4GM3A

Crystal structure of human wd repeat domain 5 with compound mm-101
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
publication title High-affinity, small-molecule peptidomimetic inhibitors of MLL1/WDR5 protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 304
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm3A00
3OKYA 4ERZA 1N6EA 1GP2B 3BWSA 4FWWA 4ESGA 5HQGA 3CFVA 4H5IA 4PXWA 2PM9B 4JXMA 3NVQA 2P9SC 4HDJA 3MZLA 3DXMC 4X63B 4ZOVA 1XKSA 3I7HA 2YB8B 1RI6A 3C5MA 3KRXB 3PVWB 2Q7QA 3OKWA 3UVMA 1XHMA 3JRPA 5IT9g 4QT8A 2CN3A 3SN6B 4CI3A 1B9YA 2I3SA 5AJAA 2GC7A 5IGQA 3I8CA 1B9XA 1VYHC 4TZ4A 4CY3A 3SXTD 5EM2A 3EMHA 2I0TA 3JPXA 4U7AA 4CI2A 2CNXA 3AH8B 2P9IC 5HE1B 3EG6A 4Y5RD 4A11A 4J78A 2CO0A 4K3JB 2UZYB 4KFMB 4J81A 3UR4A 4PC0A 4Z8LA 4ES0A 3JZNA 5FKTA 4FA5D 1JJUB 3RMZD 2IAAA 4UI9R 4E54B 2XU7A 4PNKB 4GZ8A 5H17A 2MTAH 4XYHA 3CIKB 2H68A 3OKTA 2IUPA 1SQJA 1MG3A 2HJBA 2J55H 3MKSB 2YNOA 5H1MA 4J86A 2HJ4A 2YBAA 1YFQA 3J80g 3UVLA 5A2Qg 5GMKn 2YNNA 2BBKH 4FHLA 3RFGA 1N6DA 5C2WB 4O3TB 2J57G 4CY5A 4JSPC 1PGUA 3C9CA 4LGNA 4FA1D 1NEXB 4CY2A 3BG0A 5I5JA 2OVQB 5EALA 2BCJB 4A0BA 4OZUA 4J87A 1TBGA 4FB1D 1FWXA 1K8KC 3NVXA 4LG8A 4CY1A 3SLED 5HE3B 5JWZA 4CI1A 3JB9L 1OLZA 5IGOA 2B5LA 1K32A 2AQ5A 2AGXA 5TF2A 3VGZA 2AH0A 3CFSB 2IUQA 5CXBB 4E54A 2H13A 4GGAA 4XEIC 4QRJA 5CYKA 1PBYB 4GMBA 5EARA 5HE2B 2H9NA 2PM6B 3MMYA 1P22A 3RRMC 3I7KA 4D6VA 3L4MD 3JZHA 3GFCA 1L0QA 3IJCA 1SQ9A 3E0CA 3L4OD 2IWFA 1PI6A 4A09B 5TEEA 2HXCA 4JSNC 3RN0D 4K3ID 3JZGA 3FRXA 2H9LA 3IIWA 4JSVC 2P9UC 2AH1A 3IIYA 1GG2B 4ERYA 4BH6A 2B5NA 4ERQA 1U4CA 4ZOZA 1GOTB 3RSEC 4CZVA 3B7FA 3V5WB 4PBZA 4OWRA 3IJ1A 4J0XA 1TYQC 2H14A 4CC9A 3SBRA 3SBPA 5EMMB 3K26A 4A2LA 4A0BB 3JAMg 3IKOA 3I2NA 3RLMD 4A08A 2P9LC 4I79A 5CXBA 5CXCA 1MDAH 3OTTA 4XYIA 3DM0A 3W15A 2HKRA 3C99A 5I5IA 2OJYA 5HYNB 3PVUB 2AGZA 4ZOYA 2IURA 4JD2C 2AGWA 4JT6C 4FA9D 4A09A 2PM7B 1S4UX 4GQ2P 3I7OA 2B4EA 3ODTA 5GSAA 5TEFA 5CYKB 3SVWD 3PE7A 4GQBB 3JROA 3EI2A 1U2VC 2H9PA 3I89A 2OIZA 3AFCA 4H5JA 5FKRA 1NR0A 2EBSA 4GGCA 4CI8A 3SMRA 4Y7RA 3N0EA 5TDHB 5FXYA 5B4WA 4A0AB 4G56B 2P9PC 1MG2A 4J84A 4NSXA 4FA4D 4CZXA 2OK4A 4E5ZA 2AGLA 3J81g 2CE8A 2HESX 4FAND 4IA9A 1JMXB 5IC7A 3OL2A 4X60B 5FKQA 2OVPB 3EI3A 2H47A 5C9ZB 3F3GA 2I0SA 4GM8A 4A2MA 5GXIA 4ZN4A 4FAVD 5EMJB 4L3GD 5SXMA 4GM3A 4YVDA 4A08B 3C75H 5CXCB 5HE0B 5AFU3 5EMLB 2XL2A 3EI4A 4GQ1A 3GREA 4L3HD 4EWRA 3UVKA 5GXHA 1XIPA 1SHYB 4MK0B 4LG9A 5THAA 4JT5C 4L9OA 4PSWB 4BL0A 1Q47A 3AL9A 2UZXB 4ZOXA 4R7AB 2H3XA 1R5MA 2CO0C 4O9DA 3F3PA 2AGYA 3UKUC 2QXVA 2J56H 1QNIA 2I3TA 3A0FA 1GXRA 3MKQA 4N14A 3EI2B 4A0AA 2IWKA 3SWSD 5IJ8E 3ULEC 4AEZA 2G9AA 4J0WA 3VA6A 3RN1D 