4D0KA

Complex of chaetomium thermophilum pan2 (wd40-cs1) with pan3 (c-term)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
345
structure length
329
Chain Sequence
MDADWDEVTRIAYPAPGTFPRPATAVAFDPIAELLWAGFDRGRVCSFYGRDLTRYTAFKIQPASEGPVRQFLFHDKGVIVLGTRSVHMAMRRGPALWNIRHENMKDLRCMSFTSKGTQEIIVAGWQDTMLVIDVLKGDIIKQIPAQHHYSIMKKSRYICAATKTGSVDLIDPLSFKIVRSWQAHASYINDMDAQNDFIVTCGGSYMLDPYVNVFDLKNMASMKPMPFPPLAAHVRLHPRMLTTAIVTSQHGQMHVVDIMNPNSSTVRYANISSYVKLFEIAPSGEALVIGDADCNIHLWGSPTKIHFTDMAIPIELPEPVLDWSETPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Gene regulation
molecule keywords A-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
total genus 66
structure length 329
sequence length 345
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4d0kA01
3I7KA 3UVOA 2AGWA 4FA4D 3PSLA 4A0AB 2CNXA 1R5MA 3L4OD 2IWKA 3IIYA 2GC7A 2YNPA 5SXMA 4L3GD 4CY1A 4A0AA 5FKTA 3E0CA 3KRWB 4FB1D 4X60B 4ZOZA 5FA5B 3CFVA 3JZHA 4IMMA 2UZXB 2YBAA 4PXWA 1XHMA 3UKRC 2Z2OA 3MZKA 3N0DA 5HE0B 5CXBA 4J0WA 2H47A 4GQBB 4J81A 1NR0A 2H3XA 2IUVA 4GQ1A 4J84A 5IJ7E 3A0FA 3RFGA 3I7OA 5CXBB 4GZ8A 1PBYB 3I7PA 2OVPB 3RLMD 3F3FA 3SBPA 5HQGA 5EAMA 2QXVA 5FKQA 3VH0A 2HKRA 4A09A 3L4MD 1XKSA 2B5MA 3K26A 4A08A 4CY3A 5I5JA 5HYNB 3SCYA 4GM9A 2HYEA 4QRJA 3PVWB 4CY5A 3EI4A 1U2VC 2XYIA 1K32A 3JROA 4GGCA 4JXMA 2IUQA 3HFQA 4K3JB 4X61B 3EI1B 4ERQA 1N6FA 4H5IA 4A08B 5I5MA 4BL0A 5EMKB 2J56H 2XL3A 5TDHB 2B4EA 4QQEA 3PE7A 2HXCA 4O3TB 3SN6B 4GQ2P 3AL8A 3N0EA 3JPXA 5HE2B 4GM3A 4X63B 5EMMB 3I7LA 3SBRA 4J8BA 3EI4B 3C75H 3JAMg 3AL8B 5HE3B 3F3GA 3SHFA 4GGDA 4LG8A 5B4WA 4CI8A 4J87A 3GREA 4E54A 3C5MA 3NVNA 4Y5RD 2AH0A 2HESX 2BBKH 2H6QA 3BG0A 3ORVD 1JMZB 1TYQC 3OW8A 1GOTB 2H6NA 3RRMC 4J79A 4CZVA 4JSNC 5TEFA 4ERZA 4JSPC 4L9OA 3IKOA 2H9NA 2H6KA 5C9ZB 4FAND 2AQ5A 3OL2A 2CO0A 4PC0A 5IT9g 3FRXA 2IWFA 4ZOYA 4PSXB 2H9MA 5K1CC 4FA1D 2OVQB 1PEVA 1OMWB 3DM0A 5TF2A 4FA9D 3V5WB 1RI6A 4CI3A 3CFSB 3FGBA 3UVLA 2I3SA 3JZNA 4GGAA 1NEXB 1L0QA 3I8EA 4U7AA 3UR4A 2O9KA 2I3TA 2H68A 2J55H 5EMLB 4PBYA 3SBQA 4CY2A 3J80g 3P4FA 4QL1A 4A09B 3SWSD 5H17A 3W15A 5KDOB 4G56B 4A7JA 5A2Qg 3RSEC 1A0RB 2P9UC 3AFCA 2IURA 3RN0D 4AOWA 4AEZA 1B9YA 2P9LC 2IAAA 5JWZA 5CYKA 2PBIB 4OWRA 4BH6A 4E54B 4J78A 3DSMA 3VA6A 4IA9A 4JT6C 4CI1A 4X3EA 3VGZA 4OZUA 2PM6B 3MXXA 4LG9A 5AFU3 3EI1A 4N14A 3EU7A 4FWWA 3NVXA 2AGXA 2B5LA 4PNKB 3EI2B 2P9IC 3PXWD 1MG2A 1SQJA 4MK0B 4O9DA 4HDJA 4JD2C 4A2LA 2TRCB 1K8KC 2Z2PA 2J57G 4JSVC 2I0SA 3SXTD 1SHYB 5IJ8E 5GMKn 3RN1D 2CO0C 3FM0A 1U4CA 3ZWLB 4UI9R 4CC9A 4PSWB 3NVQA 5EM2A 4GM8A 4FA5D 4L1QD 5H14A 3PXTD 4O45A 3EMHA 2I0TA 4A11B 3AH8B 3ULEC 4K3ID 5THAA 5IGOA 3C9CA 2XU7A 2PM7B 1GP2B 3PVUB 4E5ZB 5GXIA 4XYIA 4J86A 4FHLA 2AGLA 3IIWA 4GMBA 4A11A 3OL2B 5FKSA 4D0KA 3PXSD 3EG6A 2OVRB 3U4YA 5CYKB 2G99A 2B5NA 2HKMA 3BWSA 4XYHA 4A2MA 4A0BA 1QNIA 3JRPA 5IGQA 2H9PA 3JZGA 5FKRA 3V7DB 3MKSB 5FLXg 3B7FA 4BUJC 5CXCB 3PSCB 3I7HA 1ERJA 4J82A 3OTTA 5IC7A 4ZOXA 3IJ0A 3UKUC 3UVMA 3SVWD 3KRXB 1PI6A 3GFCA 3CIKB 3K27A 2W18A 5GXHA 5EM2B 1GXRA 3DXMC 2BCJB 4Y7RA 4R7AB 3I8CA 5K19A 2H14A 1GG2B 2PM9B 4XEIC 2XL2A 3UVNA 3EI2A 4JT5C 4CZYA 2PM9A 2YNNA 1JJUB 5FQDA 2QC5A 3C99A 3SFZA 2P9SC 1S4UX 4CZXA 4KFMB 2YB8B 2GC4A 4FAVD 2AGZA 1JMXB 4J73A 5H1MA 2OK4A 2OK6A 3DXKC 3MMYA 4O1QD 4LGNA 3I2NA 3JB9L 2MTAH 2IUPA 3OKYA 4J77A 2UZYB 5AJAA 4U1EI 5HE1B 4ESGA 3AL9A 4Z8LA 2EBSA 1N6DA 2HJBA 4E5ZA 2GNQA 3MZLA 2P9NC 3F3PA 5EARA 3BG1A 4I79A 2AH1A 