2YB8B

Crystal structure of nurf55 in complex with su(z)12
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
399
structure length
375
Chain Sequence
VEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYCOMB PROTEIN SU(Z)12
publication title Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 99
structure length 375
sequence length 399
ec nomenclature
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2yb8B00
4GZ8A 5CXCA 4CZYA 4JSXC 2AGXA 4A08B 2G9AA 4ZN4A 1U4CA 4L1QD 4N14A 4J0XA 4QT8A 3SMRA 5HE2B 4Z8LA 2AGZA 5IGQA 1XHMA 2H6NA 3BWSA 3PSLA 5C2WB 4J8GA 4XYIA 3J81g 3K26A 3FGBA 3EI2B 1PEVA 5AFU3 3L4OD 2YBAA 3EI1B 4J79A 5KDOB 3IJ0A 1SQ9A 4E5ZB 4BUJC 5TEFA 1QNIA 4X61B 3PXSD 2H9PA 4XYHA 1L0QA 4CI3A 3J80g 2H9LA 3BG0A 3HFQA 4GGDA 3IIYA 4JT6C 2HJBA 5TDHB 3GFCA 1P22A 2TRCB 3UKRC 5EALA 5IGOA 3SCYA 2P9KC 5IJ7E 3RFHA 2XL2A 1N6DA 2O9KA 4J84A 3I2NA 4LG9A 4LGNA 2H6KA 3I8CA 4D6VA 3AH8B 1MG3A 5HE1B 3JPXA 4GM8A 4LG8A 4CY2A 4G56B 5C9ZB 1VYHC 1SHYB 3MMYA 3N0DA 4PNKB 4A0AB 2PM7B 3RLMD 2OVQB 3W15A 3VA6A 3UR4A 2OK6A 4EWRA 5HYNB 3K27A 3OL2B 1A0RB 1PBYB 2PBIB 3EI3B 4AEZA 4PBZA 1FWXA 3RFGA 4X63B 2QC5A 4ZOZA 5EAPA 3RMZD 1NR0A 3V5WB 3DM0A 2EBSA 1TBGA 4H5JA 3RN1D 3A0FA 4A11A 2CNXA 4O3UB 3E0CA 5FLXg 1MG2A 3FRXA 4J73A 2H47A 5EM2B 4GQ1A 4FWWA 3MZLA 4K3ID 1RI6A 4U7AA 4J82A 3B7FA 4OWRA 5AMSA 3SBQA 4BH6A 5GSAA 3C9CA 4J87A 4CY3A 5JWZA 3MXXA 3BG1A 1GXRA 2J56H 4U1EI 2AH0A 2CE9A 1YFQA 5CYKB 5FKSA 3V7DB 3EWEA 3SN6B 4CZVA 4PSXB 5CXBB 4J0WA 3KRXB 2HKRA 5GXHA 2OJYA 2YB8B 2CE8A 3SWSD 4ES0A 4PC0A 4R7AB 1JJUB 4Y5RD 2QXVA 4GMBA 4NSXA 2P9NC 3OKYA 3CIKB 2B5MA 3EU7A 3F3FA 4ERQA 3DSMA 3GREA 4JSNC 1GG2B 4FA1D 3FM0A 4J78A 2YNPA 1JMXB 2I0SA 3SXTD 2IAAA 3ORVD 2H68A 4K3JB 2OK4A 2OVRB 4CC9A 1K8KC 4FAND 4A0AA 3C99A 3EI4B 2PM6B 5CXCB 3NVQA 4CY5A 3AL8B 3F3GA 4JSPC 5K19A 2YMUA 3C75H 3OL2A 3V9FA 3JROA 5IC7A 2HYEA 2Z2OA 1K32A 4MK0B 3I7OA 4E54A 2B5NA 3UVLA 4BL0A 2H14A 4GQ2P 3DXMC 4ESGA 3UVMA 5SXMA 1U2VC 3CFVA 4Y7RA 3L4MD 2BCJB 2H9MA 5EM2A 4A09A 3P4FA 4OZUA 3VH0A 3NVXA 5IJ8E 3SJLD 4QRJA 4A0BA 2Z2NA 4ERYA 2MTAH 3OW8A 2P9UC 4GM9A 3U4YA 4AOWA 2P9PC 4X60B 2OVPB 4CZXA 3IIWA 3PSCB 4H5IA 1TYQC 3AFCA 2Q7QA 4J77A 2CN3A 3JRPA 3IKOA 2HKMA 2H9NA 5CXBA 2XL3A 4A08A 5FQDA 2HJ4A 5EMKB 3DWLC 5A2Qg 5HE0B 4X3EA 3RSEC 4KFMB 5EMMB 5EARA 4FHLA 4CI1A 3PVWB 4I79A 5I5JA 5EMJB 2GNQA 4FB1D 3SVWD 3UKUC 5K1CC 3EI2A 5C2VB 1JMZB 3EI1A 4O9DA 3OKWA 4PBYA 5FKRA 4FA9D 4E5ZA 1N6EA 1OMWB 5FKTA 5GXIA 5FXYA 2CO0C 4GGAA 2AGWA 5GMKn 3SFZA 2Z2PA 2H6QA 3NVNA 3I8EA 4A2LA 1XIPA 2IURA 1XKSA 1OLZA 4IA9A 1B9XA 5I5IA 2XYIA 3EI4A 4QQEA 2PM9B 3JAMg 2I3SA 3AL8A 4CI2A 1B9YA 5B4WA 2IUVA 1R5MA 1JOFA 3ULEC 4J86A 3AL9A 3IJ1A 3F3PA 3JZGA 2J55H 4JT5C 2P9LC 3PXTD 3I89A 4JD2C 5H17A 4J81A 3ZWLB 3RRMC 4O1QD 3SBPA 3I7HA 5FKQA 3JZNA 4JSVC 5I5MA 2AGYA 2YNNA 1NEXB 5FA5B 3JB9L 3EI3A 2HESX 3OKYB 4UI9R 2I0TA 2P9IC 3MKSB 3RN0D 3UVNA 4ERZA 4FA4D 2GC7A 4ZOYA 2UZXB 4D0KA 3EMHA 2XU7A 5H14A 2H13A 4ZOVA 2YNOA 4L3HD 3I7NA 3OKTA 3I7KA 2IWFA 5EAMA 2GC4A 3EG6A 5HE3B 2AH1A 3MKQA 3I7PA 2B5LA 1GOTB 3DXKC 4L9OA 5EMLB 3UVOA 4GM3A 2H3XA 3UVKA 3KRWB 2W18A 1GP2B 3PXWD 4CI8A 1ERJA 2CO0A 4YVDA 3N0EA 4O3TB 3CFSB 4ZOXA 4FA5D 5AJAA 4TZ4A 3C5MA 5TEEA 4QL1A 4E54B 1SQJA 2J57G 4A7JA 2BBKH 5CYKA 4GQBB 1PI6A 3SHFA 4PXWA 2P9SC 2IUPA 2UZYB 2B4EA 4HDJA 2IUQA 4IMMA 3IJCA 4J8BA 3PVUB 4A09B 4A2MA 5HQGA 3VGZA 1PGUA 3SBRA 3SLED 5H1MA 1MDAH 4CY1A 3I7LA 2AGLA 4XEIC 4A0BB 1N6FA 4L3GD 2HXCA 2CN2A 2PM9A 4PSWB 3ODTA 2G99A 5TF2A 4A11B 5THAA 3PE7A 2AQ5A 3OTTA 2OIZA 1Q47A 2I0RA 3JZHA 5IT9g 2IWKA 3MZKA 2I3TA 4O45A 1S4UX 4FAVD 4GGCA 4JXMA
