2JE8A 3ZW3A 1HL8A 1JDAA 3KPRE 4ZTEA 3VD4A 5CXBB 2Z7ZA 2AEQL 2X6BA 3MRMB 4B5EA 1KCBA 4TUOB 2D2CC 1LO2H 1OK0A 3GHBL 4OCMC 3UAEA 1GOTB 3FU8A 4ZS6D 1PD6A 1I53A 4WNSA 3G6AB 1YEKH 4L5FH 3F6JA 1AKJA 2B2XH 3SDCC 4MNQD 4YXHH 3ESPA 3DX8B 3O6LL 2UZYA 4O2FB 2IC2A 2OTUA 4A08A 5EU7C 4NZUH 3QJSB 3SCMB 3PGCB 1MHPL 3VGBA 5IJCC 5EC1B 2Z2PA 4N3TA 2RJMA 5J9PB 4G7QB 4PJEE 1TZIA 3OKKA 1WIOA 1VIWA 1CD0A 3N2JA 2DQCL 1CYGA 5ANMB 5IY5B 3RN0D 1AYOA 4P23A 5E2JA 1V5JA 4P57A 4QDGA 4MMYA 1QSED 5HI4C 4LARL 4ZUTB 1S9YA 5F0PB 5E4EB 3KJ6L 1JGLL 4ZYKA 5FO7B 4GG6F 2CK0L 4LF3A 3EJZC 2WJ5A 3HBPA 4L4VB 3MV7B 4E9WA 3K81A 3WSQL 5IHZA 4X6BB 3UJJL 1K3ZA 1B0RB 3O45B 3QXWA 4RGNB 5A3ID 1RVFL 1ZHLB 4V1DA 3V4PB 4QRSB 3PIQB 1H6EA 4FFTA 4WFHE 1KGIA 2J8UA 3SKOB 2FLBT 3FT3B 4D8OA 3DOSA 3KPRB 4P8QA 2Y5EA 5A2JH 3NP3A 3U9PH 1HFUA 1JNHB 1E6OH 4JAMA 4MBOA 2KQMA 2PF6A 2L3BA 3FDWA 3O3EA 1U8JB 3OSKA 5C2BH 4AM0Q 3KPOB 4IRJC 1T0PB 1CUOA 4MA1C 3HG1A 4RH4A 3QQ3B 2Q8AL 3QCVL 1MN4A 3ZZSA 2AV1B 3UTTE 1UACL 2R0WH 1F4XH 4WU5A 4PRPE 1VACB 2I9TA 3OKLA 4J81A 1N2RB 2P5WE 5BS0E 1NPJA 5DD3L 1BAWA 1FNSH 5JPNA 3LS4H 1ERNA 3IM1A 4Z7OF 2X38A 1OOWA 4Z7WA 3WHXA 3ZTNL 3IYLW 5TDPA 4I18A 3WE6A 2A6IA 1BLNA 4PJEB 3B6SA 3FK3A 4Q6KA 2JJVA 1F3JB 2CPCA 4NM4H 4ALAL 4WWID 2BDNH 2BIIA 4FF9A 3HE6A 4UNTA 5DYFA 5HDLA 1N64H 3PQYE 5I6XB 6FABL 2J71A 3U7YH 5IGOA 3Q3GB 3BAJA 3FU7A 5KANI 3OKEA 1IJ9A 1KXVC 2C3VA 1AGCB 5HHVL 3UL4A 5EEVA 3C5ZB 4ZO8A 3DX0A 5AW1B 1Z32X 3K8LA 4F2MA 3VXTB 4HIJA 2B3RA 5IROD 2JB5H 1JGEA 2NSMA 4X7TB 5G5DB 3FUMA 2YJQA 4X80H 4F8QA 1THCA 4QEGA 3QISA 4QHKI 3GI8L 4ZXBC 1XAUA 4ELMA 4I3GA 2EUWA 3L5XL 1RPKA 2WYHA 2TSBA 2X2JA 4X5WA 2NYYD 2YAHA 2G5BA 2HCZX 3CVCA 4YBQD 5IVNA 2TRYA 1P69B 4IGBC 3UTTB 3QDJB 5IT2H 1U3JA 2BHYA 1XGQA 3TO2B 3SJVD 2CKNA 3KYKL 1OF0A 2P5WB 5BS0B 3U0WH 2A4CA 5C0BA 1CFTB 5KYXA 4PGEB 5K9OB 2V8LA 1PNCA 2Q7YB 4AENA 4HJ0D 3EOAA 5TEFA 3E3QE 1UXLA 2AANA 1QWUA 3WTWA 2F6AA 4PJ9D 4APQC 2O5ZH 2FYYA 1Y1DA 1V27A 3GQFA 4ZOVA 5BPPA 4YC2C 3Q06A 2EDRA 5E1IA 4BSWB 4XVJL 3PQYB 4BE6A 3J81g 1Y7VA 4G82A 2OR7A 3U4EB 2BCKB 5D7IE 3PHSA 1MFDH 2ZCHL 3FO2A 3O4HA 3ES6A 3LEXA 4J8RB 5KVGL 4PVLA 1X4YA 2BWDA 3D85D 4HWBL 4MDIB 5CINL 4IOSA 3IBOA 4G8GA 1U8HB 4KHXL 4LOFA 4PBXA 3KR3H 5IHUH 1N59A 1P7BA 3BPOC 1OP3H 2IANE 2XG4A 4HC1L 4LCWD 1Q9WA 5TGBB 2IUVA 3LNDA 5FKAB 2XL3A 5LJYH 2Y25A 1WQVT 4J3VA 1BECA 1GY2A 1QABA 4HWBA 2WXGA 2BOCB 4ZMVA 2OTWA 2Z34A 5HJBA 3CGTA 4ZFQA 5IB3B 4IBWA 5I24A 2W88A 2X9ZA 1JGDB 4LFHD 5EB9A 4HC1A 4AQAB 3BKJL 4OF3A 1WP6A 3O4OB 4I89A 3H9HB 2AQ2A 4JFYB 1T1ZB 2YQGA 1HHKB 3CVIL 2LU7A 3IB4A 3TZVA 1KYDA 1GGIH 5HYJD 3TBWB 3B9VA 1WZ1H 1SY6A 2FSEB 1CTMA 4I3SL 3RL1B 1BLIA 3UTQA 2WQSA 3UZEA 4IBTA 3VVVA 4A39A 2M1KA 2J3SA 2NZ9C 3BQUC 1J7VR 2IVFC 3HC3L 4KJWD 4XBPB 2A9ML 3HI5H 2P46B 5E6SB 1O6FA 5CSGA 5EM2A 4QTIH 5GGRY 2ZTBA 5FA4A 3W5MA 1MCWM 4KTEL 3MU3A 5LCVL 1U2CA 3D33A 1TDQA 1LE5B 5D7IB 1JF1A 1KBWA 1K72A 3GSOA 2DQUH 3RGBA 4BK4A 1QPPA 2K9FB 1WGVA 5D72H