4D0KA

Complex of chaetomium thermophilum pan2 (wd40-cs1) with pan3 (c-term)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
345
structure length
329
Chain Sequence
MDADWDEVTRIAYPAPGTFPRPATAVAFDPIAELLWAGFDRGRVCSFYGRDLTRYTAFKIQPASEGPVRQFLFHDKGVIVLGTRSVHMAMRRGPALWNIRHENMKDLRCMSFTSKGTQEIIVAGWQDTMLVIDVLKGDIIKQIPAQHHYSIMKKSRYICAATKTGSVDLIDPLSFKIVRSWQAHASYINDMDAQNDFIVTCGGSYMLDPYVNVFDLKNMASMKPMPFPPLAAHVRLHPRMLTTAIVTSQHGQMHVVDIMNPNSSTVRYANISSYVKLFEIAPSGEALVIGDADCNIHLWGSPTKIHFTDMAIPIELPEPVLDWSETPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Gene regulation
molecule keywords A-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
total genus 66
structure length 329
sequence length 345
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4d0kA01
1GG2B 4G56B 4E5ZB 3K26A 5CXBB 3IIYA 2AH1A 3PXTD 1PI6A 4YVDA 4CY3A 3FRXA 3IJ1A 1JJUB 4FAVD 4ERZA 2P9SC 5K19A 1N6FA 2YBAA 3RLMD 4O3TB 2OK4A 1TYQC 1JMZB 3DSMA 4CI3A 5EMMB 4JT5C 4FA4D 2H68A 3F3FA 4D6VA 5EM2B 4A09B 3DXMC 4IMMA 3BG0A 5FKSA 2P9PC 4ZN4A 2I0RA 2I0SA 2H9PA 5IGQA 2I3TA 3E0CA 3JPXA 5IGOA 4J87A 4FA9D 5C2WB 3RFGA 2AGYA 2HJ4A 3K27A 2TRCB 1N6DA 4E54A 2H6NA 4U7AA 5A2Qg 1A0RB 4BH6A 2B5NA 1K32A 1P22A 2J56H 3UKRC 3PXWD 2QC5A 2OK6A 1SHYB 2IWKA 3RFHA 1TBGA 3L4OD 5EM2A 5IJ8E 2YMUA 2IAAA 2Z2OA 5FKRA 3EI3B 3V5WB 2IUPA 2H14A 3DXKC 2H47A 4A0AB 2BBKH 4GGCA 5AMSA 3SFZA 4CI8A 4QT8A 3UVNA 3N0DA 4TZ4A 5EARA 5KDOB 5TF2A 3SN6B 3SXTD 3OKYA 3CIKB 4PNKB 4GM8A 5FA5B 3SWSD 3L4MD 2PM9A 3ODTA 3OTTA 4QQEA 3I2NA 5CXCA 2B4EA 2H9LA 1JOFA 5THAA 2OJYA 2CO0C 3U4YA 2XYIA 3PVWB 4LG8A 3UVMA 4A0AA 1NEXB 3P4FA 4QL1A 4A11A 3FGBA 5CXCB 2GNQA 3EWEA 4K3ID 3FM0A 2UZYB 1S4UX 4JT6C 5IC7A 3IIWA 3RMZD 4XYHA 4JD2C 3VH0A 4GZ8A 4A2LA 3ULEC 3W15A 3ORVD 3JAMg 4IA9A 4O1QD 4FA5D 4Z8LA 2UZXB 4H5JA 4Y7RA 3AH8B 4J0XA 2AGLA 3UR4A 5C9ZB 4JXMA 3KRXB 5FKTA 3OKTA 5EALA 4O45A 5HE0B 4GM9A 3C9CA 3KRWB 4A11B 4ESGA 1FWXA 3EMHA 4A09A 3JB9L 5GXHA 3UKUC 5FXYA 4EWRA 3OL2B 3PVUB 2XL2A 4I79A 4J77A 4GQ1A 1B9XA 3GREA 3CFVA 1QNIA 3MKSB 4O9DA 5H17A 3NVNA 2I3SA 2HYEA 1OMWB 5EMLB 4X61B 4U1EI 3AL9A 1PGUA 4Y5RD 2B5LA 4PXWA 2P9IC 2YNNA 2PM6B 5B4WA 5JWZA 5TDHB 2CN2A 2OIZA 3I89A 3ZWLB 4FB1D 4X3EA 3MXXA 2HKRA 3I7NA 2OVQB 3EI3A 4JSPC 4X63B 3SBPA 3HFQA 2HKMA 2CN3A 4CC9A 5CYKB 4NSXA 1PEVA 4CI2A 2H13A 5GSAA 3SCYA 2W18A 4FHLA 4OZUA 4J8BA 2Z2PA 2PM7B 2CNXA 4CZVA 5FLXg 4CZXA 2QXVA 4A0BB 1GXRA 1RI6A 2AGWA 5H14A 2Z2NA 2GC4A 3RSEC 5HE3B 3RRMC 3I7OA 3JZHA 2H6KA 3NVXA 2B5MA 2G99A 2O9KA 4PC0A 4ERYA 4J79A 5I5IA 4MK0B 3EI4B 1K8KC 4XYIA 3BG1A 2J57G 5K1CC 4JSVC 3PE7A 4PBZA 1B9YA 3IJ0A 2EBSA 4CY5A 2MTAH 1SQ9A 4ZOXA 3EU7A 2H3XA 2G9AA 3NVQA 3C5MA 3V9FA 5I5MA 2BCJB 1MG2A 3JRPA 3JZGA 1OLZA 4XEIC 3JROA 1MDAH 2OVRB 1GP2B 3SMRA 4FAND 4FWWA 3MZLA 3BWSA 4GMBA 4QRJA 2CE9A 4FA1D 1MG3A 5IT9g 1PBYB 2HJBA 4BL0A 5I5JA 3F3GA 4CI1A 3OL2A 4KFMB 5EAPA 1XHMA 4L3GD 3SBQA 2P9UC 3I7LA 5H1MA 5EAMA 3I8EA 4JSXC 4E5ZA 2I0TA 2Q7QA 3SJLD 2J55H 4J73A 4J86A 3MKQA 2HESX 5CYKA 1U2VC 2AH0A 4L3HD 4J8GA 3RN1D 2IWFA 4J81A 5HE1B 3B7FA 2AQ5A 3V7DB 1NR0A 4GGAA 1Q47A 3EI2A 4PSXB 1YFQA 4K3JB 4ZOVA 2IUQA 3OKWA 3SHFA 5FQDA 2AGZA 3DM0A 2PBIB 3EI1B 3EI2B 4A0BA 4D0KA 2YNPA 3MZKA 3I7HA 4UI9R 4HDJA 3AL8A 2CE8A 3SVWD 4ERQA 2H6QA 4LG9A 1L0QA 5GMKn 4BUJC 2YNOA 2YB8B 2H9NA 1XIPA 3UVLA 5IJ7E 4J84A 5TEFA 1VYHC 3OW8A 4R7AB 3C99A 3J80g 2P9KC 4E54B 5HE2B 3DWLC 1JMXB 4GGDA 4PBYA 5CXBA 5AFU3 4CY1A 1N6EA 4ZOZA 3C75H 