4D0KA

Complex of chaetomium thermophilum pan2 (wd40-cs1) with pan3 (c-term)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
345
structure length
329
Chain Sequence
MDADWDEVTRIAYPAPGTFPRPATAVAFDPIAELLWAGFDRGRVCSFYGRDLTRYTAFKIQPASEGPVRQFLFHDKGVIVLGTRSVHMAMRRGPALWNIRHENMKDLRCMSFTSKGTQEIIVAGWQDTMLVIDVLKGDIIKQIPAQHHYSIMKKSRYICAATKTGSVDLIDPLSFKIVRSWQAHASYINDMDAQNDFIVTCGGSYMLDPYVNVFDLKNMASMKPMPFPPLAAHVRLHPRMLTTAIVTSQHGQMHVVDIMNPNSSTVRYANISSYVKLFEIAPSGEALVIGDADCNIHLWGSPTKIHFTDMAIPIELPEPVLDWSETPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords A-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 66
structure length 329
sequence length 345
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4d0kA01
4A09B 2Z2NA 2B4EA 2CNXA 4MK0B 4GQ1A 3N0EA 4PBZA 2AGLA 3PE7A 3JZHA 4J8GA 4H5IA 4JXMA 3MZLA 3JZNA 4ERQA 3CFSB 2UZYB 2MTAH 4LG8A 4FAVD 3L4OD 4Y7RA 5KDOB 2IWKA 1YFQA 5HE2B 3NVQA 4GGAA 1SHYB 3EI1B 5THAA 2H3XA 3I8EA 3I7OA 2B5NA 2GC7A 1TYQC 4J79A 1PBYB 4ZOZA 2CE9A 2CO0A 1P22A 4G56B 4JT5C 3OKYB 4AOWA 3PXSD 3EI2A 2I3SA 2AQ5A 3JROA 2XL3A 5EMJB 3MXXA 5FLXg 4A7JA 2GC4A 3BG0A 4GGCA 4E54B 3I7LA 5HQGA 4JSVC 2YB8B 4CI8A 5CXBB 3RLMD 1GXRA 4PC0A 3RFGA 1FWXA 4I79A 3EI3A 5I5JA 4GM9A 4BUJC 5H17A 4FWWA 4J84A 5H14A 3VH0A 3OKWA 3C9CA 3FGBA 2P9LC 3IIWA 5C9ZB 2H14A 2G9AA 5IGQA 4X63B 2OIZA 1TBGA 2HYEA 2G99A 4CY2A 2H13A 4D6VA 3SVWD 3W15A 2CN2A 5TEEA 2P9IC 3MMYA 4E5ZA 4X61B 5C2VB 4O3TB 3EU7A 5AJAA 3SXTD 3SBPA 3JB9L 4J0XA 3UVNA 3PXWD 3BG1A 1MG3A 4GQBB 2PM7B 4CY3A 1L0QA 4A0AA 5I5MA 4LG9A 4KFMB 3SWSD 3EI2B 3EMHA 2P9PC 3SN6B 4L3GD 4ESGA 2IAAA 3DXMC 2AH1A 5GMKn 3ORVD 5CYKA 5GXIA 3CFVA 5TDHB 3ZWLB 3SJLD 5B4WA 1OLZA 5AMSA 2H9NA 2J57G 4L3HD 1R5MA 1OMWB 3EI3B 4OZUA 4H5JA 4NSXA 3DXKC 2OJYA 3EWEA 4A2LA 2XL2A 3PVWB 4U7AA 5EARA 4X60B 3SBQA 3VGZA 4N14A 4AEZA 5EMMB 4O9DA 2IWFA 3J80g 1N6FA 3V5WB 1XKSA 4XEIC 5GSAA 1QNIA 5EAPA 3MKQA 5AFU3 3AL8A 5K19A 4A11A 4BL0A 3RN1D 3PSLA 4J0WA 1PEVA 3DWLC 4E5ZB 3IJ1A 3SCYA 3UR4A 4ERYA 2HJBA 2H68A 5HE1B 3N0DA 2P9NC 3RRMC 1JMXB 3F3FA 1S4UX 4X3EA 4QQEA 3UKUC 1JOFA 4L1QD 4A0AB 4QL1A 3IKOA 4ZOXA 4XYIA 1U4CA 2J56H 3C75H 5IT9g 4IA9A 2P9SC 2Q7QA 4A0BA 4GGDA 4PSXB 2TRCB 2H9MA 4A08A 3I2NA 2H6KA 5CXCA 4HDJA 3FM0A 1GOTB 4UI9R 4FA4D 4J77A 3SBRA 4JT6C 4O45A 4GZ8A 2B5MA 4ERZA 3C5MA 4ZOVA 5HE3B 2OK6A 2AH0A 2YBAA 2YMUA 3HFQA 4LGNA 5IC7A 2Z2OA 4D0KA 4ZN4A 1MG2A 4CZYA 3I89A 3EG6A 1K32A 4PBYA 3DSMA 3OTTA 3PVUB 3F3GA 2OK4A 2QXVA 3CIKB 4J82A 2IUQA 4J87A 5EAMA 3AL8B 2W18A 3OKTA 4A11B 3RMZD 5EMKB 3I7PA 2EBSA 4CZVA 4CI2A 4Y5RD 3JAMg 2YNNA 3RFHA 3JRPA 5FXYA 3OKYA 3NVXA 3V7DB 2I0TA 3EI4A 1GG2B 3ULEC 2IURA 2HXCA 5HYNB 3PXTD 4R7AB 3VA6A 1NR0A 2CE8A 5FKSA 4FA5D 3ODTA 3V9FA 5JWZA 5TF2A 4A0BB 4GM8A 2HESX 2XYIA 1PGUA 4CZXA 1A0RB 4A08B 3IJCA 2H47A 3GFCA 3IIYA 5EALA 5CXCB 3MZKA 4QT8A 3A0FA 4GQ2P 2HKRA 2H9LA 3OL2A 3P4FA 3UVMA 1U2VC 1SQJA 4PSWB 4TZ4A 2I0SA 3B7FA 5I5IA 1JMZB 5C2WB 1NEXB 2B5LA 2I3TA 2P9KC 3KRXB 3GREA 3JPXA 4JSXC 1VYHC 5K1CC 2I0RA 3AH8B 4FHLA 5A2Qg 4A2MA 4CI1A 3OW8A 4U1EI 2AGXA 1XHMA 2OVPB 2PM9A 2BBKH 2H6QA 4K3JB 1SQ9A 5FKRA 3IJ0A 2QC5A 4ZOYA 2CN3A 1GP2B 3SHFA 4CI3A 1XIPA 4PNKB 5EM2A 4ES0A 3UVLA 2H9PA 4J81A 3I7NA 1B9YA 3PSCB 2H6NA 3EI4B 5H1MA 5HE0B 2HJ4A 2HKMA 4CY1A 5IJ8E 5CYKB 1B9XA 5EMLB 5FKTA 4JSNC 5IJ7E 1ERJA 4A09A 2J55H 3UVKA 1PI6A 2CO0C 2AGWA 4J86A 3E0CA 3AL9A 1N6EA 5TEFA 2GNQA 2Z2PA 1RI6A 4FA9D 1MDAH 3BWSA 4GM3A 4CC9A 3I8CA 4FB1D 3RSEC 2AGZA 4J8BA 3K27A 5FKQA 3OL2B 3U4YA 3J81g 3UKRC 3JZGA 4OWRA 5FA5B 3DM0A 2IUVA 4L9OA 5SXMA 4J78A 3NVNA 4XYHA 5GXHA 3EI1A 4QRJA 3L4MD 3FRXA 4YVDA 1N6DA 3F3PA 4FA1D 2YNPA 4IMMA 2AGYA 3C99A 2OVRB 3I7KA 4Z8LA 2OVQB 2PM9B 2YNOA 2PM6B 3AFCA 4GMBA 3SLED 1K8KC 4FAND 2XU7A 2O9KA 3RN0D 3MKSB 5IGOA 4JSPC 1JJUB 4K3ID 4BH6A 3K26A 2BCJB 4E54A 2PBIB 4J73A 2P9UC 4CY5A 1Q47A 5CXBA 5EM2B 4O1QD 3KRWB 3I7HA 3UVOA 3SFZA 4O3UB 4PXWA 2UZXB 4EWRA 4JD2C 5FQDA 2IUPA 3SMRA
