4D0KA

Complex of chaetomium thermophilum pan2 (wd40-cs1) with pan3 (c-term)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
345
structure length
329
Chain Sequence
b'MDADWDEVTRIAYPAPGTFPRPATAVAFDPIAELLWAGFDRGRVCSFYGRDLTRYTAFKIQPASEGPVRQFLFHDKGVIVLGTRSVHMAMRRGPALWNIRHENMKDLRCMSFTSKGTQEIIVAGWQDTMLVIDVLKGDIIKQIPAQHHYSIMKKSRYICAATKTGSVDLIDPLSFKIVRSWQAHASYINDMDAQNDFIVTCGGSYMLDPYVNVFDLKNMASMKPMPFPPLAAHVRLHPRMLTTAIVTSQHGQMHVVDIMNPNSSTVRYANISSYVKLFEIAPSGEALVIGDADCNIHLWGSPTKIHFTDMAIPIELPEPVLDWSETPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Gene regulation
total genus 66
structure length 329
sequence length 345
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4d0kA01
2AGWA 4U1EI 2Z2NA 5HE3B 3ULEC 4GM9A 3MKQA 5CXBA 4CZYA 2BCJB 5C9ZB 2CN2A 4J73A 4FA1D 4ESGA 5C2VB 3SJLD 1SHYB 3KRXB 4Y5RD 2H14A 5AJAA 3SXTD 4QT8A 4O1QD 4J0WA 4X3EA 1PEVA 2H9MA 3OKTA 5TF2A 3EI1B 2HXCA 5C2WB 3L4MD 4J8GA 3AL8B 1FWXA 3EI4A 4XEIC 3V7DB 2CNXA 3E0CA 3UVNA 1U2VC 5THAA 3JAMg 3PXWD 3N0EA 2AH0A 3JRPA 5FKSA 1TYQC 3OKYB 4FHLA 3I8EA 3KRWB 2OK6A 3OL2B 3AL9A 5AFU3 2B4EA 5HQGA 4JT6C 5I5MA 5K1CC 2XYIA 4GZ8A 3V9FA 3EU7A 1JMZB 3SBPA 4FA4D 5HE1B 2QC5A 3PSCB 4A2MA 3MMYA 1GOTB 2I3TA 5CYKA 5IT9g 3ZWLB 5GXIA 4BL0A 3PVWB 1A0RB 3V5WB 4PBYA 4X60B 2HESX 4XYHA 3F3GA 1MDAH 1YFQA 1QNIA 4J82A 3L4OD 2CE8A 3ODTA 5SXMA 4O3TB 2GC7A 4H5JA 5CXCA 1OLZA 4CY2A 2H9PA 1NR0A 2YNPA 2HJ4A 3I7HA 1K32A 4D0KA 2P9SC 5EM2A 4PSWB 4ERQA 3SBRA 3JZHA 5JWZA 2P9PC 2IAAA 5FKTA 1ERJA 2J57G 3FGBA 4CY1A 4A0AB 3MXXA 2AGYA 1PBYB 1MG3A 3SMRA 1K8KC 3BG0A 3UVLA 5HYNB 3IIYA 3K26A 4R7AB 3OKWA 2I0RA 4JSXC 4LG9A 3JPXA 2TRCB 2OJYA 5EM2B 4L1QD 1SQ9A 4CI3A 4CI1A 3F3FA 2GC4A 2I3SA 3EI1A 2B5MA 2PBIB 3UKRC 3CFVA 2P9NC 3AL8A 3BG1A 5EMLB 3SFZA 1B9YA 4GGAA 3I2NA 3DXMC 3SN6B 1XHMA 5GXHA 2UZYB 5EAMA 4JSVC 3GREA 3FM0A 3EMHA 3OKYA 2OVPB 4L9OA 3VA6A 4A08B 1NEXB 3UR4A 3OL2A 4GQBB 3UVMA 3PXTD 4QRJA 5FLXg 4J8BA 3OW8A 1P22A 2PM9B 2Z2PA 2P9IC 3PVUB 4JSNC 4CY3A 3UVKA 1TBGA 3AH8B 5B4WA 3W15A 1JJUB 2B5LA 2YMUA 3RFHA 3ORVD 1GG2B 3I7LA 1MG2A 2Q7QA 4CI2A 1PGUA 3RMZD 1R5MA 4JXMA 4O3UB 3UVOA 1XKSA 2PM7B 4IMMA 3DSMA 4QQEA 3SHFA 1B9XA 3MZKA 3A0FA 3CFSB 3NVXA 2HKMA 2YB8B 3J81g 5A2Qg 4JSPC 2EBSA 4ES0A 3I7OA 4ZOZA 2H6QA 2I0SA 3JZNA 5AMSA 4D6VA 1GP2B 4OWRA 4X63B 2P9KC 5TDHB 4A0AA 3RN0D 3C99A 4GM8A 2XL2A 1VYHC 2CO0A 1PI6A 4CI8A 4HDJA 5GMKn 1JMXB 2QXVA 2Z2OA 2MTAH 4ZN4A 4N14A 5HE0B 2G9AA 3EI3B 4E5ZB 3BWSA 2CE9A 5I5JA 2B5NA 2HYEA 2P9UC 1Q47A 4L3HD 4CZXA 2CN3A 2IUVA 3UKUC 3AFCA 4E54B 5H1MA 4J79A 4ZOVA 4A0BB 3I7KA 3RRMC 4A09B 3I8CA 3PSLA 4J78A 4YVDA 4H5IA 3NVQA 5FKQA 2XU7A 4FAVD 5IJ8E 4UI9R 5FA5B 4A08A 5FXYA 3F3PA 4ERYA 2H13A 4CY5A 4J77A 3VH0A 2UZXB 3SBQA 2PM6B 5EALA 4L3GD 2BBKH 3HFQA 2PM9A 4J81A 3IIWA 2AGZA 3EWEA 3IJCA 2GNQA 4ZOXA 4PXWA 3IKOA 4A2LA 1N6FA 4K3JB 5GSAA 4PNKB 2H6NA 5IGOA 1RI6A 4J0XA 4ERZA 4FA5D 3EG6A 5IGQA 2H6KA 1N6DA 4FB1D 2J56H 2W18A 2OK4A 1GXRA 2AGLA 2YBAA 4PC0A 2AGXA 4O45A 2IUPA 3OTTA 2IWKA 2H3XA 2J55H 5H14A 3GFCA 4A11B 5EAPA 3PXSD 4GGCA 3EI2B 4J87A 1JOFA 2OVRB 3FRXA 3MKSB 3U4YA 1SQJA 3JZGA 5I5IA 3K27A 3SCYA 4FAND 2I0TA 3B7FA 4AEZA 5CXBB 2AH1A 2YNNA 4JT5C 5FKRA 3PE7A 2YNOA 1U4CA 5IC7A 4PBZA 4K3ID 2CO0C 4QL1A 4Y7RA 4KFMB 2H9NA 3JROA 5FQDA 3EI3A 4I79A 4E5ZA 1L0QA 3DM0A 4LG8A 2XL3A 5TEFA 2IUQA 3C9CA 4GQ1A 3DXKC 3I89A 3RSEC 1N6EA 3EI4B 3IJ0A 3C5MA 5EMMB 5EMKB 4JD2C 4E54A 4A0BA 4J86A 4A09A 4GM3A 3SVWD 3CIKB 3SLED 3RN1D 2OIZA 4X61B 1S4UX 5KDOB 3VGZA 4GGDA 4CZVA 5EMJB 2H47A 3P4FA 3C75H 4MK0B 4Z8LA 3MZLA 5IJ7E 4CC9A 5EARA 4J84A 3JB9L 3NVNA 3N0DA 2HKRA 3I7PA 2AQ5A 4IA9A 5CYKB 5TEEA 1OMWB 4BH6A 2O9KA 2OVQB 5K19A 4BUJC 2IWFA 3IJ1A 4GMBA 4O9DA 3I7NA 4G56B 4EWRA 1XIPA 4FWWA 5CXCB 4OZUA 4FA9D 2H9LA 2IURA 5HE2B 5H17A 4NSXA 4PSXB 4TZ4A 2H68A 4XYIA 4GQ2P 4A7JA 2P9LC 4A11A 3RLMD 2HJBA 3RFGA 3EI2A 3DWLC 2G99A 4ZOYA 4U7AA 4AOWA 3SWSD 4LGNA 3J80g