chains in the Genus database with same CATH superfamily
4GZ8A 5CXCA 4CZYA 4JSXC 2AGXA 4A08B 2G9AA 4G55A 4ZN4A 1U4CA 1UOOA 4L1QD 2QR5A 1H2ZA 4J0XA 1GOHA 4N14A 4QT8A 3SMRA 5HE2B 2VDOA 4Z8LA 2AGZA 5IGQA 1XHMA 2H6NA 3BWSA 3PSLA 5C2WB 4J8GA 4XYIA 3J81g 2EIBA 3K26A 3FGBA 3EI2B 1PEVA 3GD1I 5AFU3 3L4OD 3DDUA 3O4IA 2YBAA 3EI1B 4J79A 5KDOB 3IJ0A 1SQ9A 4E5ZB 4BUJC 5TEFA 4BP9A 1QNIA 4X61B 3PXSD 2H9PA 4NC4A 1L0QA 4XYHA 4CI3A 3J80g 2H9LA 3BG0A 3HFQA 4GGDA 1U8CA 3IIYA 4JT6C 2HJBA 5TDHB 3IJEA 3GFCA 1P22A 2TRCB 3UKRC 5EALA 3IUMA 5IGOA 3ZE1A 3SCYA 4WK0A 2P9KC 5IJ7E 3RFHA 2XL2A 1N6DA 2O9KA 4J84A 3I2NA 4LG9A 4LGNA 2H6KA 3I8CA 4D6VA 3AH8B 3KCIA 1MG3A 5HE1B 3JPXA 4GM8A 4Z7OA 4LG8A 4CY2A 4G56B 4MMZA 5C9ZB 1VYHC 3ZDZA 1SHYB 3MMYA 3N0DA 4PNKB 4QAMA 4A0AB 2PM7B 3VI3A 3RLMD 2OVQB 2XZGA 3W15A 3VA6A 4Z7NA 5E6SA 3UR4A 2OK6A 4EWRA 5HYNB 2EIEA 3K27A 3OL2B 1A0RB 4G1EA 1PBYB 1T2XA 2PBIB 3EI3B 5C86A 4AEZA 3ZE2A 4PBZA 1FWXA 3RFGA 4X63B 2QC5A 4ZOZA 5EAPA 3RMZD 1NR0A 3V5WB 3DM0A 2EBSA 1TBGA 2VDMA 1GOGA 3T3PA 4H5JA 3RN1D 5E6UA 3A0FA 3O4GA 4A11A 2CNXA 4WJKA 4O3UB 3E0CA 5FLXg 1MG2A 3FRXA 4J73A 2H47A 5EM2B 4GQ1A 1YR2A 4FWWA 3MZLA 3O4HA 4K3ID 1RI6A 1C9LA 4U7AA 4JHPC 4J82A 3IVMA 3B7FA 4OWRA 4AX4A 5AMSA 5M5UA 3SBQA 4BH6A 5GSAA 4DNWA 3C9CA 4J87A 4NBMA 4AMZA 4CY3A 5JWZA 3MXXA 4G1MA 4BCBA 3BG1A 3QI0A 1GXRA 2J56H 4U1EI 2AH0A 2CE9A 1YFQA 5CYKB 5FKSA 3V7DB 3EWEA 3SN6B 4CZVA 4Z7QA 4PSXB 5CXBB 4J0WA 3KRXB 2HKRA 5GXHA 2OJYA 2YB8B 2CE8A 3SWSD 3IURA 4ES0A 4PC0A 4R7AB 1JJUB 4Y5RD 4RE6A 5M5VA 2QXVA 4GMBA 4NSXA 2P9NC 3OKYA 3CIKB 2B5MA 3EU7A 3F3FA 2HU7A 3VI4A 4ERQA 3DSMA 1K3IA 3OF7A 3GREA 4JSNC 1GG2B 4FA1D 1BPOA 3FM0A 5M5TA 2EICA 4J78A 2YNPA 1JMXB 2I0SA 3SXTD 2IAAA 3ORVD 5M5SA 1VE6A 2VDRA 3ZDXA 3IUQA 2H68A 4K3JB 3MVDK 2OK4A 3O4JA 5E6RA 2OVRB 4CC9A 1K8KC 4FAND 4A0AA 3C99A 3EI4B 2PM6B 1UOPA 4RE5A 3NVQA 5CXCB 4L1MA 1O6FA 4CY5A 3AL8B 3F3GA 4JSPC 5K19A 2YMUA 3C75H 3OL2A 5FFGA 2BKLA 2EIDA 3V9FA 3JROA 5IC7A 2HYEA 2Z2OA 1K32A 3NIFA 4MK0B 3I7OA 4E54A 2B5NA 3UVLA 4BL0A 2H14A 4GQ2P 3DXMC 4ESGA 3UVMA 5SXMA 1U2VC 5C92A 3CFVA 4Y7RA 3L4MD 1M1XA 3NIGA 2BCJB 5M61A 2H9MA 3MUOA 4IRZA 5EM2A 4A09A 3P4FA 4OZUA 3VH0A 3NVXA 5IJ8E 4DNUA 3SJLD 4QRJA 4A0BA 2Z2NA 4ERYA 2MTAH 3OW8A 2P9UC 4GM9A 3U4YA 4AOWA 2P9PC 4X60B 3FCUA 2OVPB 1JV2A 4CZXA 3K71A 3IIWA 3PSCB 4H5IA 1TYQC 3AFCA 2Q7QA 4J77A 2CN3A 3JRPA 3IKOA 1E5TA 2HKMA 4AN0A 2H9NA 5CXBA 1A12A 2XL3A 4A08A 5FQDA 2HJ4A 5EMKB 3DWLC 5A2Qg 5HE0B 2XE4A 4X3EA 3RSEC 4KFMB 5EMMB 5EARA 4FHLA 4CI1A 3PVWB 3ZE0A 4I79A 5I5JA 5EMJB 2GNQA 4FB1D 3SVWD 3UKUC 5K1CC 4DNVA 3EI2A 5C2VB 1JMZB 2VDKA 3EI1A 2VDNA 4O9DA 3OKWA 4PBYA 5FKRA 4FA9D 3FCSA 4O02A 4E5ZA 1N6EA 2HU8A 1OMWB 5FKTA 5GXIA 1QFMA 5FXYA 2CO0C 4GGAA 2AGWA 4O2WA 5GMKn 3SFZA 2Z2PA 2H6QA 4UM9A 2XDWA 3MUNA 3NVNA 3I8EA 4A2LA 1XIPA 2IURA 1XKSA 1OLZA 4IA9A 1B9XA 5I5IA 2XYIA 3EI4A 4QQEA 2PM9B 3V4PA 4JHNA 3JAMg 2I3SA 3NIDA 3AL8A 1E8NA 3IUJA 4CI2A 1B9YA 5B4WA 2IUVA 2HU5A 1H2YA 1R5MA 1JOFA 2QZPA 4J86A 3ULEC 3AL9A 3IJ1A 3F3PA 3JZGA 2J55H 1H2XA 2WQ8A 4JT5C 3K6SA 2P9LC 3PXTD 3I89A 4JD2C 4WK4A 5H17A 4J81A 3ZWLB 1I2MB 5FFOA 1UTCA 3RRMC 4D9SA 4O1QD 3SBPA 3I7HA 2VDQA 