chains in the Genus database with same CATH superfamily
4G1MA 4A09B 2Z2NA 2B4EA 2CNXA 4MK0B 4GQ1A 5E6UA 3MUOA 3N0EA 4PBZA 2AGLA 5FFGA 1L5GA 3PE7A 3K71A 3JZHA 4J8GA 4H5IA 4Z7QA 4JXMA 3MZLA 3JZNA 4ERQA 3CFSB 1UOPA 2UZYB 2MTAH 4LG8A 4FAVD 3L4OD 4Y7RA 5KDOB 2IWKA 1YFQA 5M5VA 5HE2B 3NVQA 4GGAA 1SHYB 3EI1B 5THAA 2H3XA 3I8EA 3I7OA 2B5NA 5E6SA 2GC7A 3IUJA 1TYQC 3SMRA 4J79A 1PBYB 4ZOZA 2CE9A 2CO0A 1P22A 4G56B 3NIFA 4JT5C 3DDUA 3OKYB 4AOWA 3PXSD 3EI2A 2I3SA 2AQ5A 3GD1I 3O4JA 3JROA 4AX4A 2XL3A 5EMJB 3MXXA 1GOGA 4G1EA 5FLXg 4A7JA 2VC2A 2GC4A 3BG0A 4GGCA 4E54B 3I7LA 5HQGA 4JSVC 4WK4A 1O6GA 2YB8B 4NENA 5CXBB 4CI8A 3RLMD 1GXRA 4DNVA 3ZDZA 1YR2A 4PC0A 3RFGA 1FWXA 1UTCA 4O02A 4I79A 3EI3A 4AN1A 5I5JA 5M5TA 4GM9A 4BUJC 5H17A 4FWWA 4J84A 5H14A 3VH0A 3OKWA 3C9CA 3FGBA 2P9LC 3IIWA 5C9ZB 2H14A 1JTDB 3ZDXA 2G9AA 4Z7OA 4BP9A 5IGQA 3K72A 4X63B 2OIZA 2EIEA 1TBGA 2XZGA 2HYEA 3OF7A 2G99A 4CY2A 2H13A 4D6VA 3SVWD 3W15A 2CN2A 1C9LA 3VI4A 3QHYB 5TEEA 2P9IC 3MMYA 4E5ZA 4X61B 5C2VB 4O3TB 3EU7A 5AJAA 5M5SA 3SXTD 3EQ8A 3SBPA 3JB9L 4J0XA 3ZE1A 3UVNA 3PXWD 3BG1A 1MG3A 4GQBB 2PM7B 4CY3A 1L0QA 4A0AA 5I5MA 4LG9A 4KFMB 3SWSD 3EI2B 1H2ZA 5HDBA 3EMHA 2P9PC 1T2XA 4JHNA 3SN6B 4L3GD 4ESGA 2IAAA 3DXMC 3KCIA 2AH1A 5GMKn 3ORVD 5CYKA 5GXIA 3CFVA 4MMYA 5TDHB 3ZWLB 3T3MA 1C9IA 4RE6A 3SJLD 5B4WA 1OLZA 5AMSA 2H9NA 2J57G 4L3HD 1R5MA 1OMWB 4BP8A 3EI3B 4BCCA 2VDPA 4OZUA 4H5JA 5M5RA 4NSXA 3DXKC 2OJYA 4O2WA 3EWEA 3MUNA 4A2LA 2XL2A 2BKLA 3PVWB 4U7AA 5EARA 2VDRA 4X60B 3SBQA 4N14A 3VGZA 4AEZA 5EMMB 5C86A 4O9DA 2IWFA 3J80g 1N6FA 3V5WB 1XKSA 4XEIC 5GSAA 2JKXA 1A12A 1QNIA 1E8MA 1JV2A 5EAPA 3MKQA 5AFU3 3AL8A 5K19A 4A11A 3V4VA 3RN1D 4BL0A 4JHPC 3PSLA 4J0WA 1PEVA 3DWLC 3O4GA 4E5ZB 3IJ1A 3SCYA 3UR4A 4ERYA 2HJBA 1BPOA 4IRZA 2H68A 2VDKA 5HE1B 3N0DA 2P9NC 2VDOA 1JMXB 3RRMC 4UM9A 5FFOA 3F3FA 1S4UX 4X3EA 4QQEA 3UKUC 1TYEA 1JOFA 5C92A 4L1QD 4A0AB 4QL1A 3IKOA 4ZOXA 4XYIA 4NC4A 1U8CA 1U4CA 2J56H 3C75H 5IT9g 4IA9A 2P9SC 2Q7QA 4A0BA 4GGDA 4PSXB 2XE4A 2TRCB 1VZ3A 2H9MA 4A08A 3I2NA 2H6KA 5CXCA 4HDJA 3FM0A 1GOTB 4UI9R 4FA4D 4J77A 4WK2A 4DNUA 5E6RA 3SBRA 3FCSA 1H2YA 4JT6C 4O45A 4GZ8A 3IVMA 2B5MA 4ERZA 3C5MA 4ZOVA 5HE3B 3VI3A 2OK6A 2AH0A 2YBAA 2YMUA 3HFQA 4LGNA 5IC7A 2Z2OA 1O6FA 4D0KA 4ZN4A 1MG2A 4AMZA 2VZ3A 4D9SA 4CZYA 3I89A 3EG6A 1K32A 4PBYA 2HU7A 3IUMA 3DSMA 3OTTA 3PVUB 3F3GA 4Z7NA 2OK4A 2QXVA 3CIKB 4J82A 2IUQA 4J87A 5EAMA 3AL8B 2W18A 3OKTA 4A11B 3FCUA 3RMZD 2HU5A 3NIGA 5EMKB 3I7PA 2EBSA 4CZVA 4CI2A 4Y5RD 3JAMg 2YNNA 1H2WA 2HU8A 3RFHA 3JRPA 5FXYA 3OKYA 3NVXA 3V7DB 2I0TA 4AN0A 3IJEA 3EI4A 1GG2B 3ULEC 3IULA 2IURA 2HXCA 5HYNB 3PXTD 4R7AB 3VA6A 1NR0A 2CE8A 5FKSA 4FA5D 3ODTA 3V9FA 5JWZA 5TF2A 4A0BB 3K6SA 4GM8A 2HESX 2XYIA 1PGUA 2VDNA 1QFSA 3GC3B 4CZXA 1A0RB 4A08B 3IJCA 3NIDA 2H47A 1H2XA 3GFCA 3IIYA 4UM8A 5EALA 5CXCB 2QZPA 2EIBA 3QI0A 1VZ2A 3MZKA 4QT8A 2QR5A 3A0FA 4GQ2P 2HKRA 2H9LA 3OL2A 3P4FA 3UVMA 1U2VC 2EIDA 1SQJA 4PSWB 