3KRWB 1JMZB 5C2VB 3ZWLB 2I0RA 3P4FA 5I5MA 3V7DB 4QL1A 4AOWA 4E5ZB 1ERJA 2TRCB 5EAPA 3V9FA 3AL8A 4CZYA 3FGBA 3UVOA 2G99A 3I7PA 2YMUA 3OL2B 3SJLD 4A7JA 5EMKB 3EI3B 2IUVA 4D0KA 4O45A 1A0RB 2Z2PA 2Z2OA 4J8BA 4O1QD 3OW8A 2H6QA 2H6NA 2W18A 3SBQA 2OK6A 4O3UB 2GC4A 5FQDA 3I8EA 4IMMA 3EI4B 4X3EA 3FM0A 5KDOB 1N6FA 3I7NA 3PSLA 2QC5A 2PBIB 3HFQA 3N0DA 1OMWB 3UVNA 3MZKA 2P9KC 2H9MA 4J82A 2PM9A 2YNPA 3EI1B 3OKYB 2O9KA 2H6KA 4JSXC 2HKMA 4J8GA 5IJ7E 3U4YA 4J73A 5FKSA 2OVRB 4GM9A 5K1CC 5AMSA 3ORVD 3IJ0A 4PBYA 2XYIA 3I7LA 2XL3A 4J79A 3NVNA 3DSMA 3DWLC 3VH0A 3DXKC 3PXSD 1JOFA 4BUJC 3AL8B 4PSXB 3PXTD 2GNQA 3PXWD 3SCYA 4GGDA 2CN2A 3EU7A 5H14A 3SFZA 5FA5B 5K19A 1PEVA 3K27A 3SHFA 4J77A 3UKRC 4QQEA 2CE9A 3EWEA 2B5MA 4L1QD 3F3FA 4U1EI 5FLXg 2HYEA 5EM2B 3MXXA 2P9NC 3PSCB 2Z2NA 3RFHA 4A11B 3BG1A 3EI1A 5EAMA 4X61B
chains in the Genus database with same CATH superfamily
3OKYA 4ERZA 1N6EA 1GP2B 3BWSA 4FWWA 4ESGA 5HQGA 3CFVA 4H5IA 4PXWA 2PM9B 4JXMA 3NVQA 2P9SC 4HDJA 3MZLA 4BCBA 3MUOA 3DXMC 4X63B 4ZOVA 1XKSA 2HU8A 3EQ8A 3I7HA 4O02A 2VDNA 2YB8B 2QR5A 1RI6A 4NAAA 4BCDA 4Z7OA 3C5MA 3KRXB 3O4HA 3T3PA 3PVWB 2Q7QA 3OKWA 3UVMA 1XHMA 3JRPA 5IT9g 4DNVA 4QT8A 2CN3A 3SN6B 4CI3A 1B9YA 2I3SA 5AJAA 2GC7A 4L1MA 5IGQA 3I8CA 1B9XA 1TYEA 1VYHC 4TZ4A 4CY3A 3SXTD 5EM2A 3EMHA 4WJKA 2I0TA 3JPXA 4U7AA 4CI2A 2CNXA 1E8MA 1K3IA 5C86A 3AH8B 2P9IC 5HE1B 4DNWA 3EG6A 4Y5RD 4A11A 4J78A 2CO0A 4BP8A 3VI3A 4K3JB 2VDLA 2UZYB 4Z7NA 4KFMB 4J81A 3UR4A 4PC0A 4Z8LA 4ES0A 3JZNA 2EIBA 5FKTA 4DNUA 1I2MB 3V4VA 4FA5D 1JJUB 3RMZD 2IAAA 2BKLA 4UI9R 1T2XA 4E54B 2XU7A 4PNKB 4GZ8A 5H17A 2MTAH 4XYHA 3CIKB 5E6UA 2H68A 3OKTA 2IUPA 1SQJA 1MG3A 2HJBA 2J55H 3MKSB 2YNOA 5H1MA 4BCCA 4J86A 2HJ4A 4IRZA 2YBAA 1YFQA 3J80g 3NIFA 3UVLA 5A2Qg 5GMKn 4WK2A 3IUNA 2YNNA 2BBKH 4FHLA 3RFGA 1N6DA 5C2WB 4O3TB 2J57G 1O6GA 4CY5A 4JSPC 1PGUA 4MMZA 3C9CA 4LGNA 1GOHA 4FA1D 1NEXB 2XE4A 4CY2A 3BG0A 5I5JA 2OVQB 5EALA 5M5UA 2BCJB 4A0BA 4OZUA 4J87A 1TBGA 4FB1D 1FWXA 3VI4A 1K8KC 3NVXA 4LG8A 4CY1A 1YR2A 4UM8A 3SLED 5HE3B 5JWZA 1H2ZA 4CI1A 3JB9L 1OLZA 1VE7A 3DDUA 5IGOA 2B5LA 1K32A 2AQ5A 2AGXA 5TF2A 2EICA 3VGZA 2AH0A 4Z7QA 3CFSB 2HU7A 2IUQA 3OF7A 5CXBB 4E54A 2H13A 4GGAA 4XEIC 4G1EA 4QRJA 1VE6A 5CYKA 1PBYB 4GMBA 2VZ1A 4AN0A 5EARA 5HE2B 2H9NA 2PM6B 3MMYA 1P22A 3RRMC 3I7KA 4D6VA 3L4MD 3JZHA 1M1XA 1L0QA 2VDMA 3GFCA 1JV2A 3IJCA 1SQ9A 3E0CA 3L4OD 2IWFA 3ZE1A 2EIDA 1PI6A 4A09B 3IURA 1H2XA 5TEEA 2HXCA 4JSNC 1A12A 4MMXA 3RN0D 4K3ID 3JZGA 1E8NA 3O4IA 3FRXA 2H9LA 3IIWA 4JSVC 1L5GA 3FCSA 2JKXA 2P9UC 2AH1A 3IIYA 1GG2B 4ERYA 4BH6A 1H2WA 4NBMA 2B5NA 4ERQA 1U4CA 4ZOZA 1GOTB 3RSEC 3ZE2A 4CZVA 3B7FA 3V5WB 5M5SA 4PBZA 4OWRA 1UOQA 3IJ1A 