4D0KA

Complex of chaetomium thermophilum pan2 (wd40-cs1) with pan3 (c-term)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
345
structure length
329
Chain Sequence
b'MDADWDEVTRIAYPAPGTFPRPATAVAFDPIAELLWAGFDRGRVCSFYGRDLTRYTAFKIQPASEGPVRQFLFHDKGVIVLGTRSVHMAMRRGPALWNIRHENMKDLRCMSFTSKGTQEIIVAGWQDTMLVIDVLKGDIIKQIPAQHHYSIMKKSRYICAATKTGSVDLIDPLSFKIVRSWQAHASYINDMDAQNDFIVTCGGSYMLDPYVNVFDLKNMASMKPMPFPPLAAHVRLHPRMLTTAIVTSQHGQMHVVDIMNPNSSTVRYANISSYVKLFEIAPSGEALVIGDADCNIHLWGSPTKIHFTDMAIPIELPEPVLDWSETPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
molecule tags Gene regulation
source organism Chaetomium thermophilum
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
total genus 66
structure length 329
sequence length 345
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4d0kA01
3OKWA 4J79A 5EMKB 5TDHB 3MKQA 4CZYA 5FKRA 4GQ1A 4N14A 4J82A 1GG2B 1L0QA 2AGWA 2H9PA 2PM9A 2H47A 3C75H 1TBGA 4CZVA 2H3XA 1JOFA 2CE9A 3CFVA 4PBZA 4FAND 4ZOYA 5HE0B 4U7AA 4CY1A 5AFU3 1OLZA 2QXVA 1B9YA 2IWKA 4GGCA 3SMRA 4GM3A 4ZOXA 2J57G 3IJ0A 4EWRA 4ESGA 4ERQA 4K3ID 3PXWD 5IC7A 4IA9A 3W15A 5K1CC 4TZ4A 3RLMD 3K27A 1Q47A 3F3GA 2P9UC 3SJLD 2OVPB 5JWZA 4ZN4A 3PSCB 5IGQA 4ERYA 2AGYA 1GXRA 2BBKH 5KDOB 2GNQA 2AQ5A 5CXBB 5FKSA 2OJYA 3J80g 4O45A 4L3GD 3C5MA 1JMZB 4XEIC 3C9CA 2XL2A 1GP2B 3MMYA 5CXBA 3RMZD 2I0SA 4H5IA 3PVUB 4J81A 2GC4A 3ODTA 4A09B 3IJ1A 2P9LC 2I0TA 2YBAA 2HJ4A 2HKMA 2P9SC 3FGBA 1N6DA 5FKTA 3EI3B 3UVNA 1R5MA 1K32A 3PSLA 3RSEC 5I5JA 1K8KC 5CYKA 3JAMg 4A2MA 3I7HA 3I7LA 4CI8A 4GQBB 1MG3A 3C99A 3SN6B 3JZHA 2UZXB 2HESX 4PSXB 4GQ2P 2MTAH 2H9NA 3EG6A 3MZLA 4JD2C 2H9MA 4PNKB 4JSVC 4PXWA 2H68A 3AL8A 3PE7A 2UZYB 3V5WB 3EI1A 3VA6A 3IJCA 4JXMA 3AFCA 2AGLA 2TRCB 4A0AA 1MDAH 4A7JA 4GGAA 4O9DA 3EI2A 2OVRB 3F3FA 2PM7B 4CY3A 3RN1D 4J84A 4Y5RD 3SCYA 1XHMA 3I2NA 1JJUB 3ORVD 4XYIA 3GFCA 3EI3A 5SXMA 4CY5A 4QQEA 5FKQA 2G99A 3UKUC 2H9LA 4CI1A 3JZNA 4AEZA 3JROA 2G9AA 4GZ8A 1SQJA 4J86A 3SLED 5EMJB 1NEXB 3F3PA 3I8CA 3P4FA 2H6NA 2Z2NA 5IT9g 3GREA 5FQDA 3PVWB 1A0RB 3JRPA 3DM0A 3UVKA 4AOWA 5GXIA 1SQ9A 1U2VC 3CFSB 2IUVA 2B4EA 4J0XA 5GXHA 3UVOA 3DSMA 1ERJA 4CI3A 5GMKn 5EALA 5HE2B 4LG8A 3NVQA 5GSAA 3SVWD 4A0BB 4FA4D 4O3UB 3I89A 1OMWB 2P9NC 3PXSD 2H6KA 4XYHA 3SWSD 2OK6A 5HE3B 2P9IC 5TEEA 1XIPA 5AMSA 2QC5A 2Q7QA 2PM6B 5H14A 2I3SA 5FA5B 2CN3A 5I5MA 4HDJA 4LG9A 3MZKA 1PGUA 1U4CA 2HKRA 3B7FA 4PBYA 3EI1B 3L4MD 4E5ZB 3IIYA 1YFQA 1RI6A 2CO0A 3IKOA 2CNXA 3EI2B 4Y7RA 5C9ZB 4E54A 4Z8LA 3BWSA 3MKSB 3EMHA 5EAPA 4GM9A 3N0EA 3OL2B 4J0WA 2PM9B 4G56B 3VH0A 3JPXA 5EARA 1QNIA 3SBPA 5FXYA 2OK4A 2O9KA 2Z2OA 5TEFA 3EU7A 4L3HD 4A0BA 4PC0A 2AGXA 1PI6A 1N6EA 3KRXB 2IWFA 3UR4A 2HJBA 5IJ8E 3NVXA 3EI4A 1PBYB 2B5MA 2GC7A 3FM0A 3EWEA 4E54B 2YNPA 5H1MA 4ZOVA 1N6FA 4CC9A 1S4UX 4BUJC 3RFHA 4CY2A 2YNOA 2YB8B 3EI4B 4FA1D 2H13A 4FAVD 1NR0A 3FRXA 4U1EI 3I7NA 3RN0D 4D6VA 4A11A 2AGZA 2AH1A 3K26A 3OW8A 4QRJA 4X60B 5HYNB 3SHFA 3DXMC 2I0RA 4JT6C 4GM8A 4X3EA 4A2LA 4YVDA 3JZGA 4A0AB 4L9OA 3V7DB 4J73A 4FA9D 3BG1A 5TF2A 1P22A 3DWLC 4KFMB 5K19A 3SXTD 2J55H 3VGZA 2P9KC 3HFQA 2W18A 5EMMB 3ULEC 4JT5C 3SBQA 2J56H 5C2WB 4R7AB 1GOTB 2CO0C 2PBIB 4BL0A 4ZOZA 4O3TB 3UVLA 2IUPA 1SHYB 2CN2A 1XKSA 4QT8A 4L1QD 4QL1A 3OKYA 4JSPC 3SFZA 3J81g 2H14A 3I7PA 3JB9L 3OTTA 4NSXA 1PEVA 4OWRA 4A09A 2H6QA 4O1QD 2IAAA 4FWWA 2BCJB 4OZUA 3OKTA 4GMBA 3OKYB 2HXCA 3SBRA 2XL3A 4CZXA 5IJ7E 3KRWB 2B5NA 4JSNC 2HYEA 4J8BA 3RFGA 4BH6A 