2YB8B

Crystal structure of nurf55 in complex with su(z)12
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
399
structure length
375
Chain Sequence
VEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords POLYCOMB PROTEIN SU(Z)12
total genus 99
structure length 375
sequence length 399
ec nomenclature
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2yb8B00
4N14A 4CC9A 4GM8A 4TZ4A 2GC7A 4A11A 3SXTD 1JOFA 5CYKA 3DXKC 1RI6A 3SFZA 3UR4A 2YNOA 4K3JB 3I7KA 5EMKB 3E0CA 3RRMC 2AH0A 1XHMA 3I2NA 2AGZA 5IGQA 4NSXA 3PVWB 3N0DA 2PM7B 3RMZD 4CZXA 3OKYB 5EM2A 3PSCB 4FWWA 3F3PA 3NVNA 2B5LA 4GGCA 5K1CC 3V7DB 5H17A 5TF2A 3V5WB 4GQ2P 2XU7A 4CI8A 2H6QA 5HQGA 4JSVC 5EMLB 3SBRA 5FXYA 2CE8A 4J82A 1TBGA 3EI1B 4GMBA 5CXCB 2IWFA 4BH6A 3EWEA 4Y5RD 1OMWB 4GZ8A 2OVQB 3FGBA 4GM3A 3SMRA 4A08A 4PBYA 3MMYA 4FA9D 3PSLA 3RFHA 4FAND 5I5JA 1OLZA 3J81g 5TEFA 4LG8A 4D6VA 5HE0B 5K19A 2QC5A 3FRXA 4D0KA 2CO0A 4CZYA 2IURA 3B7FA 3KRXB 4HDJA 5FA5B 5CYKB 3AL8A 4JSNC 4CY3A 3MZLA 1XKSA 2PM6B 3IIYA 1Q47A 4E54B 3OKWA 4MK0B 3DM0A 5H14A 4Z8LA 1PBYB 2G99A 4J8BA 4FA5D 1GG2B 3OL2A 3UVNA 1QNIA 1P22A 2H9PA 5FKSA 3EI3A 2P9NC 3DWLC 4UI9R 4CZVA 3MXXA 4QL1A 3P4FA 3SVWD 1JMXB 2YMUA 3OKTA 4XYHA 2OK6A 2AQ5A 2YNPA 4GGAA 2I3SA 5B4WA 4U7AA 5HE1B 4ERQA 2HYEA 2AGLA 3DXMC 2Z2NA 2HKMA 4JXMA 1MDAH 1JMZB 4OWRA 2CN2A 2H14A 4E5ZB 1GXRA 4JT5C 4XEIC 1GOTB 3VGZA 2YBAA 3VA6A 3RN1D 1TYQC 4JT6C 2BCJB 2PM9B 3BG1A 2UZXB 4J0WA 4J84A 4GGDA 4G56B 3MZKA 4JD2C 4KFMB 5CXCA 1SQ9A 4J81A 3OW8A 2UZYB 3JZHA 4A0BB 1PEVA 3UVMA 3UKRC 4R7AB 3UVLA 3GREA 3IJCA 5IGOA 4JSXC 2AGXA 4H5JA 1B9YA 5JWZA 2HESX 4K3ID 2GNQA 4BUJC 1MG3A 3U4YA 2J56H 2CNXA 5I5IA 3EI2A 4O9DA 4U1EI 4FHLA 2I0RA 4ZOYA 4ERZA 3C5MA 3IIWA 2OIZA 3AL8B 5AMSA 5GXIA 2HXCA 4PSWB 3AFCA 3EG6A 4O45A 4J78A 3OKYA 4X63B 3IKOA 4I79A 5CXBB 2B5MA 2H9MA 3EI4B 2OVPB 3UKUC 4J77A 1S4UX 2BBKH 3I7NA 4JSPC 3UVOA 5H1MA 1JJUB 3I8CA 3MKSB 2H6NA 2HJBA 4X60B 1SQJA 4GQBB 2YNNA 1B9XA 4A09A 5EAMA 3OTTA 3NVQA 4LG9A 2P9PC 2P9LC 4OZUA 5FQDA 4CY2A 4J79A 4A2MA 5I5MA 4L9OA 5EM2B 4ERYA 1XIPA 5GMKn 2P9UC 4ZOZA 2I0TA 3PVUB 2XL3A 4A0AA 5AJAA 4A11B 4PXWA 3K26A 4PNKB 3I7HA 4GM9A 3PXWD 2G9AA 2OVRB 2B4EA 5A2Qg 3DSMA 5FKQA 3MKQA 4X3EA 1A0RB 5HE3B 3I8EA 3W15A 5HE2B 4ZOVA 5TDHB 2PBIB 2J57G 2HJ4A 1K32A 2I3TA 1N6EA 2P9KC 3KRWB 3EU7A 5EAPA 1U2VC 2GC4A 4J87A 2P9IC 2H9LA 3CFSB 3FM0A 3I7LA 3SWSD 4J8GA 2IUQA 5EARA 4J73A 4CI2A 2J55H 5GSAA 3RSEC 5CXBA 4O3UB 4CI3A 3NVXA 3UVKA 2IWKA 4ESGA 4O1QD 3K27A 1R5MA 3JAMg 4QQEA 5FKRA 4FA4D 1PI6A 4E5ZA 4A7JA 2Z2OA 3VH0A 5C9ZB 4L3GD 3PE7A 2CO0C 5FLXg 2P9SC 3BWSA 4YVDA 3PXSD 2CE9A 3SBPA 5C2VB 3SHFA 4CI1A 2I0SA 4X61B 4EWRA 4A09B 5IT9g 2O9KA 2Z2PA 3JPXA 3EI3B 4IMMA 4A08B 2H6KA 1FWXA 2PM9A 3A0FA 1NEXB 5THAA 2Q7QA 3SBQA 3EI1A 3C99A 1U4CA 2IUPA 3SJLD 4A0AB 3HFQA 4A2LA 4LGNA 4FA1D 2XL2A 5IJ8E 3ORVD 4AEZA 1K8KC 1YFQA 3V9FA 4BL0A 4J86A 5TEEA 3ODTA 2CN3A 3BG0A 3IJ1A 4PC0A 3OL2B 2AH1A 4ZOXA 4QRJA 4H5IA 4IA9A 4A0BA 2XYIA 2QXVA 3L4MD 5HYNB 1SHYB 3ULEC 3SN6B 2IUVA 3RLMD 5EMJB 1N6FA 5C2WB 1NR0A 2H3XA 3RFGA 4PBZA 4ES0A 4E54A 2OK4A 3F3GA 3EI4A 3JZNA 3F3FA 4XYIA 4FAVD 3I89A 3L4OD 3JZGA 3EMHA 2H13A 3ZWLB 3SLED 4ZN4A 1L0QA 4QT8A 2AGWA 1PGUA 5FKTA 3CFVA 4AOWA 4CY1A 2OJYA 3IJ0A 2H9NA 1GP2B 2H68A 4FB1D 5GXHA 2AGYA 3JROA 3I7OA 4L1QD 4L3HD 3GFCA 2MTAH 5EALA 4CY5A 1MG2A 2IAAA 5EMMB 3C9CA 3JB9L 5AFU3 5IJ7E 1ERJA 3RN0D 4PSXB 2HKRA 5SXMA 2B5NA 1VYHC 1N6DA 3N0EA 4Y7RA 3EI2B 3AH8B 3I7PA 2H47A 4GQ1A 5KDOB 2YB8B 4J0XA 3SCYA 2TRCB 3CIKB 4O3TB 2W18A 3PXTD 5IC7A 3J80g 3JRPA 3AL9A 2EBSA 3C75H
