2YB8B

Crystal structure of nurf55 in complex with su(z)12
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
399
structure length
375
Chain Sequence
VEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords POLYCOMB PROTEIN SU(Z)12
publication title Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 99
structure length 375
sequence length 399
ec nomenclature
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2yb8B00
5EM2B 2BCJB 3ZWLB 1S4UX 4O9DA 2I0TA 4FWWA 1GG2B 1L0QA 3NVQA 4J8BA 3B7FA 1TBGA 2H3XA 2OK4A 4CY3A 3IJCA 3RN1D 4J87A 3OKYA 4PSXB 5IGQA 4J8GA 2P9IC 2XU7A 2IURA 4CZYA 4ZOVA 4O1QD 4JSXC 4A0BA 4A11B 5HYNB 2Z2NA 4D6VA 4PBZA 2HKMA 4U1EI 2AGZA 4ZN4A 4BUJC 1U4CA 4A0BB 5GSAA 3SBPA 1SQ9A 5HE3B 3KRWB 4GZ8A 4ERZA 1PGUA 4QL1A 4L3GD 3MMYA 5EALA 2HYEA 1R5MA 4G56B 3C75H 2H13A 3V7DB 2P9SC 5HE1B 4K3JB 3I7HA 4ES0A 3HFQA 3EI3A 1SQJA 2PM6B 5HE2B 3SHFA 4X3EA 3OKWA 3UKUC 5GXHA 5I5JA 2AH1A 4J0XA 3DM0A 2AGXA 3RN0D 3C5MA 2YMUA 3IIYA 2HJ4A 4K3ID 4PNKB 3IJ1A 4L3HD 3ORVD 4QRJA 2OK6A 2XYIA 3P4FA 4KFMB 4IA9A 4CI3A 3SWSD 5C2VB 3JZNA 2B5LA 5C9ZB 3JAMg 3I7OA 4FHLA 1JMXB 4A09B 4JSVC 5IC7A 4CI8A 4GQBB 2H47A 1XKSA 3EWEA 3I8EA 2CO0A 4JD2C 1MG3A 2HESX 2Q7QA 2P9KC 3MZKA 1OMWB 2OIZA 1PI6A 3AL9A 5EM2A 2PM9A 2OVRB 3EI4A 4GGCA 2YBAA 4I79A 3SBQA 3IKOA 2B5NA 3V5WB 4XYIA 1MG2A 3JPXA 2P9LC 5AMSA 3MXXA 4CC9A 2BBKH 3PXTD 4Y7RA 2IAAA 3ODTA 4AOWA 2EBSA 2PM9B 3PXWD 3EI4B 3L4OD 4E5ZB 5FKTA 3E0CA 4A7JA 4A11A 3AL8A 4FA1D 5I5MA 3F3GA 3RSEC 5EAPA 4PSWB 5H17A 4BL0A 5AFU3 4J73A 3JZHA 3RFGA 4J86A 4A2LA 3V9FA 2O9KA 4PXWA 3RMZD 2H9PA 3EI2B 3SBRA 1MDAH 4GMBA 3AL8B 2AGYA 2PBIB 3BG1A 3K26A 1GP2B 4OZUA 5B4WA 4O3UB 5H1MA 4HDJA 3I7LA 4NSXA 1SHYB 5CXBB 2AGLA 2H68A 2I3TA 2YNOA 4J79A 3RLMD 1PEVA 1XIPA 4LGNA 5IT9g 1B9YA 3CFVA 5A2Qg 3F3FA 4CI1A 2CE9A 3F3PA 2P9UC 1RI6A 3NVXA 1ERJA 4X63B 4CY1A 3JRPA 3RRMC 1JMZB 2Z2OA 4H5JA 5HE0B 3GFCA 4J78A 4H5IA 4UI9R 5EMJB 2H6QA 2CN3A 2HXCA 2J55H 2MTAH 3VGZA 4JSNC 5EMMB 5GXIA 4D0KA 4ESGA 3I7KA 2B4EA 3J80g 3NVNA 2HKRA 3J81g 3DSMA 3OTTA 1NR0A 3DXMC 4ZOXA 1VYHC 3PVWB 4J84A 4FA4D 4E54A 3GREA 3SLED 2QXVA 4A2MA 2Z2PA 4A09A 4TZ4A 4O3TB 4Y5RD 3PXSD 4JT6C 4FAVD 2H9LA 5TEEA 1PBYB 4A0AB 2OJYA 4JSPC 5H14A 2CE8A 4QT8A 3SFZA 4E54B 5I5IA 1K32A 4GGAA 4R7AB 3N0DA 3JB9L 2QC5A 1K8KC 4XYHA 5TEFA 3PSCB 3K27A 2P9NC 5IJ7E 5C2WB 5FQDA 4FA9D 3A0FA 3DWLC 4CZVA 4JT5C 3I8CA 4L1QD 4E5ZA 4XEIC 3UVOA 2UZXB 1N6EA 1A0RB 3OKTA 3UVKA 3PE7A 2G9AA 3OL2A 4L9OA 4ERYA 2YB8B 5KDOB 4GQ1A 2OVPB 1JJUB 4JXMA 2B5MA 5CXCA 4QQEA 2CN2A 2CO0C 3C99A 5TF2A 3EI2A 3AFCA 4O45A 1XHMA 3AH8B 3U4YA 3SN6B 3CFSB 2XL2A 3OL2B 3W15A 5JWZA 2GNQA 2IWKA 4CI2A 2YNPA 4LG9A 3EMHA 4GM8A 5CXCB 2W18A 2OVQB 4AEZA 5CXBA 4J0WA 4CY2A 3VH0A 1GXRA 1N6FA 5HQGA 3PVUB 3FRXA 4X61B 2AGWA 1OLZA 4CZXA 3PSLA 2GC4A 3EI1B 3SMRA 1B9XA 1GOTB 4BH6A 4Z8LA 5CYKA 3MZLA 3SVWD 3JZGA 4GM3A 3C9CA 2GC7A 1TYQC 2H9MA 3OW8A 4LG8A 3CIKB 2TRCB 5FKQA 1N6DA 4ZOZA 3I7PA 3I2NA 5CYKB 2XL3A 2I0SA 3OKYB 3UVLA 3UKRC 2AH0A 5EMLB 5AJAA 1FWXA 3SJLD 2J57G 3FM0A 4ERQA 2I3SA 3I89A 1Q47A 4A08A 1NEXB 5TDHB 5FKRA 2I0RA 2IUQA 2J56H 4GQ2P 4J81A 4A0AA 4MK0B 2IWFA 4PC0A 3ULEC 3BG0A 4A08B 3IIWA 3SXTD 1QNIA 5FA5B 2G99A 4J77A 5FLXg 3IJ0A 3SCYA 4X60B 4PBYA 3MKSB 4GGDA 2H6NA 2H6KA 1YFQA 2H9NA 5K19A 3MKQA 5K1CC 1P22A 4OWRA 3EI3B 5IJ8E 2PM7B 3L4MD 4FA5D 3UR4A 5THAA 5EARA 3UVNA 5GMKn 5FXYA 5EMKB 4J82A 5SXMA 2HJBA 1U2VC 3N0EA 4FAND 4GM9A 2H14A 1JOFA 3VA6A 5IGOA 2UZYB 3EG6A 4CY5A 4EWRA 5EAMA 3DXKC 3I7NA 3JROA 4IMMA 4ZOYA 3BWSA 2IUVA 2YNNA 3EU7A 3UVMA 4FB1D 2P9PC 3KRXB 3EI1A 3FGBA 4N14A 2CNXA 3RFHA 4U7AA 5FKSA 2IUPA 4YVDA 2AQ5A