1Q47A 3EI3B 2Q7QA 2CN2A 3IJCA 3V9FA 4CI2A 1MG3A 4H5JA 4D6VA 1XIPA 1JOFA 2AGYA 3SJLD 1SQ9A 4L3HD 2Z2NA 3MKQA 3EI3A 1YFQA 4J8GA 3OKWA 2H9LA 2H13A 1PGUA 5FXYA 3RMZD 4A0BB 3ODTA 2YMUA 4EWRA 3OKTA 1VYHC 4TZ4A 5C2VB 2OJYA 4QT8A 3SLED 5EALA 5CXCA 4ZOVA 3I89A 3SMRA 4ES0A 2I0RA 2YNOA 2CE8A 4ERYA 5EAPA 4O3UB 5C2WB 4PBZA 3DWLC 2P9PC 3J81g 1FWXA 3EWEA 1OLZA 5TEEA 3RFHA 4J0XA 3UVKA 1MDAH 3IJ1A 4ZN4A 3OKYB 5I5IA 5AMSA 2CE9A 2P9KC 2OIZA 4JSXC 1P22A 2CN3A 3I7NA 1B9XA 5EMJB 4NSXA 4YVDA 1TBGA 1N6EA 5GSAA 2G9AA 2HJ4A
chains in the Genus database with same CATH superfamily
3I7KA 3UVOA 2AGWA 4FA4D 3PSLA 4A0AB 1H2XA 2CNXA 1R5MA 3L4OD 3NIGA 2IWKA 3IIYA 2GC7A 2YNPA 5SXMA 3MUNA 3NIFA 1JTDB 2XZGA 4L3GD 4CY1A 4A0AA 5FKTA 3E0CA 3KRWB 4FB1D 4X60B 4ZOZA 4WK4A 3IVMA 3CFVA 3JZHA 5FA5B 4IMMA 2UZXB 2YBAA 4PXWA 1XHMA 3UKRC 2Z2OA 3MZKA 3N0DA 3O4JA 3O4HA 5HE0B 5CXBA 1C9LA 4J0WA 2H47A 4GQBB 4J81A 1NR0A 2H3XA 2IUVA 3GC3B 4GQ1A 4J84A 1VZ3A 5IJ7E 3A0FA 2EIBA 3RFGA 3I7OA 3V4PA 1U8CA 5CXBB 4GZ8A 1PBYB 3I7PA 2OVPB 3IULA 3RLMD 3EQ9A 3F3FA 3SBPA 5HQGA 4NBMA 5EAMA 2QXVA 5FKQA 2VDOA 5E6UA 3VH0A 2HKRA 3ZE0A 4A09A 3L4MD 1XKSA 3MUOA 2B5MA 3K26A 4A08A 4CY3A 1H2WA 5I5JA 5HYNB 2VC2A 3VI3A 3SCYA 4GM9A 2HYEA 3K6SA 4QRJA 3OF7A 3PVWB 4CY5A 3EI4A 5M5VA 1U2VC 2XYIA 1K32A 3JROA 4GGCA 4JXMA 4WK2A 2IUQA 3HFQA 4K3JB 4Z7QA 4X61B 3EI1B 4ERQA 1N6FA 4H5IA 4A08B 3IUJA 5E6RA 4BL0A 5EMKB 5I5MA 5HDBA 2J56H 2XL3A 5TDHB 1VE7A 2B4EA 3PE7A 4QQEA 2HXCA 4O3TB 4DNUA 3SN6B 4GQ2P 3N0EA 3AL8A 1O6GA 3JPXA 5HE2B 4GM3A 4X63B 5EMMB 3I7LA 3SBRA 4J8BA 3EI4B 4G55A 3C75H 3JAMg 3AL8B 5HE3B 3F3GA 3SHFA 1GOGA 4GGDA 4LG8A 1C9IA 5B4WA 4J87A 3GREA 3T3MA 4CI8A 4E54A 3C5MA 3NVNA 2AH0A 2HESX 4Y5RD 4JHNA 2BBKH 2H6QA 3BG0A 3ORVD 1JMZB 3MVDK 1TYQC 4DNWA 3OW8A 3VI4A 1GOTB 2H6NA 3RRMC 4J79A 4CZVA 2EIDA 2QZPA 4JSNC 5TEFA 4AN0A 4ERZA 4JSPC 3FCUA 3IKOA 4L9OA 2H9NA 4BCCA 2H6KA 5C9ZB 4FAND 1BPOA 2AQ5A 1YR2A 3OL2A 4MMZA 2CO0A 4PC0A 5IT9g 3FRXA 2IWFA 4ZOYA 4PSXB 2H9MA 1E5TA 5K1CC 4FA1D 2OVQB 1PEVA 1OMWB 3DM0A 5TF2A 4FA9D 3V5WB 1RI6A 3IURA 3CFSB 4CI3A 5E6SA 1L5GA 1GOHA 3FGBA 1QFSA 3UVLA 2I3SA 3QI0A 3JZNA 4GGAA 4BP9A 1NEXB 1L0QA 3I8EA 4U7AA 3UR4A 2O9KA 2I3TA 5FFGA 2H68A 2J55H 5EMLB 1UTCA 4PBYA 3SBQA 4CY2A 2BKLA 3J80g 3P4FA 4QL1A 3ZDXA 4A09B 3SWSD 5H17A 2VDQA 3W15A 5KDOB 4G56B 4A7JA 5A2Qg 3RSEC 1A0RB 2P9UC 3AFCA 2IURA 3RN0D 4AOWA 2WQ8A 4AEZA 1B9YA 2P9LC 2VDLA 4AMYA 2IAAA 4D9SA 5JWZA 5CYKA 2PBIB 4O02A 4OWRA 4BH6A 4E54B 4J78A 3DSMA 3VA6A 1JV2A 1H2ZA 1I2MB 4IA9A 4JT6C 4CI1A 4X3EA 3VGZA 4OZUA 2PM6B 3MXXA 4LG9A 5M5RA 5AFU3 3EI1A 4N14A 1TYEA 3EU7A 4FWWA 3NVXA 3GD1I 2AGXA 2B5LA 4PNKB 3EI2B 2P9IC 3PXWD 1MG2A 1O6FA 1SQJA 4MK0B 4O9DA 4HDJA 4JD2C 4A2LA 2TRCB 1K8KC 2Z2PA 2J57G 3EQ8A 4JSVC 2I0SA 4DNVA 3SXTD 1SHYB 5IJ8E 5GMKn 3RN1D 2CO0C 3FM0A 3O4GA 1U4CA 3ZWLB 4UI9R 4CC9A 3IJEA 4PSWB 3NVQA 5EM2A 4GM8A 4FA5D 4L1QD 2HU7A 2XE4A 5H14A 3PXTD 4O45A 4Z7NA 3EMHA 1UOPA 2I0TA 4A11B 3AH8B 3O4IA 3ULEC 4L1MA 4NAAA 4K3ID 5THAA 3IUMA 5IGOA 1QFMA 3C9CA 2XU7A 2PM7B 1GP2B 3PVUB 4NC4A 4E5ZB 4XYIA 5GXIA 4J86A 4FHLA 2AGLA 3IIWA 4GMBA 4A11A 3OL2B 5FKSA 4D0KA 3PXSD 3EG6A 2OVRB 5C86A 3U4YA 4IRZA 5CYKB 2G99A 2VDMA 1T2XA 2B5NA 2VDRA 2HKMA 3BWSA 4XYHA 4A2MA 4A0BA 1QNIA 3JRPA 5IGQA 2H9PA 3JZGA 5FKRA 3V7DB 3MKSB 4BCDA 5FLXg 3B7FA 4BUJC 5CXCB 3PSCB 3I7HA 2VZ3A 4NENA 1ERJA 4J82A 3OTTA 5IC7A 4ZOXA 1VE6A 4WJKA 3IJ0A 4G1MA 3ZDZA 3UKUC 3UVMA 3SVWD 3KRXB 