chains in the Genus database with same CATH superfamily
4N14A 4CC9A 5M61A 4GM8A 1UTCA 4NAAA 4TZ4A 5M5VA 2GC7A 4A11A 3SXTD 1JOFA 5CYKA 3DXKC 1RI6A 1C9IA 3FCSA 3SFZA 1H2YA 3UR4A 2YNOA 4BCCA 4JHPC 1UOOA 4K3JB 3I7KA 5M5RA 1K3IA 5C86A 5FFOA 5EMKB 3E0CA 3ZDZA 3RRMC 2AH0A 1XHMA 3I2NA 2AGZA 5IGQA 4NSXA 3PVWB 3DDUA 5E6RA 3N0DA 2JKXA 1T2XA 1YR2A 2PM7B 3RMZD 4CZXA 3OKYB 5EM2A 3PSCB 4FWWA 3F3PA 3NVNA 2B5LA 4GGCA 2EICA 5K1CC 3V7DB 3VI4A 5H17A 5TF2A 2VC2A 3V5WB 4GQ2P 4MMYA 2XU7A 2VDPA 4CI8A 4BP9A 2VZ1A 2H6QA 1L5GA 5HQGA 4JSVC 5EMLB 3SBRA 5FXYA 2CE8A 4J82A 1TBGA 4Z7OA 3EI1B 4GMBA 3K72A 5CXCB 3O4JA 2IWFA 4BH6A 3EWEA 4Y5RD 1OMWB 3T3PA 4GZ8A 2OVQB 3FGBA 4GM3A 3IVMA 3SMRA 4A08A 4PBYA 3MMYA 4FA9D 3EQ8A 3PSLA 3RFHA 4FAND 1VZ2A 5I5JA 1OLZA 3T3MA 4Z7QA 3J81g 5TEFA 4LG8A 4D6VA 5M5SA 5HE0B 5K19A 2QC5A 3FRXA 1H2WA 4D0KA 2CO0A 4CZYA 2IURA 3B7FA 3KRXB 4HDJA 5FA5B 1UOQA 5CYKB 3AL8A 4JSNC 3O4IA 4IRZA 4O02A 4CY3A 3MZLA 1XKSA 2PM6B 3FCUA 2BKLA 3IIYA 1Q47A 4E54B 3OKWA 3IUJA 4MK0B 3DM0A 2QR5A 2EIDA 5H14A 2VDLA 4BP8A 4Z8LA 1PBYB 2G99A 4J8BA 4FA5D 1GG2B 1GOFA 1O6FA 3OL2A 3UVNA 1QNIA 1P22A 2H9PA 5FKSA 4AN0A 3EI3A 2P9NC 3DWLC 4UI9R 4CZVA 4AX4A 4WK4A 3MXXA 4QL1A 3P4FA 1VE7A 3SVWD 1JMXB 2YMUA 3OKTA 4XYHA 2OK6A 2AQ5A 2YNPA 4GGAA 2I3SA 2XE4A 5B4WA 4MMXA 4U7AA 5HE1B 4AN1A 4ERQA 2HYEA 2AGLA 3DXMC 4NC4A 2Z2NA 2HKMA 4JXMA 1MDAH 1JMZB 4OWRA 2CN2A 3IUNA 2H14A 4E5ZB 1GXRA 4JT5C 4XEIC 1GOTB 3VGZA 2YBAA 4L1MA 3VA6A 3RN1D 1TYQC 4JT6C 3MVDK 2BCJB 2PM9B 1O6GA 2UZXB 3BG1A 4G55A 4J0WA 4J84A 4GGDA 4G56B 3MZKA 4JD2C 4KFMB 5CXCA 1SQ9A 4J81A 3OW8A 2UZYB 2XDWA 3JZHA 4A0BB 1PEVA 4MMZA 3UVMA 3UKRC 4R7AB 3UVLA 3GREA 3IJCA 5IGOA 4JSXC 2AGXA 4H5JA 1B9YA 5JWZA 2HESX 4WK2A 4K3ID 2GNQA 4BUJC 1E5TA 2VDOA 1MG3A 3U4YA 3V4VA 2J56H 2CNXA 1GOHA 5I5IA 3EI2A 4O9DA 4U1EI 4FHLA 2I0RA 2EIBA 3V4PA 4ZOYA 3NIGA 4ERZA 3EQ9A 3C5MA 3IIWA 2OIZA 1JTDB 3AL8B 5AMSA 4D9SA 5GXIA 2HXCA 4PSWB 3AFCA 3K6SA 3EG6A 3QHYB 4O45A 4J78A 3OKYA 4X63B 3ZE1A 3IKOA 4I79A 5CXBB 2B5MA 2WQ8A 2H9MA 5HDBA 3EI4B 2OVPB 3O4HA 3UKUC 1S4UX 4J77A 3ZDYA 2BBKH 3I7NA 3IUMA 4JSPC 3UVOA 4DNVA 5H1MA 1JJUB 3MKSB 3I8CA 2H6NA 2HJBA 3KCIA 4X60B 1SQJA 2VDQA 4GQBB 4BCBA 2YNNA 1GOGA 1M1XA 1B9XA 2XZGA 4A09A 5EAMA 3OTTA 3ZE2A 3ZDXA 3NVQA 4LG9A 2P9PC 2P9LC 4OZUA 5FQDA 4CY2A 4J79A 4A2MA 4Z7NA 5I5MA 3MUOA 2HU7A 4L9OA 4ERYA 1XIPA 5EM2B 5GMKn 2P9UC 4ZOZA 2I0TA 3PVUB 2XL3A 4A0AA 5AJAA 4A11B 4BCDA 4PXWA 3K26A 4PNKB 3I7HA 4UM9A 4GM9A 3J80g 3IJEA 3PXWD 2G9AA 2OVRB 2B4EA 3IURA 3DSMA 5FKQA 5A2Qg 1QFSA 3MKQA 4X3EA 1A0RB 5HE3B 3I8EA 3W15A 5HE2B 1U8CA 4ZOVA 5TDHB 2PBIB 2J57G 1UOPA 2HJ4A 1K32A 2HU8A 1BPOA 1C9LA 2I3TA 1N6EA 2P9KC 3KRWB 2EIEA 3EU7A 5EAPA 1U2VC 2GC4A 4J87A 5E6SA 1VE6A 2P9IC 2H9LA 3CFSB 3FM0A 3I7LA 3SWSD 4J8GA 3IUQA 2IUQA 5EARA 4J73A 4CI2A 2J55H 3EQ7A 2VDMA 5GSAA 3RSEC 5CXBA 4O3UB 4CI3A 4DNUA 1TYEA 3NVXA 3UVKA 4RE6A 2IWKA 4ESGA 4JHNA 4WK0A 4O1QD 3K27A 1R5MA 3JAMg 4QQEA 5FKRA 3VI3A 1PI6A 4FA4D 4E5ZA 4A7JA 2Z2OA 3VH0A 5C9ZB 4L3GD 3PE7A 2CO0C 5FLXg 1A12A 2P9SC 3BWSA 4YVDA 3PXSD 2CE9A 3SBPA 5C2VB 4G1MA 3SHFA 4CI1A 2I0SA 4X61B 4EWRA 4A09B 5IT9g 3GC3B 2O9KA 2Z2PA 3JPXA 3EI3B 4IMMA 4A08B 2H6KA 1QFMA 1FWXA 2PM9A 3A0FA 1JV2A 1NEXB 