4J0XA 1TYQC 2H14A 4CC9A 3SBRA 1VZ3A 3SBPA 5EMMB 3K26A 2VDQA 4A2LA 2HU5A 4A0BB 3JAMg 3IKOA 3I2NA 3RLMD 4A08A 2P9LC 4I79A 3ZDYA 3EQ7A 5CXBA 5CXCA 1MDAH 3OTTA 4XYIA 3DM0A 2VDOA 3V4PA 2HKRA 3W15A 3C99A 5I5IA 2OJYA 4NC4A 5HYNB 3PVUB 2AGZA 5E6RA 4ZOYA 2IURA 4JD2C 2AGWA 4JT6C 4FA9D 4A09A 2PM7B 1S4UX 4GQ2P 3I7OA 2B4EA 3ODTA 5GSAA 5TEFA 5CYKB 2VDRA 4G55A 3SVWD 3PE7A 4GQBB 3JROA 3EI2A 1U2VC 2H9PA 3I89A 2OIZA 3IJEA 4JHPC 3AFCA 4O2WA 4H5JA 5FKRA 1NR0A 2EBSA 4GGCA 4CI8A 4AMZA 3IVMA 3SMRA 4Y7RA 3N0EA 5TDHB 5FXYA 5B4WA 3NIGA 4A0AB 4G56B 2P9PC 1MG2A 5FFGA 4J84A 3NIDA 4NSXA 4FA4D 1JTDB 4CZXA 2OK4A 4E5ZA 2AGLA 4WK4A 5FFOA 3J81g 4RE5A 2CE8A 2HESX 1GOFA 5HDBA 4FAND 4IA9A 1JMXB 5IC7A 3OL2A 4X60B 4AMYA 5FKQA 3EI3A 2OVPB 3T3MA 2VC2A 2H47A 3K6SA 5C9ZB 3F3GA 2I0SA 4GM8A 4A2MA 5GXIA 2QZPA 4FAVD 5EMJB 4ZN4A 4L3GD 5SXMA 4GM3A 1BPOA 4YVDA 1UOOA 3QI0A 4A08B 3C75H 5CXCB 5HE0B 5AFU3 5EMLB 2XL2A 3EI4A 3MVDK 4UM9A 4GQ1A 3GREA 4L3HD 4EWRA 3UVKA 5GXHA 1XIPA 1SHYB 4MK0B 3KCIA 5M5TA 4LG9A 5THAA 4JT5C 4L9OA 4PSWB 4BL0A 1Q47A 1E5TA 3AL9A 2UZXB 4ZOXA 4R7AB 2H3XA 1R5MA 1C9IA 2CO0C 2VDPA 3F3PA 2AGYA 4O9DA 3UKUC 2QXVA 2J56H 1QNIA 4D9SA 2I3TA 2VDKA 3A0FA 1GXRA 3MKQA 4N14A 3EI2B 4A0AA 2IWKA 3SWSD 5IJ8E 3ULEC 3IUQA 4AEZA 3O4GA 1UTCA 2G9AA 4J0WA 3VA6A 3RN1D 3KRWB 1JMZB 3O4JA 5C2VB 3ZWLB 4MMYA 2I0RA 3P4FA 5I5MA 3V7DB 4QL1A 4AOWA 2VZ3A 5C92A 4E5ZB 1ERJA 2TRCB 5EAPA 3V9FA 3AL8A 4CZYA 3FGBA 3UVOA 2G99A 3I7PA 2YMUA 2EIEA 2XDWA 3K71A 3OL2B 3SJLD 4A7JA 5EMKB 3GC3B 3EI3B 2IUVA 4D0KA 4O45A 4AX4A 1A0RB 2Z2PA 2Z2OA 4J8BA 1QFMA 4O1QD 1U8CA 5E6SA 3OW8A 2H6QA 2H6NA 3IUMA 2W18A 2WQ8A 3SBQA 2OK6A 4O3UB 2GC4A 5FQDA 3I8EA 4IMMA 3EI4B 4X3EA 3FM0A 5KDOB 1N6FA 2XZGA 3MUNA 3I7NA 3PSLA 2QC5A 1C9LA 3QHYB 4G1MA 4WK0A 1QFSA 2PBIB 3HFQA 3N0DA 4QAMA 1OMWB 3UVNA 3MZKA 2P9KC 2H9MA 4J82A 3GD1I 2PM9A 1GOGA 2YNPA 3EI1B 3K72A 3OKYB 4NENA 2O9KA 2H6KA 4JSXC 2HKMA 4J8GA 4AN1A 5IJ7E 3U4YA 3ZDXA 4J73A 3ZDZA 4BP9A 5FKSA 2OVRB 4GM9A 5K1CC 5AMSA 3ORVD 3IJ0A 4PBYA 2XYIA 3EQ9A 3I7LA 2XL3A 4J79A 3NVNA 3DSMA 3DWLC 3VH0A 3DXKC 3PXSD 1JOFA 4BUJC 3AL8B 4PSXB 2GNQA 3PXWD 3PXTD 3SCYA 3IULA 4GGDA 2CN2A 3EU7A 3FCUA 5H14A 3SFZA 5FA5B 5K19A 1PEVA 3K27A 3SHFA 1H2YA 4J77A 3UKRC 4QQEA 2CE9A 3EWEA 2B5MA 4L1QD 3F3FA 4RE6A 5M5RA 4U1EI 3ZE0A 5FLXg 3IUJA 5M5VA 2HYEA 5EM2B 3MXXA 5M61A 2P9NC 3PSCB 2Z2NA 4JHNA 1O6FA 3RFHA 4A11B 3BG1A 5EAMA 1VZ2A 3EI1A 1UOPA 4X61B
chains in the Genus database with same CATH topology