2P9LC 2PM9B 3I7PA 3N0EA 2IUVA 5HQGA 2XL3A 4ZOYA 4H5IA 3I8CA 3PSCB 1U4CA 3AFCA 4JSNC 4O3UB 4A2MA 1SQJA 4A08B 2GC7A 5EMKB 2XU7A 4OWRA 3F3PA 3PSLA 5FKQA 5AJAA 5GXIA 4A7JA 3VGZA 4N14A 4L1QD 4CZYA 4ES0A 4A08A 3VA6A 4L9OA 2AGXA 4GQBB 3EI4A 3GFCA 3AL8B 5HYNB 5SXMA 3OKYB 3J81g 4CY2A 3CFSB 3EI1A 3JZNA 1ERJA 1XKSA 4J82A 3UVKA 1R5MA 3IKOA 3PXSD 4PSWB 5TEEA 4GM3A 5EMJB 3RN0D 3A0FA 3IJCA 5C2VB 3I7KA 2P9NC 3MMYA 4GQ2P 3EG6A 1GOTB 2HXCA 3SBRA 4X60B 2CO0A 2IURA 4J78A 3SLED 4AOWA 4J0WA 2H9MA 4LGNA 3UVOA 4AEZA 2OVPB
chains in the Genus database with same CATH superfamily
1GG2B 4G56B 4E5ZB 3K26A 4D9SA 5CXBB 3IIYA 2AH1A 3PXTD 1PI6A 3IUJA 1O6GA 4YVDA 4CY3A 1H2WA 3FRXA 3IJ1A 5E6SA 1JJUB 2VDLA 4FAVD 1H2ZA 4ERZA 2P9SC 5K19A 1N6FA 2YBAA 3O4JA 4O3TB 3RLMD 2OK4A 3IURA 4BCCA 1TYQC 1JMZB 3DSMA 4NAAA 4CI3A 5EMMB 4JT5C 4FA4D 2H68A 3F3FA 4D6VA 5EM2B 4A09B 1K3IA 4G1MA 3K72A 3DXMC 1U8CA 3BG0A 4IMMA 5FKSA 3T3MA 2P9PC 4ZN4A 2I0RA 3VI4A 2I0SA 2H9PA 2QZPA 5IGQA 1JTDB 2I3TA 3E0CA 3ZDXA 3JPXA 5IGOA 3MVDK 4J87A 4FA9D 5C2WB 3RFGA 2AGYA 2HJ4A 3K27A 2TRCB 3EQ8A 1N6DA 4E54A 2H6NA 1I2MB 4U7AA 1A0RB 5A2Qg 4BH6A 2B5NA 1K32A 1P22A 2J56H 3UKRC 3PXWD 4BCBA 2QC5A 2OK6A 1SHYB 2IWKA 3RFHA 1TBGA 3L4OD 5EM2A 5IJ8E 2YMUA 2VDQA 2IAAA 2Z2OA 5FKRA 3EI3B 3V5WB 2IUPA 2H14A 3DXKC 2H47A 5M5VA 4A0AB 2BBKH 4GGCA 5AMSA 3SFZA 1UOOA 4AN1A 4CI8A 4QT8A 1H2XA 3UVNA 3N0DA 4TZ4A 5EARA 5KDOB 5TF2A 3SN6B 4JHPC 3SXTD 3OKYA 3CIKB 4PNKB 4GM8A 5FA5B 3IUNA 2VDPA 3VI3A 3SWSD 3L4MD 2PM9A 3ODTA 3OTTA 4QQEA 3I2NA 1L5GA 5CXCA 2B4EA 2H9LA 1JOFA 2VDNA 5THAA 2OJYA 2CO0C 3U4YA 2XYIA 3PVWB 1QFSA 4LG8A 3UVMA 4AX4A 4A0AA 1NEXB 3P4FA 4G55A 4QL1A 4A11A 3FGBA 1VE7A 5CXCB 2GNQA 3EWEA 3GD1I 4K3ID 3ZE0A 3FM0A 2UZYB 1S4UX 4JT6C 5E6RA 5IC7A 3IIWA 3RMZD 3T3PA 4XYHA 1GOHA 4JD2C 1YR2A 4O02A 4GZ8A 3VH0A 4A2LA 3ULEC 3W15A 3ORVD 3JAMg 4IA9A 4O1QD 4FA5D 4Z8LA 2UZXB 4H5JA 1TYEA 4Y7RA 2EIEA 3AH8B 4J0XA 2AGLA 3UR4A 5C9ZB 4JXMA 3KRXB 5FKTA 3OKTA 4AMYA 3ZE2A 5EALA 4O45A 5HE0B 4GM9A 3C9CA 3KRWB 5M5TA 4A11B 2QR5A 4ESGA 1FWXA 3EMHA 2EIDA 4A09A 3JB9L 4NENA 3KCIA 5GXHA 3UKUC 5FXYA 4EWRA 3OL2B 3PVUB 2VDMA 2XL2A 4I79A 2XE4A 4J77A 4GQ1A 1B9XA 3EQ7A 3MUOA 4BP8A 3GREA 3CFVA 1QNIA 3MKSB 4O9DA 4RE6A 5H17A 3NVNA 2WQ8A 2I3SA 2HYEA 1OMWB 5M5RA 5EMLB 4X61B 4U1EI 3AL9A 1PGUA 4Y5RD 2B5LA 4PXWA 2P9IC 2YNNA 2PM6B 5B4WA 5JWZA 5TDHB 4L1MA 2CN2A 2OIZA 3I89A 3ZWLB 4FB1D 4X3EA 3MXXA 2HKRA 3I7NA 4JHNA 4AN0A 4MMYA 2VDKA 1C9IA 2OVQB 3EI3A 4JSPC 4G1EA 4WK2A 4X63B 2VZ3A 3SBPA 3HFQA 2HKMA 2CN3A 5FFOA 4CC9A 5CYKB 4NSXA 1PEVA 4CI2A 2H13A 5GSAA 3SCYA 3FCUA 2HU8A 2W18A 1UOPA 4FHLA 4J8BA 4OZUA 2Z2PA 2PM7B 2CNXA 4CZVA 5FLXg 4CZXA 2QXVA 4A0BB 1GXRA 1RI6A 2AGWA 5H14A 2Z2NA 2GC4A 1E8MA 5HE3B 3RSEC 3RRMC 3I7OA 1UOQA 4BCDA 3JZHA 2H6KA 3NVXA 2B5MA 2G99A 2O9KA 4PC0A 4ERYA 4J79A 5I5IA 4MK0B 3EI4B 2HU5A 1K8KC 4XYIA 3IULA 3BG1A 4AMZA 2VDOA 2J57G 5K1CC 4JSVC 3PE7A 4PBZA 1B9YA 3IJ0A 2EBSA 4CY5A 2MTAH 3IUMA 1C9LA 1SQ9A 4ZOXA 3EU7A 2H3XA 2HU7A 2G9AA 2XDWA 3GC3B 3NVQA 4IRZA 3C5MA 4QAMA 3V9FA 1GOGA 4WK0A 5I5MA 2BCJB 1MG2A 3JRPA 3JZGA 1OLZA 4XEIC 3QHYB 3JROA 1MDAH 2OVRB 1GP2B 3SMRA 4FAND 4FWWA 3MZLA 3BWSA 1GOFA 3NIGA 1E8NA 2BKLA 4GMBA 4QRJA 2CE9A 1UTCA 4FA1D 1MG3A 5IT9g 3K71A 1PBYB 2HJBA 1QFMA 4BL0A 5I5JA 3K6SA 4DNUA 3F3GA 4CI1A 3OL2A 4KFMB 5EAPA 1XHMA 4L3GD 3SBQA 2P9UC 4WK4A 3I7LA 5H1MA 5EAMA 3I8EA 4JSXC 4E5ZA 2I0TA 2Q7QA 3SJLD 2J55H 4J73A 4J86A 3MKQA 2HESX 3ZDZA 