chains in the Genus database with same CATH superfamily
2AGWA 4U1EI 5E6UA 2Z2NA 5HE3B 3ULEC 4GM9A 3MKQA 5C86A 5CXBA 4G1MA 4CZYA 2BCJB 5C9ZB 2HU5A 2CN2A 4J73A 4FA1D 1H2WA 4AMZA 2EIBA 4ESGA 5C2VB 2VDPA 3SJLD 1SHYB 3KRXB 4Y5RD 4DNUA 2H14A 5AJAA 3KCIA 3SXTD 4QT8A 4O1QD 3O4GA 4J0WA 4X3EA 2HU8A 2VDOA 1PEVA 2EIEA 2H9MA 3OKTA 5TF2A 3EI1B 1O6FA 2HXCA 3EQ9A 5C2WB 3L4MD 4J8GA 3AL8B 1FWXA 3EI4A 4XEIC 3V7DB 2CNXA 3E0CA 3UVNA 3QHYB 4G1EA 5FFOA 1U2VC 3ZE2A 5THAA 4JHPC 3JAMg 3PXWD 5C92A 3N0EA 2AH0A 3JRPA 3NIGA 4WK4A 5FKSA 1E8NA 1TYQC 3OKYB 4WK2A 4FHLA 3I8EA 3KRWB 2OK6A 4WK0A 3OL2B 3V4PA 3AL9A 5AFU3 2B4EA 5HQGA 4JT6C 1BPOA 5I5MA 4QAMA 5K1CC 2XYIA 4GZ8A 3V9FA 3EU7A 3ZE1A 1JV2A 1JMZB 1YR2A 3SBPA 4FA4D 3IUNA 1U8CA 2QC5A 5HE1B 3PSCB 4A2MA 3MMYA 1GOTB 2I3TA 5CYKA 5IT9g 3ZWLB 4NBMA 5GXIA 4BL0A 3PVWB 1A0RB 3VI4A 3V5WB 4PBYA 4X60B 2HESX 4XYHA 3F3GA 1MDAH 1YFQA 1QNIA 4J82A 3L4OD 2CE8A 3ODTA 5SXMA 4O3TB 5HDBA 2GC7A 4H5JA 5CXCA 1OLZA 4AX4A 4CY2A 1H2XA 2H9PA 1NR0A 2YNPA 2HJ4A 3IUJA 3MUOA 4WJKA 3I7HA 1K32A 4D0KA 2P9SC 5EM2A 4PSWB 2XDWA 4ERQA 2VC2A 3SBRA 3JZHA 5JWZA 2P9PC 2IAAA 4JHNA 5FKTA 1TYEA 1ERJA 2J57G 3FGBA 4CY1A 4A0AB 3MXXA 2AGYA 1PBYB 1MG3A 1UOOA 3SMRA 1C9LA 1K8KC 1H2ZA 3BG0A 3UVLA 3T3MA 5HYNB 3IIYA 3K26A 4R7AB 4DNWA 3OKWA 2I0RA 3IULA 4JSXC 3GD1I 4BCDA 4LG9A 3JPXA 2TRCB 2OJYA 5EM2B 4L1QD 1SQ9A 4CI3A 4CI1A 3MVDK 3F3FA 3NIDA 2GC4A 1E5TA 1VZ2A 2I3SA 3EI1A 2B5MA 2PBIB 3NIFA 4BCBA 3UKRC 3CFVA 2P9NC 3AL8A 3BG1A 5EMLB 3SFZA 1B9YA 4GGAA 3I2NA 3DXMC 3SN6B 2VDMA 1XHMA 5GXHA 3IUMA 4L1MA 2UZYB 4UM8A 2EICA 3GC3B 5EAMA 4JSVC 3GREA 3O4JA 3FM0A 3EMHA 3OKYA 4BCCA 2OVPB 4L9OA 3VA6A 4A08B 1T2XA 1NEXB 3UR4A 3OL2A 4GQBB 3UVMA 3PXTD 4QRJA 5FLXg 4J8BA 3OW8A 1P22A 2PM9B 2Z2PA 3K71A 3ZDZA 2P9IC 3PVUB 2VZ1A 2BKLA 4JSNC 1O6GA 4CY3A 3UVKA 1TBGA 3AH8B 5B4WA 2XZGA 3W15A 2QZPA 1JJUB 2B5LA 2YMUA 3RFHA 1K3IA 4G55A 3ORVD 1GG2B 3I7LA 1MG2A 2Q7QA 4CI2A 1PGUA 3RMZD 1R5MA 4JXMA 4O3UB 3UVOA 1XKSA 2PM7B 4IMMA 3DSMA 4QQEA 3K72A 3SHFA 1B9XA 3MZKA 1GOHA 1VZ3A 3A0FA 3CFSB 3NVXA 2HKMA 2YB8B 1GOFA 2VDQA 3J81g 5A2Qg 4JSPC 2EBSA 5E6SA 4ES0A 3I7OA 4ZOZA 2H6QA 2I0SA 3JZNA 4BP8A 5AMSA 4D6VA 4D9SA 1GP2B 4OWRA 2QR5A 3EQ8A 4X63B 4MMZA 2HU7A 2P9KC 3QI0A 5TDHB 4A0AA 5M5SA 3RN0D 3C99A 4GM8A 2XL2A 1VYHC 2CO0A 1PI6A 4CI8A 3IURA 4HDJA 5GMKn 1JMXB 4DNVA 2QXVA 5E6RA 2Z2OA 2MTAH 4ZN4A 4N14A 5HE0B 2G9AA 3V4VA 3EI3B 4E5ZB 3BWSA 2CE9A 5I5JA 1A12A 2B5NA 5M5VA 2HYEA 2P9UC 1M1XA 1Q47A 4L3HD 4CZXA 2EIDA 2VDNA 3EQ7A 2CN3A 2IUVA 3O4IA 1UTCA 4MMXA 3UKUC 3AFCA 4E54B 3FCUA 5H1MA 4J79A 4ZOVA 4A0BB 3I7KA 3RRMC 4A09B 4UM9A 3I8CA 1UOQA 3K6SA 2VDKA 3PSLA 4J78A 4YVDA 4H5IA 3NVQA 5FKQA 2XU7A 3ZDYA 4FAVD 5IJ8E 4UI9R 5FA5B 4A08A 5FXYA 3F3PA 2VDRA 4ERYA 2H13A 4CY5A 4J77A 3VH0A 2UZXB 3SBQA 2PM6B 5EALA 4L3GD 2BBKH 3HFQA 2PM9A 4J81A 3IIWA 2AGZA 3EWEA 3IJCA 2GNQA 4ZOXA 4PXWA 3IKOA 4A2LA 1I2MB 5FFGA 1N6FA 4K3JB 5GSAA 4PNKB 2H6NA 5IGOA 4Z7QA 1RI6A 4J0XA 4ERZA 4FA5D 3OF7A 