1VZ3A 5FKQA 3JZNA 4JSVC 1GOFA 1VE7A 2AGYA 2YNNA 5I5MA 1NEXB 5FA5B 3JB9L 3EI3A 2HESX 3OKYB 4UI9R 2I0TA 2P9IC 1E8MA 1VZ2A 3MKSB 5M5RA 3RN0D 3UVNA 4ERZA 4MMYA 4FA4D 1UOQA 2GC7A 2VDLA 4ZOYA 4AMYA 2UZXB 4D0KA 3EMHA 2XU7A 5H14A 3GC3B 2H13A 4ZOVA 2YNOA 4L3HD 3I7NA 3OKTA 3I7KA 3QHYB 2IWFA 1TYEA 2JKXA 5EAMA 2GC4A 3EG6A 5HE3B 2AH1A 3MKQA 3I7PA 2B5LA 1GOTB 3K72A 3ZDYA 3DXKC 4L9OA 5EMLB 4BCDA 3UVOA 4GM3A 2H3XA 2VZ1A 3UVKA 3IUNA 4NAAA 3KRWB 2W18A 1GP2B 3PXWD 4CI8A 1ERJA 2CO0A 4YVDA 3N0EA 4O3TB 3CFSB 4ZOXA 4FA5D 1JTDB 5AJAA 2VZ3A 4TZ4A 3C5MA 3IULA 4MMXA 5TEEA 4QL1A 4E54B 1SQJA 2J57G 4A7JA 1L5GA 2BBKH 5CYKA 1C9IA 4GQBB 1PI6A 3SHFA 4PXWA 3EQ7A 2P9SC 3V4VA 2IUPA 2UZYB 2B4EA 4HDJA 4BCCA 4BP8A 2IUQA 4IMMA 3IJCA 4J8BA 3PVUB 2VDPA 4A09B 4A2MA 5HDBA 4WK2A 4NENA 5HQGA 3EQ8A 3VGZA 1PGUA 3SBRA 3SLED 1O6GA 5H1MA 1MDAH 4CY1A 3I7LA 2AGLA 4XEIC 4A0BB 1N6FA 4L3GD 2HXCA 2CN2A 2PM9A 4PSWB 3ODTA 2G99A 5TF2A 4A11B 3EQ9A 5THAA 3PE7A 2AQ5A 3OTTA 1H2WA 2OIZA 1Q47A 2I0RA 4AN1A 3JZHA 5IT9g 2IWKA 3MZKA 1QFSA 2I3TA 4O45A 1S4UX 4FAVD 3T3MA 4UM8A 2VC2A 4GGCA 4JXMA
chains in the Genus database with same CATH topology
4GZ8A 5CXCA 4CZYA 4JSXC 2AGXA 4A08B 2G9AA 4ZN4A 1U4CA 4L1QD 4N14A 4J0XA 4QT8A 3SMRA 5HE2B 4Z8LA 2AGZA 5IGQA 1XHMA 2H6NA 3BWSA 3PSLA 5C2WB 4J8GA 4XYIA 3J81g 3K26A 3FGBA 3EI2B 1PEVA 5AFU3 3L4OD 2YBAA 3EI1B 4J79A 5KDOB 3IJ0A 1SQ9A 4E5ZB 4BUJC 5TEFA 1QNIA 4X61B 3PXSD 2H9PA 4XYHA 1L0QA 4CI3A 3J80g 2H9LA 3BG0A 3HFQA 4GGDA 3IIYA 4JT6C 2HJBA 5TDHB 3GFCA 1P22A 2TRCB 3UKRC 5EALA 5IGOA 3SCYA 2P9KC 5IJ7E 3RFHA 2XL2A 1N6DA 2O9KA 4J84A 3I2NA 4LG9A 4LGNA 2H6KA 3I8CA 4D6VA 3AH8B 1MG3A 5HE1B 3JPXA 4GM8A 4LG8A 4CY2A 4G56B 5C9ZB 1VYHC 1SHYB 3MMYA 3N0DA 4PNKB 4A0AB 2PM7B 3RLMD 2OVQB 3W15A 3VA6A 3UR4A 2OK6A 4EWRA 5HYNB 3K27A 3OL2B 1A0RB 1PBYB 2PBIB 3EI3B 4AEZA 4PBZA 1FWXA 3RFGA 4X63B 2QC5A 4ZOZA 5EAPA 3RMZD 1NR0A 3V5WB 3DM0A 2EBSA 1TBGA 4H5JA 3RN1D 3A0FA 4A11A 2CNXA 4O3UB 3E0CA 5FLXg 1MG2A 3FRXA 4J73A 2H47A 5EM2B 4GQ1A 4FWWA 3MZLA 4K3ID 1RI6A 4U7AA 4J82A 3B7FA 4OWRA 5AMSA 3SBQA 4BH6A 5GSAA 3C9CA 4J87A 4CY3A 5JWZA 3MXXA 3BG1A 1GXRA 2J56H 4U1EI 2AH0A 2CE9A 1YFQA 5CYKB 5FKSA 3V7DB 3EWEA 3SN6B 4CZVA 4PSXB 5CXBB 4J0WA 3KRXB 2HKRA 5GXHA 2OJYA 2YB8B 2CE8A 3SWSD 4ES0A 4PC0A 4R7AB 1JJUB 4Y5RD 2QXVA 4GMBA 4NSXA 2P9NC 3OKYA 3CIKB 2B5MA 3EU7A 3F3FA 4ERQA 3DSMA 3GREA 4JSNC 1GG2B 4FA1D 3FM0A 4J78A 2YNPA 1JMXB 2I0SA 3SXTD 2IAAA 3ORVD 2H68A 4K3JB 2OK4A 2OVRB 4CC9A 1K8KC 4FAND 4A0AA 3C99A 3EI4B 2PM6B 5CXCB 3NVQA 4CY5A 3AL8B 3F3GA 4JSPC 5K19A 2YMUA 3C75H 3OL2A 3V9FA 3JROA 5IC7A 2HYEA 2Z2OA 1K32A 4MK0B 3I7OA 4E54A 2B5NA 3UVLA 4BL0A 2H14A 4GQ2P 3DXMC 4ESGA 3UVMA 5SXMA 1U2VC 3CFVA 4Y7RA 3L4MD 2BCJB 2H9MA 5EM2A 4A09A 3P4FA 4OZUA 3VH0A 3NVXA 5IJ8E 3SJLD 4QRJA 4A0BA 2Z2NA 4ERYA 2MTAH 3OW8A 2P9UC 4GM9A 3U4YA 4AOWA 2P9PC 4X60B 2OVPB 4CZXA 3IIWA 3PSCB 4H5IA 1TYQC 3AFCA 2Q7QA 4J77A 2CN3A 3JRPA 3IKOA 2HKMA 2H9NA 5CXBA 2XL3A 4A08A 5FQDA 2HJ4A 5EMKB 3DWLC 5A2Qg 5HE0B 4X3EA 3RSEC 4KFMB 5EMMB 5EARA 4FHLA 4CI1A 3PVWB 4I79A 5I5JA 5EMJB 2GNQA 4FB1D 3SVWD 3UKUC 5K1CC 3EI2A 5C2VB 1JMZB 3EI1A 4O9DA 3OKWA 4PBYA 5FKRA 4FA9D 4E5ZA 1N6EA 1OMWB 5FKTA 5GXIA 5FXYA 2CO0C 4GGAA 2AGWA 5GMKn 3SFZA 2Z2PA 2H6QA 3NVNA 3I8EA 4A2LA 1XIPA 2IURA 1XKSA 1OLZA 4IA9A 1B9XA 5I5IA 2XYIA 3EI4A 4QQEA 2PM9B 3JAMg 2I3SA 3AL8A 4CI2A 1B9YA 5B4WA 2IUVA 1R5MA 1JOFA 3ULEC 4J86A 