3FCSA 5CYKA 1U2VC 2AH0A 4L3HD 4J8GA 3RN1D 4RE5A 2IWFA 4J81A 5HE1B 3B7FA 2AQ5A 3V7DB 1NR0A 4GGAA 3V4VA 2EICA 1Q47A 3EI2A 4PSXB 1YFQA 1T2XA 4DNWA 4K3JB 4ZOVA 2IUQA 3IVMA 3OKWA 3SHFA 1A12A 3O4IA 5FQDA 2VZ1A 2AGZA 3DM0A 5HDBA 2PBIB 3EI1B 3IUQA 3EI2B 4D0KA 2YNPA 4A0BA 3MZKA 3I7HA 4NBMA 4UI9R 4HDJA 4O2WA 3AL8A 1JV2A 2CE8A 3SVWD 4ERQA 2H6QA 4LG9A 1L0QA 5GMKn 4BUJC 2YNOA 5C86A 2YB8B 4Z7OA 2H9NA 5M5UA 1XIPA 3UVLA 5IJ7E 4J84A 4UM9A 4NC4A 5TEFA 1VYHC 3OW8A 4R7AB 3C99A 3J80g 2P9KC 3ZDYA 2EIBA 4E54B 4DNVA 5HE2B 4BP9A 3DWLC 1JMXB 1VZ3A 4GGDA 4PBYA 5CXBA 3NIFA 5AFU3 4CY1A 1N6EA 4ZOZA 3C75H 2P9LC 2PM9B 4MMZA 3I7PA 3N0EA 2IUVA 5HQGA 2XL3A 3NIDA 4ZOYA 2JKXA 4H5IA 3ZE1A 3I8CA 3PSCB 1U4CA 3AFCA 4JSNC 4O3UB 4A2MA 4Z7NA 1SQJA 4A08B 2GC7A 5EMKB 2XU7A 1VZ2A 4OWRA 3F3PA 3PSLA 3OF7A 5FKQA 5AJAA 5GXIA 3O4HA 4MMXA 3IJEA 5M61A 3MUNA 4A7JA 3VGZA 4N14A 4L1QD 4CZYA 4ES0A 4A08A 3VA6A 4L9OA 5FFGA 2AGXA 3QI0A 4GQBB 1E5TA 5E6UA 2XZGA 3EI4A 3GFCA 3AL8B 5HYNB 5SXMA 3OKYB 3EQ9A 3J81g 4UM8A 4CY2A 3O4GA 3CFSB 5C92A 3EI1A 3JZNA 2VDRA 1ERJA 1H2YA 1O6FA 1XKSA 4J82A 3UVKA 1R5MA 3IKOA 3PXSD 4PSWB 5TEEA 4GM3A 1M1XA 2VC2A 5EMJB 5M5SA 3RN0D 3A0FA 3IJCA 3V4PA 5C2VB 3I7KA 2P9NC 3MMYA 4WJKA 4GQ2P 4Z7QA 3EG6A 1GOTB 2HXCA 3SBRA 4X60B 2CO0A 2IURA 4J78A 3SLED 4AOWA 4J0WA 2H9MA 4LGNA 3UVOA 4AEZA 1BPOA 2OVPB 1VE6A 3DDUA
chains in the Genus database with same CATH topology
1GG2B 4G56B 4E5ZB 3K26A 5CXBB 3IIYA 2AH1A 3PXTD 1PI6A 4YVDA 4CY3A 3FRXA 3IJ1A 1JJUB 4FAVD 4ERZA 2P9SC 5K19A 1N6FA 2YBAA 3RLMD 4O3TB 2OK4A 1TYQC 1JMZB 3DSMA 4CI3A 5EMMB 4JT5C 4FA4D 2H68A 3F3FA 4D6VA 5EM2B 4A09B 3DXMC 4IMMA 3BG0A 5FKSA 2P9PC 4ZN4A 2I0RA 2I0SA 2H9PA 5IGQA 2I3TA 3E0CA 3JPXA 5IGOA 4J87A 4FA9D 5C2WB 3RFGA 2AGYA 2HJ4A 3K27A 2TRCB 1N6DA 4E54A 2H6NA 4U7AA 5A2Qg 1A0RB 4BH6A 2B5NA 1K32A 1P22A 2J56H 3UKRC 3PXWD 2QC5A 2OK6A 1SHYB 2IWKA 3RFHA 1TBGA 3L4OD 5EM2A 5IJ8E 2YMUA 2IAAA 2Z2OA 5FKRA 3EI3B 3V5WB 2IUPA 2H14A 3DXKC 2H47A 4A0AB 2BBKH 4GGCA 5AMSA 3SFZA 4CI8A 4QT8A 3UVNA 3N0DA 4TZ4A 5EARA 5KDOB 5TF2A 3SN6B 3SXTD 3OKYA 3CIKB 4PNKB 4GM8A 5FA5B 3SWSD 3L4MD 2PM9A 3ODTA 3OTTA 4QQEA 3I2NA 5CXCA 2B4EA 2H9LA 1JOFA 5THAA 2OJYA 2CO0C 3U4YA 2XYIA 3PVWB 4LG8A 3UVMA 4A0AA 1NEXB 3P4FA 4QL1A 4A11A 3FGBA 5CXCB 2GNQA 3EWEA 4K3ID 3FM0A 2UZYB 1S4UX 4JT6C 5IC7A 3IIWA 3RMZD 4XYHA 4JD2C 3VH0A 4GZ8A 4A2LA 3ULEC 3W15A 3ORVD 3JAMg 4IA9A 4O1QD 4FA5D 4Z8LA 2UZXB 4H5JA 4Y7RA 3AH8B 4J0XA 2AGLA 3UR4A 5C9ZB 4JXMA 3KRXB 5FKTA 3OKTA 5EALA 4O45A 5HE0B 4GM9A 3C9CA 3KRWB 4A11B 4ESGA 1FWXA 3EMHA 4A09A 3JB9L 5GXHA 3UKUC 5FXYA 4EWRA 3OL2B 3PVUB 2XL2A 4I79A 4J77A 4GQ1A 1B9XA 3GREA 3CFVA 1QNIA 3MKSB 4O9DA 5H17A 3NVNA 2I3SA 2HYEA 1OMWB 5EMLB 4X61B 4U1EI 3AL9A 1PGUA 4Y5RD 2B5LA 4PXWA 2P9IC 2YNNA 2PM6B 5B4WA 5JWZA 5TDHB 2CN2A 2OIZA 3I89A 3ZWLB 4FB1D 4X3EA 3MXXA 2HKRA 3I7NA 2OVQB 3EI3A 4JSPC 4X63B 3SBPA 3HFQA 2HKMA 2CN3A 4CC9A 5CYKB 4NSXA 1PEVA 4CI2A 2H13A 5GSAA 3SCYA 2W18A 4FHLA 4OZUA 4J8BA 2Z2PA 2PM7B 2CNXA 4CZVA 5FLXg 4CZXA 2QXVA 4A0BB 1GXRA 1RI6A 2AGWA 5H14A 2Z2NA 2GC4A 3RSEC 5HE3B 3RRMC 3I7OA 3JZHA 2H6KA 3NVXA 2B5MA 2G99A 2O9KA 4PC0A 4ERYA 4J79A 5I5IA 4MK0B 3EI4B 1K8KC 4XYIA 3BG1A 2J57G 5K1CC 4JSVC 3PE7A 4PBZA 1B9YA 3IJ0A 2EBSA 4CY5A 2MTAH 1SQ9A 4ZOXA 3EU7A 2H3XA 2G9AA 3NVQA 3C5MA 3V9FA 5I5MA 2BCJB 1MG2A 3JRPA 3JZGA 1OLZA 4XEIC 3JROA 1MDAH 2OVRB 1GP2B 3SMRA 4FAND 4FWWA 3MZLA 3BWSA 4GMBA 4QRJA 2CE9A 4FA1D 1MG3A 5IT9g 1PBYB 