3OKYA 4ERZA 1N6EA 1GP2B 3BWSA 4FWWA 4ESGA 5HQGA 3CFVA 4H5IA 4PXWA 2PM9B 4JXMA 3NVQA 2P9SC 4HDJA 3MZLA 3DXMC 4X63B 4ZOVA 1XKSA 3I7HA 2YB8B 1RI6A 3C5MA 3KRXB 3PVWB 2Q7QA 3OKWA 3UVMA 1XHMA 3JRPA 5IT9g 4QT8A 2CN3A 3SN6B 4CI3A 1B9YA 2I3SA 5AJAA 2GC7A 5IGQA 3I8CA 1B9XA 1VYHC 4TZ4A 4CY3A 3SXTD 5EM2A 3EMHA 2I0TA 3JPXA 4U7AA 4CI2A 2CNXA 3AH8B 2P9IC 5HE1B 3EG6A 4Y5RD 4A11A 4J78A 2CO0A 4K3JB 2UZYB 4KFMB 4J81A 3UR4A 4PC0A 4Z8LA 4ES0A 3JZNA 5FKTA 4FA5D 1JJUB 3RMZD 2IAAA 4UI9R 4E54B 2XU7A 4PNKB 4GZ8A 5H17A 2MTAH 4XYHA 3CIKB 2H68A 3OKTA 2IUPA 1SQJA 1MG3A 2HJBA 2J55H 3MKSB 2YNOA 5H1MA 4J86A 2HJ4A 2YBAA 1YFQA 3J80g 3UVLA 5A2Qg 5GMKn 2YNNA 2BBKH 4FHLA 3RFGA 1N6DA 5C2WB 4O3TB 2J57G 4CY5A 4JSPC 1PGUA 3C9CA 4LGNA 4FA1D 1NEXB 4CY2A 3BG0A 5I5JA 2OVQB 5EALA 2BCJB 4A0BA 4OZUA 4J87A 1TBGA 4FB1D 1FWXA 1K8KC 3NVXA 4LG8A 4CY1A 3SLED 5HE3B 5JWZA 4CI1A 3JB9L 1OLZA 5IGOA 2B5LA 1K32A 2AQ5A 2AGXA 5TF2A 3VGZA 2AH0A 3CFSB 2IUQA 5CXBB 4E54A 2H13A 4GGAA 4XEIC 4QRJA 5CYKA 1PBYB 4GMBA 5EARA 5HE2B 2H9NA 2PM6B 3MMYA 1P22A 3RRMC 3I7KA 4D6VA 3L4MD 3JZHA 3GFCA 1L0QA 3IJCA 1SQ9A 3E0CA 3L4OD 2IWFA 1PI6A 4A09B 5TEEA 2HXCA 4JSNC 3RN0D 4K3ID 3JZGA 3FRXA 2H9LA 3IIWA 4JSVC 2P9UC 2AH1A 3IIYA 1GG2B 4ERYA 4BH6A 2B5NA 4ERQA 1U4CA 4ZOZA 1GOTB 3RSEC 4CZVA 3B7FA 3V5WB 4PBZA 4OWRA 3IJ1A 4J0XA 1TYQC 2H14A 4CC9A 3SBRA 3SBPA 5EMMB 3K26A 4A2LA 4A0BB 3JAMg 3IKOA 3I2NA 3RLMD 4A08A 2P9LC 4I79A 5CXBA 5CXCA 1MDAH 3OTTA 4XYIA 3DM0A 3W15A 2HKRA 3C99A 5I5IA 2OJYA 5HYNB 3PVUB 2AGZA 4ZOYA 2IURA 4JD2C 2AGWA 4JT6C 4FA9D 4A09A 2PM7B 1S4UX 4GQ2P 3I7OA 2B4EA 3ODTA 5GSAA 5TEFA 5CYKB 3SVWD 3PE7A 4GQBB 3JROA 3EI2A 1U2VC 2H9PA 3I89A 2OIZA 3AFCA 4H5JA 5FKRA 1NR0A 2EBSA 4GGCA 4CI8A 3SMRA 4Y7RA 3N0EA 5TDHB 5FXYA 5B4WA 4A0AB 4G56B 2P9PC 1MG2A 4J84A 4NSXA 4FA4D 4CZXA 2OK4A 4E5ZA 2AGLA 3J81g 2CE8A 2HESX 4FAND 4IA9A 1JMXB 5IC7A 3OL2A 4X60B 5FKQA 2OVPB 3EI3A 2H47A 5C9ZB 3F3GA 2I0SA 4GM8A 4A2MA 5GXIA 4ZN4A 4FAVD 5EMJB 4L3GD 5SXMA 4GM3A 4YVDA 4A08B 3C75H 5CXCB 5HE0B 5AFU3 5EMLB 2XL2A 3EI4A 4GQ1A 3GREA 4L3HD 4EWRA 3UVKA 5GXHA 1XIPA 1SHYB 4MK0B 4LG9A 5THAA 4JT5C 4L9OA 4PSWB 4BL0A 1Q47A 3AL9A 2UZXB 4ZOXA 4R7AB 2H3XA 1R5MA 2CO0C 4O9DA 3F3PA 2AGYA 3UKUC 2QXVA 2J56H 1QNIA 2I3TA 3A0FA 1GXRA 3MKQA 4N14A 3EI2B 4A0AA 2IWKA 3SWSD 5IJ8E 3ULEC 4AEZA 2G9AA 4J0WA 3VA6A 3RN1D 3KRWB 1JMZB 5C2VB 3ZWLB 2I0RA 3P4FA 5I5MA 3V7DB 4QL1A 4AOWA 4E5ZB 1ERJA 2TRCB 5EAPA 3V9FA 3AL8A 4CZYA 3FGBA 3UVOA 2G99A 3I7PA 2YMUA 3OL2B 3SJLD 4A7JA 5EMKB 3EI3B 2IUVA 4D0KA 4O45A 1A0RB 2Z2PA 2Z2OA 4J8BA 4O1QD 3OW8A 2H6QA 2H6NA 2W18A 3SBQA 2OK6A 4O3UB 2GC4A 5FQDA 3I8EA 4IMMA 3EI4B 4X3EA 3FM0A 5KDOB 1N6FA 3I7NA 3PSLA 2QC5A 2PBIB 3HFQA 3N0DA 1OMWB 3UVNA 3MZKA 2P9KC 2H9MA 4J82A 2PM9A 2YNPA 3EI1B 3OKYB 2O9KA 2H6KA 4JSXC 2HKMA 4J8GA 5IJ7E 3U4YA 4J73A 5FKSA 2OVRB 4GM9A 5K1CC 5AMSA 3ORVD 3IJ0A 4PBYA 2XYIA 3I7LA 2XL3A 4J79A 3NVNA 3DSMA 3DWLC 