5THAA 4RE5A 5C92A 2Q7QA 3SBQA 3O4GA 3EI1A 3C99A 1U4CA 2VDRA 2IUPA 4NENA 3SJLD 4A0AB 3HFQA 4A2LA 4LGNA 4FA1D 3K71A 5FFGA 2XL2A 5IJ8E 3ORVD 4AEZA 1K8KC 1YFQA 3NIDA 3V9FA 4BL0A 4J86A 5TEEA 5E6UA 3ODTA 2CN3A 2VDNA 3NIFA 3BG0A 1H2ZA 3IJ1A 4PC0A 4DNWA 3OL2B 2AH1A 4ZOXA 4QRJA 4AMZA 4H5IA 4IA9A 4A0BA 2XYIA 2QXVA 3L4MD 5HYNB 1SHYB 3ULEC 1E8MA 3SN6B 2IUVA 3RLMD 5EMJB 1N6FA 5C2WB 1NR0A 2H3XA 3RFGA 4PBZA 4ES0A 4E54A 2OK4A 1I2MB 3F3GA 3EI4A 3JZNA 5M5TA 3F3FA 4XYIA 4FAVD 3I89A 3L4OD 3JZGA 3EMHA 5M5UA 3ZE0A 2H13A 3ZWLB 3SLED 4ZN4A 1L0QA 4QT8A 2AGWA 1PGUA 5FKTA 3CFVA 3OF7A 3QI0A 4AOWA 4CY1A 2OJYA 3IJ0A 2VDKA 1H2XA 2H9NA 1GP2B 4O2WA 2H68A 4FB1D 5GXHA 4QAMA 2AGYA 3JROA 3I7OA 4L1QD 4L3HD 2HU5A 2MTAH 3GFCA 5EALA 4CY5A 1MG2A 2IAAA 5EMMB 2QZPA 3C9CA 3JB9L 5AFU3 5IJ7E 1ERJA 3RN0D 4PSXB 2HKRA 5SXMA 2B5NA 1VYHC 1N6DA 3GD1I 3N0EA 4Y7RA 3EI2B 3AH8B 3I7PA 2H47A 3IULA 4NBMA 4GQ1A 1VZ3A 4G1EA 5KDOB 1E8NA 4WJKA 2YB8B 4J0XA 3SCYA 2TRCB 4UM8A 2VZ3A 3CIKB 3PXTD 2W18A 3MUNA 4O3TB 5IC7A 4AMYA 3JRPA 3AL9A 2EBSA 3C75H
chains in the Genus database with same CATH topology
4N14A 4CC9A 4GM8A 4TZ4A 2GC7A 4A11A 3SXTD 1JOFA 5CYKA 3DXKC 1RI6A 3SFZA 3UR4A 2YNOA 4K3JB 3I7KA 5EMKB 3E0CA 3RRMC 2AH0A 1XHMA 3I2NA 2AGZA 5IGQA 4NSXA 3PVWB 3N0DA 2PM7B 3RMZD 4CZXA 3OKYB 5EM2A 3PSCB 4FWWA 3F3PA 3NVNA 2B5LA 4GGCA 5K1CC 3V7DB 5H17A 5TF2A 3V5WB 4GQ2P 2XU7A 4CI8A 2H6QA 5HQGA 4JSVC 5EMLB 3SBRA 5FXYA 2CE8A 4J82A 1TBGA 3EI1B 4GMBA 5CXCB 2IWFA 4BH6A 3EWEA 4Y5RD 1OMWB 4GZ8A 2OVQB 3FGBA 4GM3A 3SMRA 4A08A 4PBYA 3MMYA 4FA9D 3PSLA 3RFHA 4FAND 5I5JA 1OLZA 3J81g 5TEFA 4LG8A 4D6VA 5HE0B 5K19A 2QC5A 3FRXA 4D0KA 2CO0A 4CZYA 2IURA 3B7FA 3KRXB 4HDJA 5FA5B 5CYKB 3AL8A 4JSNC 4CY3A 3MZLA 1XKSA 2PM6B 3IIYA 1Q47A 4E54B 3OKWA 4MK0B 3DM0A 5H14A 4Z8LA 1PBYB 2G99A 4J8BA 4FA5D 1GG2B 3OL2A 3UVNA 1QNIA 1P22A 2H9PA 5FKSA 3EI3A 2P9NC 3DWLC 4UI9R 4CZVA 3MXXA 4QL1A 3P4FA 3SVWD 1JMXB 2YMUA 3OKTA 4XYHA 2OK6A 2AQ5A 2YNPA 4GGAA 2I3SA 5B4WA 4U7AA 5HE1B 4ERQA 2HYEA 2AGLA 3DXMC 2Z2NA 2HKMA 4JXMA 1MDAH 1JMZB 4OWRA 2CN2A 2H14A 4E5ZB 1GXRA 4JT5C 4XEIC 1GOTB 3VGZA 2YBAA 3VA6A 3RN1D 1TYQC 4JT6C 2BCJB 2PM9B 3BG1A 2UZXB 4J0WA 4J84A 4GGDA 4G56B 3MZKA 4JD2C 4KFMB 5CXCA 1SQ9A 4J81A 3OW8A 2UZYB 3JZHA 4A0BB 1PEVA 3UVMA 3UKRC 4R7AB 3UVLA 3GREA 3IJCA 5IGOA 4JSXC 2AGXA 4H5JA 1B9YA 5JWZA 2HESX 4K3ID 2GNQA 4BUJC 1MG3A 3U4YA 2J56H 2CNXA 5I5IA 3EI2A 4O9DA 4U1EI 4FHLA 2I0RA 4ZOYA 4ERZA 3C5MA 3IIWA 2OIZA 3AL8B 5AMSA 5GXIA 2HXCA 4PSWB 3AFCA 3EG6A 4O45A 4J78A 3OKYA 4X63B 3IKOA 4I79A 5CXBB 2B5MA 2H9MA 3EI4B 2OVPB 3UKUC 4J77A 1S4UX 2BBKH 3I7NA 4JSPC 3UVOA 5H1MA 1JJUB 3I8CA 3MKSB 2H6NA 2HJBA 4X60B 1SQJA 4GQBB 2YNNA 1B9XA 4A09A 5EAMA 3OTTA 3NVQA 4LG9A 2P9PC 2P9LC 4OZUA 5FQDA 4CY2A 4J79A 4A2MA 5I5MA 4L9OA 5EM2B 4ERYA 1XIPA 5GMKn 2P9UC 4ZOZA 2I0TA 3PVUB 2XL3A 4A0AA 5AJAA 4A11B 4PXWA 3K26A 4PNKB 3I7HA 4GM9A 3PXWD 2G9AA 2OVRB 2B4EA 5A2Qg 3DSMA 5FKQA 3MKQA 4X3EA 1A0RB 5HE3B 3I8EA 3W15A 5HE2B 4ZOVA 5TDHB 2PBIB 2J57G 2HJ4A 1K32A 2I3TA 1N6EA 2P9KC 3KRWB 3EU7A 5EAPA 1U2VC 2GC4A 4J87A 2P9IC 2H9LA 3CFSB 3FM0A 3I7LA 3SWSD 4J8GA 2IUQA 5EARA 4J73A 4CI2A 2J55H 5GSAA 3RSEC 5CXBA 4O3UB 4CI3A 3NVXA 3UVKA 2IWKA 4ESGA 4O1QD 3K27A 1R5MA 3JAMg 4QQEA 5FKRA 4FA4D 1PI6A 4E5ZA 4A7JA 2Z2OA 3VH0A 5C9ZB 4L3GD 3PE7A 2CO0C 5FLXg 2P9SC 3BWSA 4YVDA 3PXSD 2CE9A 3SBPA 5C2VB 3SHFA 4CI1A 2I0SA 4X61B 4EWRA 4A09B 