4D0KA

Complex of chaetomium thermophilum pan2 (wd40-cs1) with pan3 (c-term)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
345
structure length
329
Chain Sequence
MDADWDEVTRIAYPAPGTFPRPATAVAFDPIAELLWAGFDRGRVCSFYGRDLTRYTAFKIQPASEGPVRQFLFHDKGVIVLGTRSVHMAMRRGPALWNIRHENMKDLRCMSFTSKGTQEIIVAGWQDTMLVIDVLKGDIIKQIPAQHHYSIMKKSRYICAATKTGSVDLIDPLSFKIVRSWQAHASYINDMDAQNDFIVTCGGSYMLDPYVNVFDLKNMASMKPMPFPPLAAHVRLHPRMLTTAIVTSQHGQMHVVDIMNPNSSTVRYANISSYVKLFEIAPSGEALVIGDADCNIHLWGSPTKIHFTDMAIPIELPEPVLDWSETPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Gene regulation
total genus 66
structure length 329
sequence length 345
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4d0kA01
1SQ9A 4UI9R 3IIYA 1JJUB 3PSCB 4A0AA 4AOWA 4ERYA 3CFSB 4BH6A 4O1QD 4ZOVA 3C5MA 1U2VC 5IT9g 2QC5A 5HYNB 1JMZB 4Y7RA 5CXCA 2I0RA 3GREA 3JPXA 5AMSA 5TEEA 3RN0D 1N6FA 3I7HA 4J82A 3A0FA 1MDAH 3C99A 4CI3A 2J55H 4GGDA 4A08B 1N6EA 2I0SA 1XHMA 3VH0A 2GC7A 2AGXA 3OTTA 2H9NA 3ODTA 5C9ZB 2P9SC 3SCYA 3EG6A 5FKQA 3EMHA 4XEIC 4A09B 1JMXB 3IIWA 5HE2B 4J8GA 1JOFA 2H3XA 1RI6A 4CC9A 5FKTA 2OVQB 4CI8A 4ZOZA 3V5WB 2UZXB 5IJ8E 1MG2A 3AH8B 3L4OD 5EARA 3NVXA 2BCJB 3DXMC 3PVWB 4ZOXA 3CIKB 2YNOA 3N0DA 3L4MD 4BL0A 3PE7A 3CFVA 3ULEC 1XIPA 4FA9D 3V9FA 2HXCA 5KDOB 3HFQA 5FA5B 3KRXB 3OW8A 4L3HD 4FA1D 4A08A 3EI4B 4FHLA 5HE3B 3SFZA 3UVLA 4PXWA 4E54B 3JROA 5HE0B 3VA6A 2P9KC 2CE9A 4A2LA 3V7DB 3SHFA 2YB8B 3JZGA 1PBYB 4FAND 4A09A 3UVNA 3PXSD 5AFU3 2TRCB 3SJLD 2IUQA 3SBRA 4K3ID 4EWRA 2W18A 5IGOA 1ERJA 3I7KA 3BG1A 3JAMg 1PGUA 3UKUC 2Q7QA 2IAAA 1R5MA 3RFHA 4JD2C 3FM0A 3UVOA 3SVWD 4GM3A 3N0EA 4O45A 2IUVA 4KFMB 2B4EA 2IWFA 1YFQA 4FWWA 4LG9A 4X60B 5C2VB 3ORVD 3NVQA 2AGWA 2H6KA 2HJ4A 5FXYA 1L0QA 3EI4A 4XYHA 4ES0A 4GQBB 5K19A 2AGYA 4GM9A 5I5JA 2PBIB 5CYKB 4U7AA 2HESX 1SQJA 2EBSA 2J57G 4YVDA 5A2Qg 4QL1A 3DWLC 2CO0C 1B9XA 3IJ0A 4NSXA 5AJAA 4GQ1A 4JSPC 4PSWB 3J81g 4IA9A 4ZN4A 4E5ZB 5FKRA 4J8BA 2XL3A 2G99A 5H17A 3UVMA 4CY5A 4FA4D 4L3GD 2H6QA 4QT8A 5H14A 3MZKA 5GMKn 5EALA 4GGAA 3U4YA 4TZ4A 2H47A 4Y5RD 2P9LC 3PXWD 4LGNA 5EAPA 2OJYA 1U4CA 3OL2A 4BUJC 5TEFA 4K3JB 4J81A 4CY3A 1OMWB 5FKSA 5CXBB 4GM8A 2CO0A 5EMMB 3PXTD 3F3GA 3JB9L 4QQEA 4PNKB 4ERZA 2O9KA 5SXMA 3I8EA 3I8CA 3MKQA 3RMZD 2Z2OA 2XL2A 4QRJA 4GGCA 2H68A 2H6NA 4FB1D 3MKSB 3DSMA 3BG0A 5FLXg 2CN2A 1A0RB 2GC4A 3AFCA 3JRPA 3DXKC 2XU7A 3I2NA 3MXXA 2OK4A 3C9CA 2PM9B 2BBKH 3MMYA 2IUPA 4X61B 2B5LA 4MK0B 3OKYB 2HJBA 5FQDA 3BWSA 4A0AB 4J86A 3MZLA 5B4WA 4A7JA 3RRMC 4O3TB 4HDJA 4PBYA 4J77A 4A0BB 2OVRB 1SHYB 3SN6B 4J0WA 4JT5C 3P4FA 2H14A 3FRXA 5CXBA 2CE8A 3AL8B 4GQ2P 4ESGA 4L1QD 1B9YA 4PSXB 4LG8A 3RN1D 5EMLB 4PC0A 4E54A 5GXHA 4JXMA 4AEZA 5C2WB 5I5MA 4A2MA 1GG2B 3I7PA 3SXTD 3SBQA 4CI1A 1S4UX 2IURA 4I79A 2PM6B 3K26A 2IWKA 2YNPA 4ZOYA 4J87A 2PM9A 5EM2B 2GNQA 1XKSA 5K1CC 5HE1B 4G56B 4CZVA 3OKYA 4J73A 4D0KA 4CY2A 5JWZA 1P22A 5EAMA 3IKOA 3FGBA 3C75H 2YBAA 2B5NA 3PSLA 1PEVA 3E0CA 2CNXA 5I5IA 4A0BA 1N6DA 3K27A 4L9OA 5IGQA 1GOTB 4XYIA 4FAVD 3SMRA 4JSVC 2Z2PA 4U1EI 4O9DA 3EI3B 3I7OA 1FWXA 3JZNA 3EWEA 1VYHC 1MG3A 3AL8A 2I0TA 2I3SA 2HKRA 3I7NA 3UVKA 3I89A 4J78A 3EI1B 4CZXA 5IJ7E 3EI2B 2HKMA 4Z8LA 2AH1A 4JSNC 2MTAH 3EU7A 5IC7A 3IJCA 3UR4A 3J80g 3VGZA 3JZHA 3OKTA 5CYKA 5HQGA 2Z2NA 4JSXC 1OLZA 2P9UC 2H9PA 2H9MA 1PI6A 2UZYB 5EM2A 3W15A 2HYEA 5H1MA 2CN3A 3PVUB 2YMUA 4X63B 4PBZA 4CY1A 2P9IC 2QXVA 3F3PA 4OWRA 4FA5D 5TDHB 4A11B 1TYQC 4OZUA 4E5ZA 3ZWLB 4GMBA 2B5MA 3RLMD 5THAA 4CI2A 1TBGA 1NR0A 1QNIA 3NVNA 3EI3A 2G9AA 2OIZA 2XYIA 5TF2A 4IMMA 3SLED 3I7LA 3RSEC 3EI1A 2P9NC 2AGLA 1K8KC 1NEXB 3EI2A 4O3UB 3SBPA 4R7AB 2OVPB 3RFGA 5CXCB 5GXIA 1GXRA 3GFCA 4H5JA 4CZYA 2AGZA 5GSAA 2PM7B 4GZ8A 2YNNA 4JT6C 2P9PC 3KRWB 3DM0A 2AQ5A 2J56H 3SWSD 4N14A 1GP2B 3OKWA 4H5IA 2I3TA 1K32A 4X3EA 2H9LA 4ERQA 2OK6A 4J79A 3AL9A 3F3FA 4A11A 5EMKB 3B7FA 1Q47A 2H13A 4J0XA 4J84A 3UKRC 5EMJB 4D6VA 3IJ1A 3OL2B 2AH0A