3VH0A 3DXKC 3PXSD 1JOFA 4BUJC 3AL8B 4PSXB 3PXTD 2GNQA 3PXWD 3SCYA 4GGDA 2CN2A 3EU7A 5H14A 3SFZA 5FA5B 5K19A 1PEVA 3K27A 3SHFA 4J77A 3UKRC 4QQEA 2CE9A 3EWEA 2B5MA 4L1QD 3F3FA 4U1EI 5FLXg 2HYEA 5EM2B 3MXXA 2P9NC 3PSCB 2Z2NA 3RFHA 4A11B 3BG1A 3EI1A 5EAMA 4X61B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKY A;  4ERZ A;  1N6E A;  1GP2 B;  3BWS A;  4FWW A;  4ESG A;  5HQG A;  3CFV A;  4H5I A;  4PXW A;  2PM9 B;  4JXM A;  3NVQ A;  2P9S C;  4HDJ A;  3MZL A;  3DXM C;  4X63 B;  4ZOV A;  1XKS A;  3I7H A;  2YB8 B;  1RI6 A;  3C5M A;  3KRX B;  3PVW B;  2Q7Q A;  3OKW A;  3UVM A;  1XHM A;  3JRP A;  5IT9 g;  4QT8 A;  2CN3 A;  3SN6 B;  4CI3 A;  1B9Y A;  2I3S A;  5AJA A;  2GC7 A;  5IGQ A;  3I8C A;  1B9X A;  1VYH C;  4TZ4 A;  4CY3 A;  3SXT D;  5EM2 A;  3EMH A;  2I0T A;  3JPX A;  4U7A A;  4CI2 A;  2CNX A;  3AH8 B;  2P9I C;  5HE1 B;  3EG6 A;  4Y5R D;  4A11 A;  4J78 A;  2CO0 A;  4K3J B;  2UZY B;  4KFM B;  4J81 A;  3UR4 A;  4PC0 A;  4Z8L A;  4ES0 A;  3JZN A;  5FKT A;  4FA5 D;  1JJU B;  3RMZ D;  2IAA A;  4UI9 R;  4E54 B;  2XU7 A;  4PNK B;  4GZ8 A;  5H17 A;  2MTA H;  4XYH A;  3CIK B;  2H68 A;  3OKT A;  2IUP A;  1SQJ A;  1MG3 A;  2HJB A;  2J55 H;  3MKS B;  2YNO A;  5H1M A;  4J86 A;  2HJ4 A;  2YBA A;  1YFQ A;  3J80 g;  3UVL A;  5A2Q g;  5GMK n;  2YNN A;  2BBK H;  4FHL A;  3RFG A;  1N6D A;  5C2W B;  4O3T B;  2J57 G;  4CY5 A;  4JSP C;  1PGU A;  3C9C A;  4LGN A;  4FA1 D;  1NEX B;  4CY2 A;  3BG0 A;  5I5J A;  2OVQ B;  5EAL A;  2BCJ B;  4A0B A;  4OZU A;  4J87 A;  1TBG A;  4FB1 D;  1FWX A;  1K8K C;  3NVX A;  4LG8 A;  4CY1 A;  3SLE D;  5HE3 B;  5JWZ A;  4CI1 A;  3JB9 L;  1OLZ A;  5IGO A;  2B5L A;  1K32 A;  2AQ5 A;  2AGX A;  5TF2 A;  3VGZ A;  2AH0 A;  3CFS B;  2IUQ A;  5CXB B;  4E54 A;  2H13 A;  4GGA A;  4XEI C;  4QRJ A;  5CYK A;  1PBY B;  4GMB A;  5EAR A;  5HE2 B;  2H9N A;  2PM6 B;  3MMY A;  1P22 A;  3RRM C;  3I7K A;  4D6V A;  3L4M D;  3JZH A;  3GFC A;  1L0Q A;  3IJC A;  1SQ9 A;  3E0C A;  3L4O D;  2IWF A;  1PI6 A;  4A09 B;  5TEE A;  2HXC A;  4JSN C;  3RN0 D;  4K3I D;  3JZG A;  3FRX A;  2H9L A;  3IIW A;  4JSV C;  2P9U C;  2AH1 A;  3IIY A;  1GG2 B;  4ERY A;  4BH6 A;  2B5N A;  4ERQ A;  1U4C A;  4ZOZ A;  1GOT B;  3RSE C;  4CZV A;  3B7F A;  3V5W B;  4PBZ A;  4OWR A;  3IJ1 A;  4J0X A;  1TYQ C;  2H14 A;  4CC9 A;  3SBR A;  3SBP A;  5EMM B;  3K26 A;  4A2L A;  4A0B B;  3JAM g;  3IKO A;  3I2N A;  3RLM D;  4A08 A;  2P9L C;  4I79 A;  5CXB A;  5CXC A;  1MDA H;  3OTT A;  4XYI A;  3DM0 A;  3W15 A;  2HKR A;  3C99 A;  5I5I A;  2OJY A;  5HYN B;  3PVU B;  2AGZ A;  4ZOY A;  2IUR A;  4JD2 C;  2AGW A;  4JT6 C;  4FA9 D;  4A09 A;  2PM7 B;  1S4U X;  4GQ2 