3IJEA 3EG6A 2WQ8A 5IGQA 2H6KA 1N6DA 4FB1D 2J56H 1C9IA 2W18A 2OK4A 1GXRA 2AGLA 2YBAA 3O4HA 1E8MA 4PC0A 2AGXA 4Z7OA 4O45A 3MUNA 2IUPA 2IWKA 2H3XA 3OTTA 2J55H 5H14A 3GFCA 4A11B 5EAPA 3PXSD 4GGCA 3EI2B 4J87A 1JOFA 4O02A 2OVRB 3FRXA 4AMYA 3MKSB 3U4YA 1SQJA 3JZGA 5I5IA 3K27A 3SCYA 4FAND 2I0TA 4O2WA 3B7FA 4MMYA 4AN1A 4AEZA 5CXBB 2AH1A 2YNNA 4JT5C 5FKRA 3PE7A 2YNOA 2JKXA 1U4CA 5IC7A 4PBZA 5M5RA 4K3ID 2CO0C 4QL1A 4Y7RA 4KFMB 2H9NA 3JROA 5FQDA 3EI3A 4I79A 4E5ZA 1L0QA 3FCSA 3ZDXA 3DM0A 4IRZA 4LG8A 2XL3A 5TEFA 2XE4A 3C9CA 2IUQA 4GQ1A 1QFMA 1QFSA 3DXKC 3I89A 3RSEC 1GOGA 1N6EA 3IJ0A 3EI4B 3C5MA 3T3PA 1H2YA 1L5GA 5EMMB 5EMKB 3IUQA 4JD2C 4NC4A 1JTDB 2VDLA 4E54A 4A0BA 4J86A 5M61A 4A09A 4GM3A 4Z7NA 3SVWD 3CIKB 3SLED 3RN1D 2OIZA 4RE6A 4X61B 4NAAA 1S4UX 5KDOB 3VGZA 4GGDA 4CZVA 5EMJB 2H47A 3P4FA 3C75H 4MK0B 4Z8LA 3MZLA 5IJ7E 4CC9A 5EARA 4J84A 5M5TA 3JB9L 2VZ3A 3NVNA 3N0DA 2HKRA 3I7PA 2AQ5A 3IVMA 4AN0A 4IA9A 5CYKB 5TEEA 1OMWB 1VE7A 4BH6A 2O9KA 2OVQB 5K19A 4BUJC 5M5UA 2IWFA 3IJ1A 4GMBA 1VE6A 4O9DA 3I7NA 4G56B 4EWRA 1XIPA 4FWWA 5CXCB 3DDUA 4OZUA 4FA9D 2H9LA 2IURA 5HE2B 5H17A 4NSXA 4PSXB 4TZ4A 2H68A 4XYIA 4GQ2P 3ZE0A 4A7JA 4RE5A 2P9LC 1UOPA 4A11A 3RLMD 4NENA 2HJBA 3RFGA 3VI3A 3EI2A 4BP9A 3DWLC 2G99A 4ZOYA 4U7AA 4AOWA 3SWSD 4LGNA 3J80g
chains in the Genus database with same CATH topology
2AGWA 4U1EI 2Z2NA 5HE3B 3ULEC 4GM9A 3MKQA 5CXBA 4CZYA 2BCJB 5C9ZB 2CN2A 4J73A 4FA1D 4ESGA 5C2VB 3SJLD 1SHYB 3KRXB 4Y5RD 2H14A 5AJAA 3SXTD 4QT8A 4O1QD 4J0WA 4X3EA 1PEVA 2H9MA 3OKTA 5TF2A 3EI1B 2HXCA 5C2WB 3L4MD 4J8GA 3AL8B 1FWXA 3EI4A 4XEIC 3V7DB 2CNXA 3E0CA 3UVNA 1U2VC 5THAA 3JAMg 3PXWD 3N0EA 2AH0A 3JRPA 5FKSA 1TYQC 3OKYB 4FHLA 3I8EA 3KRWB 2OK6A 3OL2B 3AL9A 5AFU3 2B4EA 5HQGA 4JT6C 5I5MA 5K1CC 2XYIA 4GZ8A 3V9FA 3EU7A 1JMZB 3SBPA 4FA4D 5HE1B 2QC5A 3PSCB 4A2MA 3MMYA 1GOTB 2I3TA 5CYKA 5IT9g 3ZWLB 5GXIA 4BL0A 3PVWB 1A0RB 3V5WB 4PBYA 4X60B 2HESX 4XYHA 3F3GA 1MDAH 1YFQA 1QNIA 4J82A 3L4OD 2CE8A 3ODTA 5SXMA 4O3TB 2GC7A 4H5JA 5CXCA 1OLZA 4CY2A 2H9PA 1NR0A 2YNPA 2HJ4A 3I7HA 1K32A 4D0KA 2P9SC 5EM2A 4PSWB 4ERQA 3SBRA 3JZHA 5JWZA 2P9PC 2IAAA 5FKTA 1ERJA 2J57G 3FGBA 4CY1A 4A0AB 3MXXA 2AGYA 1PBYB 1MG3A 3SMRA 1K8KC 3BG0A 3UVLA 5HYNB 3IIYA 3K26A 4R7AB 3OKWA 2I0RA 4JSXC 4LG9A 3JPXA 2TRCB 2OJYA 5EM2B 4L1QD 1SQ9A 4CI3A 4CI1A 3F3FA 2GC4A 2I3SA 3EI1A 2B5MA 2PBIB 3UKRC 3CFVA 2P9NC 3AL8A 3BG1A 5EMLB 3SFZA 1B9YA 4GGAA 3I2NA 3DXMC 3SN6B 1XHMA 5GXHA 2UZYB 5EAMA 4JSVC 3GREA 3FM0A 3EMHA 3OKYA 2OVPB 4L9OA 3VA6A 4A08B 1NEXB 3UR4A 3OL2A 4GQBB 3UVMA 3PXTD 4QRJA 5FLXg 4J8BA 3OW8A 1P22A 2PM9B 2Z2PA 2P9IC 3PVUB 4JSNC 4CY3A 3UVKA 1TBGA 3AH8B 5B4WA 3W15A 1JJUB 2B5LA 2YMUA 3RFHA 3ORVD 1GG2B 3I7LA 1MG2A 2Q7QA 4CI2A 1PGUA 3RMZD 1R5MA 4JXMA 4O3UB 3UVOA 1XKSA 2PM7B 4IMMA 3DSMA 4QQEA 3SHFA 1B9XA 3MZKA 3A0FA 3CFSB 3NVXA 2HKMA 2YB8B 3J81g 5A2Qg 4JSPC 2EBSA 4ES0A 3I7OA 4ZOZA 2H6QA 2I0SA 3JZNA 5AMSA 4D6VA 1GP2B 4OWRA 4X63B 2P9KC 5TDHB 4A0AA 3RN0D 3C99A 4GM8A 2XL2A 1VYHC 2CO0A 1PI6A 4CI8A 4HDJA 5GMKn 1JMXB 2QXVA 2Z2OA 2MTAH 4ZN4A 4N14A 5HE0B 2G9AA 3EI3B 4E5ZB 3BWSA 2CE9A 5I5JA 2B5NA 2HYEA 2P9UC 1Q47A 4L3HD 4CZXA 2CN3A 2IUVA 3UKUC 3AFCA 4E54B 5H1MA 4J79A 4ZOVA 4A0BB 3I7KA 3RRMC 4A09B 3I8CA 3PSLA 4J78A 4YVDA 4H5IA 3NVQA 5FKQA 2XU7A 4FAVD 5IJ8E 4UI9R 5FA5B 4A08A 5FXYA 3F3PA 4ERYA 2H13A 4CY5A 4J77A 3VH0A 2UZXB 3SBQA 2PM6B 5EALA 4L3GD 2BBKH 3HFQA 2PM9A 4J81A 3IIWA 2AGZA 3EWEA 3IJCA 