4TZ4A 2I0SA 3B7FA 5I5IA 3IUQA 1JMZB 5C2WB 1NEXB 2B5LA 2I3TA 1GOFA 2P9KC 3KRXB 2WQ8A 3GREA 3JPXA 4JSXC 3V4PA 1VYHC 5K1CC 2I0RA 3AH8B 4FHLA 3IUNA 5A2Qg 4A2MA 4CI1A 3ZE0A 3OW8A 4U1EI 2AGXA 1XHMA 2OVPB 2PM9A 3ZDYA 2BBKH 2H6QA 4K3JB 1SQ9A 4NAAA 5FKRA 3IJ0A 2QC5A 2VDLA 1GOHA 2VDMA 3EQ9A 3IURA 4ZOYA 2CN3A 1GP2B 3SHFA 4CI3A 1XIPA 4DNWA 4PNKB 1E8NA 5EM2A 2EICA 4ES0A 3UVLA 2H9PA 4J81A 3I7NA 1B9YA 3PSCB 2H6NA 3EI4B 2XDWA 5H1MA 1M1XA 5HE0B 2HJ4A 2HKMA 1VE7A 4CY1A 5IJ8E 5CYKB 1I2MB 4MMXA 1B9XA 5EMLB 5FKTA 4JSNC 5IJ7E 4WK0A 1ERJA 4A09A 2J55H 3UVKA 1PI6A 2CO0C 2AGWA 4BCDA 4L1MA 4J86A 3E0CA 3AL9A 1N6EA 5TEFA 2GNQA 2VDQA 1RI6A 2Z2PA 4FA9D 1MDAH 3BWSA 3T3PA 4GM3A 4CC9A 3I8CA 4FB1D 3RSEC 2AGZA 4J8BA 3K27A 5FKQA 3OL2B 3U4YA 3J81g 3UKRC 3JZGA 4OWRA 5FA5B 3DM0A 2IUVA 3EQ7A 4L9OA 5SXMA 4G55A 4J78A 3NVNA 4XYHA 5GXHA 3EI1A 4QRJA 3L4MD 4WJKA 3FRXA 3O4HA 4YVDA 1N6DA 2VZ1A 3F3PA 5M61A 3MVDK 4FA1D 2YNPA 4IMMA 4RE5A 2AGYA 3C99A 2OVRB 3I7KA 1VE6A 4NBMA 4Z8LA 2OVQB 2PM9B 2YNOA 2PM6B 3AFCA 4GMBA 3SLED 1K8KC 1K3IA 4FAND 1UOQA 2XU7A 2O9KA 3RN0D 4AMYA 3MKSB 4BCBA 5IGOA 4JSPC 1JJUB 4K3ID 4BH6A 3K26A 2BCJB 4E54A 3O4IA 1QFMA 2PBIB 4J73A 2P9UC 1UOOA 4CY5A 1Q47A 5CXBA 5EM2B 3KRWB 4O1QD 3I7HA 3UVOA 3SFZA 1E5TA 3ZE2A 4O3UB 5M5UA 4PXWA 2UZXB 4EWRA 4JD2C 5FQDA 2IUPA 4QAMA 4MMZA
chains in the Genus database with same CATH topology
4A09B 2Z2NA 2B4EA 2CNXA 4MK0B 4GQ1A 3N0EA 4PBZA 2AGLA 3PE7A 3JZHA 4J8GA 4H5IA 4JXMA 3MZLA 3JZNA 4ERQA 3CFSB 2UZYB 2MTAH 4LG8A 4FAVD 3L4OD 4Y7RA 5KDOB 2IWKA 1YFQA 5HE2B 3NVQA 4GGAA 1SHYB 3EI1B 5THAA 2H3XA 3I8EA 3I7OA 2B5NA 2GC7A 1TYQC 4J79A 1PBYB 4ZOZA 2CE9A 2CO0A 1P22A 4G56B 4JT5C 3OKYB 4AOWA 3PXSD 3EI2A 2I3SA 2AQ5A 3JROA 2XL3A 5EMJB 3MXXA 5FLXg 4A7JA 2GC4A 3BG0A 4GGCA 4E54B 3I7LA 5HQGA 4JSVC 2YB8B 4CI8A 5CXBB 3RLMD 1GXRA 4PC0A 3RFGA 1FWXA 4I79A 3EI3A 5I5JA 4GM9A 4BUJC 5H17A 4FWWA 4J84A 5H14A 3VH0A 3OKWA 3C9CA 3FGBA 2P9LC 3IIWA 5C9ZB 2H14A 2G9AA 5IGQA 4X63B 2OIZA 1TBGA 2HYEA 2G99A 4CY2A 2H13A 4D6VA 3SVWD 3W15A 2CN2A 5TEEA 2P9IC 3MMYA 4E5ZA 4X61B 5C2VB 4O3TB 3EU7A 5AJAA 3SXTD 3SBPA 3JB9L 4J0XA 3UVNA 3PXWD 3BG1A 1MG3A 4GQBB 2PM7B 4CY3A 1L0QA 4A0AA 5I5MA 4LG9A 4KFMB 3SWSD 3EI2B 3EMHA 2P9PC 3SN6B 4L3GD 4ESGA 2IAAA 3DXMC 2AH1A 5GMKn 3ORVD 5CYKA 5GXIA 3CFVA 5TDHB 3ZWLB 3SJLD 5B4WA 1OLZA 5AMSA 2H9NA 2J57G 4L3HD 1R5MA 1OMWB 3EI3B 4OZUA 4H5JA 4NSXA 3DXKC 2OJYA 3EWEA 4A2LA 2XL2A 3PVWB 4U7AA 5EARA 4X60B 3SBQA 3VGZA 4N14A 4AEZA 5EMMB 4O9DA 2IWFA 3J80g 1N6FA 3V5WB 1XKSA 4XEIC 5GSAA 1QNIA 5EAPA 3MKQA 5AFU3 3AL8A 5K19A 4A11A 4BL0A 3RN1D 3PSLA 4J0WA 1PEVA 3DWLC 4E5ZB 3IJ1A 3SCYA 3UR4A 4ERYA 2HJBA 2H68A 5HE1B 3N0DA 2P9NC 3RRMC 1JMXB 3F3FA 1S4UX 4X3EA 4QQEA 3UKUC 1JOFA 4L1QD 4A0AB 4QL1A 3IKOA 4ZOXA 4XYIA 1U4CA 2J56H 3C75H 5IT9g 4IA9A 2P9SC 2Q7QA 4A0BA 4GGDA 4PSXB 2TRCB 2H9MA 4A08A 3I2NA 2H6KA 5CXCA 4HDJA 3FM0A 1GOTB 4UI9R 4FA4D 4J77A 3SBRA 4JT6C 4O45A 4GZ8A 2B5MA 4ERZA 3C5MA 4ZOVA 5HE3B 2OK6A 2AH0A 2YBAA 2YMUA 3HFQA 4LGNA 5IC7A 2Z2OA 4D0KA 4ZN4A 1MG2A 4CZYA 3I89A 3EG6A 1K32A 4PBYA 3DSMA 3OTTA 3PVUB 3F3GA 2OK4A 2QXVA 3CIKB 4J82A 2IUQA 4J87A 5EAMA 3AL8B 2W18A 3OKTA 4A11B 3RMZD 5EMKB 3I7PA 2EBSA 4CZVA 4CI2A 4Y5RD 3JAMg 2YNNA 3RFHA 3JRPA 5FXYA 3OKYA 3NVXA 3V7DB 2I0TA 3EI4A 1GG2B 3ULEC 2IURA 2HXCA 5HYNB 3PXTD 4R7AB 3VA6A 1NR0A 2CE8A 5FKSA 4FA5D 3ODTA 3V9FA 5JWZA 5TF2A 4A0BB 4GM8A 2HESX 2XYIA 1PGUA 4CZXA 1A0RB 4A08B 3IJCA 2H47A 3GFCA 