1PI6A 3GFCA 4AN1A 3CIKB 3K27A 2W18A 5GXHA 5EM2B 1GXRA 3DXMC 1M1XA 2BCJB 4R7AB 4Y7RA 3FCSA 1A12A 4MMXA 3KCIA 3I8CA 5K19A 5M61A 2H14A 3K71A 1GG2B 2PM9B 2VZ1A 4XEIC 3ZE1A 4UM8A 2XL2A 3UVNA 4BP8A 3EI2A 4JT5C 4CZYA 2PM9A 2YNNA 1JJUB 5FQDA 1K3IA 2QC5A 3C99A 3SFZA 2P9SC 1S4UX 4CZXA 4KFMB 2YB8B 2GC4A 5FFOA 2EIEA 4FAVD 2AGZA 1JMXB 2HU8A 4J73A 5H1MA 2OK4A 2OK6A 3DXKC 3MMYA 4O1QD 5M5SA 1E8NA 1E8MA 3V4VA 4LGNA 3I2NA 3JB9L 4AMZA 2MTAH 2IUPA 3OKYA 4WK0A 4J77A 2UZYB 5AJAA 4U1EI 5HE1B 3ZDYA 4ESGA 3IUNA 3AL9A 2EICA 4Z8LA 2EBSA 1N6DA 4UM9A 2HJBA 4E5ZA 2GNQA 3MZLA 1H2YA 1UOQA 2P9NC 3BG1A 3F3PA 3K72A 4I79A 5EARA 2AH1A 1Q47A 3IUQA 3EI3B 2Q7QA 2VDNA 4QAMA 2CN2A 3IJCA 3V9FA 4MMYA 1MG3A 4CI2A 4H5JA 4D6VA 1XIPA 1JOFA 2AGYA 3SJLD 1SQ9A 4L3HD 2Z2NA 3MKQA 3EI3A 1YFQA 3DDUA 1VZ2A 2VDPA 4J8GA 3OKWA 2H9LA 2H13A 4AX4A 1PGUA 5FXYA 3RMZD 4A0BB 3ODTA 2YMUA 4EWRA 3OKTA 1VYHC 4TZ4A 3T3PA 5C2VB 2OJYA 2HU5A 4QT8A 3SLED 5EALA 5CXCA 4JHPC 4ZOVA 4BCBA 4RE6A 3I89A 3SMRA 4ES0A 1GOFA 4RE5A 2VDKA 2I0RA 2YNOA 4O2WA 2CE8A 1UOOA 4ERYA 5EAPA 4O3UB 5C2WB 4PBZA 3DWLC 2P9PC 4G1EA 3J81g 1FWXA 5M5UA 3EWEA 1OLZA 5TEEA 3RFHA 3QHYB 4J0XA 3UVKA 1MDAH 3IJ1A 3NIDA 4ZN4A 3OKYB 5I5IA 5AMSA 2CE9A 2P9KC 2OIZA 4JSXC 1P22A 2CN3A 3I7NA 3ZE2A 5M5TA 4Z7OA 1B9XA 5EMJB 2JKXA 2XDWA 4NSXA 4YVDA 5C92A 2QR5A 1TBGA 1N6EA 5GSAA 2G9AA 3EQ7A 2HJ4A
chains in the Genus database with same CATH topology
3I7KA 3UVOA 2AGWA 4FA4D 3PSLA 4A0AB 2CNXA 1R5MA 3L4OD 2IWKA 3IIYA 2GC7A 2YNPA 5SXMA 4L3GD 4CY1A 4A0AA 5FKTA 3E0CA 3KRWB 4FB1D 4X60B 4ZOZA 5FA5B 3CFVA 3JZHA 4IMMA 2UZXB 2YBAA 4PXWA 1XHMA 3UKRC 2Z2OA 3MZKA 3N0DA 5HE0B 5CXBA 4J0WA 2H47A 4GQBB 4J81A 1NR0A 2H3XA 2IUVA 4GQ1A 4J84A 5IJ7E 3A0FA 3RFGA 3I7OA 5CXBB 4GZ8A 1PBYB 3I7PA 2OVPB 3RLMD 3F3FA 3SBPA 5HQGA 5EAMA 2QXVA 5FKQA 3VH0A 2HKRA 4A09A 3L4MD 1XKSA 2B5MA 3K26A 4A08A 4CY3A 5I5JA 5HYNB 3SCYA 4GM9A 2HYEA 4QRJA 3PVWB 4CY5A 3EI4A 1U2VC 2XYIA 1K32A 3JROA 4GGCA 4JXMA 2IUQA 3HFQA 4K3JB 4X61B 3EI1B 4ERQA 1N6FA 4H5IA 4A08B 5I5MA 4BL0A 5EMKB 2J56H 2XL3A 5TDHB 2B4EA 4QQEA 3PE7A 2HXCA 4O3TB 3SN6B 4GQ2P 3AL8A 3N0EA 3JPXA 5HE2B 4GM3A 4X63B 5EMMB 3I7LA 3SBRA 4J8BA 3EI4B 3C75H 3JAMg 3AL8B 5HE3B 3F3GA 3SHFA 4GGDA 4LG8A 5B4WA 4CI8A 4J87A 3GREA 4E54A 3C5MA 3NVNA 4Y5RD 2AH0A 2HESX 2BBKH 2H6QA 3BG0A 3ORVD 1JMZB 1TYQC 3OW8A 1GOTB 2H6NA 3RRMC 4J79A 4CZVA 4JSNC 5TEFA 4ERZA 4JSPC 4L9OA 3IKOA 2H9NA 2H6KA 5C9ZB 4FAND 2AQ5A 3OL2A 2CO0A 4PC0A 5IT9g 3FRXA 2IWFA 4ZOYA 4PSXB 2H9MA 5K1CC 4FA1D 2OVQB 1PEVA 1OMWB 3DM0A 5TF2A 4FA9D 3V5WB 1RI6A 4CI3A 3CFSB 3FGBA 3UVLA 2I3SA 3JZNA 4GGAA 1NEXB 1L0QA 3I8EA 4U7AA 3UR4A 2O9KA 2I3TA 2H68A 2J55H 5EMLB 4PBYA 3SBQA 4CY2A 3J80g 3P4FA 4QL1A 4A09B 3SWSD 5H17A 3W15A 5KDOB 4G56B 4A7JA 5A2Qg 3RSEC 1A0RB 2P9UC 3AFCA 2IURA 3RN0D 4AOWA 4AEZA 1B9YA 2P9LC 2IAAA 5JWZA 5CYKA 2PBIB 4OWRA 4BH6A 4E54B 4J78A 3DSMA 3VA6A 4IA9A 4JT6C 4CI1A 4X3EA 3VGZA 4OZUA 2PM6B 3MXXA 4LG9A 5AFU3 3EI1A 4N14A 3EU7A 4FWWA 3NVXA 2AGXA 2B5LA 4PNKB 3EI2B 2P9IC 3PXWD 1MG2A 1SQJA 4MK0B 4O9DA 4HDJA 4JD2C 4A2LA 2TRCB 1K8KC 2Z2PA 2J57G 4JSVC 2I0SA 3SXTD 1SHYB 5IJ8E 5GMKn 3RN1D 2CO0C 3FM0A 1U4CA 3ZWLB 4UI9R 4CC9A 4PSWB 3NVQA 5EM2A 4GM8A 4FA5D 4L1QD 5H14A 3PXTD 4O45A 3EMHA 2I0TA 4A11B 3AH8B 3ULEC 4K3ID 5THAA 5IGOA 3C9CA 2XU7A 2PM7B 1GP2B 3PVUB 4E5ZB 5GXIA 4XYIA 4J86A 4FHLA 2AGLA 3IIWA 4GMBA 4A11A 3OL2B 5FKSA 4D0KA 3PXSD 3EG6A 2OVRB 3U4YA 5CYKB 2G99A 2B5NA 2HKMA 3BWSA 4XYHA 4A2MA 