3AL9A 3IJ1A 3F3PA 3JZGA 2J55H 4JT5C 2P9LC 3PXTD 3I89A 4JD2C 5H17A 4J81A 3ZWLB 3RRMC 4O1QD 3SBPA 3I7HA 5FKQA 3JZNA 4JSVC 5I5MA 2AGYA 2YNNA 1NEXB 5FA5B 3JB9L 3EI3A 2HESX 3OKYB 4UI9R 2I0TA 2P9IC 3MKSB 3RN0D 3UVNA 4ERZA 4FA4D 2GC7A 4ZOYA 2UZXB 4D0KA 3EMHA 2XU7A 5H14A 2H13A 4ZOVA 2YNOA 4L3HD 3I7NA 3OKTA 3I7KA 2IWFA 5EAMA 2GC4A 3EG6A 5HE3B 2AH1A 3MKQA 3I7PA 2B5LA 1GOTB 3DXKC 4L9OA 5EMLB 3UVOA 4GM3A 2H3XA 3UVKA 3KRWB 2W18A 1GP2B 3PXWD 4CI8A 1ERJA 2CO0A 4YVDA 3N0EA 4O3TB 3CFSB 4ZOXA 4FA5D 5AJAA 4TZ4A 3C5MA 5TEEA 4QL1A 4E54B 1SQJA 2J57G 4A7JA 2BBKH 5CYKA 4GQBB 1PI6A 3SHFA 4PXWA 2P9SC 2IUPA 2UZYB 2B4EA 4HDJA 2IUQA 4IMMA 3IJCA 4J8BA 3PVUB 4A09B 4A2MA 5HQGA 3VGZA 1PGUA 3SBRA 3SLED 5H1MA 1MDAH 4CY1A 3I7LA 2AGLA 4XEIC 4A0BB 1N6FA 4L3GD 2HXCA 2CN2A 2PM9A 4PSWB 3ODTA 2G99A 5TF2A 4A11B 5THAA 3PE7A 2AQ5A 3OTTA 2OIZA 1Q47A 2I0RA 3JZHA 5IT9g 2IWKA 3MZKA 2I3TA 4O45A 1S4UX 4FAVD 4GGCA 4JXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ8 A;  5CXC A;  4CZY A;  4JSX C;  2AGX A;  4A08 B;  2G9A A;  4ZN4 A;  1U4C A;  4L1Q D;  4N14 A;  4J0X A;  4QT8 A;  3SMR A;  5HE2 B;  4Z8L A;  2AGZ A;  5IGQ A;  1XHM A;  2H6N A;  3BWS A;  3PSL A;  5C2W B;  4J8G A;  4XYI A;  3J81 g;  3K26 A;  3FGB A;  3EI2 B;  1PEV A;  5AFU 3;  3L4O D;  2YBA A;  3EI1 B;  4J79 A;  5KDO B;  3IJ0 A;  1SQ9 A;  4E5Z B;  4BUJ C;  5TEF A;  1QNI A;  4X61 B;  3PXS D;  2H9P A;  4XYH A;  1L0Q A;  4CI3 A;  3J80 g;  2H9L A;  3BG0 A;  3HFQ A;  4GGD A;  3IIY A;  4JT6 C;  2HJB A;  5TDH B;  3GFC A;  1P22 A;  2TRC B;  3UKR C;  5EAL A;  5IGO A;  3SCY A;  2P9K C;  5IJ7 E;  3RFH A;  2XL2 A;  1N6D A;  2O9K A;  4J84 A;  3I2N A;  4LG9 A;  4LGN A;  2H6K A;  3I8C A;  4D6V A;  3AH8 B;  1MG3 A;  5HE1 B;  3JPX A;  4GM8 A;  4LG8 A;  4CY2 A;  4G56 B;  5C9Z B;  1VYH C;  1SHY B;  3MMY A;  3N0D A;  4PNK B;  4A0A B;  2PM7 B;  3RLM D;  2OVQ B;  3W15 A;  3VA6 A;  3UR4 A;  2OK6 A;  4EWR A;  5HYN B;  3K27 A;  3OL2 B;  1A0R B;  1PBY B;  2PBI B;  3EI3 B;  4AEZ A;  4PBZ A;  1FWX A;  3RFG A;  4X63 B;  2QC5 A;  4ZOZ A;  5EAP A;  3RMZ D;  1NR0 A;  3V5W B;  3DM0 A;  2EBS A;  1TBG A;  4H5J A;  3RN1 D;  3A0F A;  4A11 A;  2CNX A;  4O3U B;  3E0C A;  5FLX g;  1MG2 A;  3FRX A;  4J73 A;  2H47 A;  5EM2 B;  4GQ1 A;  4FWW A;  3MZL A;  4K3I D;  1RI6 A;  4U7A A;  4J82 A;  3B7F A;  4OWR A;  5AMS A;  3SBQ A;  4BH6 A;  5GSA A;  3C9C A;  4J87 A;  4CY3 A;  5JWZ A;  3MXX A;  3BG1 A;  1GXR A;  2J56 H;  4U1E I;  2AH0 A;  2CE9 A;  1YFQ A;  5CYK B;  5FKS A;  3V7D B;  3EWE A;  3SN6 B;  4CZV A;  4PSX B;  5CXB B;  4J0W A;  3KRX B;  2HKR A;  5GXH A;  2OJY A;  2YB8 B;  2CE8 A;  3SWS D;  4ES0 A;  4PC0 A;  4R7A B;  1JJU B;  4Y5R D;  2QXV A;  4GMB A;  4NSX A;  2P9N C;  3OKY A;  3CIK B;  2B5M A;  3EU7 A;  3F3F A;  4ERQ A;  3DSM A;  3GRE A;  4JSN C;  1GG2 B;  4FA1 D;  3FM0 A;  4J78 A;  2YNP A;  1JMX B;  2I0S A;  3SXT D;  2IAA A;  3ORV D;  2H68 A;  4K3J B;  2OK4 A;  2OVR B;  4CC9 A;  1K8K C;  4FAN D;  4A0A A;  3C99 A;  3EI4 B;  2PM6 B;  5CXC B;  3NVQ A;  4CY5 A;  3AL8 B;  3F3G A;  4JSP C;  5K19 A;  2YMU A;  3C75 H;  3OL2 A;  3V9F A;  3JRO A;  5IC7 A;  2HYE A;  2Z2O A;  1K32 A;  4MK0 B;  3I7O A;  4E54 A;  2B5N A;  3UVL A;  4BL0 A;  2H14 A;  4GQ2 P;  3DXM C;  4ESG A;  3UVM A;  5SXM A;  1U2V C;  3CFV A;  4Y7R A;  3L4M D;  2BCJ B;  2H9M A;  5EM2 A;  4A09 A;  3P4F A;  4OZU A;  3VH0 A;  3NVX A;  5IJ8 