P;  3I7O A;  2B4E A;  3ODT A;  5GSA A;  5TEF A;  5CYK B;  3SVW D;  3PE7 A;  4GQB B;  3JRO A;  3EI2 A;  1U2V C;  2H9P A;  3I89 A;  2OIZ A;  3AFC A;  4H5J A;  5FKR A;  1NR0 A;  2EBS A;  4GGC A;  4CI8 A;  3SMR A;  4Y7R A;  3N0E A;  5TDH B;  5FXY A;  5B4W A;  4A0A B;  4G56 B;  2P9P C;  1MG2 A;  4J84 A;  4NSX A;  4FA4 D;  4CZX A;  2OK4 A;  4E5Z A;  2AGL A;  3J81 g;  2CE8 A;  2HES X;  4FAN D;  4IA9 A;  1JMX B;  5IC7 A;  3OL2 A;  4X60 B;  5FKQ A;  2OVP B;  3EI3 A;  2H47 A;  5C9Z B;  3F3G A;  2I0S A;  4GM8 A;  4A2M A;  5GXI A;  4ZN4 A;  4FAV D;  5EMJ B;  4L3G D;  5SXM A;  4GM3 A;  4YVD A;  4A08 B;  3C75 H;  5CXC B;  5HE0 B;  5AFU 3;  5EML B;  2XL2 A;  3EI4 A;  4GQ1 A;  3GRE A;  4L3H D;  4EWR A;  3UVK A;  5GXH A;  1XIP A;  1SHY B;  4MK0 B;  4LG9 A;  5THA A;  4JT5 C;  4L9O A;  4PSW B;  4BL0 A;  1Q47 A;  3AL9 A;  2UZX B;  4ZOX A;  4R7A B;  2H3X A;  1R5M A;  2CO0 C;  4O9D A;  3F3P A;  2AGY A;  3UKU C;  2QXV A;  2J56 H;  1QNI A;  2I3T A;  3A0F A;  1GXR A;  3MKQ A;  4N14 A;  3EI2 B;  4A0A A;  2IWK A;  3SWS D;  5IJ8 E;  3ULE C;  4AEZ A;  2G9A A;  4J0W A;  3VA6 A;  3RN1 D;  3KRW B;  1JMZ B;  5C2V B;  3ZWL B;  2I0R A;  3P4F A;  5I5M A;  3V7D B;  4QL1 A;  4AOW A;  4E5Z B;  1ERJ A;  2TRC B;  5EAP A;  3V9F A;  3AL8 A;  4CZY A;  3FGB A;  3UVO A;  2G99 A;  3I7P A;  2YMU A;  3OL2 B;  3SJL D;  4A7J A;  5EMK B;  3EI3 B;  2IUV A;  4D0K A;  4O45 A;  1A0R B;  2Z2P A;  2Z2O A;  4J8B A;  4O1Q D;  3OW8 A;  2H6Q A;  2H6N A;  2W18 A;  3SBQ A;  2OK6 A;  4O3U B;  2GC4 A;  5FQD A;  3I8E A;  4IMM A;  3EI4 B;  4X3E A;  3FM0 A;  5KDO B;  1N6F A;  3I7N A;  3PSL A;  2QC5 A;  2PBI B;  3HFQ A;  3N0D A;  1OMW B;  3UVN A;  3MZK A;  2P9K C;  2H9M A;  4J82 A;  2PM9 A;  2YNP A;  3EI1 B;  3OKY B;  2O9K A;  2H6K A;  4JSX C;  2HKM A;  4J8G A;  5IJ7 E;  3U4Y A;  4J73 A;  5FKS A;  2OVR B;  4GM9 A;  5K1C C;  5AMS A;  3ORV D;  3IJ0 A;  4PBY A;  2XYI A;  3I7L A;  2XL3 A;  4J79 A;  3NVN A;  3DSM A;  3DWL C;  3VH0 A;  3DXK C;  3PXS D;  1JOF A;  4BUJ C;  3AL8 B;  4PSX B;  3PXT D;  2GNQ A;  3PXW D;  3SCY A;  4GGD A;  2CN2 A;  3EU7 A;  5H14 A;  3SFZ A;  5FA5 B;  5K19 A;  1PEV A;  3K27 A;  3SHF A;  4J77 A;  3UKR C;  4QQE A;  2CE9 A;  3EWE A;  2B5M A;  4L1Q D;  3F3F A;  4U1E I;  5FLX g;  2HYE A;  5EM2 B;  3MXX A;  2P9N C;  3PSC B;  2Z2N A;  3RFH A;  4A11 B;  3BG1 A;  3EI1 A;  5EAM A;  4X61 B; 
#chains in the Genus database with same CATH topology