3IIYA 5EALA 5CXCB 3MZKA 4QT8A 3A0FA 4GQ2P 2HKRA 2H9LA 3OL2A 3P4FA 3UVMA 1U2VC 1SQJA 4PSWB 4TZ4A 2I0SA 3B7FA 5I5IA 1JMZB 5C2WB 1NEXB 2B5LA 2I3TA 2P9KC 3KRXB 3GREA 3JPXA 4JSXC 1VYHC 5K1CC 2I0RA 3AH8B 4FHLA 5A2Qg 4A2MA 4CI1A 3OW8A 4U1EI 2AGXA 1XHMA 2OVPB 2PM9A 2BBKH 2H6QA 4K3JB 1SQ9A 5FKRA 3IJ0A 2QC5A 4ZOYA 2CN3A 1GP2B 3SHFA 4CI3A 1XIPA 4PNKB 5EM2A 4ES0A 3UVLA 2H9PA 4J81A 3I7NA 1B9YA 3PSCB 2H6NA 3EI4B 5H1MA 5HE0B 2HJ4A 2HKMA 4CY1A 5IJ8E 5CYKB 1B9XA 5EMLB 5FKTA 4JSNC 5IJ7E 1ERJA 4A09A 2J55H 3UVKA 1PI6A 2CO0C 2AGWA 4J86A 3E0CA 3AL9A 1N6EA 5TEFA 2GNQA 2Z2PA 1RI6A 4FA9D 1MDAH 3BWSA 4GM3A 4CC9A 3I8CA 4FB1D 3RSEC 2AGZA 4J8BA 3K27A 5FKQA 3OL2B 3U4YA 3J81g 3UKRC 3JZGA 4OWRA 5FA5B 3DM0A 2IUVA 4L9OA 5SXMA 4J78A 3NVNA 4XYHA 5GXHA 3EI1A 4QRJA 3L4MD 3FRXA 4YVDA 1N6DA 3F3PA 4FA1D 2YNPA 4IMMA 2AGYA 3C99A 2OVRB 3I7KA 4Z8LA 2OVQB 2PM9B 2YNOA 2PM6B 3AFCA 4GMBA 3SLED 1K8KC 4FAND 2XU7A 2O9KA 3RN0D 3MKSB 5IGOA 4JSPC 1JJUB 4K3ID 4BH6A 3K26A 2BCJB 4E54A 2PBIB 4J73A 2P9UC 4CY5A 1Q47A 5CXBA 5EM2B 4O1QD 3KRWB 3I7HA 3UVOA 3SFZA 4O3UB 4PXWA 2UZXB 4EWRA 4JD2C 5FQDA 2IUPA 3SMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A09 B;  2Z2N A;  2B4E A;  2CNX A;  4MK0 B;  4GQ1 A;  3N0E A;  4PBZ A;  2AGL A;  3PE7 A;  3JZH A;  4J8G A;  4H5I A;  4JXM A;  3MZL A;  3JZN A;  4ERQ A;  3CFS B;  2UZY B;  2MTA H;  4LG8 A;  4FAV D;  3L4O D;  4Y7R A;  5KDO B;  2IWK A;  1YFQ A;  5HE2 B;  3NVQ A;  4GGA A;  1SHY B;  3EI1 B;  5THA A;  2H3X A;  3I8E A;  3I7O A;  2B5N A;  2GC7 A;  1TYQ C;  4J79 A;  1PBY B;  4ZOZ A;  2CE9 A;  2CO0 A;  1P22 A;  4G56 B;  4JT5 C;  3OKY B;  4AOW A;  3PXS D;  3EI2 A;  2I3S A;  2AQ5 A;  3JRO A;  2XL3 A;  5EMJ B;  3MXX A;  5FLX g;  4A7J A;  2GC4 A;  3BG0 A;  4GGC A;  4E54 B;  3I7L A;  5HQG A;  4JSV C;  2YB8 B;  4CI8 A;  5CXB B;  3RLM D;  1GXR A;  4PC0 A;  3RFG A;  1FWX A;  4I79 A;  3EI3 A;  5I5J A;  4GM9 A;  4BUJ C;  5H17 A;  4FWW A;  4J84 A;  5H14 A;  3VH0 A;  3OKW A;  3C9C A;  3FGB A;  2P9L C;  3IIW A;  5C9Z B;  2H14 A;  2G9A A;  5IGQ A;  4X63 B;  2OIZ A;  1TBG A;  2HYE A;  2G99 A;  4CY2 A;  2H13 A;  4D6V A;  3SVW D;  3W15 A;  2CN2 A;  5TEE A;  2P9I C;  3MMY A;  4E5Z A;  4X61 B;  5C2V B;  4O3T B;  3EU7 A;  5AJA A;  3SXT D;  3SBP A;  3JB9 L;  4J0X A;  3UVN A;  3PXW D;  3BG1 A;  1MG3 A;  4GQB B;  2PM7 B;  4CY3 A;  1L0Q A;  4A0A A;  5I5M A;  4LG9 A;  4KFM B;  3SWS D;  3EI2 B;  3EMH A;  2P9P C;  3SN6 B;  4L3G D;  4ESG A;  2IAA A;  3DXM C;  2AH1 A;  5GMK n;  3ORV D;  5CYK A;  5GXI A;  3CFV A;  5TDH B;  3ZWL B;  3SJL D;  5B4W A;  1OLZ A;  5AMS A;  2H9N A;  2J57 G;  4L3H D;  1R5M A;  1OMW B;  3EI3 B;  4OZU A;  4H5J A;  4NSX A;  3DXK C;  2OJY A;  3EWE A;  4A2L A;  2XL2 A;  3PVW B;  4U7A A;  5EAR A;  4X60 B;  3SBQ A;  3VGZ A;  4N14 A;  4AEZ A;  5EMM B;  4O9D A;  2IWF A;  3J80 g;  1N6F A;  3V5W B;  1XKS A;  4XEI C;  5GSA A;  1QNI A;  5EAP A;  3MKQ A;  5AFU 3;  3AL8 A;  5K19 A;  4A11 A;  4BL0 A;  3RN1 D;  3PSL A;  4J0W A;  1PEV A;  3DWL C;  4E5Z B;  3IJ1 A;  3SCY A;  3UR4 A;  4ERY A;  2HJB A;  2H68 A;  5HE1 B;  3N0D A;  2P9N C;  3RRM C;  1JMX B;  3F3F A;  1S4U X;  4X3E A;  4QQE A;  3UKU C;  1JOF A;  4L1Q D;  4A0A B;  4QL1 A;  3IKO A;  4ZOX A;  4XYI A;  1U4C A;  2J56 H;  3C75 H;  5IT9 g;  4IA9 A;  2P9S C;  2Q7Q A;  4A0B A;  4GGD A;  4PSX B;  2TRC B;  2H9M A;  4A08 A;  3I2N A;  2H6K A;  5CXC A;  4HDJ A;  3FM0 A;  1GOT B;  4UI9 R;  