2GNQA 4ZOXA 4PXWA 3IKOA 4A2LA 1N6FA 4K3JB 5GSAA 4PNKB 2H6NA 5IGOA 1RI6A 4J0XA 4ERZA 4FA5D 3EG6A 5IGQA 2H6KA 1N6DA 4FB1D 2J56H 2W18A 2OK4A 1GXRA 2AGLA 2YBAA 4PC0A 2AGXA 4O45A 2IUPA 3OTTA 2IWKA 2H3XA 2J55H 5H14A 3GFCA 4A11B 5EAPA 3PXSD 4GGCA 3EI2B 4J87A 1JOFA 2OVRB 3FRXA 3MKSB 3U4YA 1SQJA 3JZGA 5I5IA 3K27A 3SCYA 4FAND 2I0TA 3B7FA 4AEZA 5CXBB 2AH1A 2YNNA 4JT5C 5FKRA 3PE7A 2YNOA 1U4CA 5IC7A 4PBZA 4K3ID 2CO0C 4QL1A 4Y7RA 4KFMB 2H9NA 3JROA 5FQDA 3EI3A 4I79A 4E5ZA 1L0QA 3DM0A 4LG8A 2XL3A 5TEFA 2IUQA 3C9CA 4GQ1A 3DXKC 3I89A 3RSEC 1N6EA 3EI4B 3IJ0A 3C5MA 5EMMB 5EMKB 4JD2C 4E54A 4A0BA 4J86A 4A09A 4GM3A 3SVWD 3CIKB 3SLED 3RN1D 2OIZA 4X61B 1S4UX 5KDOB 3VGZA 4GGDA 4CZVA 5EMJB 2H47A 3P4FA 3C75H 4MK0B 4Z8LA 3MZLA 5IJ7E 4CC9A 5EARA 4J84A 3JB9L 3NVNA 3N0DA 2HKRA 3I7PA 2AQ5A 4IA9A 5CYKB 5TEEA 1OMWB 4BH6A 2O9KA 2OVQB 5K19A 4BUJC 2IWFA 3IJ1A 4GMBA 4O9DA 3I7NA 4G56B 4EWRA 1XIPA 4FWWA 5CXCB 4OZUA 4FA9D 2H9LA 2IURA 5HE2B 5H17A 4NSXA 4PSXB 4TZ4A 2H68A 4XYIA 4GQ2P 4A7JA 2P9LC 4A11A 3RLMD 2HJBA 3RFGA 3EI2A 3DWLC 2G99A 4ZOYA 4U7AA 4AOWA 3SWSD 4LGNA 3J80g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW A;  4U1E I;  2Z2N A;  5HE3 B;  3ULE C;  4GM9 A;  3MKQ A;  5CXB A;  4CZY A;  2BCJ B;  5C9Z B;  2CN2 A;  4J73 A;  4FA1 D;  4ESG A;  5C2V B;  3SJL D;  1SHY B;  3KRX B;  4Y5R D;  2H14 A;  5AJA A;  3SXT D;  4QT8 A;  4O1Q D;  4J0W A;  4X3E A;  1PEV A;  2H9M A;  3OKT A;  5TF2 A;  3EI1 B;  2HXC A;  5C2W B;  3L4M D;  4J8G A;  3AL8 B;  1FWX A;  3EI4 A;  4XEI C;  3V7D B;  2CNX A;  3E0C A;  3UVN A;  1U2V C;  5THA A;  3JAM g;  3PXW D;  3N0E A;  2AH0 A;  3JRP A;  5FKS A;  1TYQ C;  3OKY B;  4FHL A;  3I8E A;  3KRW B;  2OK6 A;  3OL2 B;  3AL9 A;  5AFU 3;  2B4E A;  5HQG A;  4JT6 C;  5I5M A;  5K1C C;  2XYI A;  4GZ8 A;  3V9F A;  3EU7 A;  1JMZ B;  3SBP A;  4FA4 D;  5HE1 B;  2QC5 A;  3PSC B;  4A2M A;  3MMY A;  1GOT B;  2I3T A;  5CYK A;  5IT9 g;  3ZWL B;  5GXI A;  4BL0 A;  3PVW B;  1A0R B;  3V5W B;  4PBY A;  4X60 B;  2HES X;  4XYH A;  3F3G A;  1MDA H;  1YFQ A;  1QNI A;  4J82 A;  3L4O D;  2CE8 A;  3ODT A;  5SXM A;  4O3T B;  2GC7 A;  4H5J A;  5CXC A;  1OLZ A;  4CY2 A;  2H9P A;  1NR0 A;  2YNP A;  2HJ4 A;  3I7H A;  1K32 A;  4D0K A;  2P9S C;  5EM2 A;  4PSW B;  4ERQ A;  3SBR A;  3JZH A;  5JWZ A;  2P9P C;  2IAA A;  5FKT A;  1ERJ A;  2J57 G;  3FGB A;  4CY1 A;  4A0A B;  3MXX A;  2AGY A;  1PBY B;  1MG3 A;  3SMR A;  1K8K C;  3BG0 A;  3UVL A;  5HYN B;  3IIY A;  3K26 A;  4R7A B;  3OKW A;  2I0R A;  4JSX C;  4LG9 A;  3JPX A;  2TRC B;  2OJY A;  5EM2 B;  4L1Q D;  1SQ9 A;  4CI3 A;  4CI1 A;  3F3F A;  2GC4 A;  2I3S A;  3EI1 A;  2B5M A;  2PBI B;  3UKR C;  3CFV A;  2P9N C;  3AL8 A;  3BG1 A;  5EML B;  3SFZ A;  1B9Y A;  4GGA A;  3I2N A;  3DXM C;  3SN6 B;  1XHM A;  5GXH A;  2UZY B;  5EAM A;  4JSV C;  3GRE A;  3FM0 A;  3EMH A;  3OKY A;  2OVP B;  4L9O A;  3VA6 A;  4A08 B;  1NEX B;  3UR4 A;  3OL2 A;  4GQB B;  3UVM A;  3PXT D;  4QRJ A;  5FLX g;  4J8B A;  3OW8 A;  1P22 A;  2PM9 B;  2Z2P A;  2P9I C;  3PVU B;  4JSN C;  4CY3 A;  3UVK A;  1TBG A;  3AH8 B;  5B4W A;  3W15 A;  1JJU B;  2B5L A;  2YMU A;  3RFH A;  3ORV D;  1GG2 B;  3I7L A;  1MG2 A;  2Q7Q A;  4CI2 A;  1PGU A;  3RMZ D;  1R5M A;  4JXM A;  4O3U B;  3UVO A;  1XKS A;  2PM7 B;  4IMM A;  3DSM A;  4QQE A;  3SHF A;  1B9X A;  3MZK A;  3A0F A;  3CFS B;  3NVX A;  2HKM A;  2YB8 B;  3J81 g;  5A2Q g;  4JSP C;  2EBS A;  4ES0 A;  