2P9PC 3I7KA 3BG0A 5FLXg 4MK0B 4K3JB 2OIZA 4ERZA 1TYQC 2XU7A 4UI9R 3I8EA 5C2VB 4I79A 1JMXB 2EBSA 5CXCB 5B4WA 3AL8B 5EM2B 2CE8A 3UVMA 4A08A 2B5LA 5THAA 4PSWB 5EMLB 5H17A 4J87A 5CXCA 2Z2PA 5EM2A 3E0CA 3CIKB 2YNNA 4J8GA 1FWXA 2XYIA 3N0DA 4E5ZA 4A08B 2AH0A 4H5JA 5EAMA 1B9XA 4FHLA 4FA5D 3I7OA 4LGNA 4J78A 4X63B 2I3TA 3L4OD 4JSXC 3A0FA 4CI2A 2IUQA 2IURA 5I5IA 1VYHC 1MG2A 2OVQB 3RRMC 4A11B 4FB1D 4IMMA 5HE1B 5A2Qg 3IIWA 2YMUA 5AJAA 5CYKB 4D0KA 3UKRC 3PXTD 5HQGA 3NVNA 5IGOA 4GGDA 4J77A 3AH8B 4X61B 3U4YA 3AL9A 3OL2A 3ZWLB 4ES0A 3V9FA 3MXXA 3DXKC
chains in the Genus database with same CATH superfamily
2EIEA 3OKWA 4J79A 2VDRA 5EMKB 5TDHB 3MKQA 4CZYA 5FKRA 2VDMA 4GQ1A 4N14A 4J82A 3ZDXA 3NIDA 1K3IA 1GG2B 1L0QA 2AGWA 2H9PA 2PM9A 2H47A 3C75H 1TBGA 4CZVA 1T2XA 2H3XA 4JHNA 1JOFA 2CE9A 3CFVA 4PBZA 4FAND 4ZOYA 5E6UA 5HE0B 4U7AA 4CY1A 5AFU3 1OLZA 2QXVA 1B9YA 2IWKA 3MVDK 4GGCA 3T3MA 4IRZA 3SMRA 1O6FA 4GM3A 5M5VA 4ZOXA 2J57G 3IJ0A 4UM8A 4EWRA 4ESGA 2XDWA 4ERQA 4K3ID 3PXWD 5IC7A 4IA9A 3W15A 1UTCA 4TZ4A 5K1CC 3RLMD 4WK0A 3K27A 1Q47A 3F3GA 2VDKA 2P9UC 3SJLD 2OVPB 5JWZA 4ZN4A 3PSCB 5IGQA 2VDPA 4RE6A 5HDBA 4ERYA 2AGYA 5E6SA 5FFGA 1GXRA 2BBKH 5KDOB 1A12A 2GNQA 2AQ5A 1E8MA 5CXBB 2JKXA 5FKSA 3K6SA 2OJYA 5M5SA 3J80g 4O45A 4L3GD 3C5MA 1JMZB 4XEIC 3C9CA 2XL2A 1GP2B 3MMYA 4AX4A 5CXBA 3RMZD 2I0SA 3IURA 4H5IA 3PVUB 4J81A 2GC4A 3ODTA 4A09B 3IJ1A 2P9LC 2I0TA 2QZPA 2YBAA 2HJ4A 2HKMA 2P9SC 3O4IA 3FGBA 1N6DA 3EQ9A 5FKTA 3EI3B 3UVNA 1R5MA 4NENA 4UM9A 1K32A 3PSLA 3EQ8A 1H2YA 3RSEC 5I5JA 1K8KC 5CYKA 3JAMg 4A2MA 3I7HA 3I7LA 4CI8A 4GQBB 1MG3A 3C99A 3SN6B 3JZHA 2UZXB 3IUNA 2HESX 3ZDZA 4PSXB 4NAAA 4GQ2P 2MTAH 2H9NA 3EG6A 3MZLA 4JD2C 4MMXA 2H9MA 4PNKB 4JSVC 4PXWA 3ZE2A 2H68A 1M1XA 3AL8A 3O4JA 3O4HA 3PE7A 2UZYB 3V5WB 3EI1A 4D9SA 3VA6A 3IJCA 4JHPC 4JXMA 3AFCA 2AGLA 2TRCB 4A0AA 1MDAH 4A7JA 4GGAA 4O9DA 3GD1I 3EI2A 2OVRB 3F3FA 3T3PA 5M5UA 4BCDA 2PM7B 4CY3A 1VZ2A 3RN1D 4J84A 1JTDB 1UOQA 4O02A 4Y5RD 3IJEA 3SCYA 1XHMA 3ORVD 1JJUB 3I2NA 4XYIA 3GFCA 3EI3A 4O2WA 5SXMA 1QFMA 4CY5A 4QQEA 5FKQA 2G99A 3UKUC 2H9LA 4CI1A 3JZNA 4AEZA 3JROA 2G9AA 3IULA 1SQJA 4GZ8A 4J86A 3SLED 5EMJB 1NEXB 3F3PA 3I8CA 3P4FA 2H6NA 2Z2NA 5IT9g 3NIFA 5M61A 3GREA 5FQDA 3PVWB 1A0RB 3JRPA 3DM0A 3UVKA 1VE7A 4AOWA 5GXIA 1SQ9A 1U2VC 1BPOA 3CFSB 2IUVA 2B4EA 4J0XA 5GXHA 3UVOA 3GC3B 1E8NA 3DSMA 1ERJA 4CI3A 5GMKn 5EALA 5HE2B 4LG8A 3NVQA 5GSAA 3O4GA 3SVWD 4A0BB 4FA4D 4O3UB 4BP8A 3I89A 1OMWB 2P9NC 3PXSD 1UOPA 4G1MA 2H6KA 2HU5A 4XYHA 3SWSD 2OK6A 5HE3B 2P9IC 5TEEA 1XIPA 4G55A 5AMSA 2QC5A 2Q7QA 2BKLA 2PM6B 5H14A 2I3SA 5FA5B 2CN3A 5I5MA 4HDJA 4LG9A 3MZKA 1PGUA 1U4CA 2HKRA 3B7FA 4PBYA 3EI1B 3L4MD 4E5ZB 3IIYA 4AMYA 2VZ3A 3MUNA 3FCUA 1YFQA 1RI6A 2CO0A 3IKOA 1U8CA 2CNXA 3EI2B 4Y7RA 5C9ZB 4E54A 4Z8LA 3BWSA 3VI4A 1H2WA 3MKSB 3EMHA 5EAPA 4GM9A 3N0EA 3OL2B 4BCBA 4J0WA 4RE5A 2PM9B 4G56B 3VH0A 3JPXA 5EARA 1QNIA 3SBPA 5FXYA 2OK4A 2O9KA 2Z2OA 5TEFA 4NBMA 3EU7A 4L3HD 4A0BA 4PC0A 4MMYA 2AGXA 1PI6A 1N6EA 3KRXB 2IWFA 3UR4A 2EICA 2HJBA 1JV2A 5IJ8E 3NVXA 1C9IA 3EI4A 1PBYB 2B5MA 2GC7A 3FM0A 2VDLA 3EWEA 4E54B 2YNPA 5H1MA 4ZOVA 1N6FA 4CC9A 1S4UX 4BCCA 4BUJC 3RFHA 4CY2A 2YNOA 1H2XA 2YB8B 3EI4B 4FA1D 4Z7OA 1O6GA 2H13A 4FAVD 1NR0A 3FRXA 2XZGA 4U1EI 3I7NA 4WK2A 3RN0D 5E6RA 4D6VA 4A11A 2AGZA 2AH1A 3K26A 3NIGA 3OW8A 4QRJA 4X60B 2EIDA 5HYNB 2HU8A 3SHFA 3DXMC 2I0RA 4JT6C 4GM8A 4X3EA 4A2LA 4YVDA 1I2MB 3JZGA 1L5GA 4A0AB 4L9OA 2HU7A 3V7DB 4J73A 