chains in the Genus database with same CATH superfamily
3VI4A 1SQ9A 4UI9R 3IIYA 1JJUB 3PSCB 3K72A 3GD1I 4A0AA 4AOWA 4ERYA 3CFSB 4G1EA 4BH6A 4O1QD 4ZOVA 3C5MA 1U2VC 5IT9g 4DNUA 1UTCA 3IUQA 3O4JA 2QC5A 2HU7A 5HYNB 1JMZB 4Y7RA 2VDOA 3ZDXA 5CXCA 2I0RA 3GREA 3JPXA 2VZ1A 5AMSA 5TEEA 1N6FA 3I7HA 3MUOA 4J82A 3RN0D 5M5UA 3A0FA 4NBMA 1MDAH 3C99A 4CI3A 2J55H 4GGDA 4A08B 1H2XA 1N6EA 1XHMA 2I0SA 3VH0A 1C9LA 2GC7A 2AGXA 3OTTA 4O2WA 2H9NA 5M5VA 3ODTA 5C9ZB 2P9SC 3SCYA 3EG6A 1E8MA 5FKQA 3EMHA 4XEIC 4A09B 1JMXB 3IIWA 5HE2B 4J8GA 1JOFA 3EQ9A 2H3XA 1RI6A 4CC9A 5FKTA 2OVQB 4CI8A 4ZOZA 3V5WB 2UZXB 5IJ8E 5C86A 4BCDA 1MG2A 3AH8B 3L4OD 5EARA 3NVXA 2BCJB 3DXMC 3PVWB 4ZOXA 3CIKB 2YNOA 3N0DA 3L4MD 1U8CA 4BL0A 3PE7A 5E6SA 3CFVA 3ULEC 1XIPA 4FA9D 3V9FA 2HXCA 5KDOB 3HFQA 2VDPA 3O4HA 4G55A 5FA5B 1O6FA 3KRXB 3OW8A 4L3HD 3IUMA 4FA1D 4A08A 3EI4B 4FHLA 5HE3B 3SFZA 3UVLA 4PXWA 4E54B 3JROA 5HE0B 3VA6A 2P9KC 2CE9A 4A2LA 3V7DB 3ZDYA 2XZGA 3SHFA 3MVDK 2YB8B 3JZGA 1PBYB 4FAND 4A09A 3UVNA 3QHYB 3PXSD 5AFU3 2TRCB 3SJLD 3NIDA 4NC4A 2IUQA 3SBRA 4K3ID 5M61A 1A12A 4EWRA 2W18A 5IGOA 3V4PA 1ERJA 3I7KA 5M5RA 3BG1A 3JAMg 1PGUA 3UKUC 3KCIA 3O4GA 2Q7QA 2IAAA 4Z7NA 1R5MA 3RFHA 4JD2C 1UOPA 1K3IA 3FM0A 4L1MA 3UVOA 2XDWA 3SVWD 4GM3A 3N0EA 4AN0A 4O45A 2IUVA 4KFMB 2B4EA 2IWFA 1YFQA 4FWWA 1VE7A 4LG9A 4X60B 1M1XA 5C2VB 2QR5A 3ORVD 3NVQA 2AGWA 2H6KA 2HJ4A 5FXYA 1L0QA 3EI4A 4XYHA 4ES0A 3K6SA 4GQBB 1BPOA 5K19A 2AGYA 4AMYA 2HU5A 4GM9A 5I5JA 3ZE2A 5M5SA 2PBIB 5CYKB 4U7AA 3DDUA 2VDQA 5M5TA 2HESX 3EQ7A 3QI0A 4O02A 1SQJA 2EBSA 2J57G 4YVDA 5E6RA 4DNWA 5A2Qg 1GOHA 4QL1A 3DWLC 2CO0C 3NIFA 1B9XA 3IJ0A 4NSXA 5AJAA 4GQ1A 4JSPC 1H2YA 4PSWB 3J81g 4IA9A 4ZN4A 4E5ZB 5FKRA 4J8BA 2XL3A 2G99A 4Z7OA 5E6UA 5H17A 3UVMA 4CY5A 4FA4D 4L3GD 4WJKA 2H6QA 4QT8A 5H14A 3MZKA 3IVMA 4MMYA 5EALA 5GMKn 4GGAA 3U4YA 1T2XA 3IJEA 2H47A 4TZ4A 4Y5RD 2P9LC 3PXWD 4LGNA 5EAPA 1QFSA 2HU8A 2OJYA 1U4CA 2VDMA 3OL2A 4AMZA 1O6GA 4BUJC 5TEFA 4K3JB 4J81A 4CY3A 4RE5A 1OMWB 5FKSA 5CXBB 3K71A 4WK2A 4GM8A 1VZ3A 2CO0A 4NAAA 5EMMB 3PXTD 3F3GA 3JB9L 4D9SA 4QQEA 4PNKB 4ERZA 3FCSA 3IURA 2O9KA 5SXMA 3I8EA 3I8CA 3MKQA 3RMZD 2Z2OA 1JV2A 2XL2A 4QRJA 4GGCA 2H68A 2H6NA 4FB1D 3MKSB 4RE6A 3DSMA 3T3PA 4DNVA 3BG0A 5FLXg 2CN2A 3O4IA 1A0RB 2GC4A 3AFCA 1E5TA 3JRPA 3DXKC 2XU7A 1H2ZA 3I2NA 3MXXA 2OK4A 3C9CA 2PM9B 2BBKH 3VI3A 3MMYA 4AX4A 2IUPA 4X61B 2B5LA 4MK0B 3OKYB 2HJBA 5FQDA 3T3MA 3BWSA 2QZPA 4J86A 4A0AB 3MZLA 5B4WA 4A7JA 3RRMC 4Z7QA 4O3TB 2EIDA 4HDJA 4PBYA 4J77A 4A0BB 2OVRB 1SHYB 1TYEA 3SN6B 4J0WA 4JT5C 3ZE1A 3P4FA 2H14A 3FRXA 5CXBA 3IULA 2BKLA 2CE8A 4NENA 2VDRA 3AL8B 4GQ2P 4ESGA 3IUNA 1QFMA 4L1QD 1B9YA 4PSXB 1VE6A 3GC3B 4LG8A 3RN1D 5EMLB 4PC0A 4E54A 5GXHA 4JXMA 4BP8A 4AEZA 5C2WB 5I5MA 4A2MA 1GG2B 3I7PA 3SXTD 3SBQA 3ZE0A 4CI1A 1S4UX 2IURA 4I79A 2PM6B 3K26A 2IWKA 2YNPA 2VZ3A 4ZOYA 4J87A 3MUNA 2PM9A 5EM2B 2GNQA 1XKSA 4AN1A 5K1CC 5HE1B 4G56B 4CZVA 3OKYA 4J73A 4QAMA 4CY2A 4D0KA 5JWZA 1P22A 5EAMA 