4A0BA 1QNIA 3JRPA 5IGQA 2H9PA 3JZGA 5FKRA 3V7DB 3MKSB 5FLXg 3B7FA 4BUJC 5CXCB 3PSCB 3I7HA 1ERJA 4J82A 3OTTA 5IC7A 4ZOXA 3IJ0A 3UKUC 3UVMA 3SVWD 3KRXB 1PI6A 3GFCA 3CIKB 3K27A 2W18A 5GXHA 5EM2B 1GXRA 3DXMC 2BCJB 4Y7RA 4R7AB 3I8CA 5K19A 2H14A 1GG2B 2PM9B 4XEIC 2XL2A 3UVNA 3EI2A 4JT5C 4CZYA 2PM9A 2YNNA 1JJUB 5FQDA 2QC5A 3C99A 3SFZA 2P9SC 1S4UX 4CZXA 4KFMB 2YB8B 2GC4A 4FAVD 2AGZA 1JMXB 4J73A 5H1MA 2OK4A 2OK6A 3DXKC 3MMYA 4O1QD 4LGNA 3I2NA 3JB9L 2MTAH 2IUPA 3OKYA 4J77A 2UZYB 5AJAA 4U1EI 5HE1B 4ESGA 3AL9A 4Z8LA 2EBSA 1N6DA 2HJBA 4E5ZA 2GNQA 3MZLA 2P9NC 3F3PA 5EARA 3BG1A 4I79A 2AH1A 1Q47A 3EI3B 2Q7QA 2CN2A 3IJCA 3V9FA 4CI2A 1MG3A 4H5JA 4D6VA 1XIPA 1JOFA 2AGYA 3SJLD 1SQ9A 4L3HD 2Z2NA 3MKQA 3EI3A 1YFQA 4J8GA 3OKWA 2H9LA 2H13A 1PGUA 5FXYA 3RMZD 4A0BB 3ODTA 2YMUA 4EWRA 3OKTA 1VYHC 4TZ4A 5C2VB 2OJYA 4QT8A 3SLED 5EALA 5CXCA 4ZOVA 3I89A 3SMRA 4ES0A 2I0RA 2YNOA 2CE8A 4ERYA 5EAPA 4O3UB 5C2WB 4PBZA 3DWLC 2P9PC 3J81g 1FWXA 3EWEA 1OLZA 5TEEA 3RFHA 4J0XA 3UVKA 1MDAH 3IJ1A 4ZN4A 3OKYB 5I5IA 5AMSA 2CE9A 2P9KC 2OIZA 4JSXC 1P22A 2CN3A 3I7NA 1B9XA 5EMJB 4NSXA 4YVDA 1TBGA 1N6EA 5GSAA 2G9AA 2HJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7K A;  3UVO A;  2AGW A;  4FA4 D;  3PSL A;  4A0A B;  2CNX A;  1R5M A;  3L4O D;  2IWK A;  3IIY A;  2GC7 A;  2YNP A;  5SXM A;  4L3G D;  4CY1 A;  4A0A A;  5FKT A;  3E0C A;  3KRW B;  4FB1 D;  4X60 B;  4ZOZ A;  5FA5 B;  3CFV A;  3JZH A;  4IMM A;  2UZX B;  2YBA A;  4PXW A;  1XHM A;  3UKR C;  2Z2O A;  3MZK A;  3N0D A;  5HE0 B;  5CXB A;  4J0W A;  2H47 A;  4GQB B;  4J81 A;  1NR0 A;  2H3X A;  2IUV A;  4GQ1 A;  4J84 A;  5IJ7 E;  3A0F A;  3RFG A;  3I7O A;  5CXB B;  4GZ8 A;  1PBY B;  3I7P A;  2OVP B;  3RLM D;  3F3F A;  3SBP A;  5HQG A;  5EAM A;  2QXV A;  5FKQ A;  3VH0 A;  2HKR A;  4A09 A;  3L4M D;  1XKS A;  2B5M A;  3K26 A;  4A08 A;  4CY3 A;  5I5J A;  5HYN B;  3SCY A;  4GM9 A;  2HYE A;  4QRJ A;  3PVW B;  4CY5 A;  3EI4 A;  1U2V C;  2XYI A;  1K32 A;  3JRO A;  4GGC A;  4JXM A;  2IUQ A;  3HFQ A;  4K3J B;  4X61 B;  3EI1 B;  4ERQ A;  1N6F A;  4H5I A;  4A08 B;  5I5M A;  4BL0 A;  5EMK B;  2J56 H;  2XL3 A;  5TDH B;  2B4E A;  4QQE A;  3PE7 A;  2HXC A;  4O3T B;  3SN6 B;  4GQ2 P;  3AL8 A;  3N0E A;  3JPX A;  5HE2 B;  4GM3 A;  4X63 B;  5EMM B;  3I7L A;  3SBR A;  4J8B A;  3EI4 B;  3C75 H;  3JAM g;  3AL8 B;  5HE3 B;  3F3G A;  3SHF A;  4GGD A;  4LG8 A;  5B4W A;  4CI8 A;  4J87 A;  3GRE A;  4E54 A;  3C5M A;  3NVN A;  4Y5R D;  2AH0 A;  2HES X;  2BBK H;  2H6Q A;  3BG0 A;  3ORV D;  1JMZ B;  1TYQ C;  3OW8 A;  1GOT B;  2H6N A;  3RRM C;  4J79 A;  4CZV A;  4JSN C;  5TEF A;  4ERZ A;  4JSP C;  4L9O A;  3IKO A;  2H9N A;  2H6K A;  5C9Z B;  4FAN D;  2AQ5 A;  3OL2 A;  2CO0 A;  4PC0 A;  5IT9 g;  3FRX A;  2IWF A;  4ZOY A;  4PSX B;  2H9M A;  5K1C C;  4FA1 D;  2OVQ B;  1PEV A;  1OMW B;  3DM0 A;  5TF2 A;  4FA9 D;  3V5W B;  1RI6 A;  4CI3 A;  3CFS B;  3FGB A;  3UVL A;  2I3S A;  3JZN A;  4GGA A;  1NEX B;  1L0Q A;  3I8E A;  4U7A A;  3UR4 A;  2O9K A;  2I3T A;  2H68 A;  2J55 H;  5EML B;  4PBY A;  3SBQ A;  4CY2 A;  3J80 g;  3P4F A;  4QL1 A;  4A09 B;  3SWS D;  5H17 A;  3W15 A;  5KDO B;  4G56 B;  4A7J A;  5A2Q g;  3RSE C;  1A0R B;  2P9U C;  3AFC A;  2IUR A;  3RN0 D;  4AOW A;  4AEZ A;  1B9Y A;  2P9L C;  2IAA A;  5JWZ A;  5CYK A;  2PBI B;  4OWR A;  4BH6 A;  4E54 B;  4J78 A;  3DSM A;  3VA6 A;  4IA9 A;  4JT6 C;  4CI1 A;  4X3E A;  3VGZ A;  4OZU