3BWSA

Crystal structure of the leptospiral antigen lp49
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
407
structure length
407
Chain Sequence
GTEIVKFSIHPYKGTVIRLGEEILPFKVLEMDKNIALVEMAIPVYKDEKEIELKLSSPGFQNSSYRIRKPEELNEKLIALDKEGITHRFISRFKTGFQPKSVRFIDNTRLAIPLLEDEGMDVLDINSGQTVRLSPPEKYKKKLGFVETISIPEHNELWVSQMQANAVHVFDLKTLAYKATVDLTGKWSKILLYDPIRDLVYCSNWISEDISVIDRKTKLEIRKTDKIGLPRGLLLSKDGKELYIAQFSASNQESGGGRLGIYSMDKEKLIDTIGPPGNKRHIVSGNTENKIYVSDMCCSKIEVYDLKEKKVQKSIPVFDKPNTIALSPDGKYLYVSCRGPNHPTEGYLKKGLVLGKVYVIDTTTDTVKEFWEAGNQPTGLDVSPDNRYLVISDFLDHQIRVYRRDGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords protein Lp49
publication title The leptospiral antigen Lp49 is a two-domain protein with putative protein binding function
pubmed doi rcsb
source organism Leptospira interrogans
total genus 105
structure length 407
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bwsA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bwsA02
3F3FA 3UVNA 3W15A 5IJ8E 3I7KA 5EM2B 4ZOVA 2HYEA 3IIYA 2QC5A 2H9LA 3DSMA 3FRXA 3I7OA 4KFMB 3SVWD 3PE7A 1GP2B 2Z2NA 4A09B 3OKWA 4GM8A 3DXKC 4FHLA 2OIZA 3JPXA 2CN3A 2IUVA 4AOWA 1GG2B 2HKMA 2IAAA 2YNOA 4PSWB 5B4WA 5GXIA 3J81g 2Z2PA 3I8EA 4I79A 5EARA 4BH6A 3JZGA 2GC7A 5EALA 4G56B 2B5NA 4PBYA 4XEIC 5IT9g 3EWEA 1PI6A 4BUJC 3FGBA 3IKOA 4ERZA 4XYIA 2I0RA 4X3EA 1PBYB 4PXWA 1Q47A 2HESX 3U4YA 1MDAH 4X60B 2G99A 3JB9L 4PSXB 3JZHA 3VA6A 5HE1B 5H14A 4CI3A 3OL2B 1N6DA 2I0SA 5KDOB 1NEXB 3SLED 5HQGA 4D6VA 3SXTD 4J87A 3E0CA 3N0DA 2AGZA 3MKQA 4O3UB 4JSNC 3SN6B 1XKSA 5K1CC 5JWZA 2H6NA 4E54B 2AGLA 3MZKA 2P9IC 1JMXB 4GGAA 2CN2A 3ORVD 2P9UC 3EI2B 3V9FA 3BG0A 4J86A 4FA4D 1SQ9A 3UR4A 2EBSA 2YB8B 4JD2C 1U4CA 2IUQA 3IJ0A 4GM9A 2PM9A 3CFSB 2P9LC 4GQ1A 3AL8B 4GZ8A 4A0AB 3SJLD 3EI1A 4LG9A 3EI4B 2OVRB 4FA5D 3EMHA 2AGWA 5TDHB 2H9MA 2BBKH 4CY1A 4A7JA 2PBIB 5AJAA 4O3TB 1PEVA 3EG6A 2HJ4A 2IWFA 5EMJB 1SHYB 1N6FA 2B5LA 5EMKB 1B9YA 4J8GA 1ERJA 1JMZB 3OTTA 4CY3A 3SWSD 2PM7B 4PNKB 2GC4A 5TF2A 4CZVA 1A0RB 5CYKA 2AGXA 4A2LA 1GXRA 4E5ZB 1XIPA 4QRJA 1R5MA 4O9DA 4ERQA 2J56H 3ODTA 3UVOA 5GSAA 4L1QD 2OK4A 4GGDA 3RN0D 2IWKA 1GOTB 3I7HA 4GQ2P 4J81A 3JRPA 5HE0B 5CXBB 4CI8A 1MG3A 5C9ZB 4CI1A 4X61B 3CIKB 2CE9A 2Z2OA 3FM0A 4FA1D 2YBAA 4FAND 3HFQA 3DWLC 4JSPC 2W18A 3SFZA 2HKRA 3RMZD 5FXYA 3MMYA 2I0TA 4JSXC 5I5JA 5TEFA 5H17A 5CXCA 4A11A 4FAVD 3N0EA 3IJ1A 4CI2A 3MXXA 3NVNA 3RSEC 1K32A 4A0BA 2GNQA 4OWRA 3UVMA 5C2VB 2IUPA 4ZOYA 3CFVA 1SQJA 3C75H 5SXMA 2H47A 3I7LA 3K26A 4U1EI 2PM9B 3BG1A 3JROA 5K19A 4J82A 5TEEA 3EI1B 4Y5RD 2I3SA 2AH0A 4A08A 3EI3B 2B5MA 3I2NA 3MKSB 3VGZA 2H13A 3OKYA 1L0QA 3J80g 2AGYA 5FLXg 4AEZA 2I3TA 2H6KA 4L9OA 3F3PA 3C99A 2OVPB 3AL9A 4Z8LA 3PXSD 1XHMA 4L3GD 4TZ4A 3KRWB 3C5MA 1B9XA 3UKUC 3BWSA 5THAA 5FKSA 4OZUA 2PM6B 2UZXB 3V5WB 3F3GA 2O9KA 3OL2A 1JOFA 4J77A 1K8KC 2J57G 1TBGA 3ULEC 3NVXA 4FB1D 4FWWA 4L3HD 2AH1A 2TRCB 1OMWB 4LG8A 4EWRA 2QXVA 4E54A 3SBQA 3DM0A 1PGUA 4GMBA 4ESGA 4A2MA 4O45A 3SMRA 3EI2A 4FA9D 4YVDA 1OLZA 1P22A 3AFCA 2P9SC 4GQBB 2BCJB 4X63B 4XYHA 4J78A 3A0FA 4BL0A 2YNPA 3L4MD 3L4OD 3PSCB 5FA5B 3JAMg 5HE2B 4MK0B 5FKQA 3SBPA 2P9KC 2MTAH 4PBZA 5H1MA 2CO0A 2XU7A 5I5IA 5AFU3 4H5IA 4GGCA 4A11B 4JT5C 5IC7A 5HYNB 4QQEA 1U2VC 3GREA 3NVQA 2G9AA 2H14A 2OK6A 2H3XA 3MZLA 4A0BB 5C2WB 1S4UX 4J0WA 2IURA 2OVQB 3I8CA 3AH8B 3PSLA 4NSXA 3PVWB 3I89A 4HDJA 4QL1A 5I5MA 4QT8A 1TYQC 5IGOA 2B4EA 2CO0C 5A2Qg 4ZOXA 5AMSA 3GFCA 3PXWD 5GMKn 4IA9A 4E5ZA 5EM2A 1VYHC 1MG2A 2HXCA 3I7NA 1JJUB 4A08B 2H6QA 3OKYB 1N6EA 4Y7RA 1NR0A 5FKRA 4A09A 4JT6C 3SBRA 4CZYA 4U7AA 3UVLA 5GXHA 4CY5A 4J0XA 3RLMD 5CXBA 3K27A 3B7FA 2XL3A 4JSVC 4JXMA 4J8BA 4ES0A 4H5JA 3EU7A 2YMUA 3DXMC 4UI9R 3RRMC 5HE3B 2UZYB 4O1QD 3OW8A 4K3JB 2CNXA 4IMMA 2XYIA 4ERYA 5IJ7E 5EAMA 4J79A 2H9PA 3UVKA 4ZOZA 4PC0A 4GM3A 5FKTA 3JZNA 4CC9A 1QNIA 4K3ID 2P9PC 4D0KA 2HJBA 5CYKB 5EMMB 1RI6A 1YFQA 3C9CA 5FQDA 2AQ5A 5EAPA 1FWXA 2Q7QA 3EI3A 5IGQA 3RFGA 3ZWLB 3IJCA 3VH0A 4CZXA 3V7DB 3PVUB 2P9NC 3SHFA 2XL2A 4J84A 3RFHA 3UKRC 2OJYA 3P4FA 3RN1D 3AL8A 4A0AA 3PXTD 2H9NA 4N14A 4ZN4A 3EI4A 2J55H 4R7AB 3I7PA 4CY2A 4J73A 3KRXB 2CE8A 3OKTA 3IIWA 3SCYA 5CXCB 2H68A 4LGNA 5EMLB 2YNNA
chains in the Genus database with same CATH superfamily
2GEEA 1BAFH 3FB7A 1AS8A 3D2TA 2DV6A 3FMGL 1QAWA 4NUMA 5FV2A 5FHAH 4P2CG 3UC2A 3RWGB 3SCMA 3HBQA 5TH2B 4XC3L 4HDIA 5KVFH 3T0EA 2GAZA 4O58H 4Z3TA 1HCZA 5E6ID 4KZDH 3Q9PA 4L5FE 3OKWA 1NUDA 1TXKA 3LYRA 1YJDH 4K3EH 4QHLB 2E8YA 2CCVA 2BOBA 1BZ8A 1A7NH 1QLRB 4QTHA 2XQBL 4IBLT 2WW8A 3V55A 1AI1L 1KELL 4HUNB 1KXVA 4L37B 4U0RC 3VFRB 4QRAA 3GI8H 4H40A 4NZDA 4CJ0A 4TLSA 3BI9X 3GBML 4XO3A 1JGLH 2QTEA 4JR9H 5D2LB 1MQKL 5EIIA 3BUTA 1VACA 5IVXF 1Q90A 3C8HA 1HZHL 4LCYB 1LD9B 2EECA 4JB9H 5AOMA 5J3HC 3SJVB 1MHCA 4PJEF 4F7EB 1HSAB 5DVLA 4ONHA 4U1HB 2BO0A 1P1ZB 1QUNA 3MV7B 3DX7A 3QI9B 3ASNB 4LLDB 4NWTH 3SQRA 1ACCA 1BLNB 1IBBA 1GJWA 3CBJB 2AAAA 5JIIA 2IANB 1Q47A 5EF1A 2B1OA 5HE0B 1S7TB 4R8WL 2C3VA 2YGNA 3L9YA 1MCQA 2WXQA 1N26A 5DA0B 4WFHE 5DVOA 3RPKA 3SPHA 4CA4A 2ZD0A 3I2CH 5EPMA 1S7WA 1EXUB 1K5NA 3A6OA 4NQDB 5CJQH 3VXME 2NY3D 4BSVA 2I0SA 3S3PA 3RA7L 3SQBB 4ZUTA 4ZMOA 