5IT9g 2O9KA 2Z2PA 3JPXA 3EI3B 4IMMA 4A08B 2H6KA 1FWXA 2PM9A 3A0FA 1NEXB 5THAA 2Q7QA 3SBQA 3EI1A 3C99A 1U4CA 2IUPA 3SJLD 4A0AB 3HFQA 4A2LA 4LGNA 4FA1D 2XL2A 5IJ8E 3ORVD 4AEZA 1K8KC 1YFQA 3V9FA 4BL0A 4J86A 5TEEA 3ODTA 2CN3A 3BG0A 3IJ1A 4PC0A 3OL2B 2AH1A 4ZOXA 4QRJA 4H5IA 4IA9A 4A0BA 2XYIA 2QXVA 3L4MD 5HYNB 1SHYB 3ULEC 3SN6B 2IUVA 3RLMD 5EMJB 1N6FA 5C2WB 1NR0A 2H3XA 3RFGA 4PBZA 4ES0A 4E54A 2OK4A 3F3GA 3EI4A 3JZNA 3F3FA 4XYIA 4FAVD 3I89A 3L4OD 3JZGA 3EMHA 2H13A 3ZWLB 3SLED 4ZN4A 1L0QA 4QT8A 2AGWA 1PGUA 5FKTA 3CFVA 4AOWA 4CY1A 2OJYA 3IJ0A 2H9NA 1GP2B 2H68A 4FB1D 5GXHA 2AGYA 3JROA 3I7OA 4L1QD 4L3HD 3GFCA 2MTAH 5EALA 4CY5A 1MG2A 2IAAA 5EMMB 3C9CA 3JB9L 5AFU3 5IJ7E 1ERJA 3RN0D 4PSXB 2HKRA 5SXMA 2B5NA 1VYHC 1N6DA 3N0EA 4Y7RA 3EI2B 3AH8B 3I7PA 2H47A 4GQ1A 5KDOB 2YB8B 4J0XA 3SCYA 2TRCB 3CIKB 4O3TB 2W18A 3PXTD 5IC7A 3J80g 3JRPA 3AL9A 2EBSA 3C75H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N14 A;  4CC9 A;  4GM8 A;  4TZ4 A;  2GC7 A;  4A11 A;  3SXT D;  1JOF A;  5CYK A;  3DXK C;  1RI6 A;  3SFZ A;  3UR4 A;  2YNO A;  4K3J B;  3I7K A;  5EMK B;  3E0C A;  3RRM C;  2AH0 A;  1XHM A;  3I2N A;  2AGZ A;  5IGQ A;  4NSX A;  3PVW B;  3N0D A;  2PM7 B;  3RMZ D;  4CZX A;  3OKY B;  5EM2 A;  3PSC B;  4FWW A;  3F3P A;  3NVN A;  2B5L A;  4GGC A;  5K1C C;  3V7D B;  5H17 A;  5TF2 A;  3V5W B;  4GQ2 P;  2XU7 A;  4CI8 A;  2H6Q A;  5HQG A;  4JSV C;  5EML B;  3SBR A;  5FXY A;  2CE8 A;  4J82 A;  1TBG A;  3EI1 B;  4GMB A;  5CXC B;  2IWF A;  4BH6 A;  3EWE A;  4Y5R D;  1OMW B;  4GZ8 A;  2OVQ B;  3FGB A;  4GM3 A;  3SMR A;  4A08 A;  4PBY A;  3MMY A;  4FA9 D;  3PSL A;  3RFH A;  4FAN D;  5I5J A;  1OLZ A;  3J81 g;  5TEF A;  4LG8 A;  4D6V A;  5HE0 B;  5K19 A;  2QC5 A;  3FRX A;  4D0K A;  2CO0 A;  4CZY A;  2IUR A;  3B7F A;  3KRX B;  4HDJ A;  5FA5 B;  5CYK B;  3AL8 A;  4JSN C;  4CY3 A;  3MZL A;  1XKS A;  2PM6 B;  3IIY A;  1Q47 A;  4E54 B;  3OKW A;  4MK0 B;  3DM0 A;  5H14 A;  4Z8L A;  1PBY B;  2G99 A;  4J8B A;  4FA5 D;  1GG2 B;  3OL2 A;  3UVN A;  1QNI A;  1P22 A;  2H9P A;  5FKS A;  3EI3 A;  2P9N C;  3DWL C;  4UI9 R;  4CZV A;  3MXX A;  4QL1 A;  3P4F A;  3SVW D;  1JMX B;  2YMU A;  3OKT A;  4XYH A;  2OK6 A;  2AQ5 A;  2YNP A;  4GGA A;  2I3S A;  5B4W A;  4U7A A;  5HE1 B;  4ERQ A;  2HYE A;  2AGL A;  3DXM C;  2Z2N A;  2HKM A;  4JXM A;  1MDA H;  1JMZ B;  4OWR A;  2CN2 A;  2H14 A;  4E5Z B;  1GXR A;  4JT5 C;  4XEI C;  1GOT B;  3VGZ A;  2YBA A;  3VA6 A;  3RN1 D;  1TYQ C;  4JT6 C;  2BCJ B;  2PM9 B;  3BG1 A;  2UZX B;  4J0W A;  4J84 A;  4GGD A;  4G56 B;  3MZK A;  4JD2 C;  4KFM B;  5CXC A;  1SQ9 A;  4J81 A;  3OW8 A;  2UZY B;  3JZH A;  4A0B B;  1PEV A;  3UVM A;  3UKR C;  4R7A B;  3UVL A;  3GRE A;  3IJC A;  5IGO A;  4JSX C;  2AGX A;  4H5J A;  1B9Y A;  5JWZ A;  2HES X;  4K3I D;  2GNQ A;  4BUJ C;  1MG3 A;  3U4Y A;  2J56 H;  2CNX A;  5I5I A;  3EI2 A;  4O9D A;  4U1E I;  4FHL A;  2I0R A;  4ZOY A;  4ERZ A;  3C5M A;  3IIW A;  2OIZ A;  3AL8 B;  5AMS A;  5GXI A;  2HXC A;  4PSW B;  3AFC A;  3EG6 A;  4O45 A;  4J78 A;  3OKY A;  4X63 B;  3IKO A;  4I79 A;  5CXB B;  2B5M A;  2H9M A;  3EI4 B;  2OVP B;  3UKU C;  4J77 A;  1S4U X;  2BBK H;  3I7N A;  4JSP C;  3UVO A;  5H1M A;  1JJU B;  3I8C A;  3MKS B;  2H6N A;  2HJB A;  4X60 B;  1SQJ A;  4GQB B;  2YNN A;  1B9X A;  4A09 A;  5EAM A;  3OTT A;  3NVQ A;  4LG9 A;  2P9P C;  2P9L C;  4OZU A;  