2HJBA 4BL0A 5I5JA 3F3GA 4CI1A 3OL2A 4KFMB 5EAPA 1XHMA 4L3GD 3SBQA 2P9UC 3I7LA 5H1MA 5EAMA 3I8EA 4JSXC 4E5ZA 2I0TA 2Q7QA 3SJLD 2J55H 4J73A 4J86A 3MKQA 2HESX 5CYKA 1U2VC 2AH0A 4L3HD 4J8GA 3RN1D 2IWFA 4J81A 5HE1B 3B7FA 2AQ5A 3V7DB 1NR0A 4GGAA 1Q47A 3EI2A 4PSXB 1YFQA 4K3JB 4ZOVA 2IUQA 3OKWA 3SHFA 5FQDA 2AGZA 3DM0A 2PBIB 3EI1B 3EI2B 4A0BA 4D0KA 2YNPA 3MZKA 3I7HA 4UI9R 4HDJA 3AL8A 2CE8A 3SVWD 4ERQA 2H6QA 4LG9A 1L0QA 5GMKn 4BUJC 2YNOA 2YB8B 2H9NA 1XIPA 3UVLA 5IJ7E 4J84A 5TEFA 1VYHC 3OW8A 4R7AB 3C99A 3J80g 2P9KC 4E54B 5HE2B 3DWLC 1JMXB 4GGDA 4PBYA 5CXBA 5AFU3 4CY1A 1N6EA 4ZOZA 3C75H 2P9LC 2PM9B 3I7PA 3N0EA 2IUVA 5HQGA 2XL3A 4ZOYA 4H5IA 3I8CA 3PSCB 1U4CA 3AFCA 4JSNC 4O3UB 4A2MA 1SQJA 4A08B 2GC7A 5EMKB 2XU7A 4OWRA 3F3PA 3PSLA 5FKQA 5AJAA 5GXIA 4A7JA 3VGZA 4N14A 4L1QD 4CZYA 4ES0A 4A08A 3VA6A 4L9OA 2AGXA 4GQBB 3EI4A 3GFCA 3AL8B 5HYNB 5SXMA 3OKYB 3J81g 4CY2A 3CFSB 3EI1A 3JZNA 1ERJA 1XKSA 4J82A 3UVKA 1R5MA 3IKOA 3PXSD 4PSWB 5TEEA 4GM3A 5EMJB 3RN0D 3A0FA 3IJCA 5C2VB 3I7KA 2P9NC 3MMYA 4GQ2P 3EG6A 1GOTB 2HXCA 3SBRA 4X60B 2CO0A 2IURA 4J78A 3SLED 4AOWA 4J0WA 2H9MA 4LGNA 3UVOA 4AEZA 2OVPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GG2 B;  4G56 B;  4E5Z B;  3K26 A;  5CXB B;  3IIY A;  2AH1 A;  3PXT D;  1PI6 A;  4YVD A;  4CY3 A;  3FRX A;  3IJ1 A;  1JJU B;  4FAV D;  4ERZ A;  2P9S C;  5K19 A;  1N6F A;  2YBA A;  3RLM D;  4O3T B;  2OK4 A;  1TYQ C;  1JMZ B;  3DSM A;  4CI3 A;  5EMM B;  4JT5 C;  4FA4 D;  2H68 A;  3F3F A;  4D6V A;  5EM2 B;  4A09 B;  3DXM C;  4IMM A;  3BG0 A;  5FKS A;  2P9P C;  4ZN4 A;  2I0R A;  2I0S A;  2H9P A;  5IGQ A;  2I3T A;  3E0C A;  3JPX A;  5IGO A;  4J87 A;  4FA9 D;  5C2W B;  3RFG A;  2AGY A;  2HJ4 A;  3K27 A;  2TRC B;  1N6D A;  4E54 A;  2H6N A;  4U7A A;  5A2Q g;  1A0R B;  4BH6 A;  2B5N A;  1K32 A;  1P22 A;  2J56 H;  3UKR C;  3PXW D;  2QC5 A;  2OK6 A;  1SHY B;  2IWK A;  3RFH A;  1TBG A;  3L4O D;  5EM2 A;  5IJ8 E;  2YMU A;  2IAA A;  2Z2O A;  5FKR A;  3EI3 B;  3V5W B;  2IUP A;  2H14 A;  3DXK C;  2H47 A;  4A0A B;  2BBK H;  4GGC A;  5AMS A;  3SFZ A;  4CI8 A;  4QT8 A;  3UVN A;  3N0D A;  4TZ4 A;  5EAR A;  5KDO B;  5TF2 A;  3SN6 B;  3SXT D;  3OKY A;  3CIK B;  4PNK B;  4GM8 A;  5FA5 B;  3SWS D;  3L4M D;  2PM9 A;  3ODT A;  3OTT A;  4QQE A;  3I2N A;  5CXC A;  2B4E A;  2H9L A;  1JOF A;  5THA A;  2OJY A;  2CO0 C;  3U4Y A;  2XYI A;  3PVW B;  4LG8 A;  3UVM A;  4A0A A;  1NEX B;  3P4F A;  4QL1 A;  4A11 A;  3FGB A;  5CXC B;  2GNQ A;  3EWE A;  4K3I D;  3FM0 A;  2UZY B;  1S4U X;  4JT6 C;  5IC7 A;  3IIW A;  3RMZ D;  4XYH A;  4JD2 C;  3VH0 A;  4GZ8 A;  4A2L A;  3ULE C;  3W15 A;  3ORV D;  3JAM g;  4IA9 A;  4O1Q D;  4FA5 D;  4Z8L A;  2UZX B;  4H5J A;  4Y7R A;  3AH8 B;  4J0X A;  2AGL A;  3UR4 A;  5C9Z B;  4JXM A;  3KRX B;  5FKT A;  3OKT A;  5EAL A;  4O45 A;  5HE0 B;  4GM9 A;  3C9C A;  3KRW B;  4A11 B;  4ESG A;  1FWX A;  3EMH A;  4A09 A;  3JB9 L;  5GXH A;  3UKU C;  5FXY A;  4EWR A;  3OL2 B;  3PVU B;  2XL2 A;  4I79 A;  4J77 A;  4GQ1 A;  1B9X A;  3GRE A;  3CFV A;  1QNI A;  3MKS B;  4O9D A;  5H17 A;  3NVN A;  2I3S A;  2HYE A;  1OMW B;  5EML B;  4X61 B;  4U1E I;  3AL9 A;  1PGU A;  4Y5R D;  2B5L A;  4PXW A;  2P9I C;  2YNN A;  2PM6 B;  5B4W A;  5JWZ A;  5TDH B;  2CN2 A;  2OIZ A;  3I89 A;  3ZWL B;  4FB1 D;  4X3E A;  3MXX A;  2HKR A;  3I7N A;  2OVQ B;  3EI3 A;  4JSP C;  4X63 B;  3SBP A;  3HFQ A;  2HKM A;  2CN3 A;  4CC9 A;  5CYK