3H2PA 1A6WH 4UTAA 3WAJA 5AVZB 5JWZA 1C08A 3QIWC 3BKCH 2HKFL 4CNIA 4G9FD 1UZ8B 3V6FB 5EC1A 3U0PA 3T3PB 4AM0B 4Z7UA 1B2WH 2DH3A 1AZUA 3SOBH 3ROLB 3NACH 3QEQD 2LU3A 4FGMA 3AG1B 4U7MA 2IAMB 5H37H 1HWHB 2YQBA 3NFPA 1UXMA 3CE1A 5FKPA 5HJGA 3QJOA 1KOAA 3EJPA 4CMHB 4ESKA 2FNBA 5AW8B 3MNWB 1YNLL 2KLSA 1G9EA 3POHA 3WIIH 5E4OA 3CFSB 2AI0H 4GZ8A 4HQQH 2FSEA 3T2NL 2JCCE 2WQXA 2ZXBA 4GKSA 1E6OL 2CDGB 4G5ZL 4N0UA 2F1AA 4N26A 4TL5A 5AYTA 5BV7B 5I17A 4P5MA 5D1XC 4OCLC 3IFLL 2D03L 1TJHL 1GCYA 2QKSA 3WE6B 4HU8A 3OLGA 4JQIA 4OBRA 4O3TB 3OGCB 2X4UB 4A7TA 3RI5F 1NDTA 1A47A 4X8CA 3ZZSA 1IFHL 4KROB 3FHEA 1ODUA 5B21A 4JFFA 4LO9A 4PJXA 3D39D 1XFPA 4A7QA 2Z65C 1RHHB 4L1TA 4WZ9A 3BE1L 3O41B 4XN2A 1TEGA 3D25A 3ULUL 1L9PA 2WXMA 5C0GA 1J8HE 2BS8A 1AKJA 4PWGA 3DJ9A 4XN5A 4Q74A 4P04A 3S36L 3NTCL 4LVOC 3V52L 5EH1A 1FFOB 3FT3B 1AZZC 4N9GB 4NN5B 4PNKB 3QUGA 1ONQB 1JXKA 2MNWA 3CLWA 1UB5B 1EHAA 4JHNA 3O4LA 4QD2E 3HE7C 3MLRL 4B6ZA 1JPEA 2NQCA 1RZQA 3ARTA 1E30A 2MHAB 5JPNC 2FEEI 2Z7YA 3L6FA 3KPLA 3SYCA 2XU9A 4HFWB 1LO0H 3OMAB 2JIXA 1ZOXA 2VABA 1K8IB 3QUYB 3L2LA 2FQEA 3C5JA 4APQA 2OQJA 3E1ZA 3CH1A 2X2YA 1CFTA 4TUJB 4ZTEA 4Y5YC 4FQQA 2B4CH 1QLFA 3EOTL 4IEFB 4E9RA 3FS9A 4J5VA 1A6ZA 4IGBD 4FABL 1FBIH 1ND0B 1WUNT 3FPYA 4OCMC 3W0WD 1MCNA 4JDZA 3BEVB 2JI3A 3SKUD 4HJJL 3OKNB 2IGLA 4KQ3L 1H3PL 5JIQA 4PRHB 1RSFA 2J55A 3V6ZB 4OLVH 2I32A 2I60H 5LXGL 1D6EA 5LBSA 1AANA 1MCWM 3BVVA 5IY5B 4GO6B 4N9OB 3BQUD 3IWVA 5DFVC 4EI5D 5AG8A 4IMLA 1MRCL 5ICZA 5HHXL 5I74B 4CRPA 2VLMD 4Z18A 2FEEL 2OR8A 3LQAL 4ZXBC 3T8VA 5ADOL 3RSEC 3MX0A 4PJIA 1QA9B 3L4XA 1FAKT 4MKTA 5FB8B 1FLRL 5HHOD 3X1NA 3EKCA 3OZLA 5LB1A 5TPWH 2QBWA 1CGUA 4JRXD 3CVIH 5D7JD 1NC4A 3MOAL 3EG9A 3L3KA 1JP5A 5DTFA 4JO4H 3VQ2C 3V8OA 4ZD3H 3PWVB 5GS0L 1SQJA 2L3BA 5ITBH 4HKJB 3KLHC 2F19L 3PDGA 5JXEA 3VD4A 4NLHA 3FRPG 3SGDH 4PS7A 1JIBA 3IRZA 3VXOB 4Z95H 5K19A 4DZ8A 1ZLWH 4Z7WB 2YPLB 4AX3A 2DYPD 4AIOA 1OTUC 1P4UA 3PHOA 5GPRA 4A08A 4JY6B 4Y4FC 4NKMB 5IW3A 2WYZA 1L0QA 2BHUA 1SGKA 3K0YA 3BX7C 3QC6X 5B1JA 4AJVA 5CCKL 3K81A 1UWEH 5E9AA 3B3BA 1BAGA 3VI4F 4YSPA 5KSBB 4HSCX 3KDMA 5F9OL 3SYQA 4AYFA 1JDDA 4GNKB 4NM8H 2EDEA 3CJJA 1FYTD 5FK9B 2EYRB 4JE0A 3QXAA 3C99A 3CX5K 2RACA 2NX5A 2VDKB 3BSGA 3Q5OA 2AV7B 4M00A 3ZUNC 4Z8LA 3WUWA 2AXHA 3CFDA 5AALA 1UH4A 3QARA 4FXGB 5J11C 2VQ1A 4JO8A 4H1LA 5MEPA 4G1MA 3EYVA 3ABKB 1WAEA 2EEAA 3DX8B 4KI1A 1DQJB 1NGQL 4KXDA 4E41B 4M02A 1X7SA 4I8DA 1BBDL 1TBGA 3ZTCC 4G8GD 4F2EA 3LH9A 1U8NA 4L3HD 1I1AB 2V0AA 1AZCA 5BUGA 5FPIA 4ORGB 2AH1A 1F6FB 3MLYH 3PWUA 4RA0C 3CK0H 4M62H 2X7LA 1JRHI 2BVQA 4RMWA 5C0CD 5CJXC 1J1XL 1IAIL 3QJFB 5EULV 1GA2A 3W38A 5CO1A 5D6DA 2YZ1A 3SD5A 2CUAA 1OB0A 2DQCH 3QEUA 2R29H 1KEML 2P5EE 3VXNA 1AR1C 1G7LB 3PWPD 4K3JL 4EVNA 3VFMB 1KULA 2ZOLA 3LXBA 5KOVC 2DQEL 2G75A 2J72A 2CHZA 4P2QE 2VRQA 3DXAD 2YS4A 2DM3A 4UDTA 3CFNA 2KL6A 1IEAB 2ZKMX 2YNPA 1PG7L 2OJZL 2PW1A 4KJQC 4WUUA 5B39G 3CN2A 3S96B 5M5RA 4QUOA 3FUFA 4BQ8A 2ICEB 4FNLL 4PVNA 1JWMB 3LVTA 3BVWA 3R19A 3N44F 4P46A 4ZNEA 5BRZE 1OE2A 4P59L 2XWTB 3LJ3A 4OLZH 2EE2A 3C8KA 5E8EB 3ZRCC 1RZ8B 2X4TB 2JJVA 4PJFE 3LKSA 5C0IA 2VXQH 5KYXB 1CFNA 2OS7A 3MA9L 5GGRB 2AAVA 2P3YA 1JYWA 1JFQL 4KHXL 5I6KA 2XWBA 3CMOL 2J2ZA 2VW7A 5E1QA 4HV8B 3TWCL 2A83B 4RFOL 4OLYL 4NO2B 3TF4A 1MHHB 1AZBA 4XMVA 4I85A 5I6OA 3QO0A 3L7EB 2P4AB 1GIGH 3S37L 3RGVA 4NSXA 3MQIA 4LSQH 3KW7A 3F58H 3HVNA 1TCRA 5FF6B 3RWFA 2ITDB 3RGHA 5I1JH 3HB3B 5I5MA 3N0PB 1BDYA 4TL4A 4V2CB 4X6CF 5JTWA 2B4EA 2OSWA 1FF5A 4HIJA 4XXDA 5FYKH 3O6MH 1VENA 3ZRFC 3NIDB 1E27B 1I53A 1DJHA 4FKEA 1U2HA 3QNXB 4NPYA 3MODH 4HEPA 1BYPA 1ZLSH 2QZ5A 1HINH 4KHTH 2VIRA 4UAHA 1P9MA 3UPRA 3G5XA 3LQZA 1VYHC 1MEXH 1KCBA 4M9PA 1AJ7L 1JJUB 4RWYH 4O9HH 2ADGA 4BSWA 5I1LA 3BKML 3VFNB 1N6EA 1JSYA 4ADIA 4PLOB 3DO3A 3Q8BA 2IPUK 3T8XB 4WTZG 3DECA 4NFDA 3QYCA 3B6SB 3IDMA 1BJ1J 2DLEA 3LX9A 1G7HB 1H5BA 4RGNC 6CGTA 4PJAF 1MFBL 1P5VA 2IDTA 2ILLA 1E0OB 3EYSH 4Z76B 1MFUA 3P77B 5IV2B 4J8BA 4D9SA 1KGCE 2J57A 3B43A 3OPUA 3HS0B 5DWUH 1UFGA 4KJPD 1MCFA 3RTQC 1P7BA 1EBPA 1YQ2A 3K5SA 1K3IA 4I2XB 2CBMA 5EU5A 3KWVA 4U31A 3EJCA 4J28A 2E9WA 3HEIB 1N0XL 1GGUA 3DRQA 4Z7NE 4P5TD 4GW5B 4ERSL 1JAEA 2UZYB 4O1QD 4TVPL 3NN8B 3SE9L 2PCPB 1EK3A 2X4RA 4XT1C 3FZUC 3VA2C 4JFYB 5TFSL 1N0LB 5F93C 4NYLB 4LCWB 5IJ7E 4LSSH 3FTYA 3JWNG 1T2QL 2A0LC 1YEIL 3IUMA 3MMEA 3H3BC 1SMAA 1NQBA 2VE6A 2Y22A 4OQTH 5DRWB 3WJMA 3ZU8A 4GM3A 1EA9C 2VXVL 4BK4A 2XN9E 5DDHB 1EJOL 3HZVB 4TSBH 3S3BB 3VNZA 3NSFA 5IF0B 2BY2A 4CC9A 1F02I 2CCWA 4YLCA 5E8OA 2JFCA 3GI9L 5GRWA 1DQMH 3C9CA 5MP6H 3LV3A 5AW2B 3DDGA 2NT0A 2CUIA 3NDYE 4MXWH 4WWKC 1IC1A 1ILUA 3FO0H 2BRQA 1PD1A 1XGYL 1UM4H 3COOA 4JKLA 1MF2H 1HOCA 4WJ5B 4HIIA 3RX8A 1WZAA 1DVSA 3PJNA 3Q6FB 5DMIL 1R46A 5F88B 3VG9B 1U8OB 3ZPDA 3ZRSA 3A47A 4GFXA 3TO2B 3VD2A 1GGIH 1W0VA 4PRPA 2R8SH 3EI4A 4YPGB 1HHIB 3TCLB 4L4VD 3VXQB 3V79C 2Z4QA 5TF1L 1YC7A 3IETB 1Q9WA 5DXWA 4DKFL 4O2WA 2VN5A 2DM4A 1A6UL 1UURA 4X0KA 1C5CH 3RVWC 1BV8A 4EUPH 5C2BH 5IW1A 5JHDA 3OKTA 4XC1H 1LL1A 2O5YH 4P3CH 4BINA 4EUPB 1HXYB 2CMRL 2E9GA 2NYKA 1Y1UA 3QNZA 4YDVA 5HY9B 2XWRA 4MXVE 1SOQA 5CSGA 4TOYH 3F3HA 4KUCF 3JV4B 3WIHH 2LFEA 3K2IA 3E8UH 