chains in the Genus database with same CATH superfamily
5EM2B 2BCJB 3ZWLB 4WK0A 1S4UX 4O9DA 5GXIA 2I0TA 4FWWA 1GG2B 1L0QA 3NVQA 4J8BA 3B7FA 2VDMA 1TBGA 2H3XA 2OK4A 4CY3A 2BKLA 3IJCA 3RN1D 4J87A 2VDKA 1L5GA 3OKYA 4PSXB 3OF7A 5IGQA 4J8GA 1UOQA 2P9IC 2XU7A 2IURA 4CZYA 4ZOVA 5M5UA 4O1QD 4JSXC 4G55A 4G1MA 4RE5A 4A0BA 4A11B 1A12A 5HYNB 2Z2NA 3ZDXA 4D6VA 4PBZA 2HKMA 3EQ9A 4U1EI 3IUNA 2AGZA 2HU5A 4ZN4A 4BUJC 1U4CA 4BCBA 4A0BB 1BPOA 5GSAA 4JHPC 4DNUA 3SBPA 1SQ9A 5HE3B 3K71A 3KRWB 4G1EA 1E5TA 3IJEA 2JKXA 4GZ8A 5M5VA 4ERZA 1PGUA 4QL1A 4L3GD 3MMYA 5EALA 2HYEA 1R5MA 4G56B 3C75H 1JTDB 2H13A 2HU7A 2P9SC 5HE1B 3V7DB 4K3JB 3I7HA 4ES0A 3HFQA 3EI3A 1SQJA 2PM6B 5HE2B 3SHFA 4X3EA 2EIEA 4IRZA 3V4VA 3OKWA 3UKUC 4AMYA 5GXHA 5I5JA 3IUQA 2AH1A 4J0XA 3DM0A 1H2WA 2AGXA 4MMYA 3RN0D 3C5MA 2YMUA 3IIYA 4AMZA 2HJ4A 4K3ID 4PNKB 3IJ1A 4BP9A 4MMXA 4L3HD 4O02A 3ORVD 5M5SA 4QRJA 3MVDK 2OK6A 2XYIA 5M5TA 3P4FA 4KFMB 2XDWA 4IA9A 4CI3A 3SWSD 3DDUA 5C2VB 3JZNA 2B5LA 5C9ZB 3JAMg 3I7OA 4FHLA 3IVMA 1GOGA 1JMXB 4A09B 4JSVC 5IC7A 4CI8A 4GQBB 2H47A 1XKSA 3EWEA 3I8EA 1H2XA 2VZ3A 2CO0A 4JD2C 1MG3A 2HESX 2Q7QA 2P9KC 3IUMA 3MZKA 1OMWB 2OIZA 1PI6A 3AL9A 5C86A 5EM2A 2PM9A 2OVRB 3EI4A 4GGCA 2YBAA 4I79A 3K72A 5FFOA 3IKOA 3SBQA 2B5NA 3V5WB 4XYIA 1MG2A 3O4JA 3JPXA 2P9LC 5AMSA 3MXXA 4Z7QA 4CC9A 1H2YA 2BBKH 3PXTD 4Y7RA 3ZDYA 2IAAA 4WK2A 3ODTA 4AOWA 2EBSA 2PM9B 3QI0A 3PXWD 3EI4B 3L4OD 1I2MB 5FKTA 4E5ZB 3E0CA 1YR2A 3IULA 4A7JA 3AL8A 4A11A 1C9LA 4FA1D 5I5MA 3F3GA 3RSEC 5EAPA 4PSWB 5H17A 4BL0A 5AFU3 4J73A 2XE4A 3JZHA 3RFGA 4NENA 4J86A 4A2LA 3V9FA 2O9KA 4PXWA 3RMZD 2H9PA 3EI2B 3SBRA 1E8NA 1MDAH 4GMBA 3AL8B 2AGYA 2PBIB 3BG1A 3K26A 1GP2B 2EICA 4OZUA 4NBMA 4AX4A 3IUJA 5B4WA 4O3UB 1VE7A 5H1MA 3VI3A 4HDJA 3I7LA 4NSXA 4NC4A 5C92A 2XZGA 1SHYB 5CXBB 2AGLA 2H68A 2I3TA 2YNOA 5HDBA 4J79A 4BCDA 3RLMD 1PEVA 3EQ7A 1XIPA 4LGNA 5IT9g 1B9YA 3CFVA 5A2Qg 3F3FA 4CI1A 2CE9A 2VC2A 4UM9A 3F3PA 5M61A 2P9UC 1RI6A 3NVXA 1ERJA 4DNVA 4X63B 4CY1A 3JRPA 3RRMC 3T3MA 1JMZB 2Z2OA 4H5JA 3NIFA 5HE0B 5M5RA 3GFCA 4J78A 3O4IA 4H5IA 4UI9R 5EMJB 3O4GA 2H6QA 5E6SA 2CN3A 2HXCA 2J55H 2MTAH 5E6RA 4JSNC 3VGZA 3ZE2A 4BCCA 5EMMB 4D0KA 4ESGA 3I7KA 2B4EA 3J80g 3NVNA 1H2ZA 2HKRA 3J81g 3DSMA 3OTTA 1NR0A 3DXMC 4ZOXA 1VYHC 3PVWB 3ZDZA 4J84A 4FA4D 4E54A 3GREA 3SLED 2QXVA 4A2MA 2Z2PA 4A09A 4TZ4A 4O3TB 4Y5RD 4RE6A 3PXSD 4JT6C 4FAVD 1O6GA 2H9LA 5TEEA 1PBYB 4A0AB 2OJYA 4JSPC 5H14A 2CE8A 3FCUA 4QT8A 3SFZA 1K3IA 4E54B 5I5IA 1K32A 4GGAA 4R7AB 1U8CA 3N0DA 5E6UA 3JB9L 2QC5A 1K8KC 4XYHA 5TEFA 3PSCB 3K27A 2P9NC 5IJ7E 5C2WB 3FCSA 4UM8A 5FQDA 4FA9D 3A0FA 3DWLC 4CZVA 4JT5C 3I8CA 4L1QD 4E5ZA 4XEIC 3UVOA 2UZXB 1N6EA 3NIDA 1A0RB 3OKTA 3UVKA 1M1XA 3PE7A 2G9AA 1O6FA 3OL2A 4L9OA 4AN1A 4ERYA 2YB8B 5KDOB 4GQ1A 4BP8A 2OVPB 1JJUB 4JXMA 2B5MA 5CXCA 4QQEA 2CN2A 2CO0C 3C99A 5TF2A 2HU8A 3EI2A 3AFCA 4O45A 1XHMA 4Z7OA 3AH8B 3U4YA 3SN6B 3CFSB 4L1MA 2XL2A 3K6SA 4WJKA 4D9SA 3OL2B 3W15A 5JWZA 2GNQA 2IWKA 4CI2A 2YNPA 4LG9A 3EMHA 3QHYB 4GM8A 1C9IA 2VDRA 5CXCB 2W18A 3NIGA 2OVQB 5CXBA 4J0WA 4AEZA 4CY2A 3VH0A 1GXRA 1N6FA 5HQGA 1UOPA 3PVUB 3FRXA 4X61B 2AGWA 3VI4A 1OLZA 1VZ2A 4CZXA 3PSLA 3T3PA 2GC4A 