3I7O A;  4ZOZ A;  2H6Q A;  2I0S A;  3JZN A;  5AMS A;  4D6V A;  1GP2 B;  4OWR A;  4X63 B;  2P9K C;  5TDH B;  4A0A A;  3RN0 D;  3C99 A;  4GM8 A;  2XL2 A;  1VYH C;  2CO0 A;  1PI6 A;  4CI8 A;  4HDJ A;  5GMK n;  1JMX B;  2QXV A;  2Z2O A;  2MTA H;  4ZN4 A;  4N14 A;  5HE0 B;  2G9A A;  3EI3 B;  4E5Z B;  3BWS A;  2CE9 A;  5I5J A;  2B5N A;  2HYE A;  2P9U C;  1Q47 A;  4L3H D;  4CZX A;  2CN3 A;  2IUV A;  3UKU C;  3AFC A;  4E54 B;  5H1M A;  4J79 A;  4ZOV A;  4A0B B;  3I7K A;  3RRM C;  4A09 B;  3I8C A;  3PSL A;  4J78 A;  4YVD A;  4H5I A;  3NVQ A;  5FKQ A;  2XU7 A;  4FAV D;  5IJ8 E;  4UI9 R;  5FA5 B;  4A08 A;  5FXY A;  3F3P A;  4ERY A;  2H13 A;  4CY5 A;  4J77 A;  3VH0 A;  2UZX B;  3SBQ A;  2PM6 B;  5EAL A;  4L3G D;  2BBK H;  3HFQ A;  2PM9 A;  4J81 A;  3IIW A;  2AGZ A;  3EWE A;  3IJC A;  2GNQ A;  4ZOX A;  4PXW A;  3IKO A;  4A2L A;  1N6F A;  4K3J B;  5GSA A;  4PNK B;  2H6N A;  5IGO A;  1RI6 A;  4J0X A;  4ERZ A;  4FA5 D;  3EG6 A;  5IGQ A;  2H6K A;  1N6D A;  4FB1 D;  2J56 H;  2W18 A;  2OK4 A;  1GXR A;  2AGL A;  2YBA A;  4PC0 A;  2AGX A;  4O45 A;  2IUP A;  3OTT A;  2IWK A;  2H3X A;  2J55 H;  5H14 A;  3GFC A;  4A11 B;  5EAP A;  3PXS D;  4GGC A;  3EI2 B;  4J87 A;  1JOF A;  2OVR B;  3FRX A;  3MKS B;  3U4Y A;  1SQJ A;  3JZG A;  5I5I A;  3K27 A;  3SCY A;  4FAN D;  2I0T A;  3B7F A;  4AEZ A;  5CXB B;  2AH1 A;  2YNN A;  4JT5 C;  5FKR A;  3PE7 A;  2YNO A;  1U4C A;  5IC7 A;  4PBZ A;  4K3I D;  2CO0 C;  4QL1 A;  4Y7R A;  4KFM B;  2H9N A;  3JRO A;  5FQD A;  3EI3 A;  4I79 A;  4E5Z A;  1L0Q A;  3DM0 A;  4LG8 A;  2XL3 A;  5TEF A;  2IUQ A;  3C9C A;  4GQ1 A;  3DXK C;  3I89 A;  3RSE C;  1N6E A;  3EI4 B;  3IJ0 A;  3C5M A;  5EMM B;  5EMK B;  4JD2 C;  4E54 A;  4A0B A;  4J86 A;  4A09 A;  4GM3 A;  3SVW D;  3CIK B;  3SLE D;  3RN1 D;  2OIZ A;  4X61 B;  1S4U X;  5KDO B;  3VGZ A;  4GGD A;  4CZV A;  5EMJ B;  2H47 A;  3P4F A;  3C75 H;  4MK0 B;  4Z8L A;  3MZL A;  5IJ7 E;  4CC9 A;  5EAR A;  4J84 A;  3JB9 L;  3NVN A;  3N0D A;  2HKR A;  3I7P A;  2AQ5 A;  4IA9 A;  5CYK B;  5TEE A;  1OMW B;  4BH6 A;  2O9K A;  2OVQ B;  5K19 A;  4BUJ C;  2IWF A;  3IJ1 A;  4GMB A;  4O9D A;  3I7N A;  4G56 B;  4EWR A;  1XIP A;  4FWW A;  5CXC B;  4OZU A;  4FA9 D;  2H9L A;  2IUR A;  5HE2 B;  5H17 A;  4NSX A;  4PSX B;  4TZ4 A;  2H68 A;  4XYI A;  4GQ2 P;  4A7J A;  2P9L C;  4A11 A;  3RLM D;  2HJB A;  3RFG A;  3EI2 A;  3DWL C;  2G99 A;  4ZOY A;  4U7A A;  4AOW A;  3SWS D;  4LGN A;  3J80 g; 
#chains in the Genus database with same CATH topology
 2AGW A;  4U1E I;  5E6U A;  2Z2N A;  5HE3 B;  3ULE C;  4GM9 A;  3MKQ A;  5C86 A;  5CXB A;  4G1M A;  4CZY A;  2BCJ B;  5C9Z B;  2HU5 A;  2CN2 A;  4J73 A;  4FA1 D;  1H2W A;  4AMZ A;  2EIB A;  4ESG A;  5C2V B;  2VDP A;  3SJL D;  1SHY B;  3KRX B;  4Y5R D;  4DNU A;  2H14 A;  5AJA A;  3KCI A;  3SXT D;  4QT8 A;  4O1Q D;  3O4G A;  4J0W A;  4X3E A;  2HU8 A;  2VDO A;  1PEV A;  2EIE A;  2H9M A;  3OKT A;  5TF2 A;  3EI1 B;  1O6F A;  2HXC A;  3EQ9 A;  5C2W B;  3L4M D;  4J8G A;  3AL8 B;  1FWX A;  3EI4 A;  4XEI C;  3V7D B;  2CNX A;  3E0C A;  3UVN A;  3QHY B;  4G1E A;  5FFO A;  1U2V C;  3ZE2 A;  5THA A;  4JHP C;  3JAM g;  3PXW D;  5C92 A;  3N0E A;  2AH0 A;  3JRP A;  3NIG A;  4WK4 A;  5FKS A;  1E8N A;  1TYQ C;  3OKY B;  4WK2 A;  4FHL A;  3I8E A;  3KRW B;  2OK6 A;  4WK0 A;  3OL2 B;  3V4P A;  3AL9 A;  5AFU 3;  2B4E A;  5HQG A;  4JT6 C;  1BPO A;  5I5M