3IKOA 1GOGA 3FGBA 3C75H 2YBAA 2B5NA 3PSLA 1PEVA 3E0CA 2CNXA 2EIEA 5I5IA 4A0BA 1N6DA 3K27A 4L9OA 5IGQA 1GOTB 4XYIA 4FAVD 4IRZA 3SMRA 4JSVC 2Z2PA 3ZDZA 4U1EI 4O9DA 2JKXA 3EI3B 5FFOA 3I7OA 1FWXA 3JZNA 5HDBA 3EWEA 1VYHC 1MG3A 3AL8A 2I0TA 2I3SA 2HKRA 3I7NA 3UVKA 4UM9A 3V4VA 3I89A 4J78A 5C92A 3EI1B 4CZXA 4UM8A 2EICA 5IJ7E 3EI2B 2HKMA 4Z8LA 1VZ2A 2AH1A 1UOOA 4WK0A 2EIBA 4JSNC 2MTAH 3EU7A 4WK4A 5IC7A 3IJCA 3UR4A 3J80g 3VGZA 3JZHA 4G1MA 3OKTA 3IUJA 1L5GA 5CYKA 5HQGA 3OF7A 4MMZA 2Z2NA 4JHNA 4JHPC 4JSXC 1OLZA 2P9UC 2H9PA 2H9MA 1PI6A 2UZYB 5EM2A 3W15A 2HYEA 5H1MA 2CN3A 3PVUB 2YMUA 4X63B 4PBZA 4CY1A 2P9IC 2QXVA 3F3PA 4OWRA 4FA5D 2XE4A 5TDHB 1TYQC 4OZUA 4A11B 3ZWLB 4E5ZA 4GMBA 2B5MA 3RLMD 5THAA 4CI2A 2VC2A 1TBGA 1NR0A 1QNIA 3NVNA 1YR2A 3EI3A 2G9AA 1I2MB 2OIZA 2XYIA 5FFGA 5TF2A 4IMMA 3SLED 3I7LA 3RSEC 3EI1A 2P9NC 2AGLA 1K8KC 1NEXB 3EI2A 4BCBA 4O3UB 3SBPA 4R7AB 2OVPB 3RFGA 1UOQA 5CXCB 1GXRA 3GFCA 4H5JA 5GXIA 4BCCA 4CZYA 2AGZA 5GSAA 1C9IA 2PM7B 1GOFA 4GZ8A 2YNNA 4JT6C 2VDLA 2P9PC 3KRWB 3DM0A 2AQ5A 2J56H 3SWSD 1E8NA 3NIGA 1JTDB 4N14A 1GP2B 3OKWA 2VDKA 4H5IA 2I3TA 2VDNA 1K32A 4X3EA 2H9LA 4ERQA 2OK6A 4J79A 2WQ8A 3AL9A 1H2WA 3F3FA 4A11A 5EMKB 3B7FA 1Q47A 2H13A 4J0XA 4J84A 3UKRC 5EMJB 4D6VA 3EQ8A 4MMXA 3IJ1A 3FCUA 4BP9A 3OL2B 2AH0A
chains in the Genus database with same CATH topology
1SQ9A 4UI9R 3IIYA 1JJUB 3PSCB 4A0AA 4AOWA 4ERYA 3CFSB 4BH6A 4O1QD 4ZOVA 3C5MA 1U2VC 5IT9g 2QC5A 5HYNB 1JMZB 4Y7RA 5CXCA 2I0RA 3GREA 3JPXA 5AMSA 5TEEA 3RN0D 1N6FA 3I7HA 4J82A 3A0FA 1MDAH 3C99A 4CI3A 2J55H 4GGDA 4A08B 1N6EA 2I0SA 1XHMA 3VH0A 2GC7A 2AGXA 3OTTA 2H9NA 3ODTA 5C9ZB 2P9SC 3SCYA 3EG6A 5FKQA 3EMHA 4XEIC 4A09B 1JMXB 3IIWA 5HE2B 4J8GA 1JOFA 2H3XA 1RI6A 4CC9A 5FKTA 2OVQB 4CI8A 4ZOZA 3V5WB 2UZXB 5IJ8E 1MG2A 3AH8B 3L4OD 5EARA 3NVXA 2BCJB 3DXMC 3PVWB 4ZOXA 3CIKB 2YNOA 3N0DA 3L4MD 4BL0A 3PE7A 3CFVA 3ULEC 1XIPA 4FA9D 3V9FA 2HXCA 5KDOB 3HFQA 5FA5B 3KRXB 3OW8A 4L3HD 4FA1D 4A08A 3EI4B 4FHLA 5HE3B 3SFZA 3UVLA 4PXWA 4E54B 3JROA 5HE0B 3VA6A 2P9KC 2CE9A 4A2LA 3V7DB 3SHFA 2YB8B 3JZGA 1PBYB 4FAND 4A09A 3UVNA 3PXSD 5AFU3 2TRCB 3SJLD 2IUQA 3SBRA 4K3ID 4EWRA 2W18A 5IGOA 1ERJA 3I7KA 3BG1A 3JAMg 1PGUA 3UKUC 2Q7QA 2IAAA 1R5MA 3RFHA 4JD2C 3FM0A 3UVOA 3SVWD 4GM3A 3N0EA 4O45A 2IUVA 4KFMB 2B4EA 2IWFA 1YFQA 4FWWA 4LG9A 4X60B 5C2VB 3ORVD 3NVQA 2AGWA 2H6KA 2HJ4A 5FXYA 1L0QA 3EI4A 4XYHA 4ES0A 4GQBB 5K19A 2AGYA 4GM9A 5I5JA 2PBIB 5CYKB 4U7AA 2HESX 1SQJA 2EBSA 2J57G 4YVDA 5A2Qg 4QL1A 3DWLC 2CO0C 1B9XA 3IJ0A 4NSXA 5AJAA 4GQ1A 4JSPC 4PSWB 3J81g 4IA9A 4ZN4A 4E5ZB 5FKRA 4J8BA 2XL3A 2G99A 5H17A 3UVMA 4CY5A 4FA4D 4L3GD 2H6QA 4QT8A 5H14A 3MZKA 5GMKn 5EALA 4GGAA 3U4YA 4TZ4A 2H47A 4Y5RD 2P9LC 3PXWD 4LGNA 5EAPA 2OJYA 1U4CA 3OL2A 4BUJC 5TEFA 4K3JB 4J81A 4CY3A 1OMWB 5FKSA 5CXBB 4GM8A 2CO0A 5EMMB 3PXTD 3F3GA 3JB9L 4QQEA 4PNKB 4ERZA 2O9KA 5SXMA 3I8EA 3I8CA 3MKQA 3RMZD 2Z2OA 2XL2A 4QRJA 4GGCA 2H68A 2H6NA 4FB1D 3MKSB 3DSMA 3BG0A 5FLXg 2CN2A 1A0RB 2GC4A 3AFCA 3JRPA 3DXKC 2XU7A 3I2NA 3MXXA 2OK4A 3C9CA 2PM9B 2BBKH 3MMYA 2IUPA 4X61B 2B5LA 4MK0B 3OKYB 2HJBA 5FQDA 3BWSA 4A0AB 4J86A 3MZLA 5B4WA 4A7JA 3RRMC 4O3TB 4HDJA 4PBYA 4J77A 4A0BB 2OVRB 1SHYB 3SN6B 4J0WA 4JT5C 3P4FA 2H14A 3FRXA 5CXBA 2CE8A 3AL8B 4GQ2P 4ESGA 4L1QD 1B9YA 4PSXB 4LG8A 3RN1D 5EMLB 4PC0A 4E54A 5GXHA 4JXMA 4AEZA 5C2WB 5I5MA 4A2MA 1GG2B 3I7PA 3SXTD 3SBQA 4CI1A 1S4UX 2IURA 4I79A 2PM6B 3K26A 2IWKA 2YNPA 4ZOYA 4J87A 