 3OKY A;  4ERZ A;  1N6E A;  1GP2 B;  3BWS A;  4FWW A;  4ESG A;  5HQG A;  3CFV A;  4H5I A;  4PXW A;  2PM9 B;  4JXM A;  3NVQ A;  2P9S C;  4HDJ A;  3MZL A;  4BCB A;  3MUO A;  3DXM C;  4X63 B;  4ZOV A;  1XKS A;  2HU8 A;  3EQ8 A;  3I7H A;  4O02 A;  2VDN A;  2YB8 B;  2QR5 A;  1RI6 A;  4NAA A;  4BCD A;  4Z7O A;  3C5M A;  3KRX B;  3O4H A;  3T3P A;  3PVW B;  2Q7Q A;  3OKW A;  3UVM A;  1XHM A;  3JRP A;  5IT9 g;  4DNV A;  4QT8 A;  2CN3 A;  3SN6 B;  4CI3 A;  1B9Y A;  2I3S A;  5AJA A;  2GC7 A;  4L1M A;  5IGQ A;  3I8C A;  1B9X A;  1TYE A;  1VYH C;  4TZ4 A;  4CY3 A;  3SXT D;  5EM2 A;  3EMH A;  4WJK A;  2I0T A;  3JPX A;  4U7A A;  4CI2 A;  2CNX A;  1E8M A;  1K3I A;  5C86 A;  3AH8 B;  2P9I C;  5HE1 B;  4DNW A;  3EG6 A;  4Y5R D;  4A11 A;  4J78 A;  2CO0 A;  4BP8 A;  3VI3 A;  4K3J B;  2VDL A;  2UZY B;  4Z7N A;  4KFM B;  4J81 A;  3UR4 A;  4PC0 A;  4Z8L A;  4ES0 A;  3JZN A;  2EIB A;  5FKT A;  4DNU A;  1I2M B;  3V4V A;  4FA5 D;  1JJU B;  3RMZ D;  2IAA A;  2BKL A;  4UI9 R;  1T2X A;  4E54 B;  2XU7 A;  4PNK B;  4GZ8 A;  5H17 A;  2MTA H;  4XYH A;  3CIK B;  5E6U A;  2H68 A;  3OKT A;  2IUP A;  1SQJ A;  1MG3 A;  2HJB A;  2J55 H;  3MKS B;  2YNO A;  5H1M A;  4BCC A;  4J86 A;  2HJ4 A;  4IRZ A;  2YBA A;  1YFQ A;  3J80 g;  3NIF A;  3UVL A;  5A2Q g;  5GMK n;  4WK2 A;  3IUN A;  2YNN A;  2BBK H;  4FHL A;  3RFG A;  1N6D A;  5C2W B;  4O3T B;  2J57 G;  1O6G A;  4CY5 A;  4JSP C;  1PGU A;  4MMZ A;  3C9C A;  4LGN A;  1GOH A;  4FA1 D;  1NEX B;  2XE4 A;  4CY2 A;  3BG0 A;  5I5J A;  2OVQ B;  5EAL A;  5M5U A;  2BCJ B;  4A0B A;  4OZU A;  4J87 A;  1TBG A;  4FB1 D;  1FWX A;  3VI4 A;  1K8K C;  3NVX A;  4LG8 A;  4CY1 A;  1YR2 A;  4UM8 A;  3SLE D;  5HE3 B;  5JWZ A;  1H2Z A;  4CI1 A;  3JB9 L;  1OLZ A;  1VE7 A;  3DDU A;  5IGO A;  2B5L A;  1K32 A;  2AQ5 A;  2AGX A;  5TF2 A;  2EIC A;  3VGZ A;  2AH0 A;  4Z7Q A;  3CFS B;  2HU7 A;  2IUQ A;  3OF7 A;  5CXB B;  4E54 A;  2H13 A;  4GGA A;  4XEI C;  4G1E A;  4QRJ A;  1VE6 A;  5CYK A;  1PBY B;  4GMB A;  2VZ1 A;  4AN0 A;  5EAR A;  5HE2 B;  2H9N A;  2PM6 B;  3MMY A;  1P22 A;  3RRM C;  3I7K A;  4D6V A;  3L4M D;  3JZH A;  1M1X A;  1L0Q A;  2VDM A;  3GFC A;  1JV2 A;  3IJC A;  1SQ9 A;  3E0C A;  3L4O D;  2IWF A;  3ZE1 A;  2EID A;  1PI6 A;  4A09 B;  3IUR A;  1H2X A;  5TEE A;  2HXC A;  4JSN C;  1A12 A;  4MMX A;  3RN0 D;  4K3I D;  3JZG A;  1E8N A;  3O4I A;  3FRX A;  2H9L A;  3IIW A;  4JSV C;  1L5G A;  3FCS A;  2JKX A;  2P9U C;  2AH1 A;  3IIY A;  1GG2 B;  4ERY A;  4BH6 A;  1H2W A;  4NBM A;  2B5N A;  4ERQ A;  1U4C A;  4ZOZ A;  1GOT B;  3RSE C;  3ZE2 A;  4CZV A;  3B7F A;  3V5W B;  5M5S A;  4PBZ A;  4OWR A;  1UOQ A;  3IJ1 A;  4J0X A;  1TYQ C;  2H14 A;  4CC9 A;  3SBR A;  1VZ3 A;  3SBP A;  5EMM B;  3K26 A;  2VDQ A;  4A2L A;  2HU5 A;  4A0B B;  3JAM g;  3IKO A;  3I2N A;  3RLM D;  4A08 A;  2P9L C;  4I79 A;  3ZDY A;  3EQ7 A;  5CXB A;  5CXC A;  1MDA H;  