3EI1B 3SMRA 3V4PA 1B9XA 1GOTB 4BH6A 2VDNA 4O2WA 4Z8LA 5CYKA 3MZLA 3SVWD 3JZGA 4GM3A 3C9CA 2VDLA 2GC7A 1TYQC 2VZ1A 2H9MA 3OW8A 4LG8A 4AN0A 3CIKB 2TRCB 5FKQA 1N6DA 4ZOZA 3I7PA 3I2NA 2VDQA 5CYKB 2XL3A 3GC3B 3KCIA 3ZE1A 2I0SA 3OKYB 3UVLA 3UKRC 1TYEA 2WQ8A 2AH0A 1VE6A 1T2XA 5EMLB 3MUOA 5AJAA 5FFGA 1FWXA 3SJLD 2J57G 3FM0A 4ERQA 2I3SA 3I89A 1Q47A 4A08A 1NEXB 5TDHB 5FKRA 2I0RA 2IUQA 2J56H 2EIBA 4GQ2P 4J81A 4A0AA 4MK0B 2IWFA 4PC0A 2VDOA 3ULEC 4WK4A 3BG0A 4A08B 3IIWA 3SXTD 1QNIA 5FA5B 2QZPA 4DNWA 2G99A 4J77A 4MMZA 3IJ0A 3SCYA 5FLXg 1E8MA 4X60B 1VZ3A 4PBYA 3MKSB 4GGDA 3GD1I 2H6NA 2H6KA 1YFQA 2H9NA 5K19A 3IURA 3MKQA 5K1CC 1P22A 3EI3B 4OWRA 5IJ8E 2PM7B 3EQ8A 3L4MD 1UTCA 3ZE0A 4FA5D 3UR4A 1JV2A 4QAMA 5THAA 5EARA 3UVNA 5GMKn 5FXYA 5EMKB 4J82A 4Z7NA 3MUNA 5SXMA 2HJBA 1U2VC 3N0EA 4FAND 4GM9A 2H14A 1JOFA 3VA6A 1QFMA 5IGOA 1GOFA 2UZYB 2VDPA 3EG6A 4CY5A 4EWRA 5EAMA 1GOHA 3DXKC 3I7NA 3JROA 4NAAA 4IMMA 3O4HA 4ZOYA 3BWSA 2IUVA 2YNNA 3EU7A 3UVMA 4JHNA 2QR5A 4FB1D 2P9PC 1UOOA 3KRXB 3EI1A 3FGBA 4N14A 1QFSA 2CNXA 3RFHA 4U7AA 5FKSA 2EIDA 2IUPA 4YVDA 2AQ5A
chains in the Genus database with same CATH topology
5EM2B 2BCJB 3ZWLB 1S4UX 4O9DA 2I0TA 4FWWA 1GG2B 1L0QA 3NVQA 4J8BA 3B7FA 1TBGA 2H3XA 2OK4A 4CY3A 3IJCA 3RN1D 4J87A 3OKYA 4PSXB 5IGQA 4J8GA 2P9IC 2XU7A 2IURA 4CZYA 4ZOVA 4O1QD 4JSXC 4A0BA 4A11B 5HYNB 2Z2NA 4D6VA 4PBZA 2HKMA 4U1EI 2AGZA 4ZN4A 4BUJC 1U4CA 4A0BB 5GSAA 3SBPA 1SQ9A 5HE3B 3KRWB 4GZ8A 4ERZA 1PGUA 4QL1A 4L3GD 3MMYA 5EALA 2HYEA 1R5MA 4G56B 3C75H 2H13A 3V7DB 2P9SC 5HE1B 4K3JB 3I7HA 4ES0A 3HFQA 3EI3A 1SQJA 2PM6B 5HE2B 3SHFA 4X3EA 3OKWA 3UKUC 5GXHA 5I5JA 2AH1A 4J0XA 3DM0A 2AGXA 3RN0D 3C5MA 2YMUA 3IIYA 2HJ4A 4K3ID 4PNKB 3IJ1A 4L3HD 3ORVD 4QRJA 2OK6A 2XYIA 3P4FA 4KFMB 4IA9A 4CI3A 3SWSD 5C2VB 3JZNA 2B5LA 5C9ZB 3JAMg 3I7OA 4FHLA 1JMXB 4A09B 4JSVC 5IC7A 4CI8A 4GQBB 2H47A 1XKSA 3EWEA 3I8EA 2CO0A 4JD2C 1MG3A 2HESX 2Q7QA 2P9KC 3MZKA 1OMWB 2OIZA 1PI6A 3AL9A 5EM2A 2PM9A 2OVRB 3EI4A 4GGCA 2YBAA 4I79A 3SBQA 3IKOA 2B5NA 3V5WB 4XYIA 1MG2A 3JPXA 2P9LC 5AMSA 3MXXA 4CC9A 2BBKH 3PXTD 4Y7RA 2IAAA 3ODTA 4AOWA 2EBSA 2PM9B 3PXWD 3EI4B 3L4OD 4E5ZB 5FKTA 3E0CA 4A7JA 4A11A 3AL8A 4FA1D 5I5MA 3F3GA 3RSEC 5EAPA 4PSWB 5H17A 4BL0A 5AFU3 4J73A 3JZHA 3RFGA 4J86A 4A2LA 3V9FA 2O9KA 4PXWA 3RMZD 2H9PA 3EI2B 3SBRA 1MDAH 4GMBA 3AL8B 2AGYA 2PBIB 3BG1A 3K26A 1GP2B 4OZUA 5B4WA 4O3UB 5H1MA 4HDJA 3I7LA 4NSXA 1SHYB 5CXBB 2AGLA 2H68A 2I3TA 2YNOA 4J79A 3RLMD 1PEVA 1XIPA 4LGNA 5IT9g 1B9YA 3CFVA 5A2Qg 3F3FA 4CI1A 2CE9A 3F3PA 2P9UC 1RI6A 3NVXA 1ERJA 4X63B 4CY1A 3JRPA 3RRMC 1JMZB 2Z2OA 4H5JA 5HE0B 3GFCA 4J78A 4H5IA 4UI9R 5EMJB 2H6QA 2CN3A 2HXCA 2J55H 2MTAH 3VGZA 4JSNC 5EMMB 5GXIA 4D0KA 4ESGA 3I7KA 2B4EA 3J80g 3NVNA 2HKRA 3J81g 3DSMA 3OTTA 1NR0A 3DXMC 4ZOXA 1VYHC 3PVWB 4J84A 4FA4D 4E54A 3GREA 3SLED 2QXVA 4A2MA 2Z2PA 4A09A 4TZ4A 4O3TB 4Y5RD 3PXSD 4JT6C 4FAVD 2H9LA 5TEEA 1PBYB 4A0AB 2OJYA 4JSPC 5H14A 2CE8A 4QT8A 3SFZA 4E54B 5I5IA 1K32A 4GGAA 4R7AB 3N0DA 3JB9L 2QC5A 1K8KC 4XYHA 5TEFA 3PSCB 3K27A 2P9NC 5IJ7E 5C2WB 5FQDA 4FA9D 3A0FA 3DWLC 4CZVA 4JT5C 3I8CA 4L1QD 4E5ZA 4XEIC 3UVOA 2UZXB 1N6EA 1A0RB 3OKTA 3UVKA 3PE7A 2G9AA 3OL2A 4L9OA 4ERYA 2YB8B 5KDOB 4GQ1A 2OVPB 1JJUB 4JXMA 2B5MA 5CXCA 4QQEA 2CN2A 2CO0C 3C99A 5TF2A 3EI2A 3AFCA 4O45A 1XHMA 3AH8B 3U4YA 3SN6B 3CFSB 2XL2A 3OL2B 3W15A 5JWZA 2GNQA 2IWKA 4CI2A 2YNPA 4LG9A 3EMHA 4GM8A 5CXCB 2W18A 