2PM9A 5EM2B 2GNQA 1XKSA 5K1CC 5HE1B 4G56B 4CZVA 3OKYA 4J73A 4D0KA 4CY2A 5JWZA 1P22A 5EAMA 3IKOA 3FGBA 3C75H 2YBAA 2B5NA 3PSLA 1PEVA 3E0CA 2CNXA 5I5IA 4A0BA 1N6DA 3K27A 4L9OA 5IGQA 1GOTB 4XYIA 4FAVD 3SMRA 4JSVC 2Z2PA 4U1EI 4O9DA 3EI3B 3I7OA 1FWXA 3JZNA 3EWEA 1VYHC 1MG3A 3AL8A 2I0TA 2I3SA 2HKRA 3I7NA 3UVKA 3I89A 4J78A 3EI1B 4CZXA 5IJ7E 3EI2B 2HKMA 4Z8LA 2AH1A 4JSNC 2MTAH 3EU7A 5IC7A 3IJCA 3UR4A 3J80g 3VGZA 3JZHA 3OKTA 5CYKA 5HQGA 2Z2NA 4JSXC 1OLZA 2P9UC 2H9PA 2H9MA 1PI6A 2UZYB 5EM2A 3W15A 2HYEA 5H1MA 2CN3A 3PVUB 2YMUA 4X63B 4PBZA 4CY1A 2P9IC 2QXVA 3F3PA 4OWRA 4FA5D 5TDHB 4A11B 1TYQC 4OZUA 4E5ZA 3ZWLB 4GMBA 2B5MA 3RLMD 5THAA 4CI2A 1TBGA 1NR0A 1QNIA 3NVNA 3EI3A 2G9AA 2OIZA 2XYIA 5TF2A 4IMMA 3SLED 3I7LA 3RSEC 3EI1A 2P9NC 2AGLA 1K8KC 1NEXB 3EI2A 4O3UB 3SBPA 4R7AB 2OVPB 3RFGA 5CXCB 5GXIA 1GXRA 3GFCA 4H5JA 4CZYA 2AGZA 5GSAA 2PM7B 4GZ8A 2YNNA 4JT6C 2P9PC 3KRWB 3DM0A 2AQ5A 2J56H 3SWSD 4N14A 1GP2B 3OKWA 4H5IA 2I3TA 1K32A 4X3EA 2H9LA 4ERQA 2OK6A 4J79A 3AL9A 3F3FA 4A11A 5EMKB 3B7FA 1Q47A 2H13A 4J0XA 4J84A 3UKRC 5EMJB 4D6VA 3IJ1A 3OL2B 2AH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQ9 A;  4UI9 R;  3IIY A;  1JJU B;  3PSC B;  4A0A A;  4AOW A;  4ERY A;  3CFS B;  4BH6 A;  4O1Q D;  4ZOV A;  3C5M A;  1U2V C;  5IT9 g;  2QC5 A;  5HYN B;  1JMZ B;  4Y7R A;  5CXC A;  2I0R A;  3GRE A;  3JPX A;  5AMS A;  5TEE A;  3RN0 D;  1N6F A;  3I7H A;  4J82 A;  3A0F A;  1MDA H;  3C99 A;  4CI3 A;  2J55 H;  4GGD A;  4A08 B;  1N6E A;  2I0S A;  1XHM A;  3VH0 A;  2GC7 A;  2AGX A;  3OTT A;  2H9N A;  3ODT A;  5C9Z B;  2P9S C;  3SCY A;  3EG6 A;  5FKQ A;  3EMH A;  4XEI C;  4A09 B;  1JMX B;  3IIW A;  5HE2 B;  4J8G A;  1JOF A;  2H3X A;  1RI6 A;  4CC9 A;  5FKT A;  2OVQ B;  4CI8 A;  4ZOZ A;  3V5W B;  2UZX B;  5IJ8 E;  1MG2 A;  3AH8 B;  3L4O D;  5EAR A;  3NVX A;  2BCJ B;  3DXM C;  3PVW B;  4ZOX A;  3CIK B;  2YNO A;  3N0D A;  3L4M D;  4BL0 A;  3PE7 A;  3CFV A;  3ULE C;  1XIP A;  4FA9 D;  3V9F A;  2HXC A;  5KDO B;  3HFQ A;  5FA5 B;  3KRX B;  3OW8 A;  4L3H D;  4FA1 D;  4A08 A;  3EI4 B;  4FHL A;  5HE3 B;  3SFZ A;  3UVL A;  4PXW A;  4E54 B;  3JRO A;  5HE0 B;  3VA6 A;  2P9K C;  2CE9 A;  4A2L A;  3V7D B;  3SHF A;  2YB8 B;  3JZG A;  1PBY B;  4FAN D;  4A09 A;  3UVN A;  3PXS D;  5AFU 3;  2TRC B;  3SJL D;  2IUQ A;  3SBR A;  4K3I D;  4EWR A;  2W18 A;  5IGO A;  1ERJ A;  3I7K A;  3BG1 A;  3JAM g;  1PGU A;  3UKU C;  2Q7Q A;  2IAA A;  1R5M A;  3RFH A;  4JD2 C;  3FM0 A;  3UVO A;  3SVW D;  4GM3 A;  3N0E A;  4O45 A;  2IUV A;  4KFM B;  2B4E A;  2IWF A;  1YFQ A;  4FWW A;  4LG9 A;  4X60 B;  5C2V B;  3ORV D;  3NVQ A;  2AGW A;  2H6K A;  2HJ4 A;  5FXY A;  1L0Q A;  3EI4 A;  4XYH A;  4ES0 A;  4GQB B;  5K19 A;  2AGY A;  4GM9 A;  5I5J A;  2PBI B;  5CYK B;  4U7A A;  2HES X;  1SQJ A;  2EBS A;  2J57 G;  4YVD A;  5A2Q g;  4QL1 A;  3DWL C;  2CO0 C;  1B9X A;  3IJ0 A;  4NSX A;  5AJA A;  4GQ1 A;  4JSP C;  4PSW B;  3J81 g;  4IA9 A;  4ZN4 A;  4E5Z B;  5FKR A;  4J8B A;  2XL3 A;  2G99 A;  5H17 A;  3UVM A;  4CY5 A;  4FA4 D;  4L3G D;  2H6Q A;  4QT8 A;  5H14 A;  3MZK A;  5GMK n;  5EAL A;  4GGA A;  3U4Y A;  4TZ4 A;  2H47 A;  4Y5R D;  2P9L C;  3PXW D;  4LGN A;  5EAP A;  2OJY A;  1U4C A;  3OL2 A;  4BUJ C;  5TEF A;  4K3J B;  4J81 A;  4CY3 A;  1OMW B;  5FKS A;  5CXB B;  4GM8 A;  2CO0 A;  5EMM B;  3PXT D;  3F3G A;  3JB9 L;  4QQE A;  4PNK B;  4ERZ A;  2O9K A;  5SXM A;  3I8E A;  3I8C A;  