4FA4 D;  4J77 A;  3SBR A;  4JT6 C;  4O45 A;  4GZ8 A;  2B5M A;  4ERZ A;  3C5M A;  4ZOV A;  5HE3 B;  2OK6 A;  2AH0 A;  2YBA A;  2YMU A;  3HFQ A;  4LGN A;  5IC7 A;  2Z2O A;  4D0K A;  4ZN4 A;  1MG2 A;  4CZY A;  3I89 A;  3EG6 A;  1K32 A;  4PBY A;  3DSM A;  3OTT A;  3PVU B;  3F3G A;  2OK4 A;  2QXV A;  3CIK B;  4J82 A;  2IUQ A;  4J87 A;  5EAM A;  3AL8 B;  2W18 A;  3OKT A;  4A11 B;  3RMZ D;  5EMK B;  3I7P A;  2EBS A;  4CZV A;  4CI2 A;  4Y5R D;  3JAM g;  2YNN A;  3RFH A;  3JRP A;  5FXY A;  3OKY A;  3NVX A;  3V7D B;  2I0T A;  3EI4 A;  1GG2 B;  3ULE C;  2IUR A;  2HXC A;  5HYN B;  3PXT D;  4R7A B;  3VA6 A;  1NR0 A;  2CE8 A;  5FKS A;  4FA5 D;  3ODT A;  3V9F A;  5JWZ A;  5TF2 A;  4A0B B;  4GM8 A;  2HES X;  2XYI A;  1PGU A;  4CZX A;  1A0R B;  4A08 B;  3IJC A;  2H47 A;  3GFC A;  3IIY A;  5EAL A;  5CXC B;  3MZK A;  4QT8 A;  3A0F A;  4GQ2 P;  2HKR A;  2H9L A;  3OL2 A;  3P4F A;  3UVM A;  1U2V C;  1SQJ A;  4PSW B;  4TZ4 A;  2I0S A;  3B7F A;  5I5I A;  1JMZ B;  5C2W B;  1NEX B;  2B5L A;  2I3T A;  2P9K C;  3KRX B;  3GRE A;  3JPX A;  4JSX C;  1VYH C;  5K1C C;  2I0R A;  3AH8 B;  4FHL A;  5A2Q g;  4A2M A;  4CI1 A;  3OW8 A;  4U1E I;  2AGX A;  1XHM A;  2OVP B;  2PM9 A;  2BBK H;  2H6Q A;  4K3J B;  1SQ9 A;  5FKR A;  3IJ0 A;  2QC5 A;  4ZOY A;  2CN3 A;  1GP2 B;  3SHF A;  4CI3 A;  1XIP A;  4PNK B;  5EM2 A;  4ES0 A;  3UVL A;  2H9P A;  4J81 A;  3I7N A;  1B9Y A;  3PSC B;  2H6N A;  3EI4 B;  5H1M A;  5HE0 B;  2HJ4 A;  2HKM A;  4CY1 A;  5IJ8 E;  5CYK B;  1B9X A;  5EML B;  5FKT A;  4JSN C;  5IJ7 E;  1ERJ A;  4A09 A;  2J55 H;  3UVK A;  1PI6 A;  2CO0 C;  2AGW A;  4J86 A;  3E0C A;  3AL9 A;  1N6E A;  5TEF A;  2GNQ A;  2Z2P A;  1RI6 A;  4FA9 D;  1MDA H;  3BWS A;  4GM3 A;  4CC9 A;  3I8C A;  4FB1 D;  3RSE C;  2AGZ A;  4J8B A;  3K27 A;  5FKQ A;  3OL2 B;  3U4Y A;  3J81 g;  3UKR C;  3JZG A;  4OWR A;  5FA5 B;  3DM0 A;  2IUV A;  4L9O A;  5SXM A;  4J78 A;  3NVN A;  4XYH A;  5GXH A;  3EI1 A;  4QRJ A;  3L4M D;  3FRX A;  4YVD A;  1N6D A;  3F3P A;  4FA1 D;  2YNP A;  4IMM A;  2AGY A;  3C99 A;  2OVR B;  3I7K A;  4Z8L A;  2OVQ B;  2PM9 B;  2YNO A;  2PM6 B;  3AFC A;  4GMB A;  3SLE D;  1K8K C;  4FAN D;  2XU7 A;  2O9K A;  3RN0 D;  3MKS B;  5IGO A;  4JSP C;  1JJU B;  4K3I D;  4BH6 A;  3K26 A;  2BCJ B;  4E54 A;  2PBI B;  4J73 A;  2P9U C;  4CY5 A;  1Q47 A;  5CXB A;  5EM2 B;  4O1Q D;  3KRW B;  3I7H A;  3UVO A;  3SFZ A;  4O3U B;  4PXW A;  2UZX B;  4EWR A;  4JD2 C;  5FQD A;  2IUP A;  3SMR A; 
#chains in the Genus database with same CATH topology
 4G1M A;  4A09 B;  2Z2N A;  2B4E A;  2CNX A;  4MK0 B;  4GQ1 A;  5E6U A;  3MUO A;  3N0E A;  4PBZ A;  2AGL A;  5FFG A;  1L5G A;  3PE7 A;  3K71 A;  3JZH A;  4J8G A;  4H5I A;  4Z7Q A;  4JXM A;  3MZL A;  3JZN A;  4ERQ A;  3CFS B;  1UOP A;  2UZY B;  2MTA H;  4LG8 A;  4FAV D;  3L4O D;  4Y7R A;  5KDO B;  2IWK A;  1YFQ A;  5M5V A;  5HE2 B;  3NVQ A;  4GGA A;  1SHY B;  3EI1 B;  5THA A;  2H3X A;  3I8E A;  3I7O A;  2B5N A;  5E6S A;  2GC7 A;  3IUJ A;  1TYQ C;  3SMR A;  4J79 A;  1PBY B;  4ZOZ A;  2CE9 A;  2CO0 A;  1P22 A;  4G56 B;  3NIF A;  4JT5 C;  3DDU A;  3OKY B;  4AOW A;  3PXS D;  3EI2 A;  2I3S A;  2AQ5 A;  3GD1 I;  3O4J A;  3JRO A;  4AX4 A;  2XL3 A;  5EMJ B;  3MXX A;  1GOG A;  4G1E A;  5FLX g;  4A7J A;  2VC2 A;  2GC4 A;  3BG0 A;  4GGC A;  4E54 B;  3I7L A;  5HQG A;  4JSV C;  4WK4 A;  1O6G A;  2YB8 B;  4NEN A;  5CXB B;  4CI8 A;  3RLM