A;  2PM6 B;  3MXX A;  4LG9 A;  5AFU 3;  3EI1 A;  4N14 A;  3EU7 A;  4FWW A;  3NVX A;  2AGX A;  2B5L A;  4PNK B;  3EI2 B;  2P9I C;  3PXW D;  1MG2 A;  1SQJ A;  4MK0 B;  4O9D A;  4HDJ A;  4JD2 C;  4A2L A;  2TRC B;  1K8K C;  2Z2P A;  2J57 G;  4JSV C;  2I0S A;  3SXT D;  1SHY B;  5IJ8 E;  5GMK n;  3RN1 D;  2CO0 C;  3FM0 A;  1U4C A;  3ZWL B;  4UI9 R;  4CC9 A;  4PSW B;  3NVQ A;  5EM2 A;  4GM8 A;  4FA5 D;  4L1Q D;  5H14 A;  3PXT D;  4O45 A;  3EMH A;  2I0T A;  4A11 B;  3AH8 B;  3ULE C;  4K3I D;  5THA A;  5IGO A;  3C9C A;  2XU7 A;  2PM7 B;  1GP2 B;  3PVU B;  4E5Z B;  5GXI A;  4XYI A;  4J86 A;  4FHL A;  2AGL A;  3IIW A;  4GMB A;  4A11 A;  3OL2 B;  5FKS A;  4D0K A;  3PXS D;  3EG6 A;  2OVR B;  3U4Y A;  5CYK B;  2G99 A;  2B5N A;  2HKM A;  3BWS A;  4XYH A;  4A2M A;  4A0B A;  1QNI A;  3JRP A;  5IGQ A;  2H9P A;  3JZG A;  5FKR A;  3V7D B;  3MKS B;  5FLX g;  3B7F A;  4BUJ C;  5CXC B;  3PSC B;  3I7H A;  1ERJ A;  4J82 A;  3OTT A;  5IC7 A;  4ZOX A;  3IJ0 A;  3UKU C;  3UVM A;  3SVW D;  3KRX B;  1PI6 A;  3GFC A;  3CIK B;  3K27 A;  2W18 A;  5GXH A;  5EM2 B;  1GXR A;  3DXM C;  2BCJ B;  4Y7R A;  4R7A B;  3I8C A;  5K19 A;  2H14 A;  1GG2 B;  2PM9 B;  4XEI C;  2XL2 A;  3UVN A;  3EI2 A;  4JT5 C;  4CZY A;  2PM9 A;  2YNN A;  1JJU B;  5FQD A;  2QC5 A;  3C99 A;  3SFZ A;  2P9S C;  1S4U X;  4CZX A;  4KFM B;  2YB8 B;  2GC4 A;  4FAV D;  2AGZ A;  1JMX B;  4J73 A;  5H1M A;  2OK4 A;  2OK6 A;  3DXK C;  3MMY A;  4O1Q D;  4LGN A;  3I2N A;  3JB9 L;  2MTA H;  2IUP A;  3OKY A;  4J77 A;  2UZY B;  5AJA A;  4U1E I;  5HE1 B;  4ESG A;  3AL9 A;  4Z8L A;  2EBS A;  1N6D A;  2HJB A;  4E5Z A;  2GNQ A;  3MZL A;  2P9N C;  3F3P A;  5EAR A;  3BG1 A;  4I79 A;  2AH1 A;  1Q47 A;  3EI3 B;  2Q7Q A;  2CN2 A;  3IJC A;  3V9F A;  4CI2 A;  1MG3 A;  4H5J A;  4D6V A;  1XIP A;  1JOF A;  2AGY A;  3SJL D;  1SQ9 A;  4L3H D;  2Z2N A;  3MKQ A;  3EI3 A;  1YFQ A;  4J8G A;  3OKW A;  2H9L A;  2H13 A;  1PGU A;  5FXY A;  3RMZ D;  4A0B B;  3ODT A;  2YMU A;  4EWR A;  3OKT A;  1VYH C;  4TZ4 A;  5C2V B;  2OJY A;  4QT8 A;  3SLE D;  5EAL A;  5CXC A;  4ZOV A;  3I89 A;  3SMR A;  4ES0 A;  2I0R A;  2YNO A;  2CE8 A;  4ERY A;  5EAP A;  4O3U B;  5C2W B;  4PBZ A;  3DWL C;  2P9P C;  3J81 g;  1FWX A;  3EWE A;  1OLZ A;  5TEE A;  3RFH A;  4J0X A;  3UVK A;  1MDA H;  3IJ1 A;  4ZN4 A;  3OKY B;  5I5I A;  5AMS A;  2CE9 A;  2P9K C;  2OIZ A;  4JSX C;  1P22 A;  2CN3 A;  3I7N A;  1B9X A;  5EMJ B;  4NSX A;  4YVD A;  1TBG A;  1N6E A;  5GSA A;  2G9A A;  2HJ4 A; 
#chains in the Genus database with same CATH topology
 3I7K A;  3UVO A;  2AGW A;  4FA4 D;  3PSL A;  4A0A B;  1H2X A;  2CNX A;  1R5M A;  3L4O D;  3NIG A;  2IWK A;  3IIY A;  2GC7 A;  2YNP A;  5SXM A;  3MUN A;  3NIF A;  1JTD B;  2XZG A;  4L3G D;  4CY1 A;  4A0A A;  5FKT A;  3E0C A;  3KRW B;  4FB1 D;  4X60 B;  4ZOZ A;  4WK4 A;  3IVM A;  3CFV A;  3JZH A;  5FA5 B;  4IMM A;  2UZX B;  2YBA A;  4PXW A;  1XHM A;  3UKR C;  2Z2O A;  3MZK A;  3N0D A;  3O4J A;  3O4H A;  5HE0 B;  5CXB A;  1C9L A;  4J0W A;  2H47 A;  4GQB B;  4J81 A;  1NR0 A;  2H3X A;  2IUV A;  3GC3 B;  4GQ1 A;  4J84 A;  1VZ3 A;  5IJ7 E;  3A0F A;  2EIB A;  3RFG A;  3I7O A;  3V4P A;  1U8C A;  5CXB B;  4GZ8 A;  1PBY B;  3I7P A;  2OVP B;  3IUL A;  3RLM D;  3EQ9 A;  3F3F A;  3SBP A;  5HQG A;  4NBM A;  5EAM A;  2QXV A;  5FKQ A;  2VDO A;  5E6U A;  3VH0 A;  2HKR A;  3ZE0 A;  4A09 A;  3L4M D;  1XKS A;  3MUO A;  2B5M