2OVQB 4AEZA 5CXBA 4J0WA 4CY2A 3VH0A 1GXRA 1N6FA 5HQGA 3PVUB 3FRXA 4X61B 2AGWA 1OLZA 4CZXA 3PSLA 2GC4A 3EI1B 3SMRA 1B9XA 1GOTB 4BH6A 4Z8LA 5CYKA 3MZLA 3SVWD 3JZGA 4GM3A 3C9CA 2GC7A 1TYQC 2H9MA 3OW8A 4LG8A 3CIKB 2TRCB 5FKQA 1N6DA 4ZOZA 3I7PA 3I2NA 5CYKB 2XL3A 2I0SA 3OKYB 3UVLA 3UKRC 2AH0A 5EMLB 5AJAA 1FWXA 3SJLD 2J57G 3FM0A 4ERQA 2I3SA 3I89A 1Q47A 4A08A 1NEXB 5TDHB 5FKRA 2I0RA 2IUQA 2J56H 4GQ2P 4J81A 4A0AA 4MK0B 2IWFA 4PC0A 3ULEC 3BG0A 4A08B 3IIWA 3SXTD 1QNIA 5FA5B 2G99A 4J77A 5FLXg 3IJ0A 3SCYA 4X60B 4PBYA 3MKSB 4GGDA 2H6NA 2H6KA 1YFQA 2H9NA 5K19A 3MKQA 5K1CC 1P22A 4OWRA 3EI3B 5IJ8E 2PM7B 3L4MD 4FA5D 3UR4A 5THAA 5EARA 3UVNA 5GMKn 5FXYA 5EMKB 4J82A 5SXMA 2HJBA 1U2VC 3N0EA 4FAND 4GM9A 2H14A 1JOFA 3VA6A 5IGOA 2UZYB 3EG6A 4CY5A 4EWRA 5EAMA 3DXKC 3I7NA 3JROA 4IMMA 4ZOYA 3BWSA 2IUVA 2YNNA 3EU7A 3UVMA 4FB1D 2P9PC 3KRXB 3EI1A 3FGBA 4N14A 2CNXA 3RFHA 4U7AA 5FKSA 2IUPA 4YVDA 2AQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM2 B;  2BCJ B;  3ZWL B;  1S4U X;  4O9D A;  2I0T A;  4FWW A;  1GG2 B;  1L0Q A;  3NVQ A;  4J8B A;  3B7F A;  1TBG A;  2H3X A;  2OK4 A;  4CY3 A;  3IJC A;  3RN1 D;  4J87 A;  3OKY A;  4PSX B;  5IGQ A;  4J8G A;  2P9I C;  2XU7 A;  2IUR A;  4CZY A;  4ZOV A;  4O1Q D;  4JSX C;  4A0B A;  4A11 B;  5HYN B;  2Z2N A;  4D6V A;  4PBZ A;  2HKM A;  4U1E I;  2AGZ A;  4ZN4 A;  4BUJ C;  1U4C A;  4A0B B;  5GSA A;  3SBP A;  1SQ9 A;  5HE3 B;  3KRW B;  4GZ8 A;  4ERZ A;  1PGU A;  4QL1 A;  4L3G D;  3MMY A;  5EAL A;  2HYE A;  1R5M A;  4G56 B;  3C75 H;  2H13 A;  3V7D B;  2P9S C;  5HE1 B;  4K3J B;  3I7H A;  4ES0 A;  3HFQ A;  3EI3 A;  1SQJ A;  2PM6 B;  5HE2 B;  3SHF A;  4X3E A;  3OKW A;  3UKU C;  5GXH A;  5I5J A;  2AH1 A;  4J0X A;  3DM0 A;  2AGX A;  3RN0 D;  3C5M A;  2YMU A;  3IIY A;  2HJ4 A;  4K3I D;  4PNK B;  3IJ1 A;  4L3H D;  3ORV D;  4QRJ A;  2OK6 A;  2XYI A;  3P4F A;  4KFM B;  4IA9 A;  4CI3 A;  3SWS D;  5C2V B;  3JZN A;  2B5L A;  5C9Z B;  3JAM g;  3I7O A;  4FHL A;  1JMX B;  4A09 B;  4JSV C;  5IC7 A;  4CI8 A;  4GQB B;  2H47 A;  1XKS A;  3EWE A;  3I8E A;  2CO0 A;  4JD2 C;  1MG3 A;  2HES X;  2Q7Q A;  2P9K C;  3MZK A;  1OMW B;  2OIZ A;  1PI6 A;  3AL9 A;  5EM2 A;  2PM9 A;  2OVR B;  3EI4 A;  4GGC A;  2YBA A;  4I79 A;  3SBQ A;  3IKO A;  2B5N A;  3V5W B;  4XYI A;  1MG2 A;  3JPX A;  2P9L C;  5AMS A;  3MXX A;  4CC9 A;  2BBK H;  3PXT D;  4Y7R A;  2IAA A;  3ODT A;  4AOW A;  2EBS A;  2PM9 B;  3PXW D;  3EI4 B;  3L4O D;  4E5Z B;  5FKT A;  3E0C A;  4A7J A;  4A11 A;  3AL8 A;  4FA1 D;  5I5M A;  3F3G A;  3RSE C;  5EAP A;  4PSW B;  5H17 A;  4BL0 A;  5AFU 3;  4J73 A;  3JZH A;  3RFG A;  4J86 A;  4A2L A;  3V9F A;  2O9K A;  4PXW A;  3RMZ D;  2H9P A;  3EI2 B;  3SBR A;  1MDA H;  4GMB A;  3AL8 B;  2AGY A;  2PBI B;  3BG1 A;  3K26 A;  1GP2 B;  4OZU A;  5B4W A;  4O3U B;  5H1M A;  4HDJ A;  3I7L A;  4NSX A;  1SHY B;  5CXB B;  2AGL A;  2H68 A;  2I3T A;  2YNO A;  4J79 A;  3RLM D;  1PEV A;  1XIP A;  4LGN A;  5IT9 g;  1B9Y A;  3CFV A;  5A2Q g;  3F3F A;  4CI1 A;  2CE9 A;  3F3P A;  2P9U C;  1RI6 A;  3NVX A;  1ERJ A;  4X63 B;  4CY1 A;  3JRP A;  3RRM C;  1JMZ B;  2Z2O A;  4H5J A;  5HE0 B;  3GFC A;  4J78 A;  4H5I A;  4UI9 R;  5EMJ B;  2H6Q A;  2CN3 A;  2HXC A;  2J55 H;  2MTA H;  3VGZ A;  4JSN C;  5EMM B;  5GXI A;  4D0K A;  4ESG A;  3I7K A;  2B4E A;  3J80 g;  3NVN A;  2HKR A;  3J81 g;  3DSM A;  3OTT A;  1NR0 A;  