E;  3SJL D;  4QRJ A;  4A0B A;  2Z2N A;  4ERY A;  2MTA H;  3OW8 A;  2P9U C;  4GM9 A;  3U4Y A;  4AOW A;  2P9P C;  4X60 B;  2OVP B;  4CZX A;  3IIW A;  3PSC B;  4H5I A;  1TYQ C;  3AFC A;  2Q7Q A;  4J77 A;  2CN3 A;  3JRP A;  3IKO A;  2HKM A;  2H9N A;  5CXB A;  2XL3 A;  4A08 A;  5FQD A;  2HJ4 A;  5EMK B;  3DWL C;  5A2Q g;  5HE0 B;  4X3E A;  3RSE C;  4KFM B;  5EMM B;  5EAR A;  4FHL A;  4CI1 A;  3PVW B;  4I79 A;  5I5J A;  5EMJ B;  2GNQ A;  4FB1 D;  3SVW D;  3UKU C;  5K1C C;  3EI2 A;  5C2V B;  1JMZ B;  3EI1 A;  4O9D A;  3OKW A;  4PBY A;  5FKR A;  4FA9 D;  4E5Z A;  1N6E A;  1OMW B;  5FKT A;  5GXI A;  5FXY A;  2CO0 C;  4GGA A;  2AGW A;  5GMK n;  3SFZ A;  2Z2P A;  2H6Q A;  3NVN A;  3I8E A;  4A2L A;  1XIP A;  2IUR A;  1XKS A;  1OLZ A;  4IA9 A;  1B9X A;  5I5I A;  2XYI A;  3EI4 A;  4QQE A;  2PM9 B;  3JAM g;  2I3S A;  3AL8 A;  4CI2 A;  1B9Y A;  5B4W A;  2IUV A;  1R5M A;  1JOF A;  3ULE C;  4J86 A;  3AL9 A;  3IJ1 A;  3F3P A;  3JZG A;  2J55 H;  4JT5 C;  2P9L C;  3PXT D;  3I89 A;  4JD2 C;  5H17 A;  4J81 A;  3ZWL B;  3RRM C;  4O1Q D;  3SBP A;  3I7H A;  5FKQ A;  3JZN A;  4JSV C;  5I5M A;  2AGY A;  2YNN A;  1NEX B;  5FA5 B;  3JB9 L;  3EI3 A;  2HES X;  3OKY B;  4UI9 R;  2I0T A;  2P9I C;  3MKS B;  3RN0 D;  3UVN A;  4ERZ A;  4FA4 D;  2GC7 A;  4ZOY A;  2UZX B;  4D0K A;  3EMH A;  2XU7 A;  5H14 A;  2H13 A;  4ZOV A;  2YNO A;  4L3H D;  3I7N A;  3OKT A;  3I7K A;  2IWF A;  5EAM A;  2GC4 A;  3EG6 A;  5HE3 B;  2AH1 A;  3MKQ A;  3I7P A;  2B5L A;  1GOT B;  3DXK C;  4L9O A;  5EML B;  3UVO A;  4GM3 A;  2H3X A;  3UVK A;  3KRW B;  2W18 A;  1GP2 B;  3PXW D;  4CI8 A;  1ERJ A;  2CO0 A;  4YVD A;  3N0E A;  4O3T B;  3CFS B;  4ZOX A;  4FA5 D;  5AJA A;  4TZ4 A;  3C5M A;  5TEE A;  4QL1 A;  4E54 B;  1SQJ A;  2J57 G;  4A7J A;  2BBK H;  5CYK A;  4GQB B;  1PI6 A;  3SHF A;  4PXW A;  2P9S C;  2IUP A;  2UZY B;  2B4E A;  4HDJ A;  2IUQ A;  4IMM A;  3IJC A;  4J8B A;  3PVU B;  4A09 B;  4A2M A;  5HQG A;  3VGZ A;  1PGU A;  3SBR A;  3SLE D;  5H1M A;  1MDA H;  4CY1 A;  3I7L A;  2AGL A;  4XEI C;  4A0B B;  1N6F A;  4L3G D;  2HXC A;  2CN2 A;  2PM9 A;  4PSW B;  3ODT A;  2G99 A;  5TF2 A;  4A11 B;  5THA A;  3PE7 A;  2AQ5 A;  3OTT A;  2OIZ A;  1Q47 A;  2I0R A;  3JZH A;  5IT9 g;  2IWK A;  3MZK A;  2I3T A;  4O45 A;  1S4U X;  4FAV D;  4GGC A;  4JXM A; 
#chains in the Genus database with same CATH topology
 4GZ8 A;  5CXC A;  4CZY A;  4JSX C;  2AGX A;  4A08 B;  2G9A A;  4G55 A;  4ZN4 A;  1U4C A;  1UOO A;  4L1Q D;  2QR5 A;  1H2Z A;  4J0X A;  1GOH A;  4N14 A;  4QT8 A;  3SMR A;  5HE2 B;  2VDO A;  4Z8L A;  2AGZ A;  5IGQ A;  1XHM A;  2H6N A;  3BWS A;  3PSL A;  5C2W B;  4J8G A;  4XYI A;  3J81 g;  2EIB A;  3K26 A;  3FGB A;  3EI2 B;  1PEV A;  3GD1 I;  5AFU 3;  3L4O D;  3DDU A;  3O4I A;  2YBA A;  3EI1 B;  4J79 A;  5KDO B;  3IJ0 A;  1SQ9 A;  4E5Z B;  4BUJ C;  5TEF A;  4BP9 A;  1QNI A;  4X61 B;  3PXS D;  2H9P A;  4NC4 A;  1L0Q A;  4XYH A;  4CI3 A;  3J80 g;  2H9L A;  3BG0 A;  3HFQ A;  4GGD A;  1U8C A;  3IIY A;  4JT6 C;  2HJB A;  5TDH B;  3IJE A;  3GFC A;  1P22 A;  2TRC B;  3UKR C;  5EAL A;  3IUM A;  5IGO A;  3ZE1 A;  3SCY A;  4WK0 A;  2P9K C;  5IJ7 E;  3RFH A;  2XL2 A;  1N6D A;  2O9K A;  4J84 A;  3I2N A;  4LG9 A;  4LGN A;  2H6K A;  3I8C A;  4D6V A;  3AH8 B;  3KCI A;  1MG3 A;  5HE1 B;  3JPX A;  4GM8 A;  4Z7O A;  4LG8 A;  4CY2 A;  4G56 B;  4MMZ A;  5C9Z B;  1VYH C;  3ZDZ A;  1SHY B;  3MMY A;  3N0D A;  4PNK B;  4QAM A;  4A0A B;  2PM7 B;  3VI3 A;  3RLM D;  2OVQ B;  2XZG A;  3W15 A;  3VA6 A;  4Z7N A;  5E6S A;  3UR4 A;  2OK6 A;  4EWR A;  5HYN B;  2EIE A;  3K27 A;  3OL2 B;  1A0R B;  4G1E A;  1PBY B;  1T2X A;  2PBI B;  3EI3 B;  5C86 A;  4AEZ A;  3ZE2 A;  4PBZ A;  1FWX A;  3RFG A;  4X63 B;  2QC5 A;  4ZOZ A;  5EAP A;  3RMZ D;  1NR0 A;  3V5W B;  3DM0 A;  2EBS A;  1TBG A;  2VDM A;  1GOG A;  3T3P A;  4H5J A;  3RN1 D;  5E6U A;  3A0F A;  3O4G A;  4A11 A;  2CNX A;  4WJK A;  4O3U B;  3E0C A;  5FLX g;  1MG2 A;  3FRX A;  4J73 A;  2H47 A;  5EM2 B;  4GQ1 A;  1YR2 A;  4FWW A;  3MZL A;  3O4H A;  4K3I D;  1RI6 A;  1C9L A;  4U7A A;  4JHP C;  4J82 A;  3IVM A;  3B7F A;  4OWR A;  4AX4 A;  5AMS A;  5M5U A;  3SBQ A;  4BH6 A;  5GSA A;  4DNW A;  3C9C A;  4J87 A;  4NBM A;  4AMZ A;  4CY3 A;  5JWZ A;  3MXX A;  4G1M A;  4BCB A;  3BG1 A;  3QI0 A;  1GXR A;  2J56 H;  4U1E I;  2AH0 A;  2CE9 A;  1YFQ A;  5CYK B;  5FKS A;  3V7D B;  3EWE A;  3SN6 B;  4CZV A;  4Z7Q A;  4PSX B;  5CXB B;  4J0W A;  3KRX B;  2HKR A;  5GXH A;  2OJY A;  2YB8 B;  2CE8 A;  3SWS D;  3IUR A;  4ES0 A;  4PC0 A;  4R7A B;  1JJU B;  4Y5R D;  4RE6 A;  5M5V A;  2QXV A;  4GMB A;  4NSX A;  2P9N C;  3OKY A;  3CIK B;  2B5M A;  3EU7 A;  3F3F A;  2HU7 A;  3VI4 A;  4ERQ A;  3DSM A;  1K3I A;  3OF7 A;  3GRE A;  4JSN C;  1GG2 B;  4FA1 D;  1BPO A;  3FM0 A;  5M5T A;  2EIC A;  4J78 A;  2YNP A;  1JMX B;  2I0S A;  3SXT D;  2IAA A;  3ORV D;  5M5S A;  1VE6 A;  2VDR A;  3ZDX A;  3IUQ A;  2H68 A;  4K3J B;  3MVD K;  2OK4 A;  3O4J A;  5E6R A;  2OVR B;  4CC9 A;  1K8K C;  4FAN D;  4A0A A;  3C99 A;  3EI4 B;  2PM6 B;  1UOP A;  4RE5 A;  3NVQ A;  5CXC B;  4L1M A;  1O6F A;  4CY5 A;  3AL8 B;  3F3G A;  4JSP C;  5K19 A;  2YMU A;  3C75 H;  3OL2 A;  5FFG A;  2BKL A;  2EID A;  3V9F A;  3JRO A;  5IC7 A;  2HYE A;  2Z2O A;  1K32 A;  3NIF A;  4MK0 B;  3I7O A;  4E54 A;  2B5N A;  3UVL A;  4BL0 A;  2H14 A;  4GQ2 P;  3DXM C;  4ESG A;  3UVM A;  5SXM A;  1U2V C;  5C92 A;  3CFV A;  4Y7R A;  3L4M D;  1M1X A;  3NIG A;  2BCJ B;  5M61 A;  2H9M A;  3MUO A;  4IRZ A;  5EM2 A;  4A09 A;  3P4F A;  4OZU A;  3VH0 A;  3NVX A;  5IJ8 E;  4DNU A;  3SJL D;  4QRJ A;  4A0B A;  2Z2N A;  4ERY A;  2MTA H;  3OW8 A;  2P9U C;  4GM9 A;  3U4Y A;  4AOW A;  2P9P C;  4X60 B;  3FCU A;  2OVP B;  1JV2 A;  4CZX A;  3K71 A;  3IIW A;  3PSC B;  4H5I A;  1TYQ C;  3AFC A;  2Q7Q A;  4J77 A;  2CN3 A;  3JRP A;  3IKO A;  1E5T A;  2HKM A;  4AN0 A;  2H9N A;  5CXB A;  1A12 A;  2XL3 A;  4A08 A;  5FQD A;  2HJ4 A;  5EMK B;  3DWL C;  5A2Q g;  5HE0 B;  2XE4 A;  4X3E A;  3RSE C;  4KFM B;  5EMM B;  5EAR A;  4FHL A;  4CI1 A;  3PVW B;  3ZE0 A;  4I79 A;  5I5J A;  5EMJ B;  2GNQ A;  4FB1 D;  3SVW D;  3UKU C;  5K1C C;  4DNV A;  3EI2 A;  5C2V B;  1JMZ B;  2VDK A;  3EI1 A;  2VDN A;  4O9D A;  3OKW A;  4PBY A;  5FKR A;  4FA9 D;  3FCS A;  4O02 A;  4E5Z A;  1N6E A;  2HU8 A;  1OMW B;  5FKT A;  5GXI A;  1QFM A;  5FXY A;  2CO0 C;  4GGA A;  2AGW A;  4O2W A;  5GMK n;  3SFZ A;  2Z2P A;  2H6Q A;  4UM9 A;  2XDW A;  3MUN A;  3NVN A;  3I8E A;  4A2L A;  1XIP A;  2IUR A;  1XKS A;  1OLZ A;  4IA9 A;  1B9X A;  5I5I A;  2XYI A;  3EI4 A;  4QQE A;  2PM9 B;  3V4P A;  4JHN A;  3JAM g;  2I3S A;  3NID A;  3AL8 A;  1E8N A;  3IUJ A;  4CI2 A;  1B9Y A;  5B4W A;  2IUV A;  2HU5 A;  1H2Y A;  1R5M A;  1JOF A;  