A;  3K26 A;  4A08 A;  4CY3 A;  1H2W A;  5I5J A;  5HYN B;  2VC2 A;  3VI3 A;  3SCY A;  4GM9 A;  2HYE A;  3K6S A;  4QRJ A;  3OF7 A;  3PVW B;  4CY5 A;  3EI4 A;  5M5V A;  1U2V C;  2XYI A;  1K32 A;  3JRO A;  4GGC A;  4JXM A;  4WK2 A;  2IUQ A;  3HFQ A;  4K3J B;  4Z7Q A;  4X61 B;  3EI1 B;  4ERQ A;  1N6F A;  4H5I A;  4A08 B;  3IUJ A;  5E6R A;  4BL0 A;  5EMK B;  5I5M A;  5HDB A;  2J56 H;  2XL3 A;  5TDH B;  1VE7 A;  2B4E A;  3PE7 A;  4QQE A;  2HXC A;  4O3T B;  4DNU A;  3SN6 B;  4GQ2 P;  3N0E A;  3AL8 A;  1O6G A;  3JPX A;  5HE2 B;  4GM3 A;  4X63 B;  5EMM B;  3I7L A;  3SBR A;  4J8B A;  3EI4 B;  4G55 A;  3C75 H;  3JAM g;  3AL8 B;  5HE3 B;  3F3G A;  3SHF A;  1GOG A;  4GGD A;  4LG8 A;  1C9I A;  5B4W A;  4J87 A;  3GRE A;  3T3M A;  4CI8 A;  4E54 A;  3C5M A;  3NVN A;  2AH0 A;  2HES X;  4Y5R D;  4JHN A;  2BBK H;  2H6Q A;  3BG0 A;  3ORV D;  1JMZ B;  3MVD K;  1TYQ C;  4DNW A;  3OW8 A;  3VI4 A;  1GOT B;  2H6N A;  3RRM C;  4J79 A;  4CZV A;  2EID A;  2QZP A;  4JSN C;  5TEF A;  4AN0 A;  4ERZ A;  4JSP C;  3FCU A;  3IKO A;  4L9O A;  2H9N A;  4BCC A;  2H6K A;  5C9Z B;  4FAN D;  1BPO A;  2AQ5 A;  1YR2 A;  3OL2 A;  4MMZ A;  2CO0 A;  4PC0 A;  5IT9 g;  3FRX A;  2IWF A;  4ZOY A;  4PSX B;  2H9M A;  1E5T A;  5K1C C;  4FA1 D;  2OVQ B;  1PEV A;  1OMW B;  3DM0 A;  5TF2 A;  4FA9 D;  3V5W B;  1RI6 A;  3IUR A;  3CFS B;  4CI3 A;  5E6S A;  1L5G A;  1GOH A;  3FGB A;  1QFS A;  3UVL A;  2I3S A;  3QI0 A;  3JZN A;  4GGA A;  4BP9 A;  1NEX B;  1L0Q A;  3I8E A;  4U7A A;  3UR4 A;  2O9K A;  2I3T A;  5FFG A;  2H68 A;  2J55 H;  5EML B;  1UTC A;  4PBY A;  3SBQ A;  4CY2 A;  2BKL A;  3J80 g;  3P4F A;  4QL1 A;  3ZDX A;  4A09 B;  3SWS D;  5H17 A;  2VDQ A;  3W15 A;  5KDO B;  4G56 B;  4A7J A;  5A2Q g;  3RSE C;  1A0R B;  2P9U C;  3AFC A;  2IUR A;  3RN0 D;  4AOW A;  2WQ8 A;  4AEZ A;  1B9Y A;  2P9L C;  2VDL A;  4AMY A;  2IAA A;  4D9S A;  5JWZ A;  5CYK A;  2PBI B;  4O02 A;  4OWR A;  4BH6 A;  4E54 B;  4J78 A;  3DSM A;  3VA6 A;  1JV2 A;  1H2Z A;  1I2M B;  4IA9 A;  4JT6 C;  4CI1 A;  4X3E A;  3VGZ A;  4OZU A;  2PM6 B;  3MXX A;  4LG9 A;  5M5R A;  5AFU 3;  3EI1 A;  4N14 A;  1TYE A;  3EU7 A;  4FWW A;  3NVX A;  3GD1 I;  2AGX A;  2B5L A;  4PNK B;  3EI2 B;  2P9I C;  3PXW D;  1MG2 A;  1O6F A;  1SQJ A;  4MK0 B;  4O9D A;  4HDJ A;  4JD2 C;  4A2L A;  2TRC B;  1K8K C;  2Z2P A;  2J57 G;  3EQ8 A;  4JSV C;  2I0S A;  4DNV A;  3SXT D;  1SHY B;  5IJ8 E;  5GMK n;  3RN1 D;  2CO0 C;  3FM0 A;  3O4G A;  1U4C A;  3ZWL B;  4UI9 R;  4CC9 A;  3IJE A;  4PSW B;  3NVQ A;  5EM2 A;  4GM8 A;  4FA5 D;  4L1Q D;  2HU7 A;  2XE4 A;  5H14 A;  3PXT D;  4O45 A;  4Z7N A;  3EMH A;  1UOP A;  2I0T A;  4A11 B;  3AH8 B;  3O4I A;  3ULE C;  4L1M A;  4NAA A;  4K3I D;  5THA A;  3IUM A;  5IGO A;  1QFM A;  3C9C A;  2XU7 A;  2PM7 B;  1GP2 B;  3PVU B;  4NC4 A;  4E5Z B;  4XYI A;  5GXI A;  4J86 A;  4FHL A;  2AGL A;  3IIW A;  4GMB A;  4A11 A;  3OL2 B;  5FKS A;  4D0K A;  3PXS D;  3EG6 A;  2OVR B;  5C86 A;  3U4Y A;  4IRZ A;  5CYK B;  2G99 A;  2VDM A;  1T2X A;  2B5N A;  2VDR A;  2HKM A;  3BWS A;  4XYH A;  4A2M A;  4A0B A;  1QNI A;  3JRP A;  5IGQ A;  2H9P A;  3JZG A;  5FKR A;  3V7D B;  3MKS B;  4BCD A;  5FLX g;  3B7F A;  4BUJ C;  5CXC B;  3PSC B;  3I7H A;  2VZ3 A;  4NEN A;  1ERJ A;  4J82 A;  3OTT A;  5IC7 A;  4ZOX A;  1VE6 A;  4WJK A;  3IJ0 A;  4G1M A;  3ZDZ A;  3UKU C;  3UVM A;  3SVW D;  3KRX B;  1PI6 A;  3GFC A;  4AN1 A;  3CIK