3DXM C;  4ZOX A;  1VYH C;  3PVW B;  4J84 A;  4FA4 D;  4E54 A;  3GRE A;  3SLE D;  2QXV A;  4A2M A;  2Z2P A;  4A09 A;  4TZ4 A;  4O3T B;  4Y5R D;  3PXS D;  4JT6 C;  4FAV D;  2H9L A;  5TEE A;  1PBY B;  4A0A B;  2OJY A;  4JSP C;  5H14 A;  2CE8 A;  4QT8 A;  3SFZ A;  4E54 B;  5I5I A;  1K32 A;  4GGA A;  4R7A B;  3N0D A;  3JB9 L;  2QC5 A;  1K8K C;  4XYH A;  5TEF A;  3PSC B;  3K27 A;  2P9N C;  5IJ7 E;  5C2W B;  5FQD A;  4FA9 D;  3A0F A;  3DWL C;  4CZV A;  4JT5 C;  3I8C A;  4L1Q D;  4E5Z A;  4XEI C;  3UVO A;  2UZX B;  1N6E A;  1A0R B;  3OKT A;  3UVK A;  3PE7 A;  2G9A A;  3OL2 A;  4L9O A;  4ERY A;  2YB8 B;  5KDO B;  4GQ1 A;  2OVP B;  1JJU B;  4JXM A;  2B5M A;  5CXC A;  4QQE A;  2CN2 A;  2CO0 C;  3C99 A;  5TF2 A;  3EI2 A;  3AFC A;  4O45 A;  1XHM A;  3AH8 B;  3U4Y A;  3SN6 B;  3CFS B;  2XL2 A;  3OL2 B;  3W15 A;  5JWZ A;  2GNQ A;  2IWK A;  4CI2 A;  2YNP A;  4LG9 A;  3EMH A;  4GM8 A;  5CXC B;  2W18 A;  2OVQ B;  4AEZ A;  5CXB A;  4J0W A;  4CY2 A;  3VH0 A;  1GXR A;  1N6F A;  5HQG A;  3PVU B;  3FRX A;  4X61 B;  2AGW A;  1OLZ A;  4CZX A;  3PSL A;  2GC4 A;  3EI1 B;  3SMR A;  1B9X A;  1GOT B;  4BH6 A;  4Z8L A;  5CYK A;  3MZL A;  3SVW D;  3JZG A;  4GM3 A;  3C9C A;  2GC7 A;  1TYQ C;  2H9M A;  3OW8 A;  4LG8 A;  3CIK B;  2TRC B;  5FKQ A;  1N6D A;  4ZOZ A;  3I7P A;  3I2N A;  5CYK B;  2XL3 A;  2I0S A;  3OKY B;  3UVL A;  3UKR C;  2AH0 A;  5EML B;  5AJA A;  1FWX A;  3SJL D;  2J57 G;  3FM0 A;  4ERQ A;  2I3S A;  3I89 A;  1Q47 A;  4A08 A;  1NEX B;  5TDH B;  5FKR A;  2I0R A;  2IUQ A;  2J56 H;  4GQ2 P;  4J81 A;  4A0A A;  4MK0 B;  2IWF A;  4PC0 A;  3ULE C;  3BG0 A;  4A08 B;  3IIW A;  3SXT D;  1QNI A;  5FA5 B;  2G99 A;  4J77 A;  5FLX g;  3IJ0 A;  3SCY A;  4X60 B;  4PBY A;  3MKS B;  4GGD A;  2H6N A;  2H6K A;  1YFQ A;  2H9N A;  5K19 A;  3MKQ A;  5K1C C;  1P22 A;  4OWR A;  3EI3 B;  5IJ8 E;  2PM7 B;  3L4M D;  4FA5 D;  3UR4 A;  5THA A;  5EAR A;  3UVN A;  5GMK n;  5FXY A;  5EMK B;  4J82 A;  5SXM A;  2HJB A;  1U2V C;  3N0E A;  4FAN D;  4GM9 A;  2H14 A;  1JOF A;  3VA6 A;  5IGO A;  2UZY B;  3EG6 A;  4CY5 A;  4EWR A;  5EAM A;  3DXK C;  3I7N A;  3JRO A;  4IMM A;  4ZOY A;  3BWS A;  2IUV A;  2YNN A;  3EU7 A;  3UVM A;  4FB1 D;  2P9P C;  3KRX B;  3EI1 A;  3FGB A;  4N14 A;  2CNX A;  3RFH A;  4U7A A;  5FKS A;  2IUP A;  4YVD A;  2AQ5 A; 
#chains in the Genus database with same CATH topology
 5EM2 B;  2BCJ B;  3ZWL B;  4WK0 A;  1S4U X;  4O9D A;  5GXI A;  2I0T A;  4FWW A;  1GG2 B;  1L0Q A;  3NVQ A;  4J8B A;  3B7F A;  2VDM A;  1TBG A;  2H3X A;  2OK4 A;  4CY3 A;  2BKL A;  3IJC A;  3RN1 D;  4J87 A;  2VDK A;  1L5G A;  3OKY A;  4PSX B;  3OF7 A;  5IGQ A;  4J8G A;  1UOQ A;  2P9I C;  2XU7 A;  2IUR A;  4CZY A;  4ZOV A;  5M5U A;  4O1Q D;  4JSX C;  4G55 A;  4G1M A;  4RE5 A;  4A0B A;  4A11 B;  1A12 A;  5HYN B;  2Z2N A;  3ZDX A;  4D6V A;  4PBZ A;  2HKM A;  3EQ9 A;  4U1E I;  3IUN A;  2AGZ A;  2HU5 A;  4ZN4 A;  4BUJ C;  1U4C A;  4BCB A;  4A0B B;  1BPO A;  5GSA A;  4JHP C;  4DNU A;  3SBP A;  1SQ9 A;  5HE3 B;  3K71 A;  3KRW B;  4G1E A;  1E5T A;  3IJE A;  2JKX A;  4GZ8 A;  5M5V A;  4ERZ A;  1PGU A;  4QL1 A;  4L3G D;  3MMY A;  5EAL A;  2HYE A;  1R5M A;  4G56 B;  3C75 H;  1JTD B;  2H13 A;  2HU7 A;  2P9S C;  5HE1 B;  3V7D B;  4K3J B;  3I7H A;  4ES0 A;  3HFQ A;  3EI3 A;  1SQJ A;  2PM6 B;  5HE2 B;  3SHF A;  4X3E A;  2EIE A;  4IRZ A;  3V4V