3MKQ A;  3RMZ D;  2Z2O A;  2XL2 A;  4QRJ A;  4GGC A;  2H68 A;  2H6N A;  4FB1 D;  3MKS B;  3DSM A;  3BG0 A;  5FLX g;  2CN2 A;  1A0R B;  2GC4 A;  3AFC A;  3JRP A;  3DXK C;  2XU7 A;  3I2N A;  3MXX A;  2OK4 A;  3C9C A;  2PM9 B;  2BBK H;  3MMY A;  2IUP A;  4X61 B;  2B5L A;  4MK0 B;  3OKY B;  2HJB A;  5FQD A;  3BWS A;  4A0A B;  4J86 A;  3MZL A;  5B4W A;  4A7J A;  3RRM C;  4O3T B;  4HDJ A;  4PBY A;  4J77 A;  4A0B B;  2OVR B;  1SHY B;  3SN6 B;  4J0W A;  4JT5 C;  3P4F A;  2H14 A;  3FRX A;  5CXB A;  2CE8 A;  3AL8 B;  4GQ2 P;  4ESG A;  4L1Q D;  1B9Y A;  4PSX B;  4LG8 A;  3RN1 D;  5EML B;  4PC0 A;  4E54 A;  5GXH A;  4JXM A;  4AEZ A;  5C2W B;  5I5M A;  4A2M A;  1GG2 B;  3I7P A;  3SXT D;  3SBQ A;  4CI1 A;  1S4U X;  2IUR A;  4I79 A;  2PM6 B;  3K26 A;  2IWK A;  2YNP A;  4ZOY A;  4J87 A;  2PM9 A;  5EM2 B;  2GNQ A;  1XKS A;  5K1C C;  5HE1 B;  4G56 B;  4CZV A;  3OKY A;  4J73 A;  4D0K A;  4CY2 A;  5JWZ A;  1P22 A;  5EAM A;  3IKO A;  3FGB A;  3C75 H;  2YBA A;  2B5N A;  3PSL A;  1PEV A;  3E0C A;  2CNX A;  5I5I A;  4A0B A;  1N6D A;  3K27 A;  4L9O A;  5IGQ A;  1GOT B;  4XYI A;  4FAV D;  3SMR A;  4JSV C;  2Z2P A;  4U1E I;  4O9D A;  3EI3 B;  3I7O A;  1FWX A;  3JZN A;  3EWE A;  1VYH C;  1MG3 A;  3AL8 A;  2I0T A;  2I3S A;  2HKR A;  3I7N A;  3UVK A;  3I89 A;  4J78 A;  3EI1 B;  4CZX A;  5IJ7 E;  3EI2 B;  2HKM A;  4Z8L A;  2AH1 A;  4JSN C;  2MTA H;  3EU7 A;  5IC7 A;  3IJC A;  3UR4 A;  3J80 g;  3VGZ A;  3JZH A;  3OKT A;  5CYK A;  5HQG A;  2Z2N A;  4JSX C;  1OLZ A;  2P9U C;  2H9P A;  2H9M A;  1PI6 A;  2UZY B;  5EM2 A;  3W15 A;  2HYE A;  5H1M A;  2CN3 A;  3PVU B;  2YMU A;  4X63 B;  4PBZ A;  4CY1 A;  2P9I C;  2QXV A;  3F3P A;  4OWR A;  4FA5 D;  5TDH B;  4A11 B;  1TYQ C;  4OZU A;  4E5Z A;  3ZWL B;  4GMB A;  2B5M A;  3RLM D;  5THA A;  4CI2 A;  1TBG A;  1NR0 A;  1QNI A;  3NVN A;  3EI3 A;  2G9A A;  2OIZ A;  2XYI A;  5TF2 A;  4IMM A;  3SLE D;  3I7L A;  3RSE C;  3EI1 A;  2P9N C;  2AGL A;  1K8K C;  1NEX B;  3EI2 A;  4O3U B;  3SBP A;  4R7A B;  2OVP B;  3RFG A;  5CXC B;  5GXI A;  1GXR A;  3GFC A;  4H5J A;  4CZY A;  2AGZ A;  5GSA A;  2PM7 B;  4GZ8 A;  2YNN A;  4JT6 C;  2P9P C;  3KRW B;  3DM0 A;  2AQ5 A;  2J56 H;  3SWS D;  4N14 A;  1GP2 B;  3OKW A;  4H5I A;  2I3T A;  1K32 A;  4X3E A;  2H9L A;  4ERQ A;  2OK6 A;  4J79 A;  3AL9 A;  3F3F A;  4A11 A;  5EMK B;  3B7F A;  1Q47 A;  2H13 A;  4J0X A;  4J84 A;  3UKR C;  5EMJ B;  4D6V A;  3IJ1 A;  3OL2 B;  2AH0 A; 
#chains in the Genus database with same CATH topology
 3VI4 A;  1SQ9 A;  4UI9 R;  3IIY A;  1JJU B;  3PSC B;  3K72 A;  3GD1 I;  4A0A A;  4AOW A;  4ERY A;  3CFS B;  4G1E A;  4BH6 A;  4O1Q D;  4ZOV A;  3C5M A;  1U2V C;  5IT9 g;  4DNU A;  1UTC A;  3IUQ A;  3O4J A;  2QC5 A;  2HU7 A;  5HYN B;  1JMZ B;  4Y7R A;  2VDO A;  3ZDX A;  5CXC A;  2I0R A;  3GRE A;  3JPX A;  2VZ1 A;  5AMS A;  5TEE A;  1N6F A;  3I7H A;  3MUO A;  4J82 A;  3RN0 D;  5M5U A;  3A0F A;  4NBM A;  1MDA H;  3C99 A;  4CI3 A;  2J55 H;  4GGD A;  4A08 B;  1H2X A;  1N6E A;  1XHM A;  2I0S A;  3VH0 A;  1C9L A;  2GC7 A;  2AGX A;  3OTT A;  4O2W A;  2H9N A;  5M5V A;  3ODT A;  5C9Z B;  2P9S C;  3SCY A;  3EG6 A;  1E8M A;  5FKQ A;  3EMH A;  4XEI C;  4A09 B;  1JMX B;  3IIW A;  5HE2 B;  4J8G A;  1JOF A;  3EQ9 A;  2H3X A;  1RI6 A;  4CC9 A;  5FKT A;  2OVQ B;  4CI8 A;  4ZOZ A;  3V5W B;  2UZX B;  5IJ8 E;  5C86 A;  4BCD A;  1MG2 A;  3AH8 B;  3L4O