4ZTOL 3L9EA 1CQYA 1QRNB 1BD2A 5L4MA 3O3AA 1UM5L 3CSYB 3I6KB 6TAAA 4U6VL 1YPZE 2NYYD 1IBDA 4L3FA 4MJHA 3ESMA 1R3LA 2G2RA 5JQ6H 1VIWA 3MKGA 3SJVD 2VZVA 3QUXB 1T6VN 4YE0A 1J9TA 4XP1L 5AYUL 4XNAA 4KNSA 4HT1H 3CNKA 1A6TA 2HKMA 2Z2OA 3AY4C 2PW2A 3DRTB 2IAND 3WIFB 1PKQE 2VDMA 5ANMA 3U7WL 2AXGA 4NP9A 1DBBL 4UOW1 3VWKC 2XTLA 4JZOA 3OQRA 4GIPD 3ZDZE 3AT9A 4NUGH 4XE0A 1HAWA 4N6RB 4Y19E 4NQDD 4Z7VE 1UZGA 5FOJA 5A2CA 4HGKC 5C0FB 2GC7A 1KN2L 5MENB 1JWUA 3UTTD 4C83B 2H1PH 4KI5D 4DFIA 2O5ZL 3PE9A 4G6AC 2R83A 4UQDA 4O00A 2VM3A 4IRSA 2FO4A 1XF3A 4AE0A 4AXWA 4WY7L 2JKIS 2WSDA 4WTXA 5D70H 1ZS8A 2NXYC 3ARWA 4ONGL 1E8MA 3GKWH 4M7ZB 4UT7H 1AIFB 4L1BA 5EO1B 5C0DB 4Y7OC 2BNRE 3NDZE 4CBZA 1RSYA 2OULB 2TRHA 3LKNA 4HYTB 4X7CC 3QI0A 2IAMD 2VSCA 3JYCA 3UEZA 1X7TA 3QISA 3IVKB 3BVNA 1AGEB 3MKQA 4XO8A 2ORBL 3IEAA 3MLUH 1YEDB 2VXSH 4RMTA 3U6RB 1NDGA 1WO2A 4MVBC 4MTMA 5IKCA 3P4NA 1NUNB 4S2SA 3ELAT 2C9XA 4X7EC 3MRKB 1J05B 5DRZB 1TQUA 2CN2A 4D0DA 2MMXA 2P5WB 5E08H 4BGLA 5E2VL 4G43B 5GGUA 4GIAA 3RU8L 1T5XB 2YB8B 2AEIT 3APMA 1AE6L 3R0NA 4ZYKA 3ZE0E 2A5UA 4KROD 3QHZH 4GM9A 4C4BA 1BX2A 1QTPA 3WLWD 3FC8A 1BF2A 3LKPA 1URZA 2PM9A 1JD9A 1UQSA 3VMNA 4GQ1A 1UD8A 5T5FA 2DKUA 3OAZK 1YCSA 4FA5D 1O6FA 3UO1H 5CD3B 1YEKL 5DJZB 3GSRB 1V7NL 1ZWIB 4FNQA 2OMUB 1A5FL 5IB1B 3BP7A 3VXRE 4TF4A 2EDDA 2XZAH 4W9EC 3X3GL 1KG0A 4W81A 4GAJH 4KRPB 5EOQL 1U93B 4OZFG 3TV8A 4EQ3A 1JYNA 3BAIA 3IXTB 3QQ9C 5LWYL 5KVEL 1DBJL 1TZAA 3QR1A 1N6FA 1M56B 3IKCB 2Y07L 5ISZB 4GSDL 3OKOB 4HG4J 4J8GA 4TN9A 4Y89A 3WY1A 3IRCA 3FL7A 1FE8H 3LEVL 3QUYD 4OV6F 3ZZLA 4LPTA 1MIEL 2HRPH 1F6LL 2JCCA 3ATFA 4TQEL 3LCYA 2HPTA 1TQTA 3L7FA 1GL4B 5ESQB 3TZVA 2CKBL 4UMSA 3JV6A 1WIUA 2F5AL 1HYSD 3SKNA 4QXGH 1GRWA 5I66B 3QCVL 2R2BA 1JYVA 4A2LA 3E8VA 1F3JA 4HZLB 3O4OB 4JL2A 1AQKH 5F9JA 2CSPA 3IPEA 4KKNA 4YSSA 2HJLA 4O9DA 4PRHD 5FCUH 4M8VA 3FW6A 4ODUA 1P4BL 4L3AA 3GJFA 4FLHA 4BWTA 5FGBC 4X7SH 3CZSA 1NFIA 2EIDA 3QQ4A 1J8HA 3VFVA 3VW3L 4XB7A 2QTVA 5DT1H 3QFGA 5ICUA 3B2UD 1HEZA 2Y4SA 5HHQB 5T33L 2X6UA 3OLEA 5B7MA 3AM8C 2VL5B 1OSZA 5EORH 4FHKA 4AL8L 4JZJA 1P7QB 3WFHB 4EE2A 1U6AL 2H45A 1DJIA 1PSKL 2DS4A 3GRWH 3HFQA 3CDGB 1QBMH 3NZ8B 1P6AB 2J6WA 3WD5L 3INUH 5CJBA 2DIAA 3D0VA 4FERA 3TEYA 3N42F 3W2DH 3PDOB 2VDQH 1IJ9A 4P2RB 5IOPA 4WNQA 1TZIA 2R39A 3VAEA 4X8JA 2IPUG 4N28A 3UZEC 2NY0C 2ZWKA 5HYJB 1M3JA 2VDQB 5GGQH 5JW4M 1BSIA 2VMJA 5LCVA 1S8DB 3L3DB 4F57H 3IJ1A 1JHTB 4FQCH 4HS8H 3B9KD 4DGIH 4IMKA 2A77H 3C08H 2WYIA 1OZUA 5L2JB 5C09B 4LRIA 3H7BA 3DUUA 2WOBA 1MFCH 3AREC 2BOCA 2NQ3A 1CDHA 3S5LB 2CHNA 4K3GA 4NP4H 5E1AB 4EBQH 3RWCA 3ZR5A 4ZOYA 4HKBB 1E3XA 3IDJB 4TVUA 4UQEA 5GGRY 5AQ0A 2ARJA 2YLKA 3VI3E 1J0HA 2O6CA 3BZ4A 1G5AA 4PJAE 4DPCX 1U58B 5AENA 4RMQA 3K2UL 4CVXA 4R0LA 3WL9B 32C2B 2ZP8A 4X6DF 5E5LA 3NEEA 3S3JA 3EI1B 3VVWA 5FM4A 2RMNA 5FUCC 2BH0A 2WGXA 1BIIA 4DH2A 4H8WC 4MZ2A 1OCWL 2K6YA 3ESNA 1YJDL 3MRJB 4WW2A 4YHMH 4ABVA 1J88A 4XN9A 3DX6A 2WJ7A 5DC9B 4OT1H 4G6KL 3CTTA 5E1HB 1FZJB 4IDLA 4WGKA 5KAQF 1XMWA 2WPGA 1SLXA 1FIEA 1CFSB 1YN7B 3ZDXB 4JR9L 2AGJH 4OGAC 2YEVB 4PS4L 3TXAA 3X13B 2BVOB 1BQUA 1HNFA 3EJTA 4RE6A 3ISWA 1BGXL 2UZXB 4LQ1A 2F8XC 5K59E 5C0JB 3VRIB 1NL0H 4GBXB 1AIZA 5TD4A 2OYKA 4J39A 1XSIA 2AEOA 4HJUA 2FNWA 2B5IC 3QULA 2JB5H 1IQDB 3ARDB 4NQEE 4Y4KA 3WO4B 2P5ED 3MLXH 4MMXC 5DD3L 2ESVB 3LPPA 4YNYA 4Z0BH 1T04A 3INOA 5DEGA 3VX1A 5J1SC 1INDL 1JGIA 3SCMB 3II1A 4ODHH 4BFOA 4A2MA 3T0EB 3ZZ1A 3EI2A 2GAZB 2WLIA 4A1RA 1OGAB 1OLZA 4HOZA 5CEZD 4IS6A 4FKKA 3FCUA 1SDDA 2BOBB 3BWUC 3A0FA 3BT2H 4E36A 4MS8D 4K5NA 1FVDB 1OE3A 2J6EL 1HESA 3NACL 4H20H 3TNMB 3CVHA 1YA5A 4P2AA 5I23A 1H8OA 4D8PA 4JPSA 4XOAA 5EIIB 4N1HB 1VACB 2YEZA 4KZ0A 2E9IA 1EVTC 3HB3D 3WIIL 5ADPH 1MHCB 1MLBA 3DIFB 3MLTB 4Y2NA 3QA3A 3C60C 1QUNB 4YE4H 3DX7B 1KPUA 4JFTA 3RNKA 3T6QC 3MZLA 5A2IH 4NI6A 4EXPX 3FQNA 1NBVH 4OZIB 5M94B 4ZAKC 2YD4A 3ULSA 3W57A 2OXGA 5EPMB 1NUGA 3M1BA 5BRZA 4BSVB 4KTDH 3TBYA 1GSMA 3OV6A 5IIEB 4N2BA 1WYJA 3DUHA 1OO2A 4LFHG 4MBOA 5IHWA 4IBUA 4UTAH 1JGUH 3BXNA 2WUBL 4HCIA 4PJFA 3VFTA 2XVLA 4J1UA 4LU5L 4TRPH 4XAKD 3K7UA 1C08B 1CE1H 5I1IH 1BPVA 4HBQA 4CNIB 3IJEA 1AGDA 1NCCL 2ATPA 5EC1B 3U0PB 5KBPA 4Z7UB 3L5WB 1ZAGA 1AHKA 2WAQA 2ZX6A 5DU7A 5FKRA 3D3VA 2IQAA 4CZYA 3QZWB 4U7AA 1XGTA 4WRLA 4KK5D 2FR4A 2D7OA 1A22B 3ELQA 4JSVC 4UINH 2FX8H 4LCWD 2F18A 1GGCH 5I17B 2V5TA 4I0PC 2NUTA 2YRBA 4P5MB 5DFAA 2QELA 4JQIH 2K45A 5T1KB 2B2XL 4XX5A 4K8RC 3WNLA 3WY2A 2ZKHL 5EMYA 1EERB 1N6QL 2ZSVA 2O6PA 2X9WA 4PJXB 2CNXA 2W9DH 2DMGA 3FSOA 4JMNA 3SGDI 2YHGA 1A0QH 5D1XA 4GQQA 3D25B 2PO6D 4YBQD 5DO8A 3V0FA 2Y06H 2YUZA 2IG2H 2OV0A 4FQ1H 2H4EA 1PF3A 2E7BA 3LH8A 4HK0A 4A63A 3FQYA 2E7HA 1OARL 4UV4H 5C3TA 1G9MC 2JKJA 2J4WL 2G2PA 4WFFE 4K3ID 4LLUB 5TPWL 5JW3H 3O4LB 1HX0A 3W56A 3IGAA 1I9JH 3F7KA 2AJSH 4WI5A 5CM1A 1BFSA 1LEKB 4KQ4L 5FYJL 3L6FB 3KPLB 1ESOA 4JO4L 4NKOA 4XE5B 5BRQA 2JIXB 3CFUA 3VRLF 2VABB 4K71C 5HYSG 1F11A 4APQB 4ZPTA 1J87A 1T66C 3HBPA 1Q9KA 3CH1B 3KCPA 4YSAA 4BK5C 1MREH 1WEJH 3MOBH 4Z95L 3L1GA 1N70A 5IBLD 4G3YH 2DW5A 1A6ZB 1HH9A 1AC6A 1KJ2A 1EAOA 4X8GA 1FG2A 3NEOA 1BQRA 3GWJA 3LN5A 1A25A 1MJ7H 2XTJE 4U1MB 2P43B 5TE4H 2J55H 4XP5L 2MCG1 1XCQA 