A;  3OKW A;  3UKU C;  4AMY A;  5GXH A;  5I5J A;  3IUQ A;  2AH1 A;  4J0X A;  3DM0 A;  1H2W A;  2AGX A;  4MMY A;  3RN0 D;  3C5M A;  2YMU A;  3IIY A;  4AMZ A;  2HJ4 A;  4K3I D;  4PNK B;  3IJ1 A;  4BP9 A;  4MMX A;  4L3H D;  4O02 A;  3ORV D;  5M5S A;  4QRJ A;  3MVD K;  2OK6 A;  2XYI A;  5M5T A;  3P4F A;  4KFM B;  2XDW A;  4IA9 A;  4CI3 A;  3SWS D;  3DDU A;  5C2V B;  3JZN A;  2B5L A;  5C9Z B;  3JAM g;  3I7O A;  4FHL A;  3IVM A;  1GOG A;  1JMX B;  4A09 B;  4JSV C;  5IC7 A;  4CI8 A;  4GQB B;  2H47 A;  1XKS A;  3EWE A;  3I8E A;  1H2X A;  2VZ3 A;  2CO0 A;  4JD2 C;  1MG3 A;  2HES X;  2Q7Q A;  2P9K C;  3IUM A;  3MZK A;  1OMW B;  2OIZ A;  1PI6 A;  3AL9 A;  5C86 A;  5EM2 A;  2PM9 A;  2OVR B;  3EI4 A;  4GGC A;  2YBA A;  4I79 A;  3K72 A;  5FFO A;  3IKO A;  3SBQ A;  2B5N A;  3V5W B;  4XYI A;  1MG2 A;  3O4J A;  3JPX A;  2P9L C;  5AMS A;  3MXX A;  4Z7Q A;  4CC9 A;  1H2Y A;  2BBK H;  3PXT D;  4Y7R A;  3ZDY A;  2IAA A;  4WK2 A;  3ODT A;  4AOW A;  2EBS A;  2PM9 B;  3QI0 A;  3PXW D;  3EI4 B;  3L4O D;  1I2M B;  5FKT A;  4E5Z B;  3E0C A;  1YR2 A;  3IUL A;  4A7J A;  3AL8 A;  4A11 A;  1C9L A;  4FA1 D;  5I5M A;  3F3G A;  3RSE C;  5EAP A;  4PSW B;  5H17 A;  4BL0 A;  5AFU 3;  4J73 A;  2XE4 A;  3JZH A;  3RFG A;  4NEN A;  4J86 A;  4A2L A;  3V9F A;  2O9K A;  4PXW A;  3RMZ D;  2H9P A;  3EI2 B;  3SBR A;  1E8N A;  1MDA H;  4GMB A;  3AL8 B;  2AGY A;  2PBI B;  3BG1 A;  3K26 A;  1GP2 B;  2EIC A;  4OZU A;  4NBM A;  4AX4 A;  3IUJ A;  5B4W A;  4O3U B;  1VE7 A;  5H1M A;  3VI3 A;  4HDJ A;  3I7L A;  4NSX A;  4NC4 A;  5C92 A;  2XZG A;  1SHY B;  5CXB B;  2AGL A;  2H68 A;  2I3T A;  2YNO A;  5HDB A;  4J79 A;  4BCD A;  3RLM D;  1PEV A;  3EQ7 A;  1XIP A;  4LGN A;  5IT9 g;  1B9Y A;  3CFV A;  5A2Q g;  3F3F A;  4CI1 A;  2CE9 A;  2VC2 A;  4UM9 A;  3F3P A;  5M61 A;  2P9U C;  1RI6 A;  3NVX A;  1ERJ A;  4DNV A;  4X63 B;  4CY1 A;  3JRP A;  3RRM C;  3T3M A;  1JMZ B;  2Z2O A;  4H5J A;  3NIF A;  5HE0 B;  5M5R A;  3GFC A;  4J78 A;  3O4I A;  4H5I A;  4UI9 R;  5EMJ B;  3O4G A;  2H6Q A;  5E6S A;  2CN3 A;  2HXC A;  2J55 H;  2MTA H;  5E6R A;  4JSN C;  3VGZ A;  3ZE2 A;  4BCC A;  5EMM B;  4D0K A;  4ESG A;  3I7K A;  2B4E A;  3J80 g;  3NVN A;  1H2Z A;  2HKR A;  3J81 g;  3DSM A;  3OTT A;  1NR0 A;  3DXM C;  4ZOX A;  1VYH C;  3PVW B;  3ZDZ A;  4J84 A;  4FA4 D;  4E54 A;  3GRE A;  3SLE D;  2QXV A;  4A2M A;  2Z2P A;  4A09 A;  4TZ4 A;  4O3T B;  4Y5R D;  4RE6 A;  3PXS D;  4JT6 C;  4FAV D;  1O6G A;  2H9L A;  5TEE A;  1PBY B;  4A0A B;  2OJY A;  4JSP C;  5H14 A;  2CE8 A;  3FCU A;  4QT8 A;  3SFZ A;  1K3I A;  4E54 B;  5I5I A;  1K32 A;  4GGA A;  4R7A B;  1U8C A;  3N0D A;  5E6U A;  3JB9 L;  2QC5 A;  1K8K C;  4XYH A;  5TEF A;  3PSC B;  3K27 A;  2P9N C;  5IJ7 E;  5C2W B;  3FCS A;  4UM8 A;  5FQD A;  4FA9 D;  3A0F A;  3DWL C;  4CZV A;  4JT5 C;  3I8C A;  4L1Q D;  4E5Z A;  4XEI C;  3UVO A;  2UZX B;  1N6E A;  3NID A;  1A0R B;  3OKT A;  3UVK A;  1M1X A;  3PE7 A;  2G9A A;  1O6F A;  3OL2 A;  4L9O A;  4AN1 A;  4ERY A;  2YB8 B;  5KDO B;  4GQ1 A;  4BP8 A;  2OVP B;  1JJU B;  4JXM A;  2B5M A;  5CXC A;  4QQE A;  2CN2 A;  2CO0 C;  3C99 A;  5TF2 A;  2HU8 A;  3EI2 A;  3AFC A;  4O45 A;  1XHM A;  4Z7O A;  3AH8 B;  3U4Y A;  3SN6 B;  3CFS B;  4L1M A;  2XL2 A;  3K6S A;  4WJK A;  4D9S A;  3OL2 B;  3W15 A;  5JWZ A;  2GNQ A;  2IWK A;  4CI2 A;  2YNP A;  4LG9 A;  3EMH