2QZP A;  4J86 A;  3ULE C;  3AL9 A;  3IJ1 A;  3F3P A;  3JZG A;  2J55 H;  1H2X A;  2WQ8 A;  4JT5 C;  3K6S A;  2P9L C;  3PXT D;  3I89 A;  4JD2 C;  4WK4 A;  5H17 A;  4J81 A;  3ZWL B;  1I2M B;  5FFO A;  1UTC A;  3RRM C;  4D9S A;  4O1Q D;  3SBP A;  3I7H A;  2VDQ A;  1VZ3 A;  5FKQ A;  3JZN A;  4JSV C;  1GOF A;  1VE7 A;  2AGY A;  2YNN A;  5I5M A;  1NEX B;  5FA5 B;  3JB9 L;  3EI3 A;  2HES X;  3OKY B;  4UI9 R;  2I0T A;  2P9I C;  1E8M A;  1VZ2 A;  3MKS B;  5M5R A;  3RN0 D;  3UVN A;  4ERZ A;  4MMY A;  4FA4 D;  1UOQ A;  2GC7 A;  2VDL A;  4ZOY A;  4AMY A;  2UZX B;  4D0K A;  3EMH A;  2XU7 A;  5H14 A;  3GC3 B;  2H13 A;  4ZOV A;  2YNO A;  4L3H D;  3I7N A;  3OKT A;  3I7K A;  3QHY B;  2IWF A;  1TYE A;  2JKX A;  5EAM A;  2GC4 A;  3EG6 A;  5HE3 B;  2AH1 A;  3MKQ A;  3I7P A;  2B5L A;  1GOT B;  3K72 A;  3ZDY A;  3DXK C;  4L9O A;  5EML B;  4BCD A;  3UVO A;  4GM3 A;  2H3X A;  2VZ1 A;  3UVK A;  3IUN A;  4NAA A;  3KRW B;  2W18 A;  1GP2 B;  3PXW D;  4CI8 A;  1ERJ A;  2CO0 A;  4YVD A;  3N0E A;  4O3T B;  3CFS B;  4ZOX A;  4FA5 D;  1JTD B;  5AJA A;  2VZ3 A;  4TZ4 A;  3C5M A;  3IUL A;  4MMX A;  5TEE A;  4QL1 A;  4E54 B;  1SQJ A;  2J57 G;  4A7J A;  1L5G A;  2BBK H;  5CYK A;  1C9I A;  4GQB B;  1PI6 A;  3SHF A;  4PXW A;  3EQ7 A;  2P9S C;  3V4V A;  2IUP A;  2UZY B;  2B4E A;  4HDJ A;  4BCC A;  4BP8 A;  2IUQ A;  4IMM A;  3IJC A;  4J8B A;  3PVU B;  2VDP A;  4A09 B;  4A2M A;  5HDB A;  4WK2 A;  4NEN A;  5HQG A;  3EQ8 A;  3VGZ A;  1PGU A;  3SBR A;  3SLE D;  1O6G A;  5H1M A;  1MDA H;  4CY1 A;  3I7L A;  2AGL A;  4XEI C;  4A0B B;  1N6F A;  4L3G D;  2HXC A;  2CN2 A;  2PM9 A;  4PSW B;  3ODT A;  2G99 A;  5TF2 A;  4A11 B;  3EQ9 A;  5THA A;  3PE7 A;  2AQ5 A;  3OTT A;  1H2W A;  2OIZ A;  1Q47 A;  2I0R A;  4AN1 A;  3JZH A;  5IT9 g;  2IWK A;  3MZK A;  1QFS A;  2I3T A;  4O45 A;  1S4U X;  4FAV D;  3T3M A;  4UM8 A;  2VC2 A;  4GGC A;  4JXM A; 
#chains in the Genus database with same CATH homology
 4GZ8 A;  5CXC A;  4CZY A;  4JSX C;  2AGX A;  4A08 B;  2G9A A;  4ZN4 A;  1U4C A;  4L1Q D;  4N14 A;  4J0X A;  4QT8 A;  3SMR A;  5HE2 B;  4Z8L A;  2AGZ A;  5IGQ A;  1XHM A;  2H6N A;  3BWS A;  3PSL A;  5C2W B;  4J8G A;  4XYI A;  3J81 g;  3K26 A;  3FGB A;  3EI2 B;  1PEV A;  5AFU 3;  3L4O D;  2YBA A;  3EI1 B;  4J79 A;  5KDO B;  3IJ0 A;  1SQ9 A;  4E5Z B;  4BUJ C;  5TEF A;  1QNI A;  4X61 B;  3PXS D;  2H9P A;  4XYH A;  1L0Q A;  4CI3 A;  3J80 g;  2H9L A;  3BG0 A;  3HFQ A;  4GGD A;  3IIY A;  4JT6 C;  2HJB A;  5TDH B;  3GFC A;  1P22 A;  2TRC B;  3UKR C;  5EAL A;  5IGO A;  3SCY A;  2P9K C;  5IJ7 E;  3RFH A;  2XL2 A;  1N6D A;  2O9K A;  4J84 A;  3I2N A;  4LG9 A;  4LGN A;  2H6K A;  3I8C A;  4D6V A;  3AH8 B;  1MG3 A;  5HE1 B;  3JPX A;  4GM8 A;  4LG8 A;  4CY2 A;  4G56 B;  5C9Z B;  1VYH C;  1SHY B;  3MMY A;  3N0D A;  4PNK B;  4A0A B;  2PM7 B;  3RLM D;  2OVQ B;  3W15 A;  3VA6 A;  3UR4 A;  2OK6 A;  4EWR A;  5HYN B;  3K27 A;  3OL2 B;  1A0R B;  1PBY B;  2PBI B;  3EI3 B;  4AEZ A;  4PBZ A;  1FWX A;  3RFG A;  4X63 B;  2QC5 A;  4ZOZ A;  5EAP A;  3RMZ D;  1NR0 A;  3V5W B;  3DM0 A;  2EBS A;  1TBG A;  4H5J A;  3RN1 D;  3A0F A;  4A11 A;  2CNX A;  4O3U B;  3E0C A;  5FLX g;  1MG2 A;  3FRX A;  4J73 A;  2H47 A;  5EM2 B;  4GQ1 A;  4FWW A;  3MZL A;  4K3I D;  1RI6 A;  4U7A A;  4J82 A;  3B7F A;  4OWR A;  5AMS A;  3SBQ A;  4BH6 A;  5GSA A;  3C9C A;  4J87 A;  