5FQD A;  4CY2 A;  4J79 A;  4A2M A;  5I5M A;  4L9O A;  5EM2 B;  4ERY A;  1XIP A;  5GMK n;  2P9U C;  4ZOZ A;  2I0T A;  3PVU B;  2XL3 A;  4A0A A;  5AJA A;  4A11 B;  4PXW A;  3K26 A;  4PNK B;  3I7H A;  4GM9 A;  3PXW D;  2G9A A;  2OVR B;  2B4E A;  5A2Q g;  3DSM A;  5FKQ A;  3MKQ A;  4X3E A;  1A0R B;  5HE3 B;  3I8E A;  3W15 A;  5HE2 B;  4ZOV A;  5TDH B;  2PBI B;  2J57 G;  2HJ4 A;  1K32 A;  2I3T A;  1N6E A;  2P9K C;  3KRW B;  3EU7 A;  5EAP A;  1U2V C;  2GC4 A;  4J87 A;  2P9I C;  2H9L A;  3CFS B;  3FM0 A;  3I7L A;  3SWS D;  4J8G A;  2IUQ A;  5EAR A;  4J73 A;  4CI2 A;  2J55 H;  5GSA A;  3RSE C;  5CXB A;  4O3U B;  4CI3 A;  3NVX A;  3UVK A;  2IWK A;  4ESG A;  4O1Q D;  3K27 A;  1R5M A;  3JAM g;  4QQE A;  5FKR A;  4FA4 D;  1PI6 A;  4E5Z A;  4A7J A;  2Z2O A;  3VH0 A;  5C9Z B;  4L3G D;  3PE7 A;  2CO0 C;  5FLX g;  2P9S C;  3BWS A;  4YVD A;  3PXS D;  2CE9 A;  3SBP A;  5C2V B;  3SHF A;  4CI1 A;  2I0S A;  4X61 B;  4EWR A;  4A09 B;  5IT9 g;  2O9K A;  2Z2P A;  3JPX A;  3EI3 B;  4IMM A;  4A08 B;  2H6K A;  1FWX A;  2PM9 A;  3A0F A;  1NEX B;  5THA A;  2Q7Q A;  3SBQ A;  3EI1 A;  3C99 A;  1U4C A;  2IUP A;  3SJL D;  4A0A B;  3HFQ A;  4A2L A;  4LGN A;  4FA1 D;  2XL2 A;  5IJ8 E;  3ORV D;  4AEZ A;  1K8K C;  1YFQ A;  3V9F A;  4BL0 A;  4J86 A;  5TEE A;  3ODT A;  2CN3 A;  3BG0 A;  3IJ1 A;  4PC0 A;  3OL2 B;  2AH1 A;  4ZOX A;  4QRJ A;  4H5I A;  4IA9 A;  4A0B A;  2XYI A;  2QXV A;  3L4M D;  5HYN B;  1SHY B;  3ULE C;  3SN6 B;  2IUV A;  3RLM D;  5EMJ B;  1N6F A;  5C2W B;  1NR0 A;  2H3X A;  3RFG A;  4PBZ A;  4ES0 A;  4E54 A;  2OK4 A;  3F3G A;  3EI4 A;  3JZN A;  3F3F A;  4XYI A;  4FAV D;  3I89 A;  3L4O D;  3JZG A;  3EMH A;  2H13 A;  3ZWL B;  3SLE D;  4ZN4 A;  1L0Q A;  4QT8 A;  2AGW A;  1PGU A;  5FKT A;  3CFV A;  4AOW A;  4CY1 A;  2OJY A;  3IJ0 A;  2H9N A;  1GP2 B;  2H68 A;  4FB1 D;  5GXH A;  2AGY A;  3JRO A;  3I7O A;  4L1Q D;  4L3H D;  3GFC A;  2MTA H;  5EAL A;  4CY5 A;  1MG2 A;  2IAA A;  5EMM B;  3C9C A;  3JB9 L;  5AFU 3;  5IJ7 E;  1ERJ A;  3RN0 D;  4PSX B;  2HKR A;  5SXM A;  2B5N A;  1VYH C;  1N6D A;  3N0E A;  4Y7R A;  3EI2 B;  3AH8 B;  3I7P A;  2H47 A;  4GQ1 A;  5KDO B;  2YB8 B;  4J0X A;  3SCY A;  2TRC B;  3CIK B;  4O3T B;  2W18 A;  3PXT D;  5IC7 A;  3J80 g;  3JRP A;  3AL9 A;  2EBS A;  3C75 H; 
#chains in the Genus database with same CATH topology
 4N14 A;  4CC9 A;  5M61 A;  4GM8 A;  1UTC A;  4NAA A;  4TZ4 A;  5M5V A;  2GC7 A;  4A11 A;  3SXT D;  1JOF A;  5CYK A;  3DXK C;  1RI6 A;  1C9I A;  3FCS A;  3SFZ A;  1H2Y A;  3UR4 A;  2YNO A;  4BCC A;  4JHP C;  1UOO A;  4K3J B;  3I7K A;  5M5R A;  1K3I A;  5C86 A;  5FFO A;  5EMK B;  3E0C A;  3ZDZ A;  3RRM C;  2AH0 A;  1XHM A;  3I2N A;  2AGZ A;  5IGQ A;  4NSX A;  3PVW B;  3DDU A;  5E6R A;  3N0D A;  2JKX A;  1T2X A;  1YR2 A;  2PM7 B;  3RMZ D;  4CZX A;  3OKY B;  5EM2 A;  3PSC B;  4FWW A;  3F3P A;  3NVN A;  2B5L A;  4GGC A;  2EIC A;  5K1C C;  3V7D B;  3VI4 A;  5H17 A;  5TF2 A;  2VC2 A;  3V5W B;  4GQ2 P;  4MMY A;  2XU7 A;  2VDP A;  4CI8 A;  4BP9 A;  2VZ1 A;  2H6Q A;  1L5G A;  5HQG A;  4JSV C;  5EML B;  3SBR A;  5FXY A;  2CE8 A;  4J82 A;  1TBG A;  4Z7O A;  3EI1 B;  4GMB A;  3K72 A;  5CXC B;  3O4J A;  2IWF A;  4BH6 A;  3EWE A;  4Y5R D;  1OMW B;  3T3P A;  4GZ8 A;  2OVQ B;  3FGB A;  4GM3 A;  3IVM A;  3SMR A;  4A08 A;  4PBY A;  3MMY A;  4FA9 D;  3EQ8 A;  3PSL A;  3RFH A;  4FAN D;  1VZ2 A;  5I5J A;  1OLZ A;  3T3M A;  4Z7Q A;  3J81 g;  5TEF A;  4LG8 A;  4D6V A;  5M5S A;  5HE0 B;  5K19 A;  2QC5 A;  3FRX A;  1H2W A;  4D0K A;  2CO0 A;  4CZY A;  2IUR A;  3B7F A;  3KRX B;  4HDJ A;  5FA5 B;  1UOQ A;  5CYK B;  3AL8 A;  4JSN C;  3O4I A;  4IRZ A;  4O02 A;  4CY3 A;  3MZL A;  1XKS A;  2PM6 B;  3FCU A;  2BKL A;  3IIY A;  1Q47 A;  4E54 B;  3OKW A;  3IUJ A;  4MK0 B;  3DM0 A;  2QR5 A;  2EID A;  5H14 A;  2VDL A;  4BP8 A;  4Z8L A;  1PBY B;  2G99 A;  4J8B A;  4FA5 D;  1GG2 B;  1GOF A;  1O6F A;  3OL2 A;  3UVN A;  1QNI A;  1P22 A;  2H9P A;  5FKS A;  4AN0 A;  3EI3 A;  2P9N C;  3DWL C;  4UI9 R;  4CZV A;  4AX4 A;  4WK4 A;  3MXX A;  4QL1 A;  3P4F A;  1VE7 A;  3SVW D;  1JMX B;  2YMU A;  3OKT A;  4XYH A;  2OK6 A;  2AQ5 A;  2YNP A;  4GGA A;  2I3S A;  2XE4 A;  5B4W A;  4MMX A;  4U7A A;  5HE1 B;  4AN1 A;  4ERQ A;  2HYE A;  2AGL A;  3DXM C;  4NC4 A;  2Z2N A;  2HKM A;  4JXM A;  1MDA H;  1JMZ B;  4OWR A;  2CN2 A;  3IUN A;  2H14 A;  4E5Z B;  1GXR A;  4JT5 C;  4XEI C;  1GOT B;  3VGZ A;  2YBA A;  4L1M A;  3VA6 A;  3RN1 D;  1TYQ C;  4JT6 C;  3MVD K;  2BCJ B;  2PM9 B;  1O6G A;  2UZX B;  3BG1 A;  4G55 A;  4J0W A;  4J84 A;  4GGD A;  4G56 B;  3MZK A;  4JD2 C;  4KFM B;  5CXC A;  1SQ9 A;  4J81 A;  3OW8 A;  2UZY B;  2XDW A;  3JZH A;  4A0B B;  1PEV A;  4MMZ A;  3UVM A;  3UKR C;  4R7A B;  3UVL A;  3GRE A;  3IJC A;  5IGO A;  4JSX C;  2AGX A;  4H5J A;  1B9Y A;  5JWZ A;  2HES X;  4WK2 A;  4K3I D;  2GNQ A;  4BUJ C;  1E5T A;  2VDO A;  1MG3 A;  3U4Y A;  3V4V A;  2J56 H;  2CNX A;  1GOH A;  5I5I A;  3EI2 A;  4O9D A;  4U1E I;  4FHL A;  2I0R A;  2EIB A;  3V4P A;  4ZOY A;  3NIG A;  4ERZ A;  3EQ9 A;  3C5M A;  3IIW A;  2OIZ A;  1JTD B;  3AL8 B;  5AMS A;  4D9S A;  5GXI A;  2HXC A;  4PSW B;  3AFC A;  3K6S A;  3EG6 A;  3QHY B;  4O45 A;  4J78 A;  3OKY A;  4X63 B;  3ZE1 A;  3IKO A;  4I79 A;  5CXB B;  2B5M A;  2WQ8 A;  2H9M A;  5HDB A;  3EI4 B;  2OVP B;  3O4H A;  3UKU C;  1S4U X;  4J77 A;  3ZDY A;  2BBK H;  3I7N A;  3IUM A;  4JSP C;  3UVO A;  4DNV A;  5H1M A;  1JJU B;  3MKS B;  3I8C A;  2H6N A;  2HJB A;  3KCI A;  4X60 B;  1SQJ A;  2VDQ A;  4GQB B;  4BCB A;  2YNN A;  1GOG A;  1M1X A;  1B9X A;  2XZG A;  4A09 A;  5EAM A;  3OTT A;  3ZE2 A;  3ZDX A;  3NVQ A;  4LG9 A;  2P9P C;  2P9L C;  4OZU A;  5FQD A;  4CY2 A;  4J79 A;  4A2M A;  4Z7N A;  5I5M A;  3MUO A;  2HU7 A;  4L9O A;  4ERY A;  1XIP A;  5EM2 B;  5GMK n;  2P9U C;  4ZOZ A;  2I0T A;  3PVU B;  2XL3 A;  4A0A A;  5AJA A;  4A11 B;  4BCD A;  4PXW A;  3K26 A;  4PNK B;  3I7H A;  4UM9 A;  4GM9 A;  3J80 g;  3IJE A;  3PXW D;  2G9A A;  2OVR B;  2B4E A;  3IUR A;  3DSM A;  5FKQ A;  5A2Q g;  1QFS A;  3MKQ A;  4X3E A;  1A0R B;  5HE3 B;  3I8E A;  3W15 A;  5HE2 B;  1U8C A;  4ZOV A;  5TDH B;  2PBI B;  2J57 G;  1UOP A;  2HJ4 A;  1K32 A;  2HU8 A;  1BPO A;  1C9L A;  2I3T A;  1N6E A;  2P9K C;  3KRW B;  2EIE A;  3EU7 A;  5EAP A;  1U2V C;  2GC4 A;  4J87 A;  5E6S A;  1VE6 A;  2P9I C;  2H9L A;  3CFS B;  3FM0 A;  3I7L A;  3SWS D;  4J8G A;  3IUQ A;  2IUQ A;  5EAR A;  4J73 A;  4CI2 A;  2J55 H;  3EQ7 A;  2VDM A;  5GSA A;  3RSE C;  5CXB A;  4O3U B;  4CI3 A;  4DNU A;  1TYE A;  3NVX A;  3UVK A;  4RE6 A;  2IWK A;  4ESG A;  4JHN A;  4WK0 A;  4O1Q D;  3K27 A;  1R5M A;  3JAM g;  4QQE A;  5FKR A;  3VI3 A;  1PI6 A;  4FA4 D;  4E5Z A;  4A7J A;  2Z2O A;  3VH0 A;  5C9Z