4FA9D 3BG1A 5TF2A 1VZ3A 1P22A 3DWLC 4KFMB 5K19A 5C92A 3SXTD 2J55H 1GOGA 3VGZA 2P9KC 2QR5A 3HFQA 2W18A 5EMMB 3OF7A 3ULEC 4JT5C 5C86A 3SBQA 2J56H 5C2WB 4R7AB 1GOTB 2CO0C 2PBIB 4BL0A 4ZOZA 4O3TB 3UVLA 2IUPA 1SHYB 3IUQA 2CN2A 3V4PA 3QHYB 1XKSA 4QT8A 4L1QD 4QL1A 3OKYA 4JSPC 3SFZA 3J81g 4BP9A 1TYEA 2H14A 3I7PA 3JB9L 3OTTA 3K71A 5M5TA 2WQ8A 4NSXA 1PEVA 4OWRA 4A09A 2H6QA 4O1QD 2IAAA 4FWWA 2BCJB 4OZUA 3OKTA 4GMBA 1VE6A 3OKYB 2HXCA 3SBRA 2XL3A 2VC2A 5FFOA 4CZXA 5IJ7E 2VZ1A 3KRWB 3IVMA 2B5NA 4JSNC 2HYEA 4J8BA 3RFGA 1E5TA 3IUMA 4BH6A 2P9PC 3I7KA 4AMZA 1UOOA 3BG0A 5FLXg 4QAMA 4MK0B 4K3JB 2OIZA 4AN0A 4ERZA 1TYQC 4MMZA 2XU7A 4UI9R 3I8EA 5C2VB 4I79A 1JMXB 4AN1A 2EBSA 5CXCB 5B4WA 3DDUA 3ZE1A 3AL8B 5EM2B 2CE8A 3ZDYA 3UVMA 4A08A 4G1EA 2B5LA 4WK4A 5THAA 4PSWB 5EMLB 5H17A 4J87A 5CXCA 3IUJA 2Z2PA 5EM2A 3E0CA 3CIKB 1YR2A 2VDQA 1FWXA 2XYIA 2YNNA 3N0DA 4J8GA 4E5ZA 4A08B 2AH0A 4H5JA 4DNUA 5EAMA 1B9XA 1GOFA 4FHLA 4FA5D 1H2ZA 3I7OA 4LGNA 4J78A 4X63B 2I3TA 3V4VA 4L1MA 3L4OD 3FCSA 3ZE0A 4JSXC 4DNWA 3A0FA 4CI2A 3QI0A 3EQ7A 2IUQA 4NC4A 2IURA 5I5IA 1VYHC 2VDOA 1MG2A 2OVQB 2VDNA 3RRMC 4A11B 4FB1D 3VI3A 1C9LA 1GOHA 4IMMA 5HE1B 5A2Qg 3IIWA 2YMUA 1QFSA 2XE4A 5AJAA 5CYKB 4Z7NA 4D0KA 3UKRC 3KCIA 3K72A 3PXTD 5HQGA 3NVNA 4WJKA 4DNVA 5IGOA 4GGDA 4J77A 3AH8B 4X61B 2EIBA 3MUOA 3U4YA 3AL9A 3OL2A 3ZWLB 4ES0A 4Z7QA 5M5RA 3V9FA 3MXXA 3DXKC
chains in the Genus database with same CATH topology
3OKWA 4J79A 5EMKB 5TDHB 3MKQA 4CZYA 5FKRA 4GQ1A 4N14A 4J82A 1GG2B 1L0QA 2AGWA 2H9PA 2PM9A 2H47A 3C75H 1TBGA 4CZVA 2H3XA 1JOFA 2CE9A 3CFVA 4PBZA 4FAND 4ZOYA 5HE0B 4U7AA 4CY1A 5AFU3 1OLZA 2QXVA 1B9YA 2IWKA 4GGCA 3SMRA 4GM3A 4ZOXA 2J57G 3IJ0A 4EWRA 4ESGA 4ERQA 4K3ID 3PXWD 5IC7A 4IA9A 3W15A 5K1CC 4TZ4A 3RLMD 3K27A 1Q47A 3F3GA 2P9UC 3SJLD 2OVPB 5JWZA 4ZN4A 3PSCB 5IGQA 4ERYA 2AGYA 1GXRA 2BBKH 5KDOB 2GNQA 2AQ5A 5CXBB 5FKSA 2OJYA 3J80g 4O45A 4L3GD 3C5MA 1JMZB 4XEIC 3C9CA 2XL2A 1GP2B 3MMYA 5CXBA 3RMZD 2I0SA 4H5IA 3PVUB 4J81A 2GC4A 3ODTA 4A09B 3IJ1A 2P9LC 2I0TA 2YBAA 2HJ4A 2HKMA 2P9SC 3FGBA 1N6DA 5FKTA 3EI3B 3UVNA 1R5MA 1K32A 3PSLA 3RSEC 5I5JA 1K8KC 5CYKA 3JAMg 4A2MA 3I7HA 3I7LA 4CI8A 4GQBB 1MG3A 3C99A 3SN6B 3JZHA 2UZXB 2HESX 4PSXB 4GQ2P 2MTAH 2H9NA 3EG6A 3MZLA 4JD2C 2H9MA 4PNKB 4JSVC 4PXWA 2H68A 3AL8A 3PE7A 2UZYB 3V5WB 3EI1A 3VA6A 3IJCA 4JXMA 3AFCA 2AGLA 2TRCB 4A0AA 1MDAH 4A7JA 4GGAA 4O9DA 3EI2A 2OVRB 3F3FA 2PM7B 4CY3A 3RN1D 4J84A 4Y5RD 3SCYA 1XHMA 3I2NA 1JJUB 3ORVD 4XYIA 3GFCA 3EI3A 5SXMA 4CY5A 4QQEA 5FKQA 2G99A 3UKUC 2H9LA 4CI1A 3JZNA 4AEZA 3JROA 2G9AA 4GZ8A 1SQJA 4J86A 3SLED 5EMJB 1NEXB 3F3PA 3I8CA 3P4FA 2H6NA 2Z2NA 5IT9g 3GREA 5FQDA 3PVWB 1A0RB 3JRPA 3DM0A 3UVKA 4AOWA 5GXIA 1SQ9A 1U2VC 3CFSB 2IUVA 2B4EA 4J0XA 5GXHA 3UVOA 3DSMA 1ERJA 4CI3A 5GMKn 5EALA 5HE2B 4LG8A 3NVQA 5GSAA 3SVWD 4A0BB 4FA4D 4O3UB 3I89A 1OMWB 2P9NC 3PXSD 2H6KA 4XYHA 3SWSD 2OK6A 5HE3B 2P9IC 5TEEA 1XIPA 5AMSA 2QC5A 2Q7QA 2PM6B 5H14A 2I3SA 5FA5B 2CN3A 5I5MA 4HDJA 4LG9A 3MZKA 1PGUA 1U4CA 2HKRA 3B7FA 4PBYA 3EI1B 3L4MD 4E5ZB 3IIYA 1YFQA 1RI6A 2CO0A 3IKOA 2CNXA 3EI2B 4Y7RA 5C9ZB 4E54A 4Z8LA 3BWSA 3MKSB 3EMHA 5EAPA 4GM9A 3N0EA 3OL2B 4J0WA 2PM9B 4G56B 3VH0A 3JPXA 5EARA 1QNIA 3SBPA 5FXYA 2OK4A 2O9KA 2Z2OA 5TEFA 3EU7A 4L3HD 4A0BA 4PC0A 2AGXA 1PI6A 1N6EA 3KRXB 2IWFA 3UR4A 2HJBA 5IJ8E 3NVXA 3EI4A 1PBYB 2B5MA 2GC7A 3FM0A 3EWEA 4E54B 2YNPA 5H1MA 4ZOVA 1N6FA 4CC9A 1S4UX 4BUJC 3RFHA 4CY2A 2YNOA 2YB8B 3EI4B 4FA1D 2H13A 