D;  5EAR A;  3NVX A;  2BCJ B;  3DXM C;  3PVW B;  4ZOX A;  3CIK B;  2YNO A;  3N0D A;  3L4M D;  1U8C A;  4BL0 A;  3PE7 A;  5E6S A;  3CFV A;  3ULE C;  1XIP A;  4FA9 D;  3V9F A;  2HXC A;  5KDO B;  3HFQ A;  2VDP A;  3O4H A;  4G55 A;  5FA5 B;  1O6F A;  3KRX B;  3OW8 A;  4L3H D;  3IUM A;  4FA1 D;  4A08 A;  3EI4 B;  4FHL A;  5HE3 B;  3SFZ A;  3UVL A;  4PXW A;  4E54 B;  3JRO A;  5HE0 B;  3VA6 A;  2P9K C;  2CE9 A;  4A2L A;  3V7D B;  3ZDY A;  2XZG A;  3SHF A;  3MVD K;  2YB8 B;  3JZG A;  1PBY B;  4FAN D;  4A09 A;  3UVN A;  3QHY B;  3PXS D;  5AFU 3;  2TRC B;  3SJL D;  3NID A;  4NC4 A;  2IUQ A;  3SBR A;  4K3I D;  5M61 A;  1A12 A;  4EWR A;  2W18 A;  5IGO A;  3V4P A;  1ERJ A;  3I7K A;  5M5R A;  3BG1 A;  3JAM g;  1PGU A;  3UKU C;  3KCI A;  3O4G A;  2Q7Q A;  2IAA A;  4Z7N A;  1R5M A;  3RFH A;  4JD2 C;  1UOP A;  1K3I A;  3FM0 A;  4L1M A;  3UVO A;  2XDW A;  3SVW D;  4GM3 A;  3N0E A;  4AN0 A;  4O45 A;  2IUV A;  4KFM B;  2B4E A;  2IWF A;  1YFQ A;  4FWW A;  1VE7 A;  4LG9 A;  4X60 B;  1M1X A;  5C2V B;  2QR5 A;  3ORV D;  3NVQ A;  2AGW A;  2H6K A;  2HJ4 A;  5FXY A;  1L0Q A;  3EI4 A;  4XYH A;  4ES0 A;  3K6S A;  4GQB B;  1BPO A;  5K19 A;  2AGY A;  4AMY A;  2HU5 A;  4GM9 A;  5I5J A;  3ZE2 A;  5M5S A;  2PBI B;  5CYK B;  4U7A A;  3DDU A;  2VDQ A;  5M5T A;  2HES X;  3EQ7 A;  3QI0 A;  4O02 A;  1SQJ A;  2EBS A;  2J57 G;  4YVD A;  5E6R A;  4DNW A;  5A2Q g;  1GOH A;  4QL1 A;  3DWL C;  2CO0 C;  3NIF A;  1B9X A;  3IJ0 A;  4NSX A;  5AJA A;  4GQ1 A;  4JSP C;  1H2Y A;  4PSW B;  3J81 g;  4IA9 A;  4ZN4 A;  4E5Z B;  5FKR A;  4J8B A;  2XL3 A;  2G99 A;  4Z7O A;  5E6U A;  5H17 A;  3UVM A;  4CY5 A;  4FA4 D;  4L3G D;  4WJK A;  2H6Q A;  4QT8 A;  5H14 A;  3MZK A;  3IVM A;  4MMY A;  5EAL A;  5GMK n;  4GGA A;  3U4Y A;  1T2X A;  3IJE A;  2H47 A;  4TZ4 A;  4Y5R D;  2P9L C;  3PXW D;  4LGN A;  5EAP A;  1QFS A;  2HU8 A;  2OJY A;  1U4C A;  2VDM A;  3OL2 A;  4AMZ A;  1O6G A;  4BUJ C;  5TEF A;  4K3J B;  4J81 A;  4CY3 A;  4RE5 A;  1OMW B;  5FKS A;  5CXB B;  3K71 A;  4WK2 A;  4GM8 A;  1VZ3 A;  2CO0 A;  4NAA A;  5EMM B;  3PXT D;  3F3G A;  3JB9 L;  4D9S A;  4QQE A;  4PNK B;  4ERZ A;  3FCS A;  3IUR A;  2O9K A;  5SXM A;  3I8E A;  3I8C A;  3MKQ A;  3RMZ D;  2Z2O A;  1JV2 A;  2XL2 A;  4QRJ A;  4GGC A;  2H68 A;  2H6N A;  4FB1 D;  3MKS B;  4RE6 A;  3DSM A;  3T3P A;  4DNV A;  3BG0 A;  5FLX g;  2CN2 A;  3O4I A;  1A0R B;  2GC4 A;  3AFC A;  1E5T A;  3JRP A;  3DXK C;  2XU7 A;  1H2Z A;  3I2N A;  3MXX A;  2OK4 A;  3C9C A;  2PM9 B;  2BBK H;  3VI3 A;  3MMY A;  4AX4 A;  2IUP A;  4X61 B;  2B5L A;  4MK0 B;  3OKY B;  2HJB A;  5FQD A;  3T3M A;  3BWS A;  2QZP A;  4J86 A;  4A0A B;  3MZL A;  5B4W A;  4A7J A;  3RRM C;  4Z7Q A;  4O3T B;  2EID A;  4HDJ A;  4PBY A;  4J77 A;  4A0B B;  2OVR B;  1SHY B;  1TYE A;  3SN6 B;  4J0W A;  4JT5 C;  3ZE1 A;  3P4F A;  2H14 A;  3FRX A;  5CXB A;  3IUL A;  2BKL A;  2CE8 A;  4NEN A;  2VDR A;  3AL8 B;  4GQ2 P;  4ESG A;  3IUN A;  1QFM A;  4L1Q D;  1B9Y A;  4PSX B;  1VE6 A;  3GC3 B;  4LG8 A;  3RN1 D;  5EML B;  4PC0 A;  4E54 A;  5GXH A;  4JXM A;  4BP8 A;  4AEZ A;  5C2W B;  5I5M A;  4A2M A;  1GG2 B;  3I7P A;  3SXT D;  3SBQ A;  3ZE0 A;  4CI1 A;  1S4U X;  2IUR A;  4I79 A;  2PM6 B;  3K26 A;  2IWK A;  2YNP A;  2VZ3 A;  4ZOY A;  4J87 A;  3MUN A;  2PM9 A;  5EM2 B;  2GNQ A;  1XKS A;  4AN1 A;  5K1C C;  5HE1 B;  4G56 B;  4CZV A;  3OKY A;  4J73 A;  4QAM A;  4CY2 