B;  4L3G D;  3PE7 A;  2CO0 C;  5FLX g;  1A12 A;  2P9S C;  3BWS A;  4YVD A;  3PXS D;  2CE9 A;  3SBP A;  5C2V B;  4G1M A;  3SHF A;  4CI1 A;  2I0S A;  4X61 B;  4EWR A;  4A09 B;  5IT9 g;  3GC3 B;  2O9K A;  2Z2P A;  3JPX A;  3EI3 B;  4IMM A;  4A08 B;  2H6K A;  1QFM A;  1FWX A;  2PM9 A;  3A0F A;  1JV2 A;  1NEX B;  5THA A;  4RE5 A;  5C92 A;  2Q7Q A;  3SBQ A;  3O4G A;  3EI1 A;  3C99 A;  1U4C A;  2VDR A;  2IUP A;  4NEN A;  3SJL D;  4A0A B;  3HFQ A;  4A2L A;  4LGN A;  4FA1 D;  3K71 A;  5FFG A;  2XL2 A;  5IJ8 E;  3ORV D;  4AEZ A;  1K8K C;  1YFQ A;  3NID A;  3V9F A;  4BL0 A;  4J86 A;  5TEE A;  5E6U A;  3ODT A;  2CN3 A;  2VDN A;  3NIF A;  3BG0 A;  1H2Z A;  3IJ1 A;  4PC0 A;  4DNW A;  3OL2 B;  2AH1 A;  4ZOX A;  4QRJ A;  4AMZ A;  4H5I A;  4IA9 A;  4A0B A;  2XYI A;  2QXV A;  3L4M D;  5HYN B;  1SHY B;  3ULE C;  1E8M A;  3SN6 B;  2IUV A;  3RLM D;  5EMJ B;  1N6F A;  5C2W B;  1NR0 A;  2H3X A;  3RFG A;  4PBZ A;  4ES0 A;  4E54 A;  2OK4 A;  1I2M B;  3F3G A;  3EI4 A;  3JZN A;  5M5T A;  3F3F A;  4XYI A;  4FAV D;  3I89 A;  3L4O D;  3JZG A;  3EMH A;  5M5U A;  3ZE0 A;  2H13 A;  3ZWL B;  3SLE D;  4ZN4 A;  1L0Q A;  4QT8 A;  2AGW A;  1PGU A;  5FKT A;  3CFV A;  3OF7 A;  3QI0 A;  4AOW A;  4CY1 A;  2OJY A;  3IJ0 A;  2VDK A;  1H2X A;  2H9N A;  1GP2 B;  4O2W A;  2H68 A;  4FB1 D;  5GXH A;  4QAM A;  2AGY A;  3JRO A;  3I7O A;  4L1Q D;  4L3H D;  2HU5 A;  2MTA H;  3GFC A;  5EAL A;  4CY5 A;  1MG2 A;  2IAA A;  5EMM B;  2QZP A;  3C9C A;  3JB9 L;  5AFU 3;  5IJ7 E;  1ERJ A;  3RN0 D;  4PSX B;  2HKR A;  5SXM A;  2B5N A;  1VYH C;  1N6D A;  3GD1 I;  3N0E A;  4Y7R A;  3EI2 B;  3AH8 B;  3I7P A;  2H47 A;  3IUL A;  4NBM A;  4GQ1 A;  1VZ3 A;  4G1E A;  5KDO B;  1E8N A;  4WJK A;  2YB8 B;  4J0X A;  3SCY A;  2TRC B;  4UM8 A;  2VZ3 A;  3CIK B;  3PXT D;  2W18 A;  3MUN A;  4O3T B;  5IC7 A;  4AMY A;  3JRP A;  3AL9 A;  2EBS A;  3C75 H; 
#chains in the Genus database with same CATH homology
 4N14 A;  4CC9 A;  4GM8 A;  4TZ4 A;  2GC7 A;  4A11 A;  3SXT D;  1JOF A;  5CYK A;  3DXK C;  1RI6 A;  3SFZ A;  3UR4 A;  2YNO A;  4K3J B;  3I7K A;  5EMK B;  3E0C A;  3RRM C;  2AH0 A;  1XHM A;  3I2N A;  2AGZ A;  5IGQ A;  4NSX A;  3PVW B;  3N0D A;  2PM7 B;  3RMZ D;  4CZX A;  3OKY B;  5EM2 A;  3PSC B;  4FWW A;  3F3P A;  3NVN A;  2B5L A;  4GGC A;  5K1C C;  3V7D B;  5H17 A;  5TF2 A;  3V5W B;  4GQ2 P;  2XU7 A;  4CI8 A;  2H6Q A;  5HQG A;  4JSV C;  5EML B;  3SBR A;  5FXY A;  2CE8 A;  4J82 A;  1TBG A;  3EI1 B;  4GMB A;  5CXC B;  2IWF A;  4BH6 A;  3EWE A;  4Y5R D;  1OMW B;  4GZ8 A;  2OVQ B;  3FGB A;  4GM3 A;  3SMR A;  4A08 A;  4PBY A;  3MMY A;  4FA9 D;  3PSL A;  3RFH A;  4FAN D;  5I5J A;  1OLZ A;  3J81 g;  5TEF A;  4LG8 A;  4D6V A;  5HE0 B;  5K19 A;  2QC5 A;  3FRX A;  4D0K A;  2CO0 A;  4CZY A;  2IUR A;  3B7F A;  3KRX B;  4HDJ A;  5FA5 B;  5CYK B;  3AL8 A;  4JSN C;  4CY3 A;  3MZL A;  1XKS A;  2PM6 B;  3IIY A;  1Q47 A;  4E54 B;  3OKW A;  4MK0 B;  3DM0 A;  5H14 A;  4Z8L A;  1PBY B;  2G99 A;  4J8B A;  4FA5 D;  1GG2 B;  3OL2 A;  3UVN A;  1QNI A;  1P22 A;  2H9P A;  5FKS A;  3EI3 A;  2P9N C;  3DWL C;  4UI9 R;  4CZV A;  3MXX A;  4QL1 A;  3P4F A;  3SVW D;  1JMX B;  2YMU A;  3OKT A;  4XYH A;  2OK6 A;  2AQ5 A;  2YNP A;  4GGA A;  2I3S A;  5B4W A;  4U7A A;  5HE1 B;  4ERQ A;  2HYE A;  2AGL A;  3DXM C;  2Z2N A;  2HKM A;  4JXM A;  1MDA H;  1JMZ B;  4OWR A;  