4FAVD 1NR0A 3FRXA 4U1EI 3I7NA 3RN0D 4D6VA 4A11A 2AGZA 2AH1A 3K26A 3OW8A 4QRJA 4X60B 5HYNB 3SHFA 3DXMC 2I0RA 4JT6C 4GM8A 4X3EA 4A2LA 4YVDA 3JZGA 4A0AB 4L9OA 3V7DB 4J73A 4FA9D 3BG1A 5TF2A 1P22A 3DWLC 4KFMB 5K19A 3SXTD 2J55H 3VGZA 2P9KC 3HFQA 2W18A 5EMMB 3ULEC 4JT5C 3SBQA 2J56H 5C2WB 4R7AB 1GOTB 2CO0C 2PBIB 4BL0A 4ZOZA 4O3TB 3UVLA 2IUPA 1SHYB 2CN2A 1XKSA 4QT8A 4L1QD 4QL1A 3OKYA 4JSPC 3SFZA 3J81g 2H14A 3I7PA 3JB9L 3OTTA 4NSXA 1PEVA 4OWRA 4A09A 2H6QA 4O1QD 2IAAA 4FWWA 2BCJB 4OZUA 3OKTA 4GMBA 3OKYB 2HXCA 3SBRA 2XL3A 4CZXA 5IJ7E 3KRWB 2B5NA 4JSNC 2HYEA 4J8BA 3RFGA 4BH6A 2P9PC 3I7KA 3BG0A 5FLXg 4MK0B 4K3JB 2OIZA 4ERZA 1TYQC 2XU7A 4UI9R 3I8EA 5C2VB 4I79A 1JMXB 2EBSA 5CXCB 5B4WA 3AL8B 5EM2B 2CE8A 3UVMA 4A08A 2B5LA 5THAA 4PSWB 5EMLB 5H17A 4J87A 5CXCA 2Z2PA 5EM2A 3E0CA 3CIKB 2YNNA 4J8GA 1FWXA 2XYIA 3N0DA 4E5ZA 4A08B 2AH0A 4H5JA 5EAMA 1B9XA 4FHLA 4FA5D 3I7OA 4LGNA 4J78A 4X63B 2I3TA 3L4OD 4JSXC 3A0FA 4CI2A 2IUQA 2IURA 5I5IA 1VYHC 1MG2A 2OVQB 3RRMC 4A11B 4FB1D 4IMMA 5HE1B 5A2Qg 3IIWA 2YMUA 5AJAA 5CYKB 4D0KA 3UKRC 3PXTD 5HQGA 3NVNA 5IGOA 4GGDA 4J77A 3AH8B 4X61B 3U4YA 3AL9A 3OL2A 3ZWLB 4ES0A 3V9FA 3MXXA 3DXKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKW A;  4J79 A;  5EMK B;  5TDH B;  3MKQ A;  4CZY A;  5FKR A;  4GQ1 A;  4N14 A;  4J82 A;  1GG2 B;  1L0Q A;  2AGW A;  2H9P A;  2PM9 A;  2H47 A;  3C75 H;  1TBG A;  4CZV A;  2H3X A;  1JOF A;  2CE9 A;  3CFV A;  4PBZ A;  4FAN D;  4ZOY A;  5HE0 B;  4U7A A;  4CY1 A;  5AFU 3;  1OLZ A;  2QXV A;  1B9Y A;  2IWK A;  4GGC A;  3SMR A;  4GM3 A;  4ZOX A;  2J57 G;  3IJ0 A;  4EWR A;  4ESG A;  4ERQ A;  4K3I D;  3PXW D;  5IC7 A;  4IA9 A;  3W15 A;  5K1C C;  4TZ4 A;  3RLM D;  3K27 A;  1Q47 A;  3F3G A;  2P9U C;  3SJL D;  2OVP B;  5JWZ A;  4ZN4 A;  3PSC B;  5IGQ A;  4ERY A;  2AGY A;  1GXR A;  2BBK H;  5KDO B;  2GNQ A;  2AQ5 A;  5CXB B;  5FKS A;  2OJY A;  3J80 g;  4O45 A;  4L3G D;  3C5M A;  1JMZ B;  4XEI C;  3C9C A;  2XL2 A;  1GP2 B;  3MMY A;  5CXB A;  3RMZ D;  2I0S A;  4H5I A;  3PVU B;  4J81 A;  2GC4 A;  3ODT A;  4A09 B;  3IJ1 A;  2P9L C;  2I0T A;  2YBA A;  2HJ4 A;  2HKM A;  2P9S C;  3FGB A;  1N6D A;  5FKT A;  3EI3 B;  3UVN A;  1R5M A;  1K32 A;  3PSL A;  3RSE C;  5I5J A;  1K8K C;  5CYK A;  3JAM g;  4A2M A;  3I7H A;  3I7L A;  4CI8 A;  4GQB B;  1MG3 A;  3C99 A;  3SN6 B;  3JZH A;  2UZX B;  2HES X;  4PSX B;  4GQ2 P;  2MTA H;  2H9N A;  3EG6 A;  3MZL A;  4JD2 C;  2H9M A;  4PNK B;  4JSV C;  4PXW A;  2H68 A;  3AL8 A;  3PE7 A;  2UZY B;  3V5W B;  3EI1 A;  3VA6 A;  3IJC A;  4JXM A;  3AFC A;  2AGL A;  2TRC B;  4A0A A;  1MDA H;  4A7J A;  4GGA A;  4O9D A;  3EI2 A;  2OVR B;  3F3F A;  2PM7 B;  4CY3 A;  3RN1 D;  4J84 A;  4Y5R D;  3SCY A;  1XHM A;  3I2N A;  1JJU B;  3ORV D;  4XYI A;  3GFC A;  3EI3 A;  5SXM A;  4CY5 A;  4QQE A;  5FKQ A;  2G99 A;  3UKU C;  2H9L A;  4CI1 A;  3JZN A;  4AEZ A;  3JRO A;  2G9A A;  4GZ8 A;  1SQJ A;  4J86 A;  3SLE D;  5EMJ B;  1NEX B;  3F3P A;  3I8C A;  3P4F A;  2H6N A;  2Z2N A;  5IT9 g;  3GRE A;  5FQD A;  3PVW B;  1A0R B;  3JRP A;  3DM0 A;  3UVK A;  4AOW A;  5GXI A;  1SQ9 A;  1U2V C;  3CFS B;  2IUV A;  2B4E A;  4J0X A;  5GXH A;  3UVO A;  3DSM A;  1ERJ A;  4CI3 A;  5GMK n;  5EAL A;  5HE2 B;  4LG8 A;  3NVQ A;  5GSA A;  3SVW D;  4A0B B;  4FA4 D;  4O3U B;  3I89 A;  1OMW B;  2P9N C;  3PXS D;  2H6K A;  4XYH A;  3SWS D;  2OK6 A;  5HE3 B;  2P9I C;  5TEE A;  1XIP A;  5AMS A;  2QC5 A;  2Q7Q