1BZ9A 3KDPB 1VZGA 1V3KA 3C6SA 1MJ8H 1D6EB 4GAAA 4AH2A 3AU1B 4OCWH 2DI8A 3MJ7A 3NA9L 2Y24A 4B27A 4I4WB 3QUXD 4R84A 4ZMAT 4O2CA 4LVNB 1CD8A 1T21A 1U92A 1UD2A 3MX0B 4JE4B 4GKNA 4RNRA 4DGYL 2CJSA 2WO3B 3LS5H 4CVZA 3P0GB 3BAWA 4UAOC 4Z6AT 3OKEA 1JDAA 5D1QE 5DYFA 4XVOA 4PJHF 4KMTH 1GW6A 3EG9B 3L3KB 4ZW5A 5FUCE 2IDQA 2I69A 4NCC1 2GT9B 3LD8C 2GSIB 1M05A 5MEND 4ZXBA 2AQNA 4GXUM 2MNJB 4WW1B 5D2LF 2R15A 1H8LA 2BFVL 4ICWA 5T1DH 1OD7A 4BE6A 1OOAA 1GG2B 5IM7A 3ATDA 4R9HA 3GMLA 5IVZA 3QJZA 4LSUL 2R29L 3PL6C 1EFQA 1MFVA 1QR1A 4DZ8B 2H3XC 2H1LM 4HUMB 4KDTC 3PHOB 4F8LA 3RTLA 1HKLL 1F8TH 1U95A 1XCXA 1BPLB 4FTVE 4XPHH 4AUYA 4HXAH 1ZIAA 3D12B 3K3QA 4MJIA 3VGBA 1PZ3A 3QXAB 3KWWB 4AZ8A 1YPZA 2NX5B 5I1EL 3QDHA 4QWWD 2CIIB 4H1LH 2I0RA 2EXWD 1OCZB 2DQ6A 4NXKA 3KPOA 4N2NA 2VQ1B 4H1LB 4KI5F 1I8KB 5MEPB 2G99A 3EYVB 4K3DH 2YGOA 3ZQXA 5EU4B 5JIMA 1ZHLA 2P5WD 3V4PA 1LO5A 2BWDA 1IC7H 4IIQC 3EDDA 1PKQA 3L8QA 3FCGA 2QHRL 3T3PF 1LGVA 3NG5A 4RFNB 3ZDZA 3L4YA 2UWEB 4CADA 2D31A 1PJWA 1W8NA 4GI6A 5FYJU 2YQ2A 1NSNH 3F7QA 3VGHA 5B8CC 2X7LB 3JWNC 1GIGL 2DM2A 5DLML 5F6HI 5KYYA 3MZKA 3F58L 1ECZA 1F97A 2APSA 3APFA 1RJLB 4MHHG 5GGTA 5I1JL 2P9UC 2IC2A 4GP4B 3VXNB 4QJ5B 3V5HB 3BUPA 4AX4A 5FYKL 1MDTA 4ZMVA 2ZOLB 1ZGLP 4BQ9A 2IH1A 5AB0A 4KRPD 1TUPA 4GXVL 1NZRA 1C16A 3ARBB 1FAIH 1RK1A 4N8PA 2ENYA 1H15B 2PW1B 1U8MB 3N41B 2WHVA 4NRXA 3ZVVA 2R4RH 3SJLD 5ISZD 1KNOA 2CHDA 1BXUA 1G94A 3WS3B 5B3NA 4P46B 2QVKA 2DF3A 3QDMB 3SPIA 1YUHA 3VU2A 3BUBA 1F1DA 1BHGA 3H54A 5GHWL 1OT1A 3L13A 3MRDA 2ERJC 4XHJD 2LVCA 4A7JA 3LKSB 5C0IB 1RIVL 2J5LC 5AJAA 1S7UA 1RURH 2Y7MA 4AMXA 5BJTA 1PEVA 3EYSL 3VTMA 1SLVA 1FNHA 4CMMA 2ITEA 2JQMA 4HS3B 2P44B 2ZX7A 4R7NA 4XGZA 4XZUB 1O9WA 1QLEH 4GMTH 1B3IA 1T7YA 5HGAA 3X1GA 1B9YA 4G80A 1QLEB 5DQDH 1T20A 3QO0B 5KWYC 3HRZB 2UUDK 3PF2A 3LRSB 4KKQA 4LNVA 3AZUA 3WIAA 3U9UA 3RGVB 3Q2VA 5FGRA 5A6LA 4X0NA 1ERJA 2VRKA 2GABA 1TCRB 3RWFB 5K93A 3GSNL 5CLWA 2QJDA 3UDWA 3ULUC 3LZOA 5ITFA 3MGAA 2AGXA 5JOPE 2XBTA 4NPYB 3OKMB 3VXRA 3UPRB 1P7QD 5IHBA 2CDFA 2VIRB 2XWEA 1G7QB 3BKYH 2BLFA 4PJGB 4DP8X 3G5XB 1TTCA 4ERQA 2WTRA 4M61A 4ANKA 3FDWA 4TSBL 1GOFA 4B9FA 1YNKH 2AEQL 3ZT6A 4RX4D 4BHUI 4P2RD 1UXSA 4RE5A 3KLDA 1ET5A 3QIBC 3ECBA 1UENA 5ABZA 5HYJD 3GGWB 3RN0D 3B9DA 3UP1A 2ZPKH 4N0CC 5L88H 5IBTH 1H5BB 1YEHL 4TULH 1T1XA 1P5VB 3VFPB 2FJUB 3IBOA 5C09D 2JTDA 4B0MM 4MNGE 3N1MC 1DVFB 5T3XL 3TGXA 1VFBB 3WY4A 2ZYRA 1DE4A 3FT9A 2AK4E 1FNGA 1AXSA 2C9QA 4Y1SA 1NEPA 4UDUB 5CJ5A 2R8SL 1JPGA 2QEJA 2X4RB 2O6FA 2XACC 4KV5F 2BS9A 4XXCC 1K32A 1LK3H 2JJWA 1I7TA 5KN5A 4M8UA 3HFFA 2Z8RA 4FL4C 4UZSA 1BVZA 1SDYA 3HMWH 5AVSB 5FYKU 3I9IA 3MJGX 4OF0A 5FHBL 2P1YA 4P3CL 2IUPA 4UZUA 5EEYA 1A1MA 2VE6B 2ATKA 4Q58C 3WJMB 5GQBA 4FHBD 4YHKL 3LQAC 2EDTA 3P9LA 4HUWB 3RI5K 1ASOA 4JJ5A 4Z7WF 1QNZL 3GUFA 5E4EC 4TOYL 3WSQL 4HD5A 5EU6E 1F45A 3WIHL 2NNAA 2VLLA 1Q72H 1WDAA 5E8OB 1WBZB 1CICC 4L1DA 1ITBB 2HTKD 3K80A 2V5MA 4IJ3B 5KSBF 2WTPA 3RL1B 5JQ6L 5KANI 1H6UA 1IC5L 3EQ7A 2AGYA 4BFKA 1Z0MA 3AB0B 3HC0B 2IGTA 4GBXD 1HOCB 3DETD 2IQ9L 1B6DA 1S5HA 4ETYA 2HFEA 3ARDD 4PRDA 5CKAA 3IN2A 4P06A 1LE9A 2AERT 2Y25A 3MU3A 4G42A 1Z5YD 2ESVD 3EBHA 1OAKL 3AL9A 4MD5A 1HHJA 2VR9A 1MVFA 4X5RA 2JLPA 1IX2A 3VI3A 1IBHA 4PJAA 1RIUH 3SCMD 1ZLUH 4BCYA 1HNGA 1B9XA 2WBXA 2Z4QB 3VD0A 1I9RL 4Q6YA 1SUJA 1OGAD 1PMYA 1UVQA 3U2IA 7PCYA 3H8NA 3O2DA 2Q9OA 4C54A 4KK6C 1WA0X 2DDQL 2ZUXA 5DMKA 5IW1B 1NGYA 2AQ1A 2LQRA 3ULEC 1OL0A 1N4XH 5JA9A 4GW4A 1GMEA 5T1MA 4YDVB 2Z0BA 5EU7E 2VNCA 4Y16A 2O1AA 5A2JH 1UATA 3QDJA 5DJ6A 3TURA 3RE0A 5I71B 2ROYA 3GZPA 4LLYA 3KYNB 3RVVD 3HHSB 4DNVA 4JFHE 5F7UA 1BD2B 3U83A 3SMRA 4ODBD 1CWVA 3LMJL 3WMSA 3FFCE 3VWJB 4FI8A 4J7RA 5FEBA 2VXSL 4BEIA 1Q9LB 1FORH 4ELME 5F9WC 4NO3B 4EN3C 1S9VB 2N01B 5BUAA 3P0YH 5DMGD 5EN3A 3VDAA 2ZX5A 2UXTA 4QXTA 2CGYA 5EF0A 2EEFA 5E08L 2NSQA 1Y7VA 2AXGB 3JAMg 2IH3A 1XB6A 2SEBB 4NQEA 3Q05A 1Z32X 4CN6A 4YHOL 4A2FA 2VXTL 4MASA 4Q56A 2J88L 3NK3A 3WEXA 3EDFA 1S78C 3UERA 5INCB 4WF7A 5E5UB 4LLVA 5E2JA 2CKNA 2GCYA 4DVBA 3B2DC 2HA1A 3AY4A 3U7YH 4MAUL 1LXMA 3NVQA 4OUUA 1JNHA 3RKPA 3D05A 3MJWA 2AEPL 4U3CA 3RVUD 3MUY1 3VWKA 4F2ME 1XF3B 5FGCE 5ECJE 1EPFA 1ZS8B 2Y36L 3UTQA 2VRAA 4RH4A 1FG9C 1QBLL 5J6HA 3TYGL 3NIDF 1TR7A 1KBGL 3LKNB 4Q2ZB 1PZUB 2E9JA 1RUML 4NHCL 3MRLA 5EUOE 3DMMC 3EFFA 4LSDA 1DQKA 2L04A 1QPKA 1BVNT 4TM9A 2IXQB 1NDGB 4HWBA 1FE8L 1VDGA 3T4AC 3PWJA 1RCYA 4XNBA 3L5JA 4M7JH 3P4NB 2Z7ZA 4LIQH 5E2UH 5KOMC 1R3IH 4GUPA 1BOGA 3OKYB 3GMQA 3AS0A 4MQTB 1U3HB 2W94A 3M7FB 4JJOA 2YD0A 3IGFA 5T1KD 3N1GC 3H9HB 4KPHL 3N9GL 4CDGC 5L0QB 5F7WC 4N0YH 5FXCH 4WV1C 5T5FH 1TZ8A 1NCBL 1UQSB 4KNUA 4XP9H 4AKPA 5SX5K 4OFVA 5C0BE 4HJ0D 4LASL 5JLZA 4H4NA 4PBDA 1GHFL 2A9NH 2APVA 1W72H 4BGDA 1EO7A 1K8DA 1LVEA 2FWSA 1UOKA 3D07A 1W72B 5DT1L 3MYJA 3BP7B 2A3TA 4Z7NF 4OAWB 2OL3A 3QQDB 4I5BB 1KG0B 1CBVH 3A6CL 2EIEA 3VE0A 1ZT4B 2B16A 4OKVA 2W65A 3O4LD 2EIZB 5E7FA 1AD0A 2XFXB 2P24B 5BVPH 4AITA 2ZUSA 1N10A 3GSUB 2ZF9A 1KCLA 3W2DL 2JIXD 3PJLA 3BJLA 4APQD 3CDCA 3UGUA 5GGQL 1BCIA 2WVSA 1DCEA 3EO0A 4R26H 4F3FB 2QMKA 3BFWA 3EJZC 3EO9H 3GSQA 5C0AB 4B97A 5DO2C 5F7DB 5LJYH 3WEBA 1ZRUA 3TZVB 4P9HH 4TQHA 1MFCL 4MJ6A 