D;  1GXR A;  4DNV A;  3ZDZ A;  1YR2 A;  4PC0 A;  3RFG A;  1FWX A;  1UTC A;  4O02 A;  4I79 A;  3EI3 A;  4AN1 A;  5I5J A;  5M5T A;  4GM9 A;  4BUJ C;  5H17 A;  4FWW A;  4J84 A;  5H14 A;  3VH0 A;  3OKW A;  3C9C A;  3FGB A;  2P9L C;  3IIW A;  5C9Z B;  2H14 A;  1JTD B;  3ZDX A;  2G9A A;  4Z7O A;  4BP9 A;  5IGQ A;  3K72 A;  4X63 B;  2OIZ A;  2EIE A;  1TBG A;  2XZG A;  2HYE A;  3OF7 A;  2G99 A;  4CY2 A;  2H13 A;  4D6V A;  3SVW D;  3W15 A;  2CN2 A;  1C9L A;  3VI4 A;  3QHY B;  5TEE A;  2P9I C;  3MMY A;  4E5Z A;  4X61 B;  5C2V B;  4O3T B;  3EU7 A;  5AJA A;  5M5S A;  3SXT D;  3EQ8 A;  3SBP A;  3JB9 L;  4J0X A;  3ZE1 A;  3UVN A;  3PXW D;  3BG1 A;  1MG3 A;  4GQB B;  2PM7 B;  4CY3 A;  1L0Q A;  4A0A A;  5I5M A;  4LG9 A;  4KFM B;  3SWS D;  3EI2 B;  1H2Z A;  5HDB A;  3EMH A;  2P9P C;  1T2X A;  4JHN A;  3SN6 B;  4L3G D;  4ESG A;  2IAA A;  3DXM C;  3KCI A;  2AH1 A;  5GMK n;  3ORV D;  5CYK A;  5GXI A;  3CFV A;  4MMY A;  5TDH B;  3ZWL B;  3T3M A;  1C9I A;  4RE6 A;  3SJL D;  5B4W A;  1OLZ A;  5AMS A;  2H9N A;  2J57 G;  4L3H D;  1R5M A;  1OMW B;  4BP8 A;  3EI3 B;  4BCC A;  2VDP A;  4OZU A;  4H5J A;  5M5R A;  4NSX A;  3DXK C;  2OJY A;  4O2W A;  3EWE A;  3MUN A;  4A2L A;  2XL2 A;  2BKL A;  3PVW B;  4U7A A;  5EAR A;  2VDR A;  4X60 B;  3SBQ A;  4N14 A;  3VGZ A;  4AEZ A;  5EMM B;  5C86 A;  4O9D A;  2IWF A;  3J80 g;  1N6F A;  3V5W B;  1XKS A;  4XEI C;  5GSA A;  2JKX A;  1A12 A;  1QNI A;  1E8M A;  1JV2 A;  5EAP A;  3MKQ A;  5AFU 3;  3AL8 A;  5K19 A;  4A11 A;  3V4V A;  3RN1 D;  4BL0 A;  4JHP C;  3PSL A;  4J0W A;  1PEV A;  3DWL C;  3O4G A;  4E5Z B;  3IJ1 A;  3SCY A;  3UR4 A;  4ERY A;  2HJB A;  1BPO A;  4IRZ A;  2H68 A;  2VDK A;  5HE1 B;  3N0D A;  2P9N C;  2VDO A;  1JMX B;  3RRM C;  4UM9 A;  5FFO A;  3F3F A;  1S4U X;  4X3E A;  4QQE A;  3UKU C;  1TYE A;  1JOF A;  5C92 A;  4L1Q D;  4A0A B;  4QL1 A;  3IKO A;  4ZOX A;  4XYI A;  4NC4 A;  1U8C A;  1U4C A;  2J56 H;  3C75 H;  5IT9 g;  4IA9 A;  2P9S C;  2Q7Q A;  4A0B A;  4GGD A;  4PSX B;  2XE4 A;  2TRC B;  1VZ3 A;  2H9M A;  4A08 A;  3I2N A;  2H6K A;  5CXC A;  4HDJ A;  3FM0 A;  1GOT B;  4UI9 R;  4FA4 D;  4J77 A;  4WK2 A;  4DNU A;  5E6R A;  3SBR A;  3FCS A;  1H2Y A;  4JT6 C;  4O45 A;  4GZ8 A;  3IVM A;  2B5M A;  4ERZ A;  3C5M A;  4ZOV A;  5HE3 B;  3VI3 A;  2OK6 A;  2AH0 A;  2YBA A;  2YMU A;  3HFQ A;  4LGN A;  5IC7 A;  2Z2O A;  1O6F A;  4D0K A;  4ZN4 A;  1MG2 A;  4AMZ A;  2VZ3 A;  4D9S A;  4CZY A;  3I89 A;  3EG6 A;  1K32 A;  4PBY A;  2HU7 A;  3IUM A;  3DSM A;  3OTT A;  3PVU B;  3F3G A;  4Z7N A;  2OK4 A;  2QXV A;  3CIK B;  4J82 A;  2IUQ A;  4J87 A;  5EAM A;  3AL8 B;  2W18 A;  3OKT A;  4A11 B;  3FCU A;  3RMZ D;  2HU5 A;  3NIG A;  5EMK B;  3I7P A;  2EBS A;  4CZV A;  4CI2 A;  4Y5R D;  3JAM g;  2YNN A;  1H2W A;  2HU8 A;  3RFH A;  3JRP A;  5FXY A;  3OKY A;  3NVX A;  3V7D B;  2I0T A;  4AN0 A;  3IJE A;  3EI4 A;  1GG2 B;  3ULE C;  3IUL A;  2IUR A;  2HXC A;  5HYN B;  3PXT D;  4R7A B;  3VA6 A;  1NR0 A;  2CE8 A;  5FKS A;  4FA5 D;  3ODT A;  3V9F A;  5JWZ A;  5TF2 A;  4A0B B;  3K6S A;  4GM8 A;  2HES X;  2XYI A;  1PGU A;  2VDN A;  1QFS A;  3GC3 B;  4CZX A;  1A0R B;  4A08 B;  3IJC A;  3NID A;  2H47 A;  1H2X A;  3GFC A;  3IIY A;  4UM8 A;  5EAL A;  5CXC B;  2QZP A;  2EIB A;  3QI0 A;  1VZ2 A;  3MZK A;  4QT8 A;  2QR5 A;  3A0F A;  4GQ2 P;  2HKR A;  2H9L A;  3OL2 A;  3P4F A;  3UVM A;  1U2V C;  2EID A;  1SQJ A;  4PSW B;  4TZ4 A;  2I0S A;  3B7F A;  5I5I A;  3IUQ A;  1JMZ B;  5C2W B;  1NEX B;  2B5L A;  2I3T A;  1GOF A;  2P9K C;  3KRX B;  2WQ8 A;  3GRE A;  3JPX A;  4JSX C;  3V4P A;  1VYH C;  5K1C C;  2I0R A;  3AH8 B;  4FHL A;  3IUN A;  5A2Q g;  4A2M A;  4CI1 A;  3ZE0 A;  3OW8 A;  4U1E I;  2AGX A;  1XHM A;  2OVP B;  2PM9 A;  3ZDY A;  2BBK H;  2H6Q A;  4K3J B;  1SQ9 A;  4NAA A;  5FKR A;  3IJ0 A;  2QC5 A;  2VDL A;  1GOH A;  2VDM A;  3EQ9 A;  3IUR A;  4ZOY A;  2CN3 A;  1GP2 B;  3SHF A;  4CI3 A;  1XIP A;  4DNW A;  4PNK B;  1E8N A;  5EM2 A;  2EIC A;  4ES0 A;  3UVL A;  2H9P A;  4J81 A;  3I7N A;  1B9Y A;  3PSC B;  2H6N A;  3EI4 B;  2XDW A;  5H1M A;  1M1X A;  5HE0 B;  2HJ4 A;  2HKM A;  1VE7 A;  4CY1 A;  5IJ8 E;  5CYK B;  1I2M B;  4MMX A;  1B9X A;  5EML B;  5FKT A;  4JSN C;  5IJ7 E;  4WK0 A;  1ERJ A;  4A09 A;  2J55 H;  3UVK A;  1PI6 A;  2CO0 C;  2AGW A;  4BCD A;  4L1M A;  4J86 A;  3E0C A;  3AL9 A;  1N6E A;  5TEF A;  2GNQ A;  2VDQ A;  1RI6 A;  2Z2P A;  4FA9 D;  1MDA H;  3BWS A;  3T3P A;  4GM3 A;  4CC9 A;  3I8C A;  4FB1 D;  3RSE C;  2AGZ A;  4J8B A;  3K27 A;  5FKQ A;  3OL2 B;  3U4Y A;  3J81 g;  3UKR C;  3JZG A;  4OWR A;  5FA5 B;  3DM0 A;  2IUV A;  3EQ7 A;  4L9O A;  5SXM A;  4G55 A;  4J78 A;  3NVN A;  4XYH A;  5GXH A;  3EI1 A;  4QRJ A;  3L4M D;  4WJK A;  3FRX A;  3O4H A;  4YVD A;  1N6D A;  2VZ1 A;  3F3P A;  5M61 A;  3MVD K;  4FA1 D;  2YNP A;  4IMM A;  4RE5 A;  2AGY A;  3C99 A;  2OVR B;  3I7K A;  1VE6 A;  4NBM A;  4Z8L A;  2OVQ B;  2PM9 B;  2YNO A;  2PM6 B;  3AFC A;  4GMB A;  3SLE D;  1K8K C;  1K3I A;  4FAN D;  1UOQ A;  2XU7 A;  2O9K A;  3RN0 D;  4AMY A;  3MKS B;  4BCB A;  5IGO A;  4JSP C;  1JJU B;  4K3I D;  4BH6 A;  3K26 A;  2BCJ B;  4E54 A;  3O4I A;  1QFM A;  2PBI B;  4J73 A;  2P9U C;  1UOO A;  4CY5 A;  1Q47 A;  5CXB A;  5EM2 B;  3KRW B;  4O1Q D;  3I7H A;  3UVO A;  3SFZ A;  1E5T A;  3ZE2 A;  4O3U B;  5M5U A;  4PXW A;  2UZX B;  4EWR A;  4JD2 C;  5FQD A;  2IUP A;  4QAM A;  4MMZ A; 
#chains in the Genus database with same CATH homology
 4A09 B;  2Z2N A;  2B4E A;  2CNX A;  4MK0 B;  4GQ1 A;  3N0E A;  4PBZ A;  2AGL A;  3PE7 A;  3JZH A;  4J8G A;  4H5I A;  4JXM A;  3MZL A;  3JZN A;  4ERQ A;  3CFS B;  2UZY B;  2MTA H;  4LG8 A;  4FAV D;  3L4O D;  4Y7R A;  5KDO B;  2IWK A;  1YFQ A;  5HE2 B;  3NVQ A;  4GGA A;  1SHY B;  3EI1 B;  5THA A;  2H3X A;  3I8E A;  3I7O A;  2B5N A;  2GC7 A;  1TYQ C;  4J79 A;  1PBY B;  4ZOZ A;  2CE9 A;  2CO0 A;  1P22 A;  4G56 B;  4JT5 C;  3OKY B;  4AOW A;  3PXS D;  3EI2 A;  2I3S A;  2AQ5 A;  3JRO A;  2XL3 A;  5EMJ B;  3MXX A;  5FLX g;  4A7J A;  2GC4 A;  3BG0 A;  4GGC A;  4E54 B;  3I7L A;  5HQG A;  4JSV C;  2YB8 B;  4CI8 A;  5CXB B;  3RLM D;  1GXR A;  4PC0 A;  3RFG A;  1FWX A;  4I79 A;  3EI3 A;  5I5J A;  4GM9 A;  4BUJ C;  5H17 A;  4FWW A;  4J84 A;  5H14 A;  3VH0 A;  3OKW A;  3C9C A;  3FGB A;  2P9L C;  3IIW A;  5C9Z B;  2H14 A;  2G9A A;  5IGQ A;  4X63 B;  2OIZ A;  1TBG A;  2HYE A;  2G99 A;  4CY2 A;  2H13 A;  4D6V A;  3SVW D;  3W15 A;  2CN2 A;  5TEE A;  2P9I C;  3MMY A;  4E5Z A;  4X61 B;  5C2V B;  4O3T B;  3EU7 A;  5AJA A;  3SXT D;  3SBP A;  3JB9 L;  4J0X A;  3UVN A;  3PXW D;  3BG1 A;  1MG3 A;  4GQB B;  2PM7 B;  4CY3 A;  1L0Q A;  4A0A A;  5I5M A;  4LG9 A;  4KFM B;  3SWS D;  3EI2 B;  3EMH A;  2P9P C;  3SN6 B;  4L3G D;  4ESG A;  2IAA A;  3DXM C;  2AH1 A;  5GMK n;  3ORV D;  5CYK A;  5GXI A;  3CFV A;  5TDH B;  