B;  4NSX A;  1PEV A;  4CI2 A;  2H13 A;  5GSA A;  3SCY A;  2W18 A;  4FHL A;  4OZU A;  4J8B A;  2Z2P A;  2PM7 B;  2CNX A;  4CZV A;  5FLX g;  4CZX A;  2QXV A;  4A0B B;  1GXR A;  1RI6 A;  2AGW A;  5H14 A;  2Z2N A;  2GC4 A;  3RSE C;  5HE3 B;  3RRM C;  3I7O A;  3JZH A;  2H6K A;  3NVX A;  2B5M A;  2G99 A;  2O9K A;  4PC0 A;  4ERY A;  4J79 A;  5I5I A;  4MK0 B;  3EI4 B;  1K8K C;  4XYI A;  3BG1 A;  2J57 G;  5K1C C;  4JSV C;  3PE7 A;  4PBZ A;  1B9Y A;  3IJ0 A;  2EBS A;  4CY5 A;  2MTA H;  1SQ9 A;  4ZOX A;  3EU7 A;  2H3X A;  2G9A A;  3NVQ A;  3C5M A;  3V9F A;  5I5M A;  2BCJ B;  1MG2 A;  3JRP A;  3JZG A;  1OLZ A;  4XEI C;  3JRO A;  1MDA H;  2OVR B;  1GP2 B;  3SMR A;  4FAN D;  4FWW A;  3MZL A;  3BWS A;  4GMB A;  4QRJ A;  2CE9 A;  4FA1 D;  1MG3 A;  5IT9 g;  1PBY B;  2HJB A;  4BL0 A;  5I5J A;  3F3G A;  4CI1 A;  3OL2 A;  4KFM B;  5EAP A;  1XHM A;  4L3G D;  3SBQ A;  2P9U C;  3I7L A;  5H1M A;  5EAM A;  3I8E A;  4JSX C;  4E5Z A;  2I0T A;  2Q7Q A;  3SJL D;  2J55 H;  4J73 A;  4J86 A;  3MKQ A;  2HES X;  5CYK A;  1U2V C;  2AH0 A;  4L3H D;  4J8G A;  3RN1 D;  2IWF A;  4J81 A;  5HE1 B;  3B7F A;  2AQ5 A;  3V7D B;  1NR0 A;  4GGA A;  1Q47 A;  3EI2 A;  4PSX B;  1YFQ A;  4K3J B;  4ZOV A;  2IUQ A;  3OKW A;  3SHF A;  5FQD A;  2AGZ A;  3DM0 A;  2PBI B;  3EI1 B;  3EI2 B;  4A0B A;  4D0K A;  2YNP A;  3MZK A;  3I7H A;  4UI9 R;  4HDJ A;  3AL8 A;  2CE8 A;  3SVW D;  4ERQ A;  2H6Q A;  4LG9 A;  1L0Q A;  5GMK n;  4BUJ C;  2YNO A;  2YB8 B;  2H9N A;  1XIP A;  3UVL A;  5IJ7 E;  4J84 A;  5TEF A;  1VYH C;  3OW8 A;  4R7A B;  3C99 A;  3J80 g;  2P9K C;  4E54 B;  5HE2 B;  3DWL C;  1JMX B;  4GGD A;  4PBY A;  5CXB A;  5AFU 3;  4CY1 A;  1N6E A;  4ZOZ A;  3C75 H;  2P9L C;  2PM9 B;  3I7P A;  3N0E A;  2IUV A;  5HQG A;  2XL3 A;  4ZOY A;  4H5I A;  3I8C A;  3PSC B;  1U4C A;  3AFC A;  4JSN C;  4O3U B;  4A2M A;  1SQJ A;  4A08 B;  2GC7 A;  5EMK B;  2XU7 A;  4OWR A;  3F3P A;  3PSL A;  5FKQ A;  5AJA A;  5GXI A;  4A7J A;  3VGZ A;  4N14 A;  4L1Q D;  4CZY A;  4ES0 A;  4A08 A;  3VA6 A;  4L9O A;  2AGX A;  4GQB B;  3EI4 A;  3GFC A;  3AL8 B;  5HYN B;  5SXM A;  3OKY B;  3J81 g;  4CY2 A;  3CFS B;  3EI1 A;  3JZN A;  1ERJ A;  1XKS A;  4J82 A;  3UVK A;  1R5M A;  3IKO A;  3PXS D;  4PSW B;  5TEE A;  4GM3 A;  5EMJ B;  3RN0 D;  3A0F A;  3IJC A;  5C2V B;  3I7K A;  2P9N C;  3MMY A;  4GQ2 P;  3EG6 A;  1GOT B;  2HXC A;  3SBR A;  4X60 B;  2CO0 A;  2IUR A;  4J78 A;  3SLE D;  4AOW A;  4J0W A;  2H9M A;  4LGN A;  3UVO A;  4AEZ A;  2OVP B; 
#chains in the Genus database with same CATH topology
 1GG2 B;  4G56 B;  4E5Z B;  3K26 A;  4D9S A;  5CXB B;  3IIY A;  2AH1 A;  3PXT D;  1PI6 A;  3IUJ A;  1O6G A;  4YVD A;  4CY3 A;  1H2W A;  3FRX A;  3IJ1 A;  5E6S A;  1JJU B;  2VDL A;  4FAV D;  1H2Z A;  4ERZ A;  2P9S C;  5K19 A;  1N6F A;  2YBA A;  3O4J A;  4O3T B;  3RLM D;  2OK4 A;  3IUR A;  4BCC A;  1TYQ C;  1JMZ B;  3DSM A;  4NAA A;  4CI3 A;  5EMM B;  4JT5 C;  4FA4 D;  2H68 A;  3F3F A;  4D6V A;  5EM2 B;  4A09 B;  1K3I A;  4G1M A;  3K72 A;  3DXM C;  1U8C A;  3BG0 A;  4IMM A;  5FKS A;  3T3M A;  2P9P C;  4ZN4 A;  2I0R A;  3VI4 A;  2I0S A;  2H9P A;  2QZP A;  5IGQ A;  1JTD B;  2I3T A;  3E0C A;  3ZDX A;  3JPX A;  5IGO A;  3MVD K;  4J87 A;  4FA9 D;  5C2W B;  3RFG A;  2AGY A;  2HJ4 A;  3K27 A;  2TRC B;  3EQ8 A;  1N6D A;  4E54 A;  2H6N A;  1I2M B;  4U7A A;  1A0R B;  5A2Q g;  4BH6 A;  2B5N A;  1K32 A;  1P22 A;  2J56 