A;  3QHY B;  4GM8 A;  1C9I A;  2VDR A;  5CXC B;  2W18 A;  3NIG A;  2OVQ B;  5CXB A;  4J0W A;  4AEZ A;  4CY2 A;  3VH0 A;  1GXR A;  1N6F A;  5HQG A;  1UOP A;  3PVU B;  3FRX A;  4X61 B;  2AGW A;  3VI4 A;  1OLZ A;  1VZ2 A;  4CZX A;  3PSL A;  3T3P A;  2GC4 A;  3EI1 B;  3SMR A;  3V4P A;  1B9X A;  1GOT B;  4BH6 A;  2VDN A;  4O2W A;  4Z8L A;  5CYK A;  3MZL A;  3SVW D;  3JZG A;  4GM3 A;  3C9C A;  2VDL A;  2GC7 A;  1TYQ C;  2VZ1 A;  2H9M A;  3OW8 A;  4LG8 A;  4AN0 A;  3CIK B;  2TRC B;  5FKQ A;  1N6D A;  4ZOZ A;  3I7P A;  3I2N A;  2VDQ A;  5CYK B;  2XL3 A;  3GC3 B;  3KCI A;  3ZE1 A;  2I0S A;  3OKY B;  3UVL A;  3UKR C;  1TYE A;  2WQ8 A;  2AH0 A;  1VE6 A;  1T2X A;  5EML B;  3MUO A;  5AJA A;  5FFG A;  1FWX A;  3SJL D;  2J57 G;  3FM0 A;  4ERQ A;  2I3S A;  3I89 A;  1Q47 A;  4A08 A;  1NEX B;  5TDH B;  5FKR A;  2I0R A;  2IUQ A;  2J56 H;  2EIB A;  4GQ2 P;  4J81 A;  4A0A A;  4MK0 B;  2IWF A;  4PC0 A;  2VDO A;  3ULE C;  4WK4 A;  3BG0 A;  4A08 B;  3IIW A;  3SXT D;  1QNI A;  5FA5 B;  2QZP A;  4DNW A;  2G99 A;  4J77 A;  4MMZ A;  3IJ0 A;  3SCY A;  5FLX g;  1E8M A;  4X60 B;  1VZ3 A;  4PBY A;  3MKS B;  4GGD A;  3GD1 I;  2H6N A;  2H6K A;  1YFQ A;  2H9N A;  5K19 A;  3IUR A;  3MKQ A;  5K1C C;  1P22 A;  3EI3 B;  4OWR A;  5IJ8 E;  2PM7 B;  3EQ8 A;  3L4M D;  1UTC A;  3ZE0 A;  4FA5 D;  3UR4 A;  1JV2 A;  4QAM A;  5THA A;  5EAR A;  3UVN A;  5GMK n;  5FXY A;  5EMK B;  4J82 A;  4Z7N A;  3MUN A;  5SXM A;  2HJB A;  1U2V C;  3N0E A;  4FAN D;  4GM9 A;  2H14 A;  1JOF A;  3VA6 A;  1QFM A;  5IGO A;  1GOF A;  2UZY B;  2VDP A;  3EG6 A;  4CY5 A;  4EWR A;  5EAM A;  1GOH A;  3DXK C;  3I7N A;  3JRO A;  4NAA A;  4IMM A;  3O4H A;  4ZOY A;  3BWS A;  2IUV A;  2YNN A;  3EU7 A;  3UVM A;  4JHN A;  2QR5 A;  4FB1 D;  2P9P C;  1UOO A;  3KRX B;  3EI1 A;  3FGB A;  4N14 A;  1QFS A;  2CNX A;  3RFH A;  4U7A A;  5FKS A;  2EID A;  2IUP A;  4YVD A;  2AQ5 A; 
#chains in the Genus database with same CATH homology
 5EM2 B;  2BCJ B;  3ZWL B;  1S4U X;  4O9D A;  2I0T A;  4FWW A;  1GG2 B;  1L0Q A;  3NVQ A;  4J8B A;  3B7F A;  1TBG A;  2H3X A;  2OK4 A;  4CY3 A;  3IJC A;  3RN1 D;  4J87 A;  3OKY A;  4PSX B;  5IGQ A;  4J8G A;  2P9I C;  2XU7 A;  2IUR A;  4CZY A;  4ZOV A;  4O1Q D;  4JSX C;  4A0B A;  4A11 B;  5HYN B;  2Z2N A;  4D6V A;  4PBZ A;  2HKM A;  4U1E I;  2AGZ A;  4ZN4 A;  4BUJ C;  1U4C A;  4A0B B;  5GSA A;  3SBP A;  1SQ9 A;  5HE3 B;  3KRW B;  4GZ8 A;  4ERZ A;  1PGU A;  4QL1 A;  4L3G D;  3MMY A;  5EAL A;  2HYE A;  1R5M A;  4G56 B;  3C75 H;  2H13 A;  3V7D B;  2P9S C;  5HE1 B;  4K3J B;  3I7H A;  4ES0 A;  3HFQ A;  3EI3 A;  1SQJ A;  2PM6 B;  5HE2 B;  3SHF A;  4X3E A;  3OKW A;  3UKU C;  5GXH A;  5I5J A;  2AH1 A;  4J0X A;  3DM0 A;  2AGX A;  3RN0 D;  3C5M A;  2YMU A;  3IIY A;  2HJ4 A;  4K3I D;  4PNK B;  3IJ1 A;  4L3H D;  3ORV D;  4QRJ A;  2OK6 A;  2XYI A;  3P4F A;  4KFM B;  4IA9 A;  4CI3 A;  3SWS D;  5C2V B;  3JZN A;  2B5L A;  5C9Z B;  3JAM g;  3I7O A;  4FHL A;  1JMX B;  4A09 B;  4JSV C;  5IC7 A;  4CI8 A;  4GQB B;  2H47 A;  1XKS A;  3EWE A;  3I8E A;  2CO0 A;  4JD2 C;  1MG3 A;  2HES X;  2Q7Q A;  2P9K C;  3MZK A;  1OMW B;  2OIZ A;  1PI6 A;  3AL9 A;  5EM2 A;  2PM9 A;  2OVR B;  3EI4 A;  4GGC A;  2YBA A;  4I79 A;  3SBQ A;  3IKO A;  2B5N A;  3V5W B;  4XYI A;  1MG2 A;  3JPX A;  2P9L C;  5AMS A;  3MXX A;  4CC9 A;  2BBK H;  3PXT D;  4Y7R A;  2IAA A;  