A;  2PM6 B;  5H14 A;  2I3S A;  5FA5 B;  2CN3 A;  5I5M A;  4HDJ A;  4LG9 A;  3MZK A;  1PGU A;  1U4C A;  2HKR A;  3B7F A;  4PBY A;  3EI1 B;  3L4M D;  4E5Z B;  3IIY A;  1YFQ A;  1RI6 A;  2CO0 A;  3IKO A;  2CNX A;  3EI2 B;  4Y7R A;  5C9Z B;  4E54 A;  4Z8L A;  3BWS A;  3MKS B;  3EMH A;  5EAP A;  4GM9 A;  3N0E A;  3OL2 B;  4J0W A;  2PM9 B;  4G56 B;  3VH0 A;  3JPX A;  5EAR A;  1QNI A;  3SBP A;  5FXY A;  2OK4 A;  2O9K A;  2Z2O A;  5TEF A;  3EU7 A;  4L3H D;  4A0B A;  4PC0 A;  2AGX A;  1PI6 A;  1N6E A;  3KRX B;  2IWF A;  3UR4 A;  2HJB A;  5IJ8 E;  3NVX A;  3EI4 A;  1PBY B;  2B5M A;  2GC7 A;  3FM0 A;  3EWE A;  4E54 B;  2YNP A;  5H1M A;  4ZOV A;  1N6F A;  4CC9 A;  1S4U X;  4BUJ C;  3RFH A;  4CY2 A;  2YNO A;  2YB8 B;  3EI4 B;  4FA1 D;  2H13 A;  4FAV D;  1NR0 A;  3FRX A;  4U1E I;  3I7N A;  3RN0 D;  4D6V A;  4A11 A;  2AGZ A;  2AH1 A;  3K26 A;  3OW8 A;  4QRJ A;  4X60 B;  5HYN B;  3SHF A;  3DXM C;  2I0R A;  4JT6 C;  4GM8 A;  4X3E A;  4A2L A;  4YVD A;  3JZG A;  4A0A B;  4L9O A;  3V7D B;  4J73 A;  4FA9 D;  3BG1 A;  5TF2 A;  1P22 A;  3DWL C;  4KFM B;  5K19 A;  3SXT D;  2J55 H;  3VGZ A;  2P9K C;  3HFQ A;  2W18 A;  5EMM B;  3ULE C;  4JT5 C;  3SBQ A;  2J56 H;  5C2W B;  4R7A B;  1GOT B;  2CO0 C;  2PBI B;  4BL0 A;  4ZOZ A;  4O3T B;  3UVL A;  2IUP A;  1SHY B;  2CN2 A;  1XKS A;  4QT8 A;  4L1Q D;  4QL1 A;  3OKY A;  4JSP C;  3SFZ A;  3J81 g;  2H14 A;  3I7P A;  3JB9 L;  3OTT A;  4NSX A;  1PEV A;  4OWR A;  4A09 A;  2H6Q A;  4O1Q D;  2IAA A;  4FWW A;  2BCJ B;  4OZU A;  3OKT A;  4GMB A;  3OKY B;  2HXC A;  3SBR A;  2XL3 A;  4CZX A;  5IJ7 E;  3KRW B;  2B5N A;  4JSN C;  2HYE A;  4J8B A;  3RFG A;  4BH6 A;  2P9P C;  3I7K A;  3BG0 A;  5FLX g;  4MK0 B;  4K3J B;  2OIZ A;  4ERZ A;  1TYQ C;  2XU7 A;  4UI9 R;  3I8E A;  5C2V B;  4I79 A;  1JMX B;  2EBS A;  5CXC B;  5B4W A;  3AL8 B;  5EM2 B;  2CE8 A;  3UVM A;  4A08 A;  2B5L A;  5THA A;  4PSW B;  5EML B;  5H17 A;  4J87 A;  5CXC A;  2Z2P A;  5EM2 A;  3E0C A;  3CIK B;  2YNN A;  4J8G A;  1FWX A;  2XYI A;  3N0D A;  4E5Z A;  4A08 B;  2AH0 A;  4H5J A;  5EAM A;  1B9X A;  4FHL A;  4FA5 D;  3I7O A;  4LGN A;  4J78 A;  4X63 B;  2I3T A;  3L4O D;  4JSX C;  3A0F A;  4CI2 A;  2IUQ A;  2IUR A;  5I5I A;  1VYH C;  1MG2 A;  2OVQ B;  3RRM C;  4A11 B;  4FB1 D;  4IMM A;  5HE1 B;  5A2Q g;  3IIW A;  2YMU A;  5AJA A;  5CYK B;  4D0K A;  3UKR C;  3PXT D;  5HQG A;  3NVN A;  5IGO A;  4GGD A;  4J77 A;  3AH8 B;  4X61 B;  3U4Y A;  3AL9 A;  3OL2 A;  3ZWL B;  4ES0 A;  3V9F A;  3MXX A;  3DXK C; 
#chains in the Genus database with same CATH topology
 2EIE A;  3OKW A;  4J79 A;  2VDR A;  5EMK B;  5TDH B;  3MKQ A;  4CZY A;  5FKR A;  2VDM A;  4GQ1 A;  4N14 A;  4J82 A;  3ZDX A;  3NID A;  1K3I A;  1GG2 B;  1L0Q A;  2AGW A;  2H9P A;  2PM9 A;  2H47 A;  3C75 H;  1TBG A;  4CZV A;  1T2X A;  2H3X A;  4JHN A;  1JOF A;  2CE9 A;  3CFV A;  4PBZ A;  4FAN D;  4ZOY A;  5E6U A;  5HE0 B;  4U7A A;  4CY1 A;  5AFU 3;  1OLZ A;  2QXV A;  1B9Y A;  2IWK A;  3MVD K;  4GGC A;  3T3M A;  4IRZ A;  3SMR A;  1O6F A;  4GM3 A;  5M5V A;  4ZOX A;  2J57 G;  3IJ0 A;  4UM8 A;  4EWR A;  4ESG A;  2XDW A;  4ERQ A;  4K3I D;  3PXW D;  5IC7 A;  4IA9 A;  3W15 A;  1UTC A;  4TZ4 A;  5K1C C;  3RLM D;  4WK0 A;  3K27 A;  1Q47 A;  3F3G A;  2VDK A;  2P9U C;  3SJL D;  2OVP B;  5JWZ A;  4ZN4 A;  3PSC B;  5IGQ A;  2VDP A;  4RE6 A;  5HDB A;  4ERY A;  2AGY A;  5E6S A;  5FFG A;  1GXR A;  2BBK H;  