4CY3 A;  5JWZ A;  3MXX A;  3BG1 A;  1GXR A;  2J56 H;  4U1E I;  2AH0 A;  2CE9 A;  1YFQ A;  5CYK B;  5FKS A;  3V7D B;  3EWE A;  3SN6 B;  4CZV A;  4PSX B;  5CXB B;  4J0W A;  3KRX B;  2HKR A;  5GXH A;  2OJY A;  2YB8 B;  2CE8 A;  3SWS D;  4ES0 A;  4PC0 A;  4R7A B;  1JJU B;  4Y5R D;  2QXV A;  4GMB A;  4NSX A;  2P9N C;  3OKY A;  3CIK B;  2B5M A;  3EU7 A;  3F3F A;  4ERQ A;  3DSM A;  3GRE A;  4JSN C;  1GG2 B;  4FA1 D;  3FM0 A;  4J78 A;  2YNP A;  1JMX B;  2I0S A;  3SXT D;  2IAA A;  3ORV D;  2H68 A;  4K3J B;  2OK4 A;  2OVR B;  4CC9 A;  1K8K C;  4FAN D;  4A0A A;  3C99 A;  3EI4 B;  2PM6 B;  5CXC B;  3NVQ A;  4CY5 A;  3AL8 B;  3F3G A;  4JSP C;  5K19 A;  2YMU A;  3C75 H;  3OL2 A;  3V9F A;  3JRO A;  5IC7 A;  2HYE A;  2Z2O A;  1K32 A;  4MK0 B;  3I7O A;  4E54 A;  2B5N A;  3UVL A;  4BL0 A;  2H14 A;  4GQ2 P;  3DXM C;  4ESG A;  3UVM A;  5SXM A;  1U2V C;  3CFV A;  4Y7R A;  3L4M D;  2BCJ B;  2H9M A;  5EM2 A;  4A09 A;  3P4F A;  4OZU A;  3VH0 A;  3NVX A;  5IJ8 E;  3SJL D;  4QRJ A;  4A0B A;  2Z2N A;  4ERY A;  2MTA H;  3OW8 A;  2P9U C;  4GM9 A;  3U4Y A;  4AOW A;  2P9P C;  4X60 B;  2OVP B;  4CZX A;  3IIW A;  3PSC B;  4H5I A;  1TYQ C;  3AFC A;  2Q7Q A;  4J77 A;  2CN3 A;  3JRP A;  3IKO A;  2HKM A;  2H9N A;  5CXB A;  2XL3 A;  4A08 A;  5FQD A;  2HJ4 A;  5EMK B;  3DWL C;  5A2Q g;  5HE0 B;  4X3E A;  3RSE C;  4KFM B;  5EMM B;  5EAR A;  4FHL A;  4CI1 A;  3PVW B;  4I79 A;  5I5J A;  5EMJ B;  2GNQ A;  4FB1 D;  3SVW D;  3UKU C;  5K1C C;  3EI2 A;  5C2V B;  1JMZ B;  3EI1 A;  4O9D A;  3OKW A;  4PBY A;  5FKR A;  4FA9 D;  4E5Z A;  1N6E A;  1OMW B;  5FKT A;  5GXI A;  5FXY A;  2CO0 C;  4GGA A;  2AGW A;  5GMK n;  3SFZ A;  2Z2P A;  2H6Q A;  3NVN A;  3I8E A;  4A2L A;  1XIP A;  2IUR A;  1XKS A;  1OLZ A;  4IA9 A;  1B9X A;  5I5I A;  2XYI A;  3EI4 A;  4QQE A;  2PM9 B;  3JAM g;  2I3S A;  3AL8 A;  4CI2 A;  1B9Y A;  5B4W A;  2IUV A;  1R5M A;  1JOF A;  3ULE C;  4J86 A;  3AL9 A;  3IJ1 A;  3F3P A;  3JZG A;  2J55 H;  4JT5 C;  2P9L C;  3PXT D;  3I89 A;  4JD2 C;  5H17 A;  4J81 A;  3ZWL B;  3RRM C;  4O1Q D;  3SBP A;  3I7H A;  5FKQ A;  3JZN A;  4JSV C;  5I5M A;  2AGY A;  2YNN A;  1NEX B;  5FA5 B;  3JB9 L;  3EI3 A;  2HES X;  3OKY B;  4UI9 R;  2I0T A;  2P9I C;  3MKS B;  3RN0 D;  3UVN A;  4ERZ A;  4FA4 D;  2GC7 A;  4ZOY A;  2UZX B;  4D0K A;  3EMH A;  2XU7 A;  5H14 A;  2H13 A;  4ZOV A;  2YNO A;  4L3H D;  3I7N A;  3OKT A;  3I7K A;  2IWF A;  5EAM A;  2GC4 A;  3EG6 A;  5HE3 B;  2AH1 A;  3MKQ A;  3I7P A;  2B5L A;  1GOT B;  3DXK C;  4L9O A;  5EML B;  3UVO A;  4GM3 A;  2H3X A;  3UVK A;  3KRW B;  2W18 A;  1GP2 B;  3PXW D;  4CI8 A;  1ERJ A;  2CO0 A;  4YVD A;  3N0E A;  4O3T B;  3CFS B;  4ZOX A;  4FA5 D;  5AJA A;  4TZ4 A;  3C5M A;  5TEE A;  4QL1 A;  4E54 B;  1SQJ A;  2J57 G;  4A7J A;  2BBK H;  5CYK A;  4GQB B;  1PI6 A;  3SHF A;  4PXW A;  2P9S C;  2IUP A;  2UZY B;  2B4E A;  4HDJ A;  2IUQ A;  4IMM A;  3IJC A;  4J8B A;  3PVU B;  4A09 B;  4A2M A;  5HQG A;  3VGZ A;  1PGU A;  3SBR A;  3SLE D;  5H1M A;  1MDA H;  4CY1 A;  3I7L A;  2AGL A;  4XEI C;  4A0B B;  1N6F A;  4L3G D;  2HXC A;  2CN2 A;  2PM9 A;  4PSW B;  3ODT A;  2G99 A;  5TF2 A;  4A11 B;  5THA A;  3PE7 A;  2AQ5 A;  3OTT A;  2OIZ A;  1Q47 A;  2I0R A;  3JZH A;  5IT9 g;  2IWK A;  3MZK A;  2I3T A;  4O45 A;  1S4U X;  4FAV D;  4GGC A;  4JXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...