A;  4QAM A;  5K1C C;  2XYI A;  4GZ8 A;  3V9F A;  3EU7 A;  3ZE1 A;  1JV2 A;  1JMZ B;  1YR2 A;  3SBP A;  4FA4 D;  3IUN A;  1U8C A;  2QC5 A;  5HE1 B;  3PSC B;  4A2M A;  3MMY A;  1GOT B;  2I3T A;  5CYK A;  5IT9 g;  3ZWL B;  4NBM A;  5GXI A;  4BL0 A;  3PVW B;  1A0R B;  3VI4 A;  3V5W B;  4PBY A;  4X60 B;  2HES X;  4XYH A;  3F3G A;  1MDA H;  1YFQ A;  1QNI A;  4J82 A;  3L4O D;  2CE8 A;  3ODT A;  5SXM A;  4O3T B;  5HDB A;  2GC7 A;  4H5J A;  5CXC A;  1OLZ A;  4AX4 A;  4CY2 A;  1H2X A;  2H9P A;  1NR0 A;  2YNP A;  2HJ4 A;  3IUJ A;  3MUO A;  4WJK A;  3I7H A;  1K32 A;  4D0K A;  2P9S C;  5EM2 A;  4PSW B;  2XDW A;  4ERQ A;  2VC2 A;  3SBR A;  3JZH A;  5JWZ A;  2P9P C;  2IAA A;  4JHN A;  5FKT A;  1TYE A;  1ERJ A;  2J57 G;  3FGB A;  4CY1 A;  4A0A B;  3MXX A;  2AGY A;  1PBY B;  1MG3 A;  1UOO A;  3SMR A;  1C9L A;  1K8K C;  1H2Z A;  3BG0 A;  3UVL A;  3T3M A;  5HYN B;  3IIY A;  3K26 A;  4R7A B;  4DNW A;  3OKW A;  2I0R A;  3IUL A;  4JSX C;  3GD1 I;  4BCD A;  4LG9 A;  3JPX A;  2TRC B;  2OJY A;  5EM2 B;  4L1Q D;  1SQ9 A;  4CI3 A;  4CI1 A;  3MVD K;  3F3F A;  3NID A;  2GC4 A;  1E5T A;  1VZ2 A;  2I3S A;  3EI1 A;  2B5M A;  2PBI B;  3NIF A;  4BCB A;  3UKR C;  3CFV A;  2P9N C;  3AL8 A;  3BG1 A;  5EML B;  3SFZ A;  1B9Y A;  4GGA A;  3I2N A;  3DXM C;  3SN6 B;  2VDM A;  1XHM A;  5GXH A;  3IUM A;  4L1M A;  2UZY B;  4UM8 A;  2EIC A;  3GC3 B;  5EAM A;  4JSV C;  3GRE A;  3O4J A;  3FM0 A;  3EMH A;  3OKY A;  4BCC A;  2OVP B;  4L9O A;  3VA6 A;  4A08 B;  1T2X A;  1NEX B;  3UR4 A;  3OL2 A;  4GQB B;  3UVM A;  3PXT D;  4QRJ A;  5FLX g;  4J8B A;  3OW8 A;  1P22 A;  2PM9 B;  2Z2P A;  3K71 A;  3ZDZ A;  2P9I C;  3PVU B;  2VZ1 A;  2BKL A;  4JSN C;  1O6G A;  4CY3 A;  3UVK A;  1TBG A;  3AH8 B;  5B4W A;  2XZG A;  3W15 A;  2QZP A;  1JJU B;  2B5L A;  2YMU A;  3RFH A;  1K3I A;  4G55 A;  3ORV D;  1GG2 B;  3I7L A;  1MG2 A;  2Q7Q A;  4CI2 A;  1PGU A;  3RMZ D;  1R5M A;  4JXM A;  4O3U B;  3UVO A;  1XKS A;  2PM7 B;  4IMM A;  3DSM A;  4QQE A;  3K72 A;  3SHF A;  1B9X A;  3MZK A;  1GOH A;  1VZ3 A;  3A0F A;  3CFS B;  3NVX A;  2HKM A;  2YB8 B;  1GOF A;  2VDQ A;  3J81 g;  5A2Q g;  4JSP C;  2EBS A;  5E6S A;  4ES0 A;  3I7O A;  4ZOZ A;  2H6Q A;  2I0S A;  3JZN A;  4BP8 A;  5AMS A;  4D6V A;  4D9S A;  1GP2 B;  4OWR A;  2QR5 A;  3EQ8 A;  4X63 B;  4MMZ A;  2HU7 A;  2P9K C;  3QI0 A;  5TDH B;  4A0A A;  5M5S A;  3RN0 D;  3C99 A;  4GM8 A;  2XL2 A;  1VYH C;  2CO0 A;  1PI6 A;  4CI8 A;  3IUR A;  4HDJ A;  5GMK n;  1JMX B;  4DNV A;  2QXV A;  5E6R A;  2Z2O A;  2MTA H;  4ZN4 A;  4N14 A;  5HE0 B;  2G9A A;  3V4V A;  3EI3 B;  4E5Z B;  3BWS A;  2CE9 A;  5I5J A;  1A12 A;  2B5N A;  5M5V A;  2HYE A;  2P9U C;  1M1X A;  1Q47 A;  4L3H D;  4CZX A;  2EID A;  2VDN A;  3EQ7 A;  2CN3 A;  2IUV A;  3O4I A;  1UTC A;  4MMX A;  3UKU C;  3AFC A;  4E54 B;  3FCU A;  5H1M A;  4J79 A;  4ZOV A;  4A0B B;  3I7K A;  3RRM C;  4A09 B;  4UM9 A;  3I8C A;  1UOQ A;  3K6S A;  2VDK A;  3PSL A;  4J78 A;  4YVD A;  4H5I A;  3NVQ A;  5FKQ A;  2XU7 A;  3ZDY A;  4FAV D;  5IJ8 E;  4UI9 R;  5FA5 B;  4A08 A;  5FXY A;  3F3P A;  2VDR A;  4ERY A;  2H13 A;  4CY5 A;  4J77 A;  3VH0 A;  2UZX B;  3SBQ A;  2PM6 B;  5EAL A;  4L3G D;  2BBK H;  3HFQ A;  2PM9 A;  4J81 A;  3IIW A;  2AGZ A;  3EWE A;  3IJC A;  2GNQ A;  4ZOX A;  4PXW A;  3IKO A;  4A2L A;  1I2M B;  5FFG A;  1N6F A;  4K3J B;  5GSA A;  4PNK B;  2H6N A;  5IGO A;  4Z7Q A;  1RI6 A;  