5KDO B;  1A12 A;  2GNQ A;  2AQ5 A;  1E8M A;  5CXB B;  2JKX A;  5FKS A;  3K6S A;  2OJY A;  5M5S A;  3J80 g;  4O45 A;  4L3G D;  3C5M A;  1JMZ B;  4XEI C;  3C9C A;  2XL2 A;  1GP2 B;  3MMY A;  4AX4 A;  5CXB A;  3RMZ D;  2I0S A;  3IUR A;  4H5I A;  3PVU B;  4J81 A;  2GC4 A;  3ODT A;  4A09 B;  3IJ1 A;  2P9L C;  2I0T A;  2QZP A;  2YBA A;  2HJ4 A;  2HKM A;  2P9S C;  3O4I A;  3FGB A;  1N6D A;  3EQ9 A;  5FKT A;  3EI3 B;  3UVN A;  1R5M A;  4NEN A;  4UM9 A;  1K32 A;  3PSL A;  3EQ8 A;  1H2Y A;  3RSE C;  5I5J A;  1K8K C;  5CYK A;  3JAM g;  4A2M A;  3I7H A;  3I7L A;  4CI8 A;  4GQB B;  1MG3 A;  3C99 A;  3SN6 B;  3JZH A;  2UZX B;  3IUN A;  2HES X;  3ZDZ A;  4PSX B;  4NAA A;  4GQ2 P;  2MTA H;  2H9N A;  3EG6 A;  3MZL A;  4JD2 C;  4MMX A;  2H9M A;  4PNK B;  4JSV C;  4PXW A;  3ZE2 A;  2H68 A;  1M1X A;  3AL8 A;  3O4J A;  3O4H A;  3PE7 A;  2UZY B;  3V5W B;  3EI1 A;  4D9S A;  3VA6 A;  3IJC A;  4JHP C;  4JXM A;  3AFC A;  2AGL A;  2TRC B;  4A0A A;  1MDA H;  4A7J A;  4GGA A;  4O9D A;  3GD1 I;  3EI2 A;  2OVR B;  3F3F A;  3T3P A;  5M5U A;  4BCD A;  2PM7 B;  4CY3 A;  1VZ2 A;  3RN1 D;  4J84 A;  1JTD B;  1UOQ A;  4O02 A;  4Y5R D;  3IJE A;  3SCY A;  1XHM A;  3ORV D;  1JJU B;  3I2N A;  4XYI A;  3GFC A;  3EI3 A;  4O2W A;  5SXM A;  1QFM A;  4CY5 A;  4QQE A;  5FKQ A;  2G99 A;  3UKU C;  2H9L A;  4CI1 A;  3JZN A;  4AEZ A;  3JRO A;  2G9A A;  3IUL A;  1SQJ A;  4GZ8 A;  4J86 A;  3SLE D;  5EMJ B;  1NEX B;  3F3P A;  3I8C A;  3P4F A;  2H6N A;  2Z2N A;  5IT9 g;  3NIF A;  5M61 A;  3GRE A;  5FQD A;  3PVW B;  1A0R B;  3JRP A;  3DM0 A;  3UVK A;  1VE7 A;  4AOW A;  5GXI A;  1SQ9 A;  1U2V C;  1BPO A;  3CFS B;  2IUV A;  2B4E A;  4J0X A;  5GXH A;  3UVO A;  3GC3 B;  1E8N A;  3DSM A;  1ERJ A;  4CI3 A;  5GMK n;  5EAL A;  5HE2 B;  4LG8 A;  3NVQ A;  5GSA A;  3O4G A;  3SVW D;  4A0B B;  4FA4 D;  4O3U B;  4BP8 A;  3I89 A;  1OMW B;  2P9N C;  3PXS D;  1UOP A;  4G1M A;  2H6K A;  2HU5 A;  4XYH A;  3SWS D;  2OK6 A;  5HE3 B;  2P9I C;  5TEE A;  1XIP A;  4G55 A;  5AMS A;  2QC5 A;  2Q7Q A;  2BKL A;  2PM6 B;  5H14 A;  2I3S A;  5FA5 B;  2CN3 A;  5I5M A;  4HDJ A;  4LG9 A;  3MZK A;  1PGU A;  1U4C A;  2HKR A;  3B7F A;  4PBY A;  3EI1 B;  3L4M D;  4E5Z B;  3IIY A;  4AMY A;  2VZ3 A;  3MUN A;  3FCU A;  1YFQ A;  1RI6 A;  2CO0 A;  3IKO A;  1U8C A;  2CNX A;  3EI2 B;  4Y7R A;  5C9Z B;  4E54 A;  4Z8L A;  3BWS A;  3VI4 A;  1H2W A;  3MKS B;  3EMH A;  5EAP A;  4GM9 A;  3N0E A;  3OL2 B;  4BCB A;  4J0W A;  4RE5 A;  2PM9 B;  4G56 B;  3VH0 A;  3JPX A;  5EAR A;  1QNI A;  3SBP A;  5FXY A;  2OK4 A;  2O9K A;  2Z2O A;  5TEF A;  4NBM A;  3EU7 A;  4L3H D;  4A0B A;  4PC0 A;  4MMY A;  2AGX A;  1PI6 A;  1N6E A;  3KRX B;  2IWF A;  3UR4 A;  2EIC A;  2HJB A;  1JV2 A;  5IJ8 E;  3NVX A;  1C9I A;  3EI4 A;  1PBY B;  2B5M A;  2GC7 A;  3FM0 A;  2VDL A;  3EWE A;  4E54 B;  2YNP A;  5H1M A;  4ZOV A;  1N6F A;  4CC9 A;  1S4U X;  4BCC A;  4BUJ C;  3RFH A;  4CY2 A;  2YNO A;  1H2X A;  2YB8 B;  3EI4 B;  4FA1 D;  4Z7O A;  1O6G A;  2H13 A;  4FAV D;  1NR0 A;  3FRX A;  2XZG A;  4U1E I;  3I7N A;  4WK2 A;  3RN0 D;  5E6R A;  4D6V A;  4A11 A;  2AGZ A;  2AH1 A;  3K26 A;  3NIG A;  3OW8 A;  4QRJ A;  4X60 B;  2EID A;  5HYN B;  2HU8 A;  3SHF A;  3DXM C;  2I0R A;  4JT6 C;  4GM8 A;  4X3E A;  4A2L A;  4YVD A;  1I2M B;  3JZG A;  1L5G A;  4A0A B;  4L9O A;  2HU7 A;  3V7D B;  4J73 A;  4FA9 D;  3BG1 A;  5TF2 A;  1VZ3 A;  1P22 A;  3DWL C;  4KFM B;  5K19 A;  5C92 A;  3SXT D;  2J55 H;  1GOG A;  3VGZ A;  2P9K C;  2QR5 A;  3HFQ A;  2W18 A;  5EMM B;  3OF7 A;  3ULE C;  4JT5 C;  5C86 A;  3SBQ A;  2J56 H;  5C2W B;  4R7A B;  1GOT B;  2CO0 C;  2PBI B;  4BL0 A;  4ZOZ A;  4O3T B;  3UVL A;  2IUP A;  1SHY B;  3IUQ A;  2CN2 A;  3V4P A;  3QHY B;  1XKS A;  4QT8 A;  4L1Q D;  4QL1 A;  3OKY A;  4JSP C;  3SFZ A;  3J81 g;  4BP9 A;  1TYE A;  2H14 A;  3I7P A;  3JB9 L;  3OTT A;  3K71 A;  5M5T A;  2WQ8 A;  4NSX A;  1PEV A;  4OWR A;  4A09 A;  2H6Q A;  4O1Q D;  2IAA A;  4FWW A;  2BCJ B;  4OZU A;  3OKT A;  4GMB A;  1VE6 A;  3OKY B;  2HXC A;  3SBR A;  2XL3 A;  2VC2 A;  5FFO A;  4CZX A;  5IJ7 E;  2VZ1 A;  3KRW B;  3IVM A;  2B5N A;  4JSN C;  2HYE A;  4J8B A;  3RFG A;  1E5T A;  3IUM A;  4BH6 A;  2P9P C;  3I7K A;  4AMZ A;  1UOO A;  3BG0 A;  5FLX g;  4QAM A;  4MK0 B;  4K3J B;  2OIZ A;  4AN0 A;  4ERZ A;  1TYQ C;  4MMZ A;  2XU7 A;  4UI9 R;  3I8E A;  5C2V B;  4I79 A;  1JMX B;  4AN1 A;  2EBS A;  5CXC B;  5B4W A;  3DDU A;  3ZE1 A;  3AL8 B;  5EM2 B;  2CE8 A;  3ZDY A;  3UVM A;  4A08 A;  4G1E A;  2B5L A;  4WK4 A;  5THA A;  4PSW B;  5EML B;  5H17 A;  4J87 A;  5CXC A;  3IUJ A;  2Z2P A;  5EM2 A;  3E0C A;  3CIK B;  1YR2 A;  2VDQ A;  1FWX A;  2XYI A;  2YNN A;  3N0D A;  4J8G A;  4E5Z A;  4A08 B;  2AH0 A;  4H5J A;  4DNU A;  5EAM A;  1B9X A;  1GOF A;  4FHL A;  4FA5 D;  1H2Z A;  3I7O A;  4LGN A;  4J78 A;  4X63 B;  2I3T A;  3V4V A;  4L1M A;  3L4O D;  3FCS A;  3ZE0 A;  4JSX C;  4DNW A;  3A0F A;  4CI2 A;  3QI0 A;  3EQ7 A;  2IUQ A;  4NC4 A;  2IUR A;  5I5I A;  1VYH C;  2VDO A;  1MG2 A;  2OVQ B;  2VDN A;  3RRM C;  4A11 B;  4FB1 D;  3VI3 A;  1C9L A;  1GOH A;  4IMM A;  5HE1 B;  5A2Q g;  3IIW A;  2YMU A;  1QFS A;  2XE4 A;  5AJA A;  5CYK B;  4Z7N A;  4D0K A;  3UKR C;  3KCI A;  3K72 A;  3PXT D;  5HQG A;  3NVN A;  4WJK A;  4DNV A;  5IGO A;  4GGD A;  4J77 A;  3AH8 B;  4X61 B;  2EIB A;  3MUO A;  3U4Y A;  3AL9 A;  3OL2 A;  3ZWL B;  4ES0 A;  4Z7Q A;  5M5R A;  3V9F A;  3MXX A;  3DXK C; 
#chains in the Genus database with same CATH homology
 3OKW A;  4J79 A;  5EMK B;  5TDH B;  3MKQ A;  4CZY A;  5FKR A;  4GQ1 A;  4N14 A;  4J82 A;  1GG2 B;  1L0Q A;  2AGW A;  2H9P A;  2PM9 A;  2H47 A;  3C75 H;  1TBG A;  4CZV A;  2H3X A;  1JOF A;  2CE9 A;  3CFV A;  4PBZ A;  4FAN D;  4ZOY A;  5HE0 B;  4U7A A;  4CY1 A;  5AFU 3;  1OLZ A;  2QXV A;  1B9Y A;  2IWK A;  4GGC A;  3SMR A;  4GM3 A;  4ZOX A;  2J57 G;  3IJ0 A;  4EWR A;  4ESG A;  4ERQ A;  4K3I D;  3PXW D;  5IC7 A;  4IA9 A;  3W15 A;  5K1C C;  4TZ4 A;  3RLM D;  3K27 A;  1Q47 A;  3F3G A;  2P9U C;  3SJL D;  2OVP B;  5JWZ A;  4ZN4 A;  3PSC B;  5IGQ A;  4ERY A;  2AGY A;  1GXR A;  2BBK H;  5KDO B;  2GNQ A;  2AQ5 A;  5CXB B;  5FKS A;  2OJY A;  3J80 g;  4O45 A;  4L3G D;  3C5M A;  1JMZ B;  4XEI C;  3C9C A;  2XL2 A;  1GP2 B;  3MMY A;  5CXB A;  3RMZ D;  2I0S A;  4H5I A;  3PVU B;  4J81 A;  2GC4 A;  3ODT A;  4A09 B;  3IJ1 A;  2P9L C;  2I0T A;  2YBA A;  2HJ4 A;  2HKM A;  2P9S C;  3FGB A;  1N6D A;  5FKT A;  3EI3 B;  3UVN A;  1R5M A;  1K32 A;  3PSL A;  3RSE C;  5I5J A;  1K8K C;  5CYK A;  3JAM g;  4A2M A;  3I7H A;  3I7L A;  4CI8 A;  4GQB B;  1MG3 A;  3C99 A;  3SN6 B;  3JZH A;  2UZX B;  2HES X;  4PSX B;  4GQ2 P;  2MTA H;  2H9N A;  3EG6 A;  3MZL A;  4JD2 C;  2H9M A;  4PNK B;  4JSV C;  4PXW A;  2H68 A;  3AL8 A;  3PE7 A;  2UZY B;  3V5W B;  3EI1 A;  3VA6 A;  3IJC A;  4JXM A;  3AFC A;  2AGL A;  2TRC B;  