3SKNB 3LDBB 1QO3A 3B83A 3FCSA 4LL4A 1UOQA 1BFOA 1MSPA 2HT4C 1F3JB 4NP4L 4O02L 3FN9A 4X4YA 2YRLA 4EBQL 4KZEH 5EAPA 5F9JB 4BFIA 1YAIA 4TUUA 1MI5E 1A7BA 4JFEE 3GJFH 3N6YA 4CGTA 5D4QA 5ALBH 2OMVA 1XF4A 1YEFL 1Z9SA 2XI9A 3GJFB 2A9DA 4GXFA 5LKNA 4BUGA 2VC2A 1NFDA 4ZO6A 3QQ4B 4QGYA 5IJKA 2VQUA 3VFVB 1OB1A 3DURA 4XP6L 4JKKA 4M5YL 3U0TB 1OLLA 2OJYA 5CLYA 1HEZB 4LOFA 3MV8A 4DO6A 3FXIC 1ES0A 1GC1L 1NCDH 1ZE3C 2F0CA 5K9OA 4RAHA 3AL8A 1NGPH 2VJXA 1V7MH 3SOTA 3SEPA 4YHML 1V55B 1RKRA 3LN4A 5FGBA 3N85H 4G2AA 2VQTA 2ENJA 2J8UB 1D3CA 1X5YA 1XDTT 5JYMA 2BIIA 4H88L 2NY4C 2XHNA 1IRAY 2YA0A 5IOPB 1TVHA 1TZIB 4ZBJA 4GP8B 4X8JB 4DKDC 1WF5A 3AM8A 5D1QD 1L9RA 2VLJE 4XX1E 1B6UA 2A38A 3TVMC 2KUTA 2Q86A 4U7SA 1CBJA 3H7BB 3DUUB 1ACYH 1N8ZA 2EDNA 5E00A 4N2KA 2ADYA 5EM2B 5A43C 3CIAA 3KL5A 1HXMB 5EB9A 4OD3L 3LAFA 5L7XH 2K1MA 2Z1PA 1SVCP 2JB5L 3DYMA 5J12C 1ZT7A 2DTSA 1L3NA 3MLXL 4MJ5A 1QD0A 1Q94B 2KPNA 3AS2A 3LPOA 3C6LB 2JH2A 5DJAA 4Z0BL 3IDNA 4BWUA 2VDLA 2CO7B 3ARQA 1FRGH 4W9JC 4CVXB 2E27L 1J9RA 1J18A 1CF8H 2NX5D 4ODHL 1TSHA 4JDVB 4S1SL 4XRCA 4PJ9C 4PJBE 5TQ0H 5JHMA 4ZQKA 4IOFD 2XZQL 1GGBH 4Z7VF 4ODTH 3WTSA 1EZUA 1GJIA 3EYFA 4PBYA 2HUEA 2X1PA 5D7IE 2EUVA 5ESAA 1IGCH 3LPGA 4M3JA 3X12A 5L4JA 1IBGH 1KXHA 5CZKA 1ZJBA 4H20L 4YHPA 4HJIA 4ZFOB 4ERZA 4KAQH 1M3IA 4XYIA 4PLKC 4M93B 3F62A 4BZ1A 1F1AA 5I8OH 3LIUA 2V37A 1KT2A 5HI5C 3O3UN 3HZ3A 4PP1D 4A2GA 1MG2C 5CP3H 3CPUA 1S6NA 3OX8A 1G7PA 1MW1A 3I9GH 1M1SA 3RZWA 3ARBD 4Y4KB 3IS0X 2AGZA 1WBYA 3OF7A 4AV0A 5DGRA 4I88A 2K8MA 4NI3A 4YNYB 2PXYC 4FTVA 2WJ5A 4BKSC 2ZSWA 4JFSA 4P46D 3QDMD 1FSKC 2Q76B 4MAYB 4IJTA 3Q2CA 2EE9A 5CZVH 3EI2B 1KWGA 1SEBA 1J0ZA 4IS6B 4GQ9H 1JGUL 1PTZA 4MMXA 1ET8A 3A6BL 4KO7A 3VXUD 4ZUSA 4ABWA 3S0PA 3ZE0F 4NBZB 4N2IA 4RBPK 3AS3A 4ONFH 3UPCA 3S2CA 3GHBH 3H6JA 4XWOC 4QMEA 5F9AC 3T0XA 5EEZA 2A9ML 3KLSA 3BHBB 2UXVA 3SDYL 4TPRL 2FBOJ 3G5YA 1M42A 3FQTA 3U1SH 1HOEA 3O9WD 3QJRB 4D8PB 3WFDH 2E3VA 1PLCA 4G8EA 3RGVD 1KZYA 2YEZB 5E03A 4CY1A 4WO4A 1TTRA 5CN1A 4PREA 4XCYB 4QOKE 4YR6A 3BRGC 1ZK9A 4U0RB 1MLBB 2Z3FA 3VXSE 3QA3B 4FCAA 5I0DA 1GGCL 4KKAC 4RISL 1KPUB 3GM8A 5E99L 4OB5L 3AMLA 4JQIL 3FQNB 4J4PC 4X9BA 3ILDA 1OXYA 4BFJA 2E0PA 1DLFH 4JHZA 2B1AH 1JHLH 4OCSL 2IIJA 2X88A 3OTTA 1NGZA 2OXGB 5IB4A 3UTSE 3C60A 4PG2C 5IG7A 4GSQA 3OWEA 4FG4A 3TBYB 4I18A 2W9DL 4KKCD 4JFDE 1T83C 4C4UA 4XPGH 1SM3H 3LZFH 3BXNB 1H8SA 4G7YL 4WJKA 4ZAKA 3VFTB 1GXRA 4WK2A 2IG2L 3RB7A 1YYMH 3UOAB 3HA0A 2Z7UA 1DVFD 1AGDB 5D1ZA 4QXVA 3GXMA 4RMBA 2YRZA 3MBXL 5I8EB 1BEXA 1SEQH 3BMVA 3BIKB 1Q0YH 3D3VB 4BE5A 1JF5A 1XL4A 2BSEA 3MJ9A 1CC3A 1XGTB 2O6DA 2AJSL 3IF1B 3QIWB 4PMFA 5EDXA 5IFAL 3QNFA 4M6ML 2VM4A 1GZPA 3OJMB 4LF3A 4NZ8A 5H2BA 1O7DC 3SGEH 3VSTA 3FCBA 2MJWA 1L9TA 4J8QA 4NSKA 5F1IA 5T1LA 5C70A 3M1CA 3GT6A 4QHNB 2DBLL 2HMIC 2DJ4A 2ICWJ 3MJ8A 3F85A 2R9HC 5HHPA 2NUTB 4R5XA 1ECYA 2C9AA 4R90H 4YXLH 4ZZFA 3OWRA 5FXYA 1RK0B 1ETJA 2MTAA 3MXVH 4HWZA 2E5EA 4DHLA 3TFKD 5H17A 2H32A 4M7LT 4JDTH 5J0BA 5CGYC 1XH1A 4BP9A 1I3RA 3KVPA 3UAAA 4A0BA 5LBSL 25C8H 1FZMA 2KH2B 5I1AB 2EC9U 1OAZH 4P07A 5D1XB 1MJ8L 3MRQA 4WI2A 1IM3B 1FJ1B 2IAAC 2OJEB 3FTGB 1E8NA 1S7RB 3HKZA 1OANA 1X7QB 1AHWC 1MUJA 4HK0B 4B5EA 4A39A 1O6TA 5C1MB 4KKRA 2F5BH 5CMAA 5A3IC 2BIQA 1Q0XH 1REIA 2PYEA 3QDGA 3E3QC 4JAMB 2AKRB 5FR3A 2IWGA 5HDBA 3BG1A 3IGAB 3JROA 3FOLA 4XI5D 1A1NB 4KMTL 2FCBA 5E9DE 5ICXA 1X4YA 4FFVD 4LVOB 1TTGA 4NKOB 3Q43A 2A6KA 5GIRA 4ETQB 3I2NA 2GIXA 1EANA 2FQFA 2YXWA 1F11B 2QGCA 3L5XH 5BNXD 4MA3B 4ZPTB 3H42H 2BSTA 4LLAA 1RIHH 3ZDXF 4ICXA 1Q9KB 4QCIA 3KCPB 5T1DL 3WEAA 1B90A 3BWAB 3HE7B 4YUEH 3UG5A 1RPQA 3RX7A 4DIXA 4XCEA 1KJ2H 4RAVA 5JPNB 4BA0A 5JPMA 4PJ8C 2WZPA 1HH9B 4N5UA 1KJ2B 3H2QA 1YJDC 4KBPA 3UBXA 1RHFA 1KZQA 1FG2B 2WXJA 3LN5B 4B96A 1RMFH 1WLHA 4HHAA 5EU6A 1KYOK 1BD2D 1BZ9B 2XJLA 4FYSA 4BK5A 1JV2A 3C6SB 4Y5YB 3SKJL 3VWJD 4AH2B 2FH6A 2L7UA 5E6SA 4UILL 3FTWA 3MJ7B 1OP5H 5DJYA 3HFML 3TV3L 4NO0A 4QRQB 5D72L 4BKTC 5GZND 4KUZH 4FWWA 3Q48A 1T21B 2EAEA 2TRCB 3MV11 2QKIA 1U92B 4GKNB 3MNDA 3TYFA 3WV0A 4HPYH 3KCWA 4U1JA 4CVZB 4JKPL 4PY8I 1AZNA 1IC7L 3GRGA 3OKEB 5JW4Q 2P8PA 1UB6B 3SHSA 1SYSA 3B7TA 4M1GL 4H2AA 3WHE1 3I85A 5K1VA 3ZYIA 2K9UA 4LAJH 3CDFA 4IBQA 4KXCA 3DJTA 2QLYA 3EAKA 5IZ7A 1M05B 1S7SA 1Z9PA 3CZGA 4ZXBB 2DI9A 1NSNL 4IOIB 3ZHDA 2EZ0D 3QZNA 1I8IA 4KY1H 5KVDE 2J1KA 5I6PA 2FLMA 1E5BA 1A3LH 1QEWA 3GMLB 5IVZB 3QCUH 3P11L 2UY7A 2WB7A 4GKZA 1E28B 2HUHA 4XAWH 3NCEB 4DP9X 1P4LA 3QGVA 3ATEA 1QR1B 1GY2A 1SVBA 1HIML 3RX9A 4GO9A 4YSQA 2EXYC 2GB2A 4S1QL 1UJ3C 1AXIB 4X5QA 3NCJH 4WWID 5SX4H 1FAIL 1N12A 2A6JA 3BLKA 2VCOA 2RD0A 4OZIF 2XA8H 1N64H 4APXA 4Z7OE 4GQRA 4MJIB 4Y9GA 5AUMB 3PL6A 5DC4B 3KYOA 4OZHE 4N25A 2ZONA 2H3XA 4A7VA 1DQQA 3MBEC 4PJCE 2CK2A 3JT0A 1MZYA 4WTZA 4NJAH 4KDVA 4Y4FB 5AOIA 1VADB 2YARA 3TEWA 3S3SA 2Y2YA 1A4AA 4EI6A 3V4PH 5CU9A 4ELMA 1CXKA 3MA7A 3V4PB 1U3HD 2CUHA 1SXZA 3JZYA 3KH3A 2Y7SA 2WXPA 1UEYA 3JSSA 3PGCA 3S9DB 4Z7UF 2EH8L 3ULVL 4F1SA 1EHLH 4LHJB 3S4SB 5J11B 1U0QA 1X3DA 5FV1L 3MRGA 5CR1A 4JCWA 1E4XL 1NEZG 1Y18A 1V5JA 1I82A 1UWXK 5GGTH 5DJDB 4B0MB 5KYYB 4JS7A 3VFOA 5BUPA 4JPIA 2LLGA 4IIQA 4LRNL 2HXCA 2I9LA 2OTWA 3RIAF 4LKCA 1N5AA 