H;  3UKR C;  3PXW D;  4BCB A;  2QC5 A;  2OK6 A;  1SHY B;  2IWK A;  3RFH A;  1TBG A;  3L4O D;  5EM2 A;  5IJ8 E;  2YMU A;  2VDQ A;  2IAA A;  2Z2O A;  5FKR A;  3EI3 B;  3V5W B;  2IUP A;  2H14 A;  3DXK C;  2H47 A;  5M5V A;  4A0A B;  2BBK H;  4GGC A;  5AMS A;  3SFZ A;  1UOO A;  4AN1 A;  4CI8 A;  4QT8 A;  1H2X A;  3UVN A;  3N0D A;  4TZ4 A;  5EAR A;  5KDO B;  5TF2 A;  3SN6 B;  4JHP C;  3SXT D;  3OKY A;  3CIK B;  4PNK B;  4GM8 A;  5FA5 B;  3IUN A;  2VDP A;  3VI3 A;  3SWS D;  3L4M D;  2PM9 A;  3ODT A;  3OTT A;  4QQE A;  3I2N A;  1L5G A;  5CXC A;  2B4E A;  2H9L A;  1JOF A;  2VDN A;  5THA A;  2OJY A;  2CO0 C;  3U4Y A;  2XYI A;  3PVW B;  1QFS A;  4LG8 A;  3UVM A;  4AX4 A;  4A0A A;  1NEX B;  3P4F A;  4G55 A;  4QL1 A;  4A11 A;  3FGB A;  1VE7 A;  5CXC B;  2GNQ A;  3EWE A;  3GD1 I;  4K3I D;  3ZE0 A;  3FM0 A;  2UZY B;  1S4U X;  4JT6 C;  5E6R A;  5IC7 A;  3IIW A;  3RMZ D;  3T3P A;  4XYH A;  1GOH A;  4JD2 C;  1YR2 A;  4O02 A;  4GZ8 A;  3VH0 A;  4A2L A;  3ULE C;  3W15 A;  3ORV D;  3JAM g;  4IA9 A;  4O1Q D;  4FA5 D;  4Z8L A;  2UZX B;  4H5J A;  1TYE A;  4Y7R A;  2EIE A;  3AH8 B;  4J0X A;  2AGL A;  3UR4 A;  5C9Z B;  4JXM A;  3KRX B;  5FKT A;  3OKT A;  4AMY A;  3ZE2 A;  5EAL A;  4O45 A;  5HE0 B;  4GM9 A;  3C9C A;  3KRW B;  5M5T A;  4A11 B;  2QR5 A;  4ESG A;  1FWX A;  3EMH A;  2EID A;  4A09 A;  3JB9 L;  4NEN A;  3KCI A;  5GXH A;  3UKU C;  5FXY A;  4EWR A;  3OL2 B;  3PVU B;  2VDM A;  2XL2 A;  4I79 A;  2XE4 A;  4J77 A;  4GQ1 A;  1B9X A;  3EQ7 A;  3MUO A;  4BP8 A;  3GRE A;  3CFV A;  1QNI A;  3MKS B;  4O9D A;  4RE6 A;  5H17 A;  3NVN A;  2WQ8 A;  2I3S A;  2HYE A;  1OMW B;  5M5R A;  5EML B;  4X61 B;  4U1E I;  3AL9 A;  1PGU A;  4Y5R D;  2B5L A;  4PXW A;  2P9I C;  2YNN A;  2PM6 B;  5B4W A;  5JWZ A;  5TDH B;  4L1M A;  2CN2 A;  2OIZ A;  3I89 A;  3ZWL B;  4FB1 D;  4X3E A;  3MXX A;  2HKR A;  3I7N A;  4JHN A;  4AN0 A;  4MMY A;  2VDK A;  1C9I A;  2OVQ B;  3EI3 A;  4JSP C;  4G1E A;  4WK2 A;  4X63 B;  2VZ3 A;  3SBP A;  3HFQ A;  2HKM A;  2CN3 A;  5FFO A;  4CC9 A;  5CYK B;  4NSX A;  1PEV A;  4CI2 A;  2H13 A;  5GSA A;  3SCY A;  3FCU A;  2HU8 A;  2W18 A;  1UOP A;  4FHL A;  4J8B A;  4OZU A;  2Z2P A;  2PM7 B;  2CNX A;  4CZV A;  5FLX g;  4CZX A;  2QXV A;  4A0B B;  1GXR A;  1RI6 A;  2AGW A;  5H14 A;  2Z2N A;  2GC4 A;  1E8M A;  5HE3 B;  3RSE C;  3RRM C;  3I7O A;  1UOQ A;  4BCD A;  3JZH A;  2H6K A;  3NVX A;  2B5M A;  2G99 A;  2O9K A;  4PC0 A;  4ERY A;  4J79 A;  5I5I A;  4MK0 B;  3EI4 B;  2HU5 A;  1K8K C;  4XYI A;  3IUL A;  3BG1 A;  4AMZ A;  2VDO A;  2J57 G;  5K1C C;  4JSV C;  3PE7 A;  4PBZ A;  1B9Y A;  3IJ0 A;  2EBS A;  4CY5 A;  2MTA H;  3IUM A;  1C9L A;  1SQ9 A;  4ZOX A;  3EU7 A;  2H3X A;  2HU7 A;  2G9A A;  2XDW A;  3GC3 B;  3NVQ A;  4IRZ A;  3C5M A;  4QAM A;  3V9F A;  1GOG A;  4WK0 A;  5I5M A;  2BCJ B;  1MG2 A;  3JRP A;  3JZG A;  1OLZ A;  4XEI C;  3QHY B;  3JRO A;  1MDA H;  2OVR B;  1GP2 B;  3SMR A;  4FAN D;  4FWW A;  3MZL A;  3BWS A;  1GOF A;  3NIG A;  1E8N A;  2BKL A;  4GMB A;  4QRJ A;  2CE9 A;  1UTC A;  4FA1 D;  1MG3 A;  5IT9 g;  3K71 A;  1PBY B;  2HJB A;  1QFM A;  4BL0 A;  5I5J A;  3K6S A;  4DNU A;  3F3G A;  4CI1 A;  3OL2 A;  4KFM B;  5EAP A;  1XHM A;  4L3G D;  3SBQ A;  2P9U C;  4WK4 A;  3I7L A;  5H1M A;  5EAM A;  3I8E A;  4JSX C;  4E5Z A;  2I0T A;  2Q7Q A;  3SJL D;  2J55 H;  4J73 A;  4J86 A;  3MKQ A;  2HES X;  3ZDZ A;  3FCS A;  5CYK A;  1U2V