4J0X A;  4ERZ A;  4FA5 D;  3OF7 A;  3IJE A;  3EG6 A;  2WQ8 A;  5IGQ A;  2H6K A;  1N6D A;  4FB1 D;  2J56 H;  1C9I A;  2W18 A;  2OK4 A;  1GXR A;  2AGL A;  2YBA A;  3O4H A;  1E8M A;  4PC0 A;  2AGX A;  4Z7O A;  4O45 A;  3MUN A;  2IUP A;  2IWK A;  2H3X A;  3OTT A;  2J55 H;  5H14 A;  3GFC A;  4A11 B;  5EAP A;  3PXS D;  4GGC A;  3EI2 B;  4J87 A;  1JOF A;  4O02 A;  2OVR B;  3FRX A;  4AMY A;  3MKS B;  3U4Y A;  1SQJ A;  3JZG A;  5I5I A;  3K27 A;  3SCY A;  4FAN D;  2I0T A;  4O2W A;  3B7F A;  4MMY A;  4AN1 A;  4AEZ A;  5CXB B;  2AH1 A;  2YNN A;  4JT5 C;  5FKR A;  3PE7 A;  2YNO A;  2JKX A;  1U4C A;  5IC7 A;  4PBZ A;  5M5R A;  4K3I D;  2CO0 C;  4QL1 A;  4Y7R A;  4KFM B;  2H9N A;  3JRO A;  5FQD A;  3EI3 A;  4I79 A;  4E5Z A;  1L0Q A;  3FCS A;  3ZDX A;  3DM0 A;  4IRZ A;  4LG8 A;  2XL3 A;  5TEF A;  2XE4 A;  3C9C A;  2IUQ A;  4GQ1 A;  1QFM A;  1QFS A;  3DXK C;  3I89 A;  3RSE C;  1GOG A;  1N6E A;  3IJ0 A;  3EI4 B;  3C5M A;  3T3P A;  1H2Y A;  1L5G A;  5EMM B;  5EMK B;  3IUQ A;  4JD2 C;  4NC4 A;  1JTD B;  2VDL A;  4E54 A;  4A0B A;  4J86 A;  5M61 A;  4A09 A;  4GM3 A;  4Z7N A;  3SVW D;  3CIK B;  3SLE D;  3RN1 D;  2OIZ A;  4RE6 A;  4X61 B;  4NAA A;  1S4U X;  5KDO B;  3VGZ A;  4GGD A;  4CZV A;  5EMJ B;  2H47 A;  3P4F A;  3C75 H;  4MK0 B;  4Z8L A;  3MZL A;  5IJ7 E;  4CC9 A;  5EAR A;  4J84 A;  5M5T A;  3JB9 L;  2VZ3 A;  3NVN A;  3N0D A;  2HKR A;  3I7P A;  2AQ5 A;  3IVM A;  4AN0 A;  4IA9 A;  5CYK B;  5TEE A;  1OMW B;  1VE7 A;  4BH6 A;  2O9K A;  2OVQ B;  5K19 A;  4BUJ C;  5M5U A;  2IWF A;  3IJ1 A;  4GMB A;  1VE6 A;  4O9D A;  3I7N A;  4G56 B;  4EWR A;  1XIP A;  4FWW A;  5CXC B;  3DDU A;  4OZU A;  4FA9 D;  2H9L A;  2IUR A;  5HE2 B;  5H17 A;  4NSX A;  4PSX B;  4TZ4 A;  2H68 A;  4XYI A;  4GQ2 P;  3ZE0 A;  4A7J A;  4RE5 A;  2P9L C;  1UOP A;  4A11 A;  3RLM D;  4NEN A;  2HJB A;  3RFG A;  3VI3 A;  3EI2 A;  4BP9 A;  3DWL C;  2G99 A;  4ZOY A;  4U7A A;  4AOW A;  3SWS D;  4LGN A;  3J80 g; 
#chains in the Genus database with same CATH homology
 2AGW A;  4U1E I;  2Z2N A;  5HE3 B;  3ULE C;  4GM9 A;  3MKQ A;  5CXB A;  4CZY A;  2BCJ B;  5C9Z B;  2CN2 A;  4J73 A;  4FA1 D;  4ESG A;  5C2V B;  3SJL D;  1SHY B;  3KRX B;  4Y5R D;  2H14 A;  5AJA A;  3SXT D;  4QT8 A;  4O1Q D;  4J0W A;  4X3E A;  1PEV A;  2H9M A;  3OKT A;  5TF2 A;  3EI1 B;  2HXC A;  5C2W B;  3L4M D;  4J8G A;  3AL8 B;  1FWX A;  3EI4 A;  4XEI C;  3V7D B;  2CNX A;  3E0C A;  3UVN A;  1U2V C;  5THA A;  3JAM g;  3PXW D;  3N0E A;  2AH0 A;  3JRP A;  5FKS A;  1TYQ C;  3OKY B;  4FHL A;  3I8E A;  3KRW B;  2OK6 A;  3OL2 B;  3AL9 A;  5AFU 3;  2B4E A;  5HQG A;  4JT6 C;  5I5M A;  5K1C C;  2XYI A;  4GZ8 A;  3V9F A;  3EU7 A;  1JMZ B;  3SBP A;  4FA4 D;  5HE1 B;  2QC5 A;  3PSC B;  4A2M A;  3MMY A;  1GOT B;  2I3T A;  5CYK A;  5IT9 g;  3ZWL B;  5GXI A;  4BL0 A;  3PVW B;  1A0R B;  3V5W B;  4PBY A;  4X60 B;  2HES X;  4XYH A;  3F3G A;  1MDA H;  1YFQ A;  1QNI A;  4J82 A;  3L4O D;  2CE8 A;  3ODT A;  5SXM A;  4O3T B;  2GC7 A;  4H5J A;  5CXC A;  1OLZ A;  4CY2 A;  2H9P A;  1NR0 A;  2YNP A;  2HJ4 A;  3I7H A;  1K32 A;  4D0K A;  2P9S C;  5EM2 A;  4PSW B;  4ERQ A;  3SBR A;  3JZH A;  5JWZ A;  2P9P C;  2IAA A;  5FKT A;  1ERJ A;  2J57 G;  3FGB A;  4CY1 A;  4A0A B;  3MXX A;  2AGY A;  1PBY B;  1MG3 A;  3SMR A;  1K8K C;  3BG0 A;  3UVL A;  5HYN B;  3IIY A;  3K26 A;  4R7A B;  3OKW A;  2I0R A;  4JSX C;  4LG9 A;  3JPX