3SYAA 1AZVA 4GRWE 3CFEB 3WUZA 2MPAL 4HLZH 1JYXA 2L7EA 4IHOA 1LJMA 2IH1B 4QHKJ 2WKOF 5B8CA 1JV5A 3R06B 1C16B 4BCZA 1RK1B 2BZCA 3BKYL 3GMNA 4FMKA 2ZOUA 4M5SA 3B7FA 1F41A 3VTAA 2NZ1A 1NLDH 2RGSA 3D9AH 5C7ZA 2D2OA 1AR1B 1YUHB 1PEZA 2FUTA 5EFIA 1FIGH 2EKSA 1CLYL 3AQYA 3N1PC 2ZJSH 3NIFE 3MRDB 3VB8A 5TQ2H 1BJMA 3GM0A 5C0AD 5LG1A 3ZKNC 4RIRB 3MTXA 2C4XA 2FO8A 4JHVA 1KGWA 5GRUH 3ME0A 3TN0C 5C6TL 5KYWA 1A6VL 2WLMA 3NP3A 3DV4A 2Y23A 1A7RL 3MLZH 5JUEL 2V33A 3CN4A 4R7NB 4XGZB 2ARJQ 2IPTH 5CGMA 2VZTA 1KBKA 1NCTA 3L3OA 4NENB 3PDDA 4ZQTA 3BVDB 4JO3H 2VDRA 5F6IC 1FDLH 1WIOA 4BRJA 2Q3XA 2R1YB 1A7QH 1MFNA 5E8DH 3U9PH 5DVPA 1LO3L 3U9UB 4RFEB 1FN4A 1R5IA 1G6RH 3NSDA 3HG1E 1TFPA 2Z8SA 5C0BA 1QUPA 1G6RB 3DIVA 1MI5D 5FA4A 1LK3L 4C58B 1KBWA 3C75A 3MBWB 1XAKA 3P9WB 3UROR 3CXHK 1EHKB 3FO9A 5ITFB 4KJYB 2E7LC 4ANUA 1L9MA 3U30C 1UT9A 3GO1L 4N5ED 2CDFB 5IW6A 2O61B 3OKDB 4R3SA 3FUHA 1RFDH 3IJCA 1SN2A 4N2OA 1WAAA 2LAAA 2P8MB 4LEOB 1UXSB 3ETTA 1B88A 1Q72L 4MCYA 2JJSA 4WI0A 3UKRC 3J8F7 1WZKA 2F53E 1T1XB 4FULA 4MDIA 1WISA 1T4KB 4MCZB 4ZN4A 5DMJB 1W16A 3GZQA 4P05A 2VLJD 2QPEB 4D94A 4PBXA 2BVPB 3F12B 3P3RA 4Y1AE 4JN1L 3QIBA 5IROC 1WD9A 3WKMH 4X6BB 5EDSA 4J3OD 4J73A 1FNGB 3L2NA 3STLA 2XE4A 3OD3A 1AXSB 4RGNB 4ZFZA 4XTRD 2GTWA 3C6LD 3HG3A 4JFEA 4K23L 5D8JH 2ZUVA 43CAA 2QVMA 4G9DA 1JPGB 5J1AB 5KS9F 3ZL2A 1D7DA 1YNTA 2H26A 3RTQB 4FFYH 3BT0A 4XHQA 4JMXA 4AVKA 1I7TB 4GB9A 4LBAA 1K2DB 3JTSB 4M1DL 5KN5B 3I7KA 2WP3O 1FNLA 1WS8A 3VH8B 1JTTA 3IIYA 3D5OF 2OTPA 3JWDL 4W9CC 5D4JA 3SVWD 4XMKL 1SHSA 1PIGA 3SBWC 4AENB 2IWEA 2P42B 4JJ5B 4P23A 5DD6A 4XXCA 4F2FA 2AQRA 1J8RA 1M1XA 2PCFB 2KHAA 2FJHB 1J5IA 2VLLB 3D2UB 4MCMA 2FDBP 3F6LA 3FQ4A 2CU9A 4OFPA 2C9PA 4BH6A 3Q6GL 3HE6C 2N0KA 2ZNWA 5D7EA 4UT6L 4OV5B 2MKWA 2VDML 1S5HB 5CD5D 1NIFA 1GS8A 1SFHA 1CICA 1GH7A 1LE9B 4UOW0 1BG1A 4G42B 4QRSB 3FGBA 1U8HB 2FSDA 2OXHA 3L16A 1DBKH 4MD5B 4WWKB 1JVKA 3KBPA 5C8JA 1QMUA 1PBYB 3VI3B 4MNQE 4JRYE 5J6SA 1U8QA 4MAYD 4G59C 1SRDA 3QEGH 4P5RA 1VFMA 2UWEF 3O2DH 4JG5A 5H14A 4K15A 2DL2A 1LTXA 1UVQB 2WLKA 3GYRA 3MYZA 4QYAA 4L5FL 1EFXB 4NHUA 5DMKB 1NGYB 1KDJA 2APFA 4XZ4A 4PJBA 1LILA 5K9QI 4GW4B 4J2XA 3RAJH 1WHOA 2FWLB 3L4ZA 5KVGE 1NCJA 1EXGA 3LS4H 3QDJB 1GYUA 1YEGH 3O8XA 4FQXC 2P9IC 1MH5A 2H8PA 1ZHBA 5EG6C 1ZLVH 3P2BA 2JTYA 3P4OB 3AADB 2RQEA 1SQ9A 1G43A 3MRBB 4UWQB 5GJTH 3TT3L 4JQVA 1XQ4A 3K1KC 3L17A 4XN8A 4G5AA 2Z31C 1FHNA 3QZLA 1MFAH 1UH3A 3EJJX 4M7JL 2HX8A 4N8CH 5E2UL 2GUOA 2O6EA 4NC2B 5DS1A 1A4BA 4BFFA 4XPTH 4QXTB 2NY1C 2VSDA 3HG0A 3APNA 1MLCA 5JOFA 5IFHL 5CGTA 5BVJB 4JL1A 3OQ3B 5J3HD 1N9PA 2P80A 3FQWB 2BBKH 2YC1A 3K71A 1TU2A 1MW2A 1EZVX 2XBZA 4N0YL 2ADIB 1B0IA 1NPNA 1FH5H 1S5IH 4LLVB 4ZDHA 3VYOA 4DVBB 3UTPD 4XP9L 1HH6A 4OUUB 2ARWA 3HBGA 1ERNA 2AXWA 1VEOA 4OM1L 3VWKB 2XETA 3UTSD 2C7UA 1CL7H 1T3FA 1FFNB 2VLKB 5C07E 3IK2A 3CLFH 3B2VL 2UVFA 4LCCA 2W88A 5GS2D 3IT8D 5CZXC 3W11C 3ZK0A 5J6HB 3O4IA 1MKFA 3JV0A 2JLLA 1I4FA 4XXWC 5AZ2H 1BZQK 2ID5A 3D3VD 3K74B 3WUWG 3CLEH 4PJGF 1CIUA 1JTDB 4F7TB 2XY1A 3MRLB 4YVNA 4IBSA 5CUSL 3QIWD 3MFGB 4HUXA 4HWNA 5I1CH 4HWBH 5J89A 2NXYB 2VITA 3HJ0A 4WLCA 5CYKA 3CZFB 3NMEA 4MNHA 12E8L 2FWOA 4HSQA 2IALA 1XIPA 2FHCA 3G6AA 3FO1A 4UV7H 5ALCH 4NKQB 5EWIH 4XB8A 4NC1C 1IGYB 4R26L 3VXSA 2LW3A 3V0WH 3L1EA 4GUPB 3AXHA 1BOGB 3GMQB 3P4LA 3MRCA 5F0LB 2VQ4A 4AIZA 2ED7A 1SXNA 1HE8A 4P9HL 5KYUA 3CC5B 3CVBA 2H6OA 4GUQA 1D6VL 2DQHH 4XPAL 3GTVA 4Y4HA 5INDA 2EINB 1T7XA 4KZEL 4LP4A 2IMNA 2B1HL 3FKUS 3U25A 4X61B 2W8CA 3IFNL 5D1XD 4BD4A 1D5ZB 3BZDA 1JZFA 5ALBL 4UUJA 1IM3D 1DCLA 3W39A 4W4OC 5KJRH 3BUYA 1RXLA 4JFDA 1ZHKA 3SPGA 2FECI 5DQ9A 2LU4A 3TO4C 3VGEA 5TGBA 4DW2H 4BELD 3BD4A 2NXZD 5I5JA 3MYJB 4PWEA 4WV1A 3V5DA 2XVGA 5E6ZA 3V6OC 4AY0A 3DVNA 4A11A 1NCDL 3GMOA 3W81A 1V7ML 1OP3H 1MJJA 4BSJA 1GOHA 3M8OH 2W65B 3MUZ1 1GKEA 2E56A 5FYLE 4DKEH 1AD0B 3MGTA 4HPHA 1P5UA 5KYNA 4XVSH 4IK7A 4LCUB 2NZ9C 5LCVL 4QRRE 5JIPA 1TEFA 1H2XA 4XNYL 3ZL1A 2N7BA 2YSSB 3V7AE 5AD0A 1UTDA 1IAIM 1LK2B 5E9DD 1RD6A 3OM3B 3X11A 2IDCA 3AWEA 3KJ4C 1IAKA 2R59A 3HE7D 5AYQA 1TTBA 2Y7OA 3L1FA 4S1RL 3I7LA 2X4OA 2D3JA 3NRFA 1KBPA 4MJ6B 5AZUA 1E4JA 2VKWA 2FECL 5L7XL 1WP6A 4DESA 2PPDA 3IU4L 1BQSA 1MIML 2GJ6E 3MFFB 4XN1A 3WNPA 4JG9A 4HMDA 4X4YB 4N4YB 5IMMA 1GMIA 2B5MA 4XMLL 5FCSH 2VC2H 3EYOA 2OMVB 1Z9SB 4WJG3 3ULAB 2BSSA 4HEPG 4JX0A 2VC2B 4CU7A 1G9NH 1N6UA 5D7LE 2I85A 1CF8L 1FL3A 1NFDB 1KACB 3UAJC 5ACLA 1OB1B 4NQXA 3IDGA 1XEDA 5E94A 3TJPA 2WKGA 2A99A 2Y2WA 3MV8B 4WK0A 2R0KH 1RY7B 2CHXA 4IKLA 3PXSD 4NZUH 4JM2A 4B9JA 5SWQB 4E9TA 3C5MA 3BWSA 5C9KA 5THAA 5FFLA 2DWDA 2PM6B 3QXDB 5DFVD 1PLGH 5FDYA 4IRJC 3F05A 2SODB 2VH5H 2YZ8A 1JPTH 3JTTA 3IUQA 4JZNB 1K8KC 2J57G 4ZXBD 4NGHH 3WU1A 4MBRA 2XDWA 3KGUA 2WINA 2B14A 4GG6A 1E65A 2XIIA 3QCTH 4LG8A 1KFAL 1Z1WA 1BMWA 4RGOH 3QIUC 2AQ3A 4DP7X 1L0PA 4YDKL 2EUZA 1N8ZB 5E00B 4B9ZA 2B0SH 3DI3B 3D87B 5AKRA 4EO5A 1G0DA 4YXKH 1RU9L 2NY0B 5G5DA 1MJUH 1CQKA 3ZIYA 1F3RB 3BMWA 2VDLH 3TVMA 5DJAB 4DP0X 3IDNB 2VDLB 4Q14A 5E51A 2VR8A 3F7YA 4JREC 2X6VA 3M17B 4WNSA 5HP5A 1OTUD 3AREB 2XBDA 4Y4FD 1AQHA 3EOAA 5CZVL 1K4CA 1PNCA 4XRCB 5AB2A 3IJSB 3I74A 4ODXA 2YMXH 1JWSA 1MCKA 1JZ6A 