A;  4D0K A;  5JWZ A;  1P22 A;  5EAM A;  3IKO A;  1GOG A;  3FGB A;  3C75 H;  2YBA A;  2B5N A;  3PSL A;  1PEV A;  3E0C A;  2CNX A;  2EIE A;  5I5I A;  4A0B A;  1N6D A;  3K27 A;  4L9O A;  5IGQ A;  1GOT B;  4XYI A;  4FAV D;  4IRZ A;  3SMR A;  4JSV C;  2Z2P A;  3ZDZ A;  4U1E I;  4O9D A;  2JKX A;  3EI3 B;  5FFO A;  3I7O A;  1FWX A;  3JZN A;  5HDB A;  3EWE A;  1VYH C;  1MG3 A;  3AL8 A;  2I0T A;  2I3S A;  2HKR A;  3I7N A;  3UVK A;  4UM9 A;  3V4V A;  3I89 A;  4J78 A;  5C92 A;  3EI1 B;  4CZX A;  4UM8 A;  2EIC A;  5IJ7 E;  3EI2 B;  2HKM A;  4Z8L A;  1VZ2 A;  2AH1 A;  1UOO A;  4WK0 A;  2EIB A;  4JSN C;  2MTA H;  3EU7 A;  4WK4 A;  5IC7 A;  3IJC A;  3UR4 A;  3J80 g;  3VGZ A;  3JZH A;  4G1M A;  3OKT A;  3IUJ A;  1L5G A;  5CYK A;  5HQG A;  3OF7 A;  4MMZ A;  2Z2N A;  4JHN A;  4JHP C;  4JSX C;  1OLZ A;  2P9U C;  2H9P A;  2H9M A;  1PI6 A;  2UZY B;  5EM2 A;  3W15 A;  2HYE A;  5H1M A;  2CN3 A;  3PVU B;  2YMU A;  4X63 B;  4PBZ A;  4CY1 A;  2P9I C;  2QXV A;  3F3P A;  4OWR A;  4FA5 D;  2XE4 A;  5TDH B;  1TYQ C;  4OZU A;  4A11 B;  3ZWL B;  4E5Z A;  4GMB A;  2B5M A;  3RLM D;  5THA A;  4CI2 A;  2VC2 A;  1TBG A;  1NR0 A;  1QNI A;  3NVN A;  1YR2 A;  3EI3 A;  2G9A A;  1I2M B;  2OIZ A;  2XYI A;  5FFG A;  5TF2 A;  4IMM A;  3SLE D;  3I7L A;  3RSE C;  3EI1 A;  2P9N C;  2AGL A;  1K8K C;  1NEX B;  3EI2 A;  4BCB A;  4O3U B;  3SBP A;  4R7A B;  2OVP B;  3RFG A;  1UOQ A;  5CXC B;  1GXR A;  3GFC A;  4H5J A;  5GXI A;  4BCC A;  4CZY A;  2AGZ A;  5GSA A;  1C9I A;  2PM7 B;  1GOF A;  4GZ8 A;  2YNN A;  4JT6 C;  2VDL A;  2P9P C;  3KRW B;  3DM0 A;  2AQ5 A;  2J56 H;  3SWS D;  1E8N A;  3NIG A;  1JTD B;  4N14 A;  1GP2 B;  3OKW A;  2VDK A;  4H5I A;  2I3T A;  2VDN A;  1K32 A;  4X3E A;  2H9L A;  4ERQ A;  2OK6 A;  4J79 A;  2WQ8 A;  3AL9 A;  1H2W A;  3F3F A;  4A11 A;  5EMK B;  3B7F A;  1Q47 A;  2H13 A;  4J0X A;  4J84 A;  3UKR C;  5EMJ B;  4D6V A;  3EQ8 A;  4MMX A;  3IJ1 A;  3FCU A;  4BP9 A;  3OL2 B;  2AH0 A; 
#chains in the Genus database with same CATH homology
 1SQ9 A;  4UI9 R;  3IIY A;  1JJU B;  3PSC B;  4A0A A;  4AOW A;  4ERY A;  3CFS B;  4BH6 A;  4O1Q D;  4ZOV A;  3C5M A;  1U2V C;  5IT9 g;  2QC5 A;  5HYN B;  1JMZ B;  4Y7R A;  5CXC A;  2I0R A;  3GRE A;  3JPX A;  5AMS A;  5TEE A;  3RN0 D;  1N6F A;  3I7H A;  4J82 A;  3A0F A;  1MDA H;  3C99 A;  4CI3 A;  2J55 H;  4GGD A;  4A08 B;  1N6E A;  2I0S A;  1XHM A;  3VH0 A;  2GC7 A;  2AGX A;  3OTT A;  2H9N A;  3ODT A;  5C9Z B;  2P9S C;  3SCY A;  3EG6 A;  5FKQ A;  3EMH A;  4XEI C;  4A09 B;  1JMX B;  3IIW A;  5HE2 B;  4J8G A;  1JOF A;  2H3X A;  1RI6 A;  4CC9 A;  5FKT A;  2OVQ B;  4CI8 A;  4ZOZ A;  3V5W B;  2UZX B;  5IJ8 E;  1MG2 A;  3AH8 B;  3L4O D;  5EAR A;  3NVX A;  2BCJ B;  3DXM C;  3PVW B;  4ZOX A;  3CIK B;  2YNO A;  3N0D A;  3L4M D;  4BL0 A;  3PE7 A;  3CFV A;  3ULE C;  1XIP A;  4FA9 D;  3V9F A;  2HXC A;  5KDO B;  3HFQ A;  5FA5 B;  3KRX B;  3OW8 A;  4L3H D;  4FA1 D;  4A08 A;  3EI4 B;  4FHL A;  5HE3 B;  3SFZ A;  3UVL A;  4PXW A;  4E54 B;  3JRO A;  5HE0 B;  3VA6 A;  2P9K C;  2CE9 A;  4A2L A;  3V7D B;  3SHF A;  2YB8 B;  3JZG A;  1PBY B;  4FAN D;  4A09 A;  3UVN A;  3PXS D;  5AFU 3;  2TRC B;  3SJL D;  2IUQ A;  3SBR A;  4K3I D;  4EWR A;  2W18 A;  5IGO A;  1ERJ A;  3I7K A;  3BG1 A;  3JAM g;  1PGU A;  3UKU C;  2Q7Q A;  2IAA A;  1R5M A;  3RFH A;  4JD2 C;  3FM0 A;  3UVO A;  3SVW D;  4GM3 A;  3N0E A;  4O45 A;  2IUV