2CN2 A;  2H14 A;  4E5Z B;  1GXR A;  4JT5 C;  4XEI C;  1GOT B;  3VGZ A;  2YBA A;  3VA6 A;  3RN1 D;  1TYQ C;  4JT6 C;  2BCJ B;  2PM9 B;  3BG1 A;  2UZX B;  4J0W A;  4J84 A;  4GGD A;  4G56 B;  3MZK A;  4JD2 C;  4KFM B;  5CXC A;  1SQ9 A;  4J81 A;  3OW8 A;  2UZY B;  3JZH A;  4A0B B;  1PEV A;  3UVM A;  3UKR C;  4R7A B;  3UVL A;  3GRE A;  3IJC A;  5IGO A;  4JSX C;  2AGX A;  4H5J A;  1B9Y A;  5JWZ A;  2HES X;  4K3I D;  2GNQ A;  4BUJ C;  1MG3 A;  3U4Y A;  2J56 H;  2CNX A;  5I5I A;  3EI2 A;  4O9D A;  4U1E I;  4FHL A;  2I0R A;  4ZOY A;  4ERZ A;  3C5M A;  3IIW A;  2OIZ A;  3AL8 B;  5AMS A;  5GXI A;  2HXC A;  4PSW B;  3AFC A;  3EG6 A;  4O45 A;  4J78 A;  3OKY A;  4X63 B;  3IKO A;  4I79 A;  5CXB B;  2B5M A;  2H9M A;  3EI4 B;  2OVP B;  3UKU C;  4J77 A;  1S4U X;  2BBK H;  3I7N A;  4JSP C;  3UVO A;  5H1M A;  1JJU B;  3I8C A;  3MKS B;  2H6N A;  2HJB A;  4X60 B;  1SQJ A;  4GQB B;  2YNN A;  1B9X A;  4A09 A;  5EAM A;  3OTT A;  3NVQ A;  4LG9 A;  2P9P C;  2P9L C;  4OZU A;  5FQD A;  4CY2 A;  4J79 A;  4A2M A;  5I5M A;  4L9O A;  5EM2 B;  4ERY A;  1XIP A;  5GMK n;  2P9U C;  4ZOZ A;  2I0T A;  3PVU B;  2XL3 A;  4A0A A;  5AJA A;  4A11 B;  4PXW A;  3K26 A;  4PNK B;  3I7H A;  4GM9 A;  3PXW D;  2G9A A;  2OVR B;  2B4E A;  5A2Q g;  3DSM A;  5FKQ A;  3MKQ A;  4X3E A;  1A0R B;  5HE3 B;  3I8E A;  3W15 A;  5HE2 B;  4ZOV A;  5TDH B;  2PBI B;  2J57 G;  2HJ4 A;  1K32 A;  2I3T A;  1N6E A;  2P9K C;  3KRW B;  3EU7 A;  5EAP A;  1U2V C;  2GC4 A;  4J87 A;  2P9I C;  2H9L A;  3CFS B;  3FM0 A;  3I7L A;  3SWS D;  4J8G A;  2IUQ A;  5EAR A;  4J73 A;  4CI2 A;  2J55 H;  5GSA A;  3RSE C;  5CXB A;  4O3U B;  4CI3 A;  3NVX A;  3UVK A;  2IWK A;  4ESG A;  4O1Q D;  3K27 A;  1R5M A;  3JAM g;  4QQE A;  5FKR A;  4FA4 D;  1PI6 A;  4E5Z A;  4A7J A;  2Z2O A;  3VH0 A;  5C9Z B;  4L3G D;  3PE7 A;  2CO0 C;  5FLX g;  2P9S C;  3BWS A;  4YVD A;  3PXS D;  2CE9 A;  3SBP A;  5C2V B;  3SHF A;  4CI1 A;  2I0S A;  4X61 B;  4EWR A;  4A09 B;  5IT9 g;  2O9K A;  2Z2P A;  3JPX A;  3EI3 B;  4IMM A;  4A08 B;  2H6K A;  1FWX A;  2PM9 A;  3A0F A;  1NEX B;  5THA A;  2Q7Q A;  3SBQ A;  3EI1 A;  3C99 A;  1U4C A;  2IUP A;  3SJL D;  4A0A B;  3HFQ A;  4A2L A;  4LGN A;  4FA1 D;  2XL2 A;  5IJ8 E;  3ORV D;  4AEZ A;  1K8K C;  1YFQ A;  3V9F A;  4BL0 A;  4J86 A;  5TEE A;  3ODT A;  2CN3 A;  3BG0 A;  3IJ1 A;  4PC0 A;  3OL2 B;  2AH1 A;  4ZOX A;  4QRJ A;  4H5I A;  4IA9 A;  4A0B A;  2XYI A;  2QXV A;  3L4M D;  5HYN B;  1SHY B;  3ULE C;  3SN6 B;  2IUV A;  3RLM D;  5EMJ B;  1N6F A;  5C2W B;  1NR0 A;  2H3X A;  3RFG A;  4PBZ A;  4ES0 A;  4E54 A;  2OK4 A;  3F3G A;  3EI4 A;  3JZN A;  3F3F A;  4XYI A;  4FAV D;  3I89 A;  3L4O D;  3JZG A;  3EMH A;  2H13 A;  3ZWL B;  3SLE D;  4ZN4 A;  1L0Q A;  4QT8 A;  2AGW A;  1PGU A;  5FKT A;  3CFV A;  4AOW A;  4CY1 A;  2OJY A;  3IJ0 A;  2H9N A;  1GP2 B;  2H68 A;  4FB1 D;  5GXH A;  2AGY A;  3JRO A;  3I7O A;  4L1Q D;  4L3H D;  3GFC A;  2MTA H;  5EAL A;  4CY5 A;  1MG2 A;  2IAA A;  5EMM B;  3C9C A;  3JB9 L;  5AFU 3;  5IJ7 E;  1ERJ A;  3RN0 D;  4PSX B;  2HKR A;  5SXM A;  2B5N A;  1VYH C;  1N6D A;  3N0E A;  4Y7R A;  3EI2 B;  3AH8 B;  3I7P A;  2H47 A;  4GQ1 A;  5KDO B;  2YB8 B;  4J0X A;  3SCY A;  2TRC B;  3CIK B;  4O3T B;  2W18 A;  3PXT D;  5IC7 A;  3J80 g;  3JRP A;  3AL9 A;  2EBS A;  3C75 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...