B;  3K27 A;  2W18 A;  5GXH A;  5EM2 B;  1GXR A;  3DXM C;  1M1X A;  2BCJ B;  4R7A B;  4Y7R A;  3FCS A;  1A12 A;  4MMX A;  3KCI A;  3I8C A;  5K19 A;  5M61 A;  2H14 A;  3K71 A;  1GG2 B;  2PM9 B;  2VZ1 A;  4XEI C;  3ZE1 A;  4UM8 A;  2XL2 A;  3UVN A;  4BP8 A;  3EI2 A;  4JT5 C;  4CZY A;  2PM9 A;  2YNN A;  1JJU B;  5FQD A;  1K3I A;  2QC5 A;  3C99 A;  3SFZ A;  2P9S C;  1S4U X;  4CZX A;  4KFM B;  2YB8 B;  2GC4 A;  5FFO A;  2EIE A;  4FAV D;  2AGZ A;  1JMX B;  2HU8 A;  4J73 A;  5H1M A;  2OK4 A;  2OK6 A;  3DXK C;  3MMY A;  4O1Q D;  5M5S A;  1E8N A;  1E8M A;  3V4V A;  4LGN A;  3I2N A;  3JB9 L;  4AMZ A;  2MTA H;  2IUP A;  3OKY A;  4WK0 A;  4J77 A;  2UZY B;  5AJA A;  4U1E I;  5HE1 B;  3ZDY A;  4ESG A;  3IUN A;  3AL9 A;  2EIC A;  4Z8L A;  2EBS A;  1N6D A;  4UM9 A;  2HJB A;  4E5Z A;  2GNQ A;  3MZL A;  1H2Y A;  1UOQ A;  2P9N C;  3BG1 A;  3F3P A;  3K72 A;  4I79 A;  5EAR A;  2AH1 A;  1Q47 A;  3IUQ A;  3EI3 B;  2Q7Q A;  2VDN A;  4QAM A;  2CN2 A;  3IJC A;  3V9F A;  4MMY A;  1MG3 A;  4CI2 A;  4H5J A;  4D6V A;  1XIP A;  1JOF A;  2AGY A;  3SJL D;  1SQ9 A;  4L3H D;  2Z2N A;  3MKQ A;  3EI3 A;  1YFQ A;  3DDU A;  1VZ2 A;  2VDP A;  4J8G A;  3OKW A;  2H9L A;  2H13 A;  4AX4 A;  1PGU A;  5FXY A;  3RMZ D;  4A0B B;  3ODT A;  2YMU A;  4EWR A;  3OKT A;  1VYH C;  4TZ4 A;  3T3P A;  5C2V B;  2OJY A;  2HU5 A;  4QT8 A;  3SLE D;  5EAL A;  5CXC A;  4JHP C;  4ZOV A;  4BCB A;  4RE6 A;  3I89 A;  3SMR A;  4ES0 A;  1GOF A;  4RE5 A;  2VDK A;  2I0R A;  2YNO A;  4O2W A;  2CE8 A;  1UOO A;  4ERY A;  5EAP A;  4O3U B;  5C2W B;  4PBZ A;  3DWL C;  2P9P C;  4G1E A;  3J81 g;  1FWX A;  5M5U A;  3EWE A;  1OLZ A;  5TEE A;  3RFH A;  3QHY B;  4J0X A;  3UVK A;  1MDA H;  3IJ1 A;  3NID A;  4ZN4 A;  3OKY B;  5I5I A;  5AMS A;  2CE9 A;  2P9K C;  2OIZ A;  4JSX C;  1P22 A;  2CN3 A;  3I7N A;  3ZE2 A;  5M5T A;  4Z7O A;  1B9X A;  5EMJ B;  2JKX A;  2XDW A;  4NSX A;  4YVD A;  5C92 A;  2QR5 A;  1TBG A;  1N6E A;  5GSA A;  2G9A A;  3EQ7 A;  2HJ4 A; 
#chains in the Genus database with same CATH homology
 3I7K A;  3UVO A;  2AGW A;  4FA4 D;  3PSL A;  4A0A B;  2CNX A;  1R5M A;  3L4O D;  2IWK A;  3IIY A;  2GC7 A;  2YNP A;  5SXM A;  4L3G D;  4CY1 A;  4A0A A;  5FKT A;  3E0C A;  3KRW B;  4FB1 D;  4X60 B;  4ZOZ A;  5FA5 B;  3CFV A;  3JZH A;  4IMM A;  2UZX B;  2YBA A;  4PXW A;  1XHM A;  3UKR C;  2Z2O A;  3MZK A;  3N0D A;  5HE0 B;  5CXB A;  4J0W A;  2H47 A;  4GQB B;  4J81 A;  1NR0 A;  2H3X A;  2IUV A;  4GQ1 A;  4J84 A;  5IJ7 E;  3A0F A;  3RFG A;  3I7O A;  5CXB B;  4GZ8 A;  1PBY B;  3I7P A;  2OVP B;  3RLM D;  3F3F A;  3SBP A;  5HQG A;  5EAM A;  2QXV A;  5FKQ A;  3VH0 A;  2HKR A;  4A09 A;  3L4M D;  1XKS A;  2B5M A;  3K26 A;  4A08 A;  4CY3 A;  5I5J A;  5HYN B;  3SCY A;  4GM9 A;  2HYE A;  4QRJ A;  3PVW B;  4CY5 A;  3EI4 A;  1U2V C;  2XYI A;  1K32 A;  3JRO A;  4GGC A;  4JXM A;  2IUQ A;  3HFQ A;  4K3J B;  4X61 B;  3EI1 B;  4ERQ A;  1N6F A;  4H5I A;  4A08 B;  5I5M A;  4BL0 A;  5EMK B;  2J56 H;  2XL3 A;  5TDH B;  2B4E A;  4QQE A;  3PE7 A;  2HXC A;  4O3T B;  3SN6 B;  4GQ2 P;  3AL8 A;  3N0E A;  3JPX A;  5HE2 B;  4GM3 A;  4X63 B;  5EMM B;  3I7L A;  3SBR A;  4J8B A;  3EI4 B;  3C75 H;  3JAM g;  3AL8 B;  5HE3 B;  3F3G A;  3SHF A;  4GGD A;  4LG8 A;  5B4W A;  4CI8 A;  4J87 A;  3GRE A;  4E54 A;  3C5M A;  3NVN A;  4Y5R D;  2AH0 A;  2HES X;  2BBK H;  2H6Q A;  3BG0 A;  3ORV D;  1JMZ B;  1TYQ C;  3OW8 A;  1GOT