4A0A A;  1MDA H;  4A7J A;  4GGA A;  4O9D A;  3EI2 A;  2OVR B;  3F3F A;  2PM7 B;  4CY3 A;  3RN1 D;  4J84 A;  4Y5R D;  3SCY A;  1XHM A;  3I2N A;  1JJU B;  3ORV D;  4XYI A;  3GFC A;  3EI3 A;  5SXM A;  4CY5 A;  4QQE A;  5FKQ A;  2G99 A;  3UKU C;  2H9L A;  4CI1 A;  3JZN A;  4AEZ A;  3JRO A;  2G9A A;  4GZ8 A;  1SQJ A;  4J86 A;  3SLE D;  5EMJ B;  1NEX B;  3F3P A;  3I8C A;  3P4F A;  2H6N A;  2Z2N A;  5IT9 g;  3GRE A;  5FQD A;  3PVW B;  1A0R B;  3JRP A;  3DM0 A;  3UVK A;  4AOW A;  5GXI A;  1SQ9 A;  1U2V C;  3CFS B;  2IUV A;  2B4E A;  4J0X A;  5GXH A;  3UVO A;  3DSM A;  1ERJ A;  4CI3 A;  5GMK n;  5EAL A;  5HE2 B;  4LG8 A;  3NVQ A;  5GSA A;  3SVW D;  4A0B B;  4FA4 D;  4O3U B;  3I89 A;  1OMW B;  2P9N C;  3PXS D;  2H6K A;  4XYH A;  3SWS D;  2OK6 A;  5HE3 B;  2P9I C;  5TEE A;  1XIP A;  5AMS A;  2QC5 A;  2Q7Q A;  2PM6 B;  5H14 A;  2I3S A;  5FA5 B;  2CN3 A;  5I5M A;  4HDJ A;  4LG9 A;  3MZK A;  1PGU A;  1U4C A;  2HKR A;  3B7F A;  4PBY A;  3EI1 B;  3L4M D;  4E5Z B;  3IIY A;  1YFQ A;  1RI6 A;  2CO0 A;  3IKO A;  2CNX A;  3EI2 B;  4Y7R A;  5C9Z B;  4E54 A;  4Z8L A;  3BWS A;  3MKS B;  3EMH A;  5EAP A;  4GM9 A;  3N0E A;  3OL2 B;  4J0W A;  2PM9 B;  4G56 B;  3VH0 A;  3JPX A;  5EAR A;  1QNI A;  3SBP A;  5FXY A;  2OK4 A;  2O9K A;  2Z2O A;  5TEF A;  3EU7 A;  4L3H D;  4A0B A;  4PC0 A;  2AGX A;  1PI6 A;  1N6E A;  3KRX B;  2IWF A;  3UR4 A;  2HJB A;  5IJ8 E;  3NVX A;  3EI4 A;  1PBY B;  2B5M A;  2GC7 A;  3FM0 A;  3EWE A;  4E54 B;  2YNP A;  5H1M A;  4ZOV A;  1N6F A;  4CC9 A;  1S4U X;  4BUJ C;  3RFH A;  4CY2 A;  2YNO A;  2YB8 B;  3EI4 B;  4FA1 D;  2H13 A;  4FAV D;  1NR0 A;  3FRX A;  4U1E I;  3I7N A;  3RN0 D;  4D6V A;  4A11 A;  2AGZ A;  2AH1 A;  3K26 A;  3OW8 A;  4QRJ A;  4X60 B;  5HYN B;  3SHF A;  3DXM C;  2I0R A;  4JT6 C;  4GM8 A;  4X3E A;  4A2L A;  4YVD A;  3JZG A;  4A0A B;  4L9O A;  3V7D B;  4J73 A;  4FA9 D;  3BG1 A;  5TF2 A;  1P22 A;  3DWL C;  4KFM B;  5K19 A;  3SXT D;  2J55 H;  3VGZ A;  2P9K C;  3HFQ A;  2W18 A;  5EMM B;  3ULE C;  4JT5 C;  3SBQ A;  2J56 H;  5C2W B;  4R7A B;  1GOT B;  2CO0 C;  2PBI B;  4BL0 A;  4ZOZ A;  4O3T B;  3UVL A;  2IUP A;  1SHY B;  2CN2 A;  1XKS A;  4QT8 A;  4L1Q D;  4QL1 A;  3OKY A;  4JSP C;  3SFZ A;  3J81 g;  2H14 A;  3I7P A;  3JB9 L;  3OTT A;  4NSX A;  1PEV A;  4OWR A;  4A09 A;  2H6Q A;  4O1Q D;  2IAA A;  4FWW A;  2BCJ B;  4OZU A;  3OKT A;  4GMB A;  3OKY B;  2HXC A;  3SBR A;  2XL3 A;  4CZX A;  5IJ7 E;  3KRW B;  2B5N A;  4JSN C;  2HYE A;  4J8B A;  3RFG A;  4BH6 A;  2P9P C;  3I7K A;  3BG0 A;  5FLX g;  4MK0 B;  4K3J B;  2OIZ A;  4ERZ A;  1TYQ C;  2XU7 A;  4UI9 R;  3I8E A;  5C2V B;  4I79 A;  1JMX B;  2EBS A;  5CXC B;  5B4W A;  3AL8 B;  5EM2 B;  2CE8 A;  3UVM A;  4A08 A;  2B5L A;  5THA A;  4PSW B;  5EML B;  5H17 A;  4J87 A;  5CXC A;  2Z2P A;  5EM2 A;  3E0C A;  3CIK B;  2YNN A;  4J8G A;  1FWX A;  2XYI A;  3N0D A;  4E5Z A;  4A08 B;  2AH0 A;  4H5J A;  5EAM A;  1B9X A;  4FHL A;  4FA5 D;  3I7O A;  4LGN A;  4J78 A;  4X63 B;  2I3T A;  3L4O D;  4JSX C;  3A0F A;  4CI2 A;  2IUQ A;  2IUR A;  5I5I A;  1VYH C;  1MG2 A;  2OVQ B;  3RRM C;  4A11 B;  4FB1 D;  4IMM A;  5HE1 B;  5A2Q g;  3IIW A;  2YMU A;  5AJA A;  5CYK B;  4D0K A;  3UKR C;  3PXT D;  5HQG A;  3NVN A;  5IGO A;  4GGD A;  4J77 A;  3AH8 B;  4X61 B;  3U4Y A;  3AL9 A;  3OL2 A;  3ZWL B;  4ES0 A;  3V9F A;  3MXX A;  3DXK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...