3ZWL B;  3SJL D;  5B4W A;  1OLZ A;  5AMS A;  2H9N A;  2J57 G;  4L3H D;  1R5M A;  1OMW B;  3EI3 B;  4OZU A;  4H5J A;  4NSX A;  3DXK C;  2OJY A;  3EWE A;  4A2L A;  2XL2 A;  3PVW B;  4U7A A;  5EAR A;  4X60 B;  3SBQ A;  3VGZ A;  4N14 A;  4AEZ A;  5EMM B;  4O9D A;  2IWF A;  3J80 g;  1N6F A;  3V5W B;  1XKS A;  4XEI C;  5GSA A;  1QNI A;  5EAP A;  3MKQ A;  5AFU 3;  3AL8 A;  5K19 A;  4A11 A;  4BL0 A;  3RN1 D;  3PSL A;  4J0W A;  1PEV A;  3DWL C;  4E5Z B;  3IJ1 A;  3SCY A;  3UR4 A;  4ERY A;  2HJB A;  2H68 A;  5HE1 B;  3N0D A;  2P9N C;  3RRM C;  1JMX B;  3F3F A;  1S4U X;  4X3E A;  4QQE A;  3UKU C;  1JOF A;  4L1Q D;  4A0A B;  4QL1 A;  3IKO A;  4ZOX A;  4XYI A;  1U4C A;  2J56 H;  3C75 H;  5IT9 g;  4IA9 A;  2P9S C;  2Q7Q A;  4A0B A;  4GGD A;  4PSX B;  2TRC B;  2H9M A;  4A08 A;  3I2N A;  2H6K A;  5CXC A;  4HDJ A;  3FM0 A;  1GOT B;  4UI9 R;  4FA4 D;  4J77 A;  3SBR A;  4JT6 C;  4O45 A;  4GZ8 A;  2B5M A;  4ERZ A;  3C5M A;  4ZOV A;  5HE3 B;  2OK6 A;  2AH0 A;  2YBA A;  2YMU A;  3HFQ A;  4LGN A;  5IC7 A;  2Z2O A;  4D0K A;  4ZN4 A;  1MG2 A;  4CZY A;  3I89 A;  3EG6 A;  1K32 A;  4PBY A;  3DSM A;  3OTT A;  3PVU B;  3F3G A;  2OK4 A;  2QXV A;  3CIK B;  4J82 A;  2IUQ A;  4J87 A;  5EAM A;  3AL8 B;  2W18 A;  3OKT A;  4A11 B;  3RMZ D;  5EMK B;  3I7P A;  2EBS A;  4CZV A;  4CI2 A;  4Y5R D;  3JAM g;  2YNN A;  3RFH A;  3JRP A;  5FXY A;  3OKY A;  3NVX A;  3V7D B;  2I0T A;  3EI4 A;  1GG2 B;  3ULE C;  2IUR A;  2HXC A;  5HYN B;  3PXT D;  4R7A B;  3VA6 A;  1NR0 A;  2CE8 A;  5FKS A;  4FA5 D;  3ODT A;  3V9F A;  5JWZ A;  5TF2 A;  4A0B B;  4GM8 A;  2HES X;  2XYI A;  1PGU A;  4CZX A;  1A0R B;  4A08 B;  3IJC A;  2H47 A;  3GFC A;  3IIY A;  5EAL A;  5CXC B;  3MZK A;  4QT8 A;  3A0F A;  4GQ2 P;  2HKR A;  2H9L A;  3OL2 A;  3P4F A;  3UVM A;  1U2V C;  1SQJ A;  4PSW B;  4TZ4 A;  2I0S A;  3B7F A;  5I5I A;  1JMZ B;  5C2W B;  1NEX B;  2B5L A;  2I3T A;  2P9K C;  3KRX B;  3GRE A;  3JPX A;  4JSX C;  1VYH C;  5K1C C;  2I0R A;  3AH8 B;  4FHL A;  5A2Q g;  4A2M A;  4CI1 A;  3OW8 A;  4U1E I;  2AGX A;  1XHM A;  2OVP B;  2PM9 A;  2BBK H;  2H6Q A;  4K3J B;  1SQ9 A;  5FKR A;  3IJ0 A;  2QC5 A;  4ZOY A;  2CN3 A;  1GP2 B;  3SHF A;  4CI3 A;  1XIP A;  4PNK B;  5EM2 A;  4ES0 A;  3UVL A;  2H9P A;  4J81 A;  3I7N A;  1B9Y A;  3PSC B;  2H6N A;  3EI4 B;  5H1M A;  5HE0 B;  2HJ4 A;  2HKM A;  4CY1 A;  5IJ8 E;  5CYK B;  1B9X A;  5EML B;  5FKT A;  4JSN C;  5IJ7 E;  1ERJ A;  4A09 A;  2J55 H;  3UVK A;  1PI6 A;  2CO0 C;  2AGW A;  4J86 A;  3E0C A;  3AL9 A;  1N6E A;  5TEF A;  2GNQ A;  2Z2P A;  1RI6 A;  4FA9 D;  1MDA H;  3BWS A;  4GM3 A;  4CC9 A;  3I8C A;  4FB1 D;  3RSE C;  2AGZ A;  4J8B A;  3K27 A;  5FKQ A;  3OL2 B;  3U4Y A;  3J81 g;  3UKR C;  3JZG A;  4OWR A;  5FA5 B;  3DM0 A;  2IUV A;  4L9O A;  5SXM A;  4J78 A;  3NVN A;  4XYH A;  5GXH A;  3EI1 A;  4QRJ A;  3L4M D;  3FRX A;  4YVD A;  1N6D A;  3F3P A;  4FA1 D;  2YNP A;  4IMM A;  2AGY A;  3C99 A;  2OVR B;  3I7K A;  4Z8L A;  2OVQ B;  2PM9 B;  2YNO A;  2PM6 B;  3AFC A;  4GMB A;  3SLE D;  1K8K C;  4FAN D;  2XU7 A;  2O9K A;  3RN0 D;  3MKS B;  5IGO A;  4JSP C;  1JJU B;  4K3I D;  4BH6 A;  3K26 A;  2BCJ B;  4E54 A;  2PBI B;  4J73 A;  2P9U C;  4CY5 A;  1Q47 A;  5CXB A;  5EM2 B;  4O1Q D;  3KRW B;  3I7H A;  3UVO A;  3SFZ A;  4O3U B;  4PXW A;  2UZX B;  4EWR A;  4JD2 C;  5FQD A;  2IUP A;  3SMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...