B;  2H6N A;  3RRM C;  4J79 A;  4CZV A;  4JSN C;  5TEF A;  4ERZ A;  4JSP C;  4L9O A;  3IKO A;  2H9N A;  2H6K A;  5C9Z B;  4FAN D;  2AQ5 A;  3OL2 A;  2CO0 A;  4PC0 A;  5IT9 g;  3FRX A;  2IWF A;  4ZOY A;  4PSX B;  2H9M A;  5K1C C;  4FA1 D;  2OVQ B;  1PEV A;  1OMW B;  3DM0 A;  5TF2 A;  4FA9 D;  3V5W B;  1RI6 A;  4CI3 A;  3CFS B;  3FGB A;  3UVL A;  2I3S A;  3JZN A;  4GGA A;  1NEX B;  1L0Q A;  3I8E A;  4U7A A;  3UR4 A;  2O9K A;  2I3T A;  2H68 A;  2J55 H;  5EML B;  4PBY A;  3SBQ A;  4CY2 A;  3J80 g;  3P4F A;  4QL1 A;  4A09 B;  3SWS D;  5H17 A;  3W15 A;  5KDO B;  4G56 B;  4A7J A;  5A2Q g;  3RSE C;  1A0R B;  2P9U C;  3AFC A;  2IUR A;  3RN0 D;  4AOW A;  4AEZ A;  1B9Y A;  2P9L C;  2IAA A;  5JWZ A;  5CYK A;  2PBI B;  4OWR A;  4BH6 A;  4E54 B;  4J78 A;  3DSM A;  3VA6 A;  4IA9 A;  4JT6 C;  4CI1 A;  4X3E A;  3VGZ A;  4OZU A;  2PM6 B;  3MXX A;  4LG9 A;  5AFU 3;  3EI1 A;  4N14 A;  3EU7 A;  4FWW A;  3NVX A;  2AGX A;  2B5L A;  4PNK B;  3EI2 B;  2P9I C;  3PXW D;  1MG2 A;  1SQJ A;  4MK0 B;  4O9D A;  4HDJ A;  4JD2 C;  4A2L A;  2TRC B;  1K8K C;  2Z2P A;  2J57 G;  4JSV C;  2I0S A;  3SXT D;  1SHY B;  5IJ8 E;  5GMK n;  3RN1 D;  2CO0 C;  3FM0 A;  1U4C A;  3ZWL B;  4UI9 R;  4CC9 A;  4PSW B;  3NVQ A;  5EM2 A;  4GM8 A;  4FA5 D;  4L1Q D;  5H14 A;  3PXT D;  4O45 A;  3EMH A;  2I0T A;  4A11 B;  3AH8 B;  3ULE C;  4K3I D;  5THA A;  5IGO A;  3C9C A;  2XU7 A;  2PM7 B;  1GP2 B;  3PVU B;  4E5Z B;  5GXI A;  4XYI A;  4J86 A;  4FHL A;  2AGL A;  3IIW A;  4GMB A;  4A11 A;  3OL2 B;  5FKS A;  4D0K A;  3PXS D;  3EG6 A;  2OVR B;  3U4Y A;  5CYK B;  2G99 A;  2B5N A;  2HKM A;  3BWS A;  4XYH A;  4A2M A;  4A0B A;  1QNI A;  3JRP A;  5IGQ A;  2H9P A;  3JZG A;  5FKR A;  3V7D B;  3MKS B;  5FLX g;  3B7F A;  4BUJ C;  5CXC B;  3PSC B;  3I7H A;  1ERJ A;  4J82 A;  3OTT A;  5IC7 A;  4ZOX A;  3IJ0 A;  3UKU C;  3UVM A;  3SVW D;  3KRX B;  1PI6 A;  3GFC A;  3CIK B;  3K27 A;  2W18 A;  5GXH A;  5EM2 B;  1GXR A;  3DXM C;  2BCJ B;  4Y7R A;  4R7A B;  3I8C A;  5K19 A;  2H14 A;  1GG2 B;  2PM9 B;  4XEI C;  2XL2 A;  3UVN A;  3EI2 A;  4JT5 C;  4CZY A;  2PM9 A;  2YNN A;  1JJU B;  5FQD A;  2QC5 A;  3C99 A;  3SFZ A;  2P9S C;  1S4U X;  4CZX A;  4KFM B;  2YB8 B;  2GC4 A;  4FAV D;  2AGZ A;  1JMX B;  4J73 A;  5H1M A;  2OK4 A;  2OK6 A;  3DXK C;  3MMY A;  4O1Q D;  4LGN A;  3I2N A;  3JB9 L;  2MTA H;  2IUP A;  3OKY A;  4J77 A;  2UZY B;  5AJA A;  4U1E I;  5HE1 B;  4ESG A;  3AL9 A;  4Z8L A;  2EBS A;  1N6D A;  2HJB A;  4E5Z A;  2GNQ A;  3MZL A;  2P9N C;  3F3P A;  5EAR A;  3BG1 A;  4I79 A;  2AH1 A;  1Q47 A;  3EI3 B;  2Q7Q A;  2CN2 A;  3IJC A;  3V9F A;  4CI2 A;  1MG3 A;  4H5J A;  4D6V A;  1XIP A;  1JOF A;  2AGY A;  3SJL D;  1SQ9 A;  4L3H D;  2Z2N A;  3MKQ A;  3EI3 A;  1YFQ A;  4J8G A;  3OKW A;  2H9L A;  2H13 A;  1PGU A;  5FXY A;  3RMZ D;  4A0B B;  3ODT A;  2YMU A;  4EWR A;  3OKT A;  1VYH C;  4TZ4 A;  5C2V B;  2OJY A;  4QT8 A;  3SLE D;  5EAL A;  5CXC A;  4ZOV A;  3I89 A;  3SMR A;  4ES0 A;  2I0R A;  2YNO A;  2CE8 A;  4ERY A;  5EAP A;  4O3U B;  5C2W B;  4PBZ A;  3DWL C;  2P9P C;  3J81 g;  1FWX A;  3EWE A;  1OLZ A;  5TEE A;  3RFH A;  4J0X A;  3UVK A;  1MDA H;  3IJ1 A;  4ZN4 A;  3OKY B;  5I5I A;  5AMS A;  2CE9 A;  2P9K C;  2OIZ A;  4JSX C;  1P22 A;  2CN3 A;  3I7N A;  1B9X A;  5EMJ B;  4NSX A;  4YVD A;  1TBG A;  1N6E A;  5GSA A;  2G9A A;  2HJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...