1VLXA 3LKOA 5I1DA 4PBZA 4RZCB 4ZQKB 5DRNA 2VLRA 1I9IL 2UVEA 4ENEC 3EYFB 1T1ZB 2DD8L 4H5IA 4OCYH 5ESAB 1ZLWK 3CVHL 4XVTL 3IDUA 3BESR 4PCYA 1ZA3B 4H8WH 4GUOA 4BZ1H 4PJ9A 5CP7A 4QT5A 2WP3T 3WFDL 4OGXH 2D0FA 1WWCA 2NTSP 1L0YA 1M9WA 2R56L 5CU5A 1JNJA 3KM2A 3WJJC 3OAWA 2Y7NA 1O9VA 3HHRB 4F80A 5I18H 4HDJA 3HG2A 1XH3A 4XOEA 4BKLA 1YEEH 2DEXX 4XNZC 1NCOA 2EE6A 3GBLA 5TDOB 3EGDA 4WFEE 4ZOXA 5E0FA 1WBYB 2HFFA 2APTA 1O0VA 3SGEI 2B1AL 4Y2OA 4Z7OA 1AR1D 3KPRE 1MG2A 2LOEA 4LDEB 4F8PA 4L48A 2EICA 1R3HA 3QQXA 2B5IB 1SEBB 1NR0A 3D09A 1SM3L 5FW6A 4MMXB 4N0RA 1IGIH 4KJQD 4QYOB 4ZUSB 2NDFA 2DI7A 3DGGA 4PJEE 3S8GB 3UVLA 2PXYA 3GMRA 3GXDA 1YYML 4OCXL 1JZJA 4WHCA 1CG9B 2XYBA 4KKBC 4JPWL 1EAQA 3S35H 5TK2A 5AW4B 1BFTA 1KLGA 2JI2A 2QGEA 3LH2L 4TUOB 1ZHNA 3G5YB 4N20A 4RDQG 4XCCL 1Q0YL 5CSZA 4G8EB 3CG8A 5E5MA 1MZZA 3K6NA 3DXMC 1E6JH 1FO0A 4K7PL 5J4MA 3B5HA 2B59A 1JZEA 2JK5A 4EZMA 5ICYA 4NQTA 4UTBA 1LO4L 1Q1PA 1MCCA 4FLSA 3OW8A 1W0WB 1S7XA 1FA4A 1KTJA 4M7LL 1K5WA 3X17A 2Y5QA 4IU2A 1A14L 4R90L 3T6XA 4YXLL 1Y6NR 2ZXEB 4A6YA 3KXFA 3ECVA 3W9EA 2J12B 5MEQA 1DFBL 1PCXA 2CDEA 4ZOZA 4KKZA 4TNEA 2CIKA 3HPJA 2HVJA 3C60B 4TTGA 4XBPA 2BHZA 5JHLL 4I3RH 4WK4A 25C8L 4HHGA 1VEPA 1OAZL 5AVTB 1KGUA 1RH8A 3OR7A 4J4PA 3NIFA 3NJVA 4WJKB 4ZAKB 2PTUA 4XO9A 4U1IA 4WK2B 3P9MA 3GBNL 2OZ4A 1WFJA 2AQ5A 5FLXg 3SE4A 4AZUA 2FL5A 5IGQA 1ICTA 2BSCA 1R24A 4PG2A 2WQAA 1CF1A 2JF1A 1OW0C 2OCCB 5IHHA 1TLKA 1QI3A 4UNTA 3WNNA 4RGND 3KYKL 4NFBA 1YSOA 4CVWA 4OF7A 2FYVA 3FJTA 4ODVL 1L6PA 2CR3A 2J8UF 3WTVA 2BPBA 3RTQD 3V6OE 2Q2LA 2Z34A 3RN1D 3V0DA 5H2BB 3FBQA 1OV8A 4NSKB 1R6VA 3FONA 3L5XL 4YHIA 2CKBA 3CZJA 3BUQA 4UBDD 4CY2A 1M71A 1LO2L 3FRPB 2X38A 3S36X 2H32H 4R6UA 2CE8A 4CKQA 4FD0A 3WXVH 5HYIA 4HWZB 1BYOA 3IIWA 2CBOA 3FZUD 1GC1C 2H32B 3FU8A 2VZUA 4UM9A 1BF8A 1I3RB 3L3HA 3NJIA 1FPTH 1P7HL 3KPQA 3V4UL 1RMFL 4J3OF 4AEIH 4NC4A 3D2UD 1LNUA 4I0PB 2MKLC 1FZMB 2Q10A 2A0LD 3MRQB 1CXLA 3PYCA 4K8RH 2QC5A 4O51B 3IN0A 3SE3C 2DQJH 2G9HA 4L0PB 4PTUA 1MUJB 4S0HA 4BFRA 2NW2A 4KUZL 4LNRA 3PLYA 5AVWB 5SX4I 1WT5C 1ZT1B 4GM8A 3AJ7A 4NQCB 4A2EA 3RFZA 3B7SA 4FHLA 5EZIL 4ZUUA 4YQXH 2O72A 2CN3A 3ASOB 2AMUA 2OX5A 4KU1A 4Y1AA 5C7XL 5GS1A 2PYEB 3QDGB 2X70A 2XVKA 4LSPH 4TSCH 5HDBB 2Z1KA 1I8UA 1SY6A 2IAAA 4NN6C 4WWKD 2HPOA 2RR3A 3ZY7A 3DBSA 4AUUA 1ZTXH 1DVUA 2AABH 4JO2H 1CGSL 2C9RA 1G9MH 1GR7A 3X1FA 2OCJA 4C56E 3AG4B 1G1CA 2OCFD 3AY2A 3KYAA 2BSTB 4XB3A 5AVVB 4KY1L 1X5LA 4QCIB 1EFXD 4HLEA 5BOJA 5D7IF 4UBDC 4KTYA 1A3LL 2BCKA 3TOPA 1KIQB 3R18A 3GBDA 1CD9B 1KB5A 4RAVB 4XCEB 4ZODA 4K71B 4LBEB 4QKXB 2VMCA 1QSFE 5DD5L 3QRGH 3O2WH 3JB9L 4HHAB 3RVWD 2G30A 4WWOA 1WFIA 5IB5A 2XA8L 1O6SA 4R4BA 1XXDC 4KTEL 3HC3H 3CFCH 1Y0LB 4OTXH 4BCCA 4NO0B 3SGKC 4HIHA 4E42A 1NMAH 3IB4A 2ICWA 3AXIA 3NA4A 1B0GA 2VXUH 3NCCB 3V4PL 4G8FA 3ZE2B 1XKSA 1KGXA 3TYFB 2H6NA 2AGLA 4YDZA 2RALA 4X7FC 3MV9D 4H0IA 4AQAA 4MLIA 4GGAA 5F7EL 5HHME 3J7HA 2F2HA 4ZFGH 3APCA 1EH9A 2X1QA 2AJVH 3L48A 1DVTA 5F96H 3VI4E 1LP9B 1S7SB 4JRYA 4JD2C 4ZSOB 4FQJL 4OSUH 2PYFB 1I8IB 4FN0A 1YY8B 5GGTL 5KSUA 3US0A 4UAOB 2J3SA 1QEWB 3MZGB 5HPMB 4X4KA 1YEJH 3KPMA 1CGWA 2BY3A 3QAQA 4D9RE 4LG9A 2VLKD 4GKZB 4AQOA 5BS0B 2XKNA 4JUSA 1FC2D 1P4LB 8FABA 3LD8B 1D7FA 1X5AA 5T8IA 4ONOA 1UZ6F 1KPVA 4G72B 3G6DL 4G6AD 3HUJB 1XCTA 1TPXC 2A6JB 3DVGB 4XC3H 4APXB 3NPZB 2HJ4A 5F1KC 3TBWA 1NLDL 1F6AA 3PL6B 5L2KB 2NXYD 3KYOB 4LCIH 4PPTA 5JIHA 2OW6A 2HWZL 1DQQB 1QSEB 3H9SE 2XQBH 1FIGL 1AI1H 4CC0A 1UJ3A 5IMOA 3HMXA 3H0TA 5KUMA 3MA7B 2J6EA 4FFTA 4Y2LA 3MREA 4HUVA 2BP5M 1MQKH 3ET9F 2WLHA 1HN1A 2H3NA 5D5MF 3MBEA 2EDKA 2WQWA 1KPRA 3IFOA 1HZHH 3MCG1 3PFUA 1SYVB 3R4DA 5EEUA 4K7FB 2Q3ZA 5EC2A 5K1JA 1A7QL 1DDTA 1PG7X 1Q38A 4L3CA 3U9PL 4PVBA 5FW7A 3RNQA 3BGMA 3VFOB 4IIQB 4RMSA 2CGZA 2OTWB 1GKOA 1E67A 4LKCB 3UVOA 1N5AB 4HBCL 3DROA 1A2YA 1MN4A 1TYJA 4R8WH 4OU3A 3ARXA 1NIBA 1C7TA 5C07A 2YA2A 3WNIA 1UUNA 5CWSA 1A9BA 5JHBA 2VYRE 5CKGA 1EDHA 5B8CB 3WFCL 3P54A 2WLLB 1WBXA 4H25A 3I02B 4TNGA 3GMNB 3IURA 3U36A 1RFDL 3BEWA 3RA7H 2OMXA 1X9LA 5D9SA 3LSOA 1TYEA 3OF6D 5EFIB 2EKSB 2HKFH 4JY5H 4MD4A 3VVVA 5TTRA 3S37X 2WBJA 3F7LA 3QQ9D 4KH2A 4NQQA 4LGPB 1FP5A 3LRGA 3ME0B 1AGCA 4U1KA 1Q1JL 2HJFA 4X6CE 4Z5RA 4UNVA 2X6CA 3HIZA 3DV4B 5IGXL 1H3GA 1EAPA 1ZVSB 1NKOA 4NPJA 3U4KA 3OKKA 1NLBL 2VZ3A 3Q8FA 4WEEA 3RILA 5I76A 1LDPH 2DEYX 3N3EA 2ERJB 5D7KD 3PXLA 1ETZB 3E6HB 2J5LB 2APWA 3T2NH 4NNYA 5SV3A 4Y2DD 2EDQA 1E6OH 1I8AA 4G5ZH 1AC0A 3TN0A 1FN4B 4DO5A 1UA3A 1TVBB 5JW4N 2W07B 3QPQC 2GJ6D 3C75H 3AT8A 3IFLH 2D03H 3T1WA 1TZHA 5FA4B 4AYMC 1GS7A 3BYTA 2ENSA 2MQ0A 3MV8D 3FO9B 2R23A 3EBGA 1IFHH 2YGQA 4UF7C 4LDOB 4FLOA 4TQPA 3D6GA 3KS0H 3MKSB 2J8OA 4GRLC 3UL4A 1J8KA 3ULUH 1AO7E 3LPWA 1PAMA 4FYQA 2HH0H 2PWHA 5D93C 1NKRA 2OMWA 3ABZA 5IEKA 3NBNA 2JJUA 3V52H 2E7LA 3Q3GA 1BMZA 5E8PA 2VL4A 4QRRA 3BUIA 3FQXA 1KTBA 2JKTM 4MDIB 4M5ZH 2EVGA 4HS6B 2X5PA 4I1NB 1T0MA 5C08A 5JXEC 4EKXA 2X3BA 3CFKA 4QRPA 2YK1L 4YSTA 3MLRH 2W0LA 4AOFA 4FKHA 5I5RA 1TMCB 4TTDC 3LRKA 3QIBB 3NCMA 3LQMA 4HUUA 2NY0D 3UZVB 4DKAA 1PFCA 1WTLA 3MRIB 4A37A 1S9WB 3GLAA 1WZ1L 1YAZA 4FS0A 1FCGA 2FK9A 4OLUL 4ZOEA 4ZFZB 5B1JC 3REVB 3K6SA 1DBKL 5I6XC 5EEXA 3KLAA 