A;  2TRC B;  2OJY A;  5EM2 B;  4L1Q D;  1SQ9 A;  4CI3 A;  4CI1 A;  3F3F A;  2GC4 A;  2I3S A;  3EI1 A;  2B5M A;  2PBI B;  3UKR C;  3CFV A;  2P9N C;  3AL8 A;  3BG1 A;  5EML B;  3SFZ A;  1B9Y A;  4GGA A;  3I2N A;  3DXM C;  3SN6 B;  1XHM A;  5GXH A;  2UZY B;  5EAM A;  4JSV C;  3GRE A;  3FM0 A;  3EMH A;  3OKY A;  2OVP B;  4L9O A;  3VA6 A;  4A08 B;  1NEX B;  3UR4 A;  3OL2 A;  4GQB B;  3UVM A;  3PXT D;  4QRJ A;  5FLX g;  4J8B A;  3OW8 A;  1P22 A;  2PM9 B;  2Z2P A;  2P9I C;  3PVU B;  4JSN C;  4CY3 A;  3UVK A;  1TBG A;  3AH8 B;  5B4W A;  3W15 A;  1JJU B;  2B5L A;  2YMU A;  3RFH A;  3ORV D;  1GG2 B;  3I7L A;  1MG2 A;  2Q7Q A;  4CI2 A;  1PGU A;  3RMZ D;  1R5M A;  4JXM A;  4O3U B;  3UVO A;  1XKS A;  2PM7 B;  4IMM A;  3DSM A;  4QQE A;  3SHF A;  1B9X A;  3MZK A;  3A0F A;  3CFS B;  3NVX A;  2HKM A;  2YB8 B;  3J81 g;  5A2Q g;  4JSP C;  2EBS A;  4ES0 A;  3I7O A;  4ZOZ A;  2H6Q A;  2I0S A;  3JZN A;  5AMS A;  4D6V A;  1GP2 B;  4OWR A;  4X63 B;  2P9K C;  5TDH B;  4A0A A;  3RN0 D;  3C99 A;  4GM8 A;  2XL2 A;  1VYH C;  2CO0 A;  1PI6 A;  4CI8 A;  4HDJ A;  5GMK n;  1JMX B;  2QXV A;  2Z2O A;  2MTA H;  4ZN4 A;  4N14 A;  5HE0 B;  2G9A A;  3EI3 B;  4E5Z B;  3BWS A;  2CE9 A;  5I5J A;  2B5N A;  2HYE A;  2P9U C;  1Q47 A;  4L3H D;  4CZX A;  2CN3 A;  2IUV A;  3UKU C;  3AFC A;  4E54 B;  5H1M A;  4J79 A;  4ZOV A;  4A0B B;  3I7K A;  3RRM C;  4A09 B;  3I8C A;  3PSL A;  4J78 A;  4YVD A;  4H5I A;  3NVQ A;  5FKQ A;  2XU7 A;  4FAV D;  5IJ8 E;  4UI9 R;  5FA5 B;  4A08 A;  5FXY A;  3F3P A;  4ERY A;  2H13 A;  4CY5 A;  4J77 A;  3VH0 A;  2UZX B;  3SBQ A;  2PM6 B;  5EAL A;  4L3G D;  2BBK H;  3HFQ A;  2PM9 A;  4J81 A;  3IIW A;  2AGZ A;  3EWE A;  3IJC A;  2GNQ A;  4ZOX A;  4PXW A;  3IKO A;  4A2L A;  1N6F A;  4K3J B;  5GSA A;  4PNK B;  2H6N A;  5IGO A;  1RI6 A;  4J0X A;  4ERZ A;  4FA5 D;  3EG6 A;  5IGQ A;  2H6K A;  1N6D A;  4FB1 D;  2J56 H;  2W18 A;  2OK4 A;  1GXR A;  2AGL A;  2YBA A;  4PC0 A;  2AGX A;  4O45 A;  2IUP A;  3OTT A;  2IWK A;  2H3X A;  2J55 H;  5H14 A;  3GFC A;  4A11 B;  5EAP A;  3PXS D;  4GGC A;  3EI2 B;  4J87 A;  1JOF A;  2OVR B;  3FRX A;  3MKS B;  3U4Y A;  1SQJ A;  3JZG A;  5I5I A;  3K27 A;  3SCY A;  4FAN D;  2I0T A;  3B7F A;  4AEZ A;  5CXB B;  2AH1 A;  2YNN A;  4JT5 C;  5FKR A;  3PE7 A;  2YNO A;  1U4C A;  5IC7 A;  4PBZ A;  4K3I D;  2CO0 C;  4QL1 A;  4Y7R A;  4KFM B;  2H9N A;  3JRO A;  5FQD A;  3EI3 A;  4I79 A;  4E5Z A;  1L0Q A;  3DM0 A;  4LG8 A;  2XL3 A;  5TEF A;  2IUQ A;  3C9C A;  4GQ1 A;  3DXK C;  3I89 A;  3RSE C;  1N6E A;  3EI4 B;  3IJ0 A;  3C5M A;  5EMM B;  5EMK B;  4JD2 C;  4E54 A;  4A0B A;  4J86 A;  4A09 A;  4GM3 A;  3SVW D;  3CIK B;  3SLE D;  3RN1 D;  2OIZ A;  4X61 B;  1S4U X;  5KDO B;  3VGZ A;  4GGD A;  4CZV A;  5EMJ B;  2H47 A;  3P4F A;  3C75 H;  4MK0 B;  4Z8L A;  3MZL A;  5IJ7 E;  4CC9 A;  5EAR A;  4J84 A;  3JB9 L;  3NVN A;  3N0D A;  2HKR A;  3I7P A;  2AQ5 A;  4IA9 A;  5CYK B;  5TEE A;  1OMW B;  4BH6 A;  2O9K A;  2OVQ B;  5K19 A;  4BUJ C;  2IWF A;  3IJ1 A;  4GMB A;  4O9D A;  3I7N A;  4G56 B;  4EWR A;  1XIP A;  4FWW A;  5CXC B;  4OZU A;  4FA9 D;  2H9L A;  2IUR A;  5HE2 B;  5H17 A;  4NSX A;  4PSX B;  4TZ4 A;  2H68 A;  4XYI A;  4GQ2 P;  4A7J A;  2P9L C;  4A11 A;  3RLM D;  2HJB A;  3RFG A;  3EI2 A;  3DWL C;  2G99 A;  4ZOY A;  4U7A A;  4AOW A;  3SWS D;  4LGN A;  3J80 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...