3ODT A;  4AOW A;  2EBS A;  2PM9 B;  3PXW D;  3EI4 B;  3L4O D;  4E5Z B;  5FKT A;  3E0C A;  4A7J A;  4A11 A;  3AL8 A;  4FA1 D;  5I5M A;  3F3G A;  3RSE C;  5EAP A;  4PSW B;  5H17 A;  4BL0 A;  5AFU 3;  4J73 A;  3JZH A;  3RFG A;  4J86 A;  4A2L A;  3V9F A;  2O9K A;  4PXW A;  3RMZ D;  2H9P A;  3EI2 B;  3SBR A;  1MDA H;  4GMB A;  3AL8 B;  2AGY A;  2PBI B;  3BG1 A;  3K26 A;  1GP2 B;  4OZU A;  5B4W A;  4O3U B;  5H1M A;  4HDJ A;  3I7L A;  4NSX A;  1SHY B;  5CXB B;  2AGL A;  2H68 A;  2I3T A;  2YNO A;  4J79 A;  3RLM D;  1PEV A;  1XIP A;  4LGN A;  5IT9 g;  1B9Y A;  3CFV A;  5A2Q g;  3F3F A;  4CI1 A;  2CE9 A;  3F3P A;  2P9U C;  1RI6 A;  3NVX A;  1ERJ A;  4X63 B;  4CY1 A;  3JRP A;  3RRM C;  1JMZ B;  2Z2O A;  4H5J A;  5HE0 B;  3GFC A;  4J78 A;  4H5I A;  4UI9 R;  5EMJ B;  2H6Q A;  2CN3 A;  2HXC A;  2J55 H;  2MTA H;  3VGZ A;  4JSN C;  5EMM B;  5GXI A;  4D0K A;  4ESG A;  3I7K A;  2B4E A;  3J80 g;  3NVN A;  2HKR A;  3J81 g;  3DSM A;  3OTT A;  1NR0 A;  3DXM C;  4ZOX A;  1VYH C;  3PVW B;  4J84 A;  4FA4 D;  4E54 A;  3GRE A;  3SLE D;  2QXV A;  4A2M A;  2Z2P A;  4A09 A;  4TZ4 A;  4O3T B;  4Y5R D;  3PXS D;  4JT6 C;  4FAV D;  2H9L A;  5TEE A;  1PBY B;  4A0A B;  2OJY A;  4JSP C;  5H14 A;  2CE8 A;  4QT8 A;  3SFZ A;  4E54 B;  5I5I A;  1K32 A;  4GGA A;  4R7A B;  3N0D A;  3JB9 L;  2QC5 A;  1K8K C;  4XYH A;  5TEF A;  3PSC B;  3K27 A;  2P9N C;  5IJ7 E;  5C2W B;  5FQD A;  4FA9 D;  3A0F A;  3DWL C;  4CZV A;  4JT5 C;  3I8C A;  4L1Q D;  4E5Z A;  4XEI C;  3UVO A;  2UZX B;  1N6E A;  1A0R B;  3OKT A;  3UVK A;  3PE7 A;  2G9A A;  3OL2 A;  4L9O A;  4ERY A;  2YB8 B;  5KDO B;  4GQ1 A;  2OVP B;  1JJU B;  4JXM A;  2B5M A;  5CXC A;  4QQE A;  2CN2 A;  2CO0 C;  3C99 A;  5TF2 A;  3EI2 A;  3AFC A;  4O45 A;  1XHM A;  3AH8 B;  3U4Y A;  3SN6 B;  3CFS B;  2XL2 A;  3OL2 B;  3W15 A;  5JWZ A;  2GNQ A;  2IWK A;  4CI2 A;  2YNP A;  4LG9 A;  3EMH A;  4GM8 A;  5CXC B;  2W18 A;  2OVQ B;  4AEZ A;  5CXB A;  4J0W A;  4CY2 A;  3VH0 A;  1GXR A;  1N6F A;  5HQG A;  3PVU B;  3FRX A;  4X61 B;  2AGW A;  1OLZ A;  4CZX A;  3PSL A;  2GC4 A;  3EI1 B;  3SMR A;  1B9X A;  1GOT B;  4BH6 A;  4Z8L A;  5CYK A;  3MZL A;  3SVW D;  3JZG A;  4GM3 A;  3C9C A;  2GC7 A;  1TYQ C;  2H9M A;  3OW8 A;  4LG8 A;  3CIK B;  2TRC B;  5FKQ A;  1N6D A;  4ZOZ A;  3I7P A;  3I2N A;  5CYK B;  2XL3 A;  2I0S A;  3OKY B;  3UVL A;  3UKR C;  2AH0 A;  5EML B;  5AJA A;  1FWX A;  3SJL D;  2J57 G;  3FM0 A;  4ERQ A;  2I3S A;  3I89 A;  1Q47 A;  4A08 A;  1NEX B;  5TDH B;  5FKR A;  2I0R A;  2IUQ A;  2J56 H;  4GQ2 P;  4J81 A;  4A0A A;  4MK0 B;  2IWF A;  4PC0 A;  3ULE C;  3BG0 A;  4A08 B;  3IIW A;  3SXT D;  1QNI A;  5FA5 B;  2G99 A;  4J77 A;  5FLX g;  3IJ0 A;  3SCY A;  4X60 B;  4PBY A;  3MKS B;  4GGD A;  2H6N A;  2H6K A;  1YFQ A;  2H9N A;  5K19 A;  3MKQ A;  5K1C C;  1P22 A;  4OWR A;  3EI3 B;  5IJ8 E;  2PM7 B;  3L4M D;  4FA5 D;  3UR4 A;  5THA A;  5EAR A;  3UVN A;  5GMK n;  5FXY A;  5EMK B;  4J82 A;  5SXM A;  2HJB A;  1U2V C;  3N0E A;  4FAN D;  4GM9 A;  2H14 A;  1JOF A;  3VA6 A;  5IGO A;  2UZY B;  3EG6 A;  4CY5 A;  4EWR A;  5EAM A;  3DXK C;  3I7N A;  3JRO A;  4IMM A;  4ZOY A;  3BWS A;  2IUV A;  2YNN A;  3EU7 A;  3UVM A;  4FB1 D;  2P9P C;  3KRX B;  3EI1 A;  3FGB A;  4N14 A;  2CNX A;  3RFH A;  4U7A A;  5FKS A;  2IUP A;  4YVD A;  2AQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...