2Q3AA 1W6WA 4W9GC 1PZ2A 1YNTB 1EV2E 2H26B 1OMWB 1A6AA 2H2PC 3ARED 2AXJA 5CLZA 2QXVA 3QEGL 4HA1A 5JORB 1A1OB 4NUJB 4LPCA 4URTB 1G7JA 1PGUA 1A3RH 2X6BA 3QHYB 4ESGA 5DEFA 5F7LB 3CBKB 2H0JA 1QW8A 2QQKL 4HJJH 2VN6A 1Z66A 5IQMA 2PP7A 4KQ3H 3V5KB 1FNFA 3VMOA 4DZBA 3ZX1A 3F00A 1E4WL 4GSXA 5J06A 5DD6B 5LXGH 2YAHA 3W9DB 3U4BH 3LS4L 4PYHA 4QNPF 1R3KA 4X63B 4J78A 4XYHA 4I0KA 3H2WA 2YFOA 4YC2C 4FL4B 3U7AA 3QPXH 1MRCH 1PYWA 2YQGA 5HHXH 1IQWH 1CL7I 4LKXA 3LQAH 1OCRB 1CK0L 2F54E 4XCFL 1EHNA 1FLRH 1NCWL 1JZHA 3BH8B 4LSRH 5I16A 2JXMA 2VN3A 5E4EB 4L8BA 2XU7A 1MFAL 3QUKB 4NN7C 4WNJA 4B9YA 3EGXB 3MRHB 4X42A 4N8CL 3O6LL 1OGTB 1BLIA 1E50A 3Q2WA 4UOJA 4EDWL 5G2NA 4RQQA 4OGAD 3PFQA 1CICB 4HUKB 3G3LA 2EDHA 5F3HA 3CXHJ 3QZOA 2BZ7A 2YJLA 1LHZA 2FH8A 2GC4C 1OIOA 3OR6B 4N90E 4NQSB 3DBXA 2OXHB 3V0JA 3D0LB 1LE5A 2CM6A 1CDCA 2F19H 1MY7A 2BSRB 4I48A 4NXSA 4ABQA 1U8QB 3D4CA 1FFTB 1S5IL 4JW3A 1FH5L 1ROCA 1R5WB 3REWA 3FUDA 3PVWB 3BC9A 4B9IA 4EZLA 2O4EA 1JMZA 4J27A 2IDUA 2BW5A 1I3GL 2Y3NA 4M4RA 4PJBB 3EBAA 3ZLQC 5CCKH 3VO0A 3IGKA 2ZCHL 4IQHA 3BH9A 2KPWA 4WI8A 4HISA 2F1BA 1BMGA 5F9OH 3DOHA 3FYEB 3LKQA 4XNUH 1EZSA 4J6IA 4RA3A 3L45A 1HZKA 2HRLA 4QLWA 4LCVA 3LEXA 1PIFA 4D0CB 1MH5B 2H8PB 2YGPA 1ZHBB 1UGKA 3I7NA 4AGNA 5FA3B 4YPJA 3NZHL 4G7QB 5T5NG 4U1NA 4YL4A 1K6QL 1E42A 2YLHA 4G7VL 4X2UA 3ULVC 1K85A 1KLUA 3IXAA 5I1CL 1SJEA 3NH7L 4RZKA 4GJTB 4OFDA 1NGQH 3LIZL 1UG9A 2EP6A 5ALCL 1CU4H 1BBDH 2EDYA 5EWIL 1ZGLA 3VG0L 2GUOB 3V0WL 3HZKA 4R7DB 1JHKL 5K5YA 1XGQA 3BDYH 4B60A 1MLCB 4F7PA 5JOFB 3CVCA 1KSRA 5C0ND 3ZL4L 4AYID 4E9XA 5KVMC 1LEIA 1P9MC 2Z31A 2WXIA 1J1XH 2YC1B 1IAIH 2QQNL 3QORC 3K71B 1TU2B 3C60D 3B8SA 3P02A 5F9WB 1KEMH 3KPRA 3E38A 4EN3B 4K3JH 4J23A 1HH6B 1JS4A 4LHUA 4OKDA 5E23A 3GZOA 2DQEH 4K3JB 3WAKA 2PPAA 3HAEG 2UY6A 4ZAKD 3VXPA 5IVXA 5L8JB 2C7UB 1T3FB 4TV3A 3P73A 2WO4A 4PJEA 1PG7H 2LTQC 2OJZH 2OL3L 4EMZA 1QFSA 2H9PA 1QBBA 2K4AA 1ADQL 4ZS7H 4AV5A 1HI6A 4GG8A 4P3DA 4P59H 1UTCA 4FADA 5T3ZD 1U3ZA 5FKTA 4G9FE 4DKEL 3U2JA 4LEEA 3U1QA 4KQ0A 1QNIA 3TCXA 2P9PC 2D0HA 3G5ZB 2QHLA 3QEQE 5CYKB 1L0XA 1VE6A 5C86A 5D96C 1VZHA 2FWOB 3H9YA 4PB0L 2IALB 5HJ3B 4KHXH 3G6AB 1JTOA 3FO1B 4XXWA 1FWXA 4EOWL 2K7PA 2WYTA 4Z3JA 5DC0A 2W60B 1KN4L 3RFGA 4RFOH 4OLYH 1HL5A 4GI8A 4ZFQA 2L0DA 2FX9L 2CWRA 4AIZB 4BQCA 3Q2NA 3DMMB 5KYUB 5AKTA 4KDWA 3C5ZA 3S37H 4AK2A 5INDB 3T4AB 4WI9A 4GS7C 4V11A 4OQ1A 2ZWNA 4GO8A 4I0PD 4HSAC 2ZKXA 2H9NA 4N14A 4W6YB 2VC2L 3VFSB 3J07A 4UUJB 3RIAK 1S46A 2GSGB 3BUYB 2FB4H 4Y0GA 1G9NL 2P28B 4Y9BA 5DQ9B 1NCAH 5TGBB 1T0OA 4K8RD 2H2SC 2F6AA 1AJ7H 4CL7A 4PR5A 4OLXH 4NQCD 3BKMH 4WV1B 3V5DB 1ZA6B 3DVNB 3GMOB 1OE1A 4DCQA 2WYHA 4HCGA 2PYED 3QDGD 1ZGLM 4OUOA 1V54B 2WNXA 1XEUA 2BMKA 1LEGB 1PZBA 4WEBL 1B9ZA 4FNPA 4D9QD 5JHAA 3WCYA 5IFJA 3BAJA 1MFBH 1JPTL 4ZOVA 3Q0HA 1CN4A 1QFUL 3I7OA 4UT9A 4YMPA 3V6OA 4Q52A 5DHYA 1ORQA 1CDUA 1I7RA 5AD0B 3ARZA 1JUFB 3X11B 5M5TA 4UMGA 1IGTB 2Y3AA 1S2EA 4RGOL 3JPXA 4OJYA 3THMH 1N0XH 2X4OB 2XN1A 5E8NA 1Z3RA 1OSPL 3O3EB 3SE6A 3TLRA 4ERSH 1OM3H 3JWDC 4TVPH 2ENPA 3SE9H 1U8IA 1UKTA 4P48A 1MJUL 1T66D 5IMMB 5TFSH 2VDLL 2NPLX 3FU5A 4YAQA 2P26A 3WFEL 3QWRA 3K8MA 3CUPA 4YGVA 3LEYL 3MLVH 3EYOB 5LAXA 3X14B 2CLVA 2BSSB 1UWYA 3W0WE 4PJ5B 2ISDA 1T2QH 5FO8A 1YEIH 2EDOA 4IBVA 1QX1A 3BAEL 2YD3A 1PQZB 2VXVH 2XPGA 3IDGB 3PHSA 1XAUA 4WK0B 3UJIL 3MNZA 1YMMB 4XNQA 1BZDA 1I75A 2EEDA 2DM7A 1BZOA 4JPVL 2VLME 3VGDA 2DWDB 3AROA 3ZTEA 4R4FH 3UAJA 4HOXA 4FE9A 4FJ6A 3QXTA 4DNWA 1TJIL 1YRKA 4H13C 3AQXA 5CHNA 4F8QA 4WEMB 4BZ1L 4M7KH 2CLZA 4KXZH 5TDPB 2D7TL 1DO5A 1DBMH 1D7CA 1XGYH 4JRXE 2WINB 4TLKA 4GG6B 3FOMB 1IE4A 1HAUA 4X6DE 1UXLA 3RUGA 2P46B 3NT0A 5CBAA 3OJVC 4HG4K 4N3TA 4IU3A 4QR7A 4IRSC 1G4RA 5BS0D 5DMIH 2NY4B 3ERXA 1SBBA 2JKRM 1KXTA 1DANU 2P8LB 2YPKA 1WZLA 2V2TA 1RZJL 4WAFA 1A12A 1RZFH 3EJRA 5IBUG 1CD1A 2OR9H 2F7QA 3TVMB 4TKWA 3QIUA 4LAQL 2NYYC 5GGVH 2OR7A 5CEXB 3F7YB 3PL6D 1NAMA 5L2KD 2Q7YA 3R0MA 4NC0B 2BXYA 4CVUA 2DQMA 3KBEA 1QSED 3M88A 2CMRH 4UQ3A 1DVZA 1UXWA 5CFHA 1K4CB 4U2ZA 5HDLA 5IEHA 5J12B 1MWAL 5DHXB 1JWSB 4FJZA 1JCVA 3EMHA 1IGIL 2RCSL 1FYTE 5I1DB 5GRZA 3VCLA 4XPBL 2VLRB 3H9SD 1NC2D 3FCTB 3GPEA 4F27A 2EDXA 5IESL 1UM5H 4LSVL 5EOTA 43C9A 3S35L 5I1HH 2R0WH 2W91A 4U6VH 4XBEL 2NR6C 3TJEH 2W80C 3QFJD 1XZ0A 4PB9L 1MVUA 4V1DA 2ZOWA 4PJ9B 3T0WA 4QT5B 3KYMA 4XP1H 35C8L 3V7MA 4PW4A 4JFPB 5AYUH 3OXSB 5EMKB 5J6GB 4G8GE 5EZJA 1QZNA 2OMBA 1N8OE 1E6JL 2E59A 3NJJA 2HP4A 2CBTA 5LN4A 5LXVA 1DBBH 3FU7A 4PJ7B 4YK4C 5A40E 1XH3B 2CH8A 2XQYK 4YOKA 5C0CE 3DGDA 4DOHE 2KBGA 3OB0K 5HVHC 3BJ91 4Z77A 9PCYA 1KN2H 1A0RB 3FT2B 1JZ8A 3X3FL 3PWPE 3HI5L 4Z7QF 3WJJA 1VEMA 3V4LA 3O6FD 2ATAA 5C97A 4B41A 1WCBA 1XIWC 3DXAE 3KPNA 4WI4A 4WY7H 1D2PA 4EN2A 1HEHC 1R3HB 1BVKA 4ONGH 5D2NE 2IO5A 4JANB 4JLRA 4OCNC 4UU9A 3MUOA 4XOBA 1OAQH 3QRLA 4PGBA 3VNYA 4XBGA 1XBRA 3OAZH 5KBMA 2PXYB 3GMRB 3IUJA 3JXAA 5D7HA 4JFWA 4J81A 1XGPA 2BS71 1FSKB 3WE1A 5C9ZB 3PXHA 4WSGA 3RDTC 2BP3A 4WKZA 2CE9A 3FM0A 3SO3C 3MJ9L 4LE8A 4P9HC 3RZCA 4JSPC 3KPSE 3TPUA 3QEHB 1AFVL 1FO0H 4TUKH 1T0PB 1H0DB 1SQMA 3FQUA 3EXLA 4A04A 2I0TA 1ORSA 2MQGA 3V0AC 4JSXC 4UTBH 4X4XA 2DYSB 2ZXGA 2I07A 4P4KA 4Z3GA 5E2VH