C;  2AH0 A;  4L3H D;  4J8G A;  3RN1 D;  4RE5 A;  2IWF A;  4J81 A;  5HE1 B;  3B7F A;  2AQ5 A;  3V7D B;  1NR0 A;  4GGA A;  3V4V A;  2EIC A;  1Q47 A;  3EI2 A;  4PSX B;  1YFQ A;  1T2X A;  4DNW A;  4K3J B;  4ZOV A;  2IUQ A;  3IVM A;  3OKW A;  3SHF A;  1A12 A;  3O4I A;  5FQD A;  2VZ1 A;  2AGZ A;  3DM0 A;  5HDB A;  2PBI B;  3EI1 B;  3IUQ A;  3EI2 B;  4D0K A;  2YNP A;  4A0B A;  3MZK A;  3I7H A;  4NBM A;  4UI9 R;  4HDJ A;  4O2W A;  3AL8 A;  1JV2 A;  2CE8 A;  3SVW D;  4ERQ A;  2H6Q A;  4LG9 A;  1L0Q A;  5GMK n;  4BUJ C;  2YNO A;  5C86 A;  2YB8 B;  4Z7O A;  2H9N A;  5M5U A;  1XIP A;  3UVL A;  5IJ7 E;  4J84 A;  4UM9 A;  4NC4 A;  5TEF A;  1VYH C;  3OW8 A;  4R7A B;  3C99 A;  3J80 g;  2P9K C;  3ZDY A;  2EIB A;  4E54 B;  4DNV A;  5HE2 B;  4BP9 A;  3DWL C;  1JMX B;  1VZ3 A;  4GGD A;  4PBY A;  5CXB A;  3NIF A;  5AFU 3;  4CY1 A;  1N6E A;  4ZOZ A;  3C75 H;  2P9L C;  2PM9 B;  4MMZ A;  3I7P A;  3N0E A;  2IUV A;  5HQG A;  2XL3 A;  3NID A;  4ZOY A;  2JKX A;  4H5I A;  3ZE1 A;  3I8C A;  3PSC B;  1U4C A;  3AFC A;  4JSN C;  4O3U B;  4A2M A;  4Z7N A;  1SQJ A;  4A08 B;  2GC7 A;  5EMK B;  2XU7 A;  1VZ2 A;  4OWR A;  3F3P A;  3PSL A;  3OF7 A;  5FKQ A;  5AJA A;  5GXI A;  3O4H A;  4MMX A;  3IJE A;  5M61 A;  3MUN A;  4A7J A;  3VGZ A;  4N14 A;  4L1Q D;  4CZY A;  4ES0 A;  4A08 A;  3VA6 A;  4L9O A;  5FFG A;  2AGX A;  3QI0 A;  4GQB B;  1E5T A;  5E6U A;  2XZG A;  3EI4 A;  3GFC A;  3AL8 B;  5HYN B;  5SXM A;  3OKY B;  3EQ9 A;  3J81 g;  4UM8 A;  4CY2 A;  3O4G A;  3CFS B;  5C92 A;  3EI1 A;  3JZN A;  2VDR A;  1ERJ A;  1H2Y A;  1O6F A;  1XKS A;  4J82 A;  3UVK A;  1R5M A;  3IKO A;  3PXS D;  4PSW B;  5TEE A;  4GM3 A;  1M1X A;  2VC2 A;  5EMJ B;  5M5S A;  3RN0 D;  3A0F A;  3IJC A;  3V4P A;  5C2V B;  3I7K A;  2P9N C;  3MMY A;  4WJK A;  4GQ2 P;  4Z7Q A;  3EG6 A;  1GOT B;  2HXC A;  3SBR A;  4X60 B;  2CO0 A;  2IUR A;  4J78 A;  3SLE D;  4AOW A;  4J0W A;  2H9M A;  4LGN A;  3UVO A;  4AEZ A;  1BPO A;  2OVP B;  1VE6 A;  3DDU A; 
#chains in the Genus database with same CATH homology
 1GG2 B;  4G56 B;  4E5Z B;  3K26 A;  5CXB B;  3IIY A;  2AH1 A;  3PXT D;  1PI6 A;  4YVD A;  4CY3 A;  3FRX A;  3IJ1 A;  1JJU B;  4FAV D;  4ERZ A;  2P9S C;  5K19 A;  1N6F A;  2YBA A;  3RLM D;  4O3T B;  2OK4 A;  1TYQ C;  1JMZ B;  3DSM A;  4CI3 A;  5EMM B;  4JT5 C;  4FA4 D;  2H68 A;  3F3F A;  4D6V A;  5EM2 B;  4A09 B;  3DXM C;  4IMM A;  3BG0 A;  5FKS A;  2P9P C;  4ZN4 A;  2I0R A;  2I0S A;  2H9P A;  5IGQ A;  2I3T A;  3E0C A;  3JPX A;  5IGO A;  4J87 A;  4FA9 D;  5C2W B;  3RFG A;  2AGY A;  2HJ4 A;  3K27 A;  2TRC B;  1N6D A;  4E54 A;  2H6N A;  4U7A A;  5A2Q g;  1A0R B;  4BH6 A;  2B5N A;  1K32 A;  1P22 A;  2J56 H;  3UKR C;  3PXW D;  2QC5 A;  2OK6 A;  1SHY B;  2IWK A;  3RFH A;  1TBG A;  3L4O D;  5EM2 A;  5IJ8 E;  2YMU A;  2IAA A;  2Z2O A;  5FKR A;  3EI3 B;  3V5W B;  2IUP A;  2H14 A;  3DXK C;  2H47 A;  4A0A B;  2BBK H;  4GGC A;  5AMS A;  3SFZ A;  4CI8 A;  4QT8 A;  3UVN A;  3N0D A;  4TZ4 A;  5EAR A;  5KDO B;  5TF2 A;  3SN6 B;  3SXT D;  3OKY A;  3CIK B;  4PNK B;  4GM8 A;  5FA5 B;  3SWS D;  3L4M D;  2PM9 A;  3ODT A;  3OTT A;  4QQE A;  3I2N A;  5CXC A;  2B4E A;  2H9L A;  1JOF A;  5THA A;  2OJY A;  2CO0 C;  3U4Y A;  2XYI A;  3PVW B;  4LG8 A;  3UVM A;  4A0A A;  1NEX B;  3P4F A;  4QL1 A;  4A11 A;  3FGB A;  5CXC B;  2GNQ A;  3EWE A;  4K3I D;  3FM0 A;  2UZY B;  1S4U X;  4JT6 C;  5IC7 A;  3IIW A;  3RMZ D;  4XYH A;  4JD2 C;  3VH0 A;  4GZ8 A;  4A2L A;  3ULE C;  3W15 A;  3ORV D;  3JAM g;  4IA9 A;  4O1Q D;  4FA5 D;  4Z8L A;  2UZX B;  4H5J A;  4Y7R A;  3AH8 B;  4J0X A;  2AGL A;  3UR4 A;  5C9Z B;  4JXM A;  3KRX B;  5FKT A;  3OKT A;  5EAL A;  4O45 A;  5HE0 B;  4GM9 A;  3C9C A;  3KRW B;  4A11 B;  4ESG A;  1FWX A;  3EMH A;  4A09 A;  3JB9 L;  5GXH A;  3UKU C;  5FXY A;  4EWR A;  3OL2 B;  3PVU B;  2XL2 A;  4I79 A;  4J77 A;  4GQ1 A;  1B9X A;  3GRE A;  3CFV A;  1QNI A;  3MKS B;  4O9D A;  5H17 A;  3NVN A;  2I3S A;  2HYE A;  1OMW B;  5EML B;  4X61 B;  4U1E I;  3AL9 A;  1PGU A;  4Y5R D;  2B5L A;  4PXW A;  2P9I C;  2YNN A;  2PM6 B;  5B4W A;  5JWZ A;  5TDH B;  2CN2 A;  2OIZ A;  3I89 A;  3ZWL B;  4FB1 D;  4X3E A;  3MXX A;  2HKR A;  3I7N A;  2OVQ B;  3EI3 A;  4JSP C;  4X63 B;  3SBP A;  3HFQ A;  2HKM A;  2CN3 A;  4CC9 A;  5CYK B;  4NSX A;  1PEV A;  4CI2 A;  2H13 A;  5GSA A;  3SCY A;  2W18 A;  4FHL A;  4OZU A;  4J8B A;  2Z2P A;  2PM7 B;  2CNX A;  4CZV A;  5FLX g;  4CZX A;  2QXV A;  4A0B B;  1GXR A;  1RI6 A;  2AGW A;  5H14 A;  2Z2N A;  2GC4 A;  3RSE C;  5HE3 B;  3RRM C;  3I7O A;  3JZH A;  2H6K A;  3NVX A;  2B5M A;  2G99 A;  2O9K A;  4PC0 A;  4ERY A;  4J79 A;  5I5I A;  4MK0 B;  3EI4 B;  1K8K C;  4XYI A;  3BG1 A;  2J57 G;  5K1C C;  4JSV C;  3PE7 A;  4PBZ A;  1B9Y A;  3IJ0 A;  2EBS A;  4CY5 A;  2MTA H;  1SQ9 A;  4ZOX A;  3EU7 A;  2H3X A;  2G9A A;  3NVQ A;  3C5M A;  3V9F A;  5I5M A;  2BCJ B;  1MG2 A;  3JRP A;  3JZG A;  1OLZ A;  4XEI C;  3JRO A;  1MDA H;  2OVR B;  1GP2 B;  3SMR A;  4FAN D;  4FWW A;  3MZL A;  3BWS A;  4GMB A;  4QRJ A;  2CE9 A;  4FA1 D;  1MG3 A;  5IT9 g;  1PBY B;  2HJB A;  4BL0 A;  5I5J A;  3F3G A;  4CI1 A;  3OL2 A;  4KFM B;  5EAP A;  1XHM A;  4L3G D;  3SBQ A;  2P9U C;  3I7L A;  5H1M A;  5EAM A;  3I8E A;  4JSX C;  4E5Z A;  2I0T A;  2Q7Q A;  3SJL D;  2J55 H;  4J73 A;  4J86 A;  3MKQ A;  2HES X;  5CYK A;  1U2V C;  2AH0 A;  4L3H D;  4J8G A;  3RN1 D;  2IWF A;  4J81 A;  5HE1 B;  3B7F A;  2AQ5 A;  3V7D B;  1NR0 A;  4GGA A;  1Q47 A;  3EI2 A;  4PSX B;  1YFQ A;  4K3J B;  4ZOV A;  2IUQ A;  3OKW A;  3SHF A;  5FQD A;  2AGZ A;  3DM0 A;  2PBI B;  3EI1 B;  3EI2 B;  4A0B A;  4D0K A;  2YNP A;  3MZK A;  3I7H A;  4UI9 R;  4HDJ A;  3AL8 A;  2CE8 A;  3SVW D;  4ERQ A;  2H6Q A;  4LG9 A;  1L0Q A;  5GMK n;  4BUJ C;  2YNO A;  2YB8 B;  2H9N A;  1XIP A;  3UVL A;  5IJ7 E;  4J84 A;  5TEF A;  1VYH C;  3OW8 A;  4R7A B;  3C99 A;  3J80 g;  2P9K C;  4E54 B;  5HE2 B;  3DWL C;  1JMX B;  4GGD A;  4PBY A;  5CXB A;  5AFU 3;  4CY1 A;  1N6E A;  4ZOZ A;  3C75 H;  2P9L C;  2PM9 B;  3I7P A;  3N0E A;  2IUV A;  5HQG A;  2XL3 A;  4ZOY A;  4H5I A;  3I8C A;  3PSC B;  1U4C A;  3AFC A;  4JSN C;  4O3U B;  4A2M A;  1SQJ A;  4A08 B;  2GC7 A;  5EMK B;  2XU7 A;  4OWR A;  3F3P A;  3PSL A;  5FKQ A;  5AJA A;  5GXI A;  4A7J A;  3VGZ A;  4N14 A;  4L1Q D;  4CZY A;  4ES0 A;  4A08 A;  3VA6 A;  4L9O A;  2AGX A;  4GQB B;  3EI4 A;  3GFC A;  3AL8 B;  5HYN B;  5SXM A;  3OKY B;  3J81 g;  4CY2 A;  3CFS B;  3EI1 A;  3JZN A;  1ERJ A;  1XKS A;  4J82 A;  3UVK A;  1R5M A;  3IKO A;  3PXS D;  4PSW B;  5TEE A;  4GM3 A;  5EMJ B;  3RN0 D;  3A0F A;  3IJC A;  5C2V B;  3I7K A;  2P9N C;  3MMY A;  4GQ2 P;  3EG6 A;  1GOT B;  2HXC A;  3SBR A;  4X60 B;  2CO0 A;  2IUR A;  4J78 A;  3SLE D;  4AOW A;  4J0W A;  2H9M A;  4LGN A;  3UVO A;  4AEZ A;  2OVP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...