A;  4KFM B;  2B4E A;  2IWF A;  1YFQ A;  4FWW A;  4LG9 A;  4X60 B;  5C2V B;  3ORV D;  3NVQ A;  2AGW A;  2H6K A;  2HJ4 A;  5FXY A;  1L0Q A;  3EI4 A;  4XYH A;  4ES0 A;  4GQB B;  5K19 A;  2AGY A;  4GM9 A;  5I5J A;  2PBI B;  5CYK B;  4U7A A;  2HES X;  1SQJ A;  2EBS A;  2J57 G;  4YVD A;  5A2Q g;  4QL1 A;  3DWL C;  2CO0 C;  1B9X A;  3IJ0 A;  4NSX A;  5AJA A;  4GQ1 A;  4JSP C;  4PSW B;  3J81 g;  4IA9 A;  4ZN4 A;  4E5Z B;  5FKR A;  4J8B A;  2XL3 A;  2G99 A;  5H17 A;  3UVM A;  4CY5 A;  4FA4 D;  4L3G D;  2H6Q A;  4QT8 A;  5H14 A;  3MZK A;  5GMK n;  5EAL A;  4GGA A;  3U4Y A;  4TZ4 A;  2H47 A;  4Y5R D;  2P9L C;  3PXW D;  4LGN A;  5EAP A;  2OJY A;  1U4C A;  3OL2 A;  4BUJ C;  5TEF A;  4K3J B;  4J81 A;  4CY3 A;  1OMW B;  5FKS A;  5CXB B;  4GM8 A;  2CO0 A;  5EMM B;  3PXT D;  3F3G A;  3JB9 L;  4QQE A;  4PNK B;  4ERZ A;  2O9K A;  5SXM A;  3I8E A;  3I8C A;  3MKQ A;  3RMZ D;  2Z2O A;  2XL2 A;  4QRJ A;  4GGC A;  2H68 A;  2H6N A;  4FB1 D;  3MKS B;  3DSM A;  3BG0 A;  5FLX g;  2CN2 A;  1A0R B;  2GC4 A;  3AFC A;  3JRP A;  3DXK C;  2XU7 A;  3I2N A;  3MXX A;  2OK4 A;  3C9C A;  2PM9 B;  2BBK H;  3MMY A;  2IUP A;  4X61 B;  2B5L A;  4MK0 B;  3OKY B;  2HJB A;  5FQD A;  3BWS A;  4A0A B;  4J86 A;  3MZL A;  5B4W A;  4A7J A;  3RRM C;  4O3T B;  4HDJ A;  4PBY A;  4J77 A;  4A0B B;  2OVR B;  1SHY B;  3SN6 B;  4J0W A;  4JT5 C;  3P4F A;  2H14 A;  3FRX A;  5CXB A;  2CE8 A;  3AL8 B;  4GQ2 P;  4ESG A;  4L1Q D;  1B9Y A;  4PSX B;  4LG8 A;  3RN1 D;  5EML B;  4PC0 A;  4E54 A;  5GXH A;  4JXM A;  4AEZ A;  5C2W B;  5I5M A;  4A2M A;  1GG2 B;  3I7P A;  3SXT D;  3SBQ A;  4CI1 A;  1S4U X;  2IUR A;  4I79 A;  2PM6 B;  3K26 A;  2IWK A;  2YNP A;  4ZOY A;  4J87 A;  2PM9 A;  5EM2 B;  2GNQ A;  1XKS A;  5K1C C;  5HE1 B;  4G56 B;  4CZV A;  3OKY A;  4J73 A;  4D0K A;  4CY2 A;  5JWZ A;  1P22 A;  5EAM A;  3IKO A;  3FGB A;  3C75 H;  2YBA A;  2B5N A;  3PSL A;  1PEV A;  3E0C A;  2CNX A;  5I5I A;  4A0B A;  1N6D A;  3K27 A;  4L9O A;  5IGQ A;  1GOT B;  4XYI A;  4FAV D;  3SMR A;  4JSV C;  2Z2P A;  4U1E I;  4O9D A;  3EI3 B;  3I7O A;  1FWX A;  3JZN A;  3EWE A;  1VYH C;  1MG3 A;  3AL8 A;  2I0T A;  2I3S A;  2HKR A;  3I7N A;  3UVK A;  3I89 A;  4J78 A;  3EI1 B;  4CZX A;  5IJ7 E;  3EI2 B;  2HKM A;  4Z8L A;  2AH1 A;  4JSN C;  2MTA H;  3EU7 A;  5IC7 A;  3IJC A;  3UR4 A;  3J80 g;  3VGZ A;  3JZH A;  3OKT A;  5CYK A;  5HQG A;  2Z2N A;  4JSX C;  1OLZ A;  2P9U C;  2H9P A;  2H9M A;  1PI6 A;  2UZY B;  5EM2 A;  3W15 A;  2HYE A;  5H1M A;  2CN3 A;  3PVU B;  2YMU A;  4X63 B;  4PBZ A;  4CY1 A;  2P9I C;  2QXV A;  3F3P A;  4OWR A;  4FA5 D;  5TDH B;  4A11 B;  1TYQ C;  4OZU A;  4E5Z A;  3ZWL B;  4GMB A;  2B5M A;  3RLM D;  5THA A;  4CI2 A;  1TBG A;  1NR0 A;  1QNI A;  3NVN A;  3EI3 A;  2G9A A;  2OIZ A;  2XYI A;  5TF2 A;  4IMM A;  3SLE D;  3I7L A;  3RSE C;  3EI1 A;  2P9N C;  2AGL A;  1K8K C;  1NEX B;  3EI2 A;  4O3U B;  3SBP A;  4R7A B;  2OVP B;  3RFG A;  5CXC B;  5GXI A;  1GXR A;  3GFC A;  4H5J A;  4CZY A;  2AGZ A;  5GSA A;  2PM7 B;  4GZ8 A;  2YNN A;  4JT6 C;  2P9P C;  3KRW B;  3DM0 A;  2AQ5 A;  2J56 H;  3SWS D;  4N14 A;  1GP2 B;  3OKW A;  4H5I A;  2I3T A;  1K32 A;  4X3E A;  2H9L A;  4ERQ A;  2OK6 A;  4J79 A;  3AL9 A;  3F3F A;  4A11 A;  5EMK B;  3B7F A;  1Q47 A;  2H13 A;  4J0X A;  4J84 A;  3UKR C;  5EMJ B;  4D6V A;  3IJ1 A;  3OL2 B;  2AH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...