3OTT A;  4XYI A;  3DM0 A;  2VDO A;  3V4P A;  2HKR A;  3W15 A;  3C99 A;  5I5I A;  2OJY A;  4NC4 A;  5HYN B;  3PVU B;  2AGZ A;  5E6R A;  4ZOY A;  2IUR A;  4JD2 C;  2AGW A;  4JT6 C;  4FA9 D;  4A09 A;  2PM7 B;  1S4U X;  4GQ2 P;  3I7O A;  2B4E A;  3ODT A;  5GSA A;  5TEF A;  5CYK B;  2VDR A;  4G55 A;  3SVW D;  3PE7 A;  4GQB B;  3JRO A;  3EI2 A;  1U2V C;  2H9P A;  3I89 A;  2OIZ A;  3IJE A;  4JHP C;  3AFC A;  4O2W A;  4H5J A;  5FKR A;  1NR0 A;  2EBS A;  4GGC A;  4CI8 A;  4AMZ A;  3IVM A;  3SMR A;  4Y7R A;  3N0E A;  5TDH B;  5FXY A;  5B4W A;  3NIG A;  4A0A B;  4G56 B;  2P9P C;  1MG2 A;  5FFG A;  4J84 A;  3NID A;  4NSX A;  4FA4 D;  1JTD B;  4CZX A;  2OK4 A;  4E5Z A;  2AGL A;  4WK4 A;  5FFO A;  3J81 g;  4RE5 A;  2CE8 A;  2HES X;  1GOF A;  5HDB A;  4FAN D;  4IA9 A;  1JMX B;  5IC7 A;  3OL2 A;  4X60 B;  4AMY A;  5FKQ A;  3EI3 A;  2OVP B;  3T3M A;  2VC2 A;  2H47 A;  3K6S A;  5C9Z B;  3F3G A;  2I0S A;  4GM8 A;  4A2M A;  5GXI A;  2QZP A;  4FAV D;  5EMJ B;  4ZN4 A;  4L3G D;  5SXM A;  4GM3 A;  1BPO A;  4YVD A;  1UOO A;  3QI0 A;  4A08 B;  3C75 H;  5CXC B;  5HE0 B;  5AFU 3;  5EML B;  2XL2 A;  3EI4 A;  3MVD K;  4UM9 A;  4GQ1 A;  3GRE A;  4L3H D;  4EWR A;  3UVK A;  5GXH A;  1XIP A;  1SHY B;  4MK0 B;  3KCI A;  5M5T A;  4LG9 A;  5THA A;  4JT5 C;  4L9O A;  4PSW B;  4BL0 A;  1Q47 A;  1E5T A;  3AL9 A;  2UZX B;  4ZOX A;  4R7A B;  2H3X A;  1R5M A;  1C9I A;  2CO0 C;  2VDP A;  3F3P A;  2AGY A;  4O9D A;  3UKU C;  2QXV A;  2J56 H;  1QNI A;  4D9S A;  2I3T A;  2VDK A;  3A0F A;  1GXR A;  3MKQ A;  4N14 A;  3EI2 B;  4A0A A;  2IWK A;  3SWS D;  5IJ8 E;  3ULE C;  3IUQ A;  4AEZ A;  3O4G A;  1UTC A;  2G9A A;  4J0W A;  3VA6 A;  3RN1 D;  3KRW B;  1JMZ B;  3O4J A;  5C2V B;  3ZWL B;  4MMY A;  2I0R A;  3P4F A;  5I5M A;  3V7D B;  4QL1 A;  4AOW A;  2VZ3 A;  5C92 A;  4E5Z B;  1ERJ A;  2TRC B;  5EAP A;  3V9F A;  3AL8 A;  4CZY A;  3FGB A;  3UVO A;  2G99 A;  3I7P A;  2YMU A;  2EIE A;  2XDW A;  3K71 A;  3OL2 B;  3SJL D;  4A7J A;  5EMK B;  3GC3 B;  3EI3 B;  2IUV A;  4D0K A;  4O45 A;  4AX4 A;  1A0R B;  2Z2P A;  2Z2O A;  4J8B A;  1QFM A;  4O1Q D;  1U8C A;  5E6S A;  3OW8 A;  2H6Q A;  2H6N A;  3IUM A;  2W18 A;  2WQ8 A;  3SBQ A;  2OK6 A;  4O3U B;  2GC4 A;  5FQD A;  3I8E A;  4IMM A;  3EI4 B;  4X3E A;  3FM0 A;  5KDO B;  1N6F A;  2XZG A;  3MUN A;  3I7N A;  3PSL A;  2QC5 A;  1C9L A;  3QHY B;  4G1M A;  4WK0 A;  1QFS A;  2PBI B;  3HFQ A;  3N0D A;  4QAM A;  1OMW B;  3UVN A;  3MZK A;  2P9K C;  2H9M A;  4J82 A;  3GD1 I;  2PM9 A;  1GOG A;  2YNP A;  3EI1 B;  3K72 A;  3OKY B;  4NEN A;  2O9K A;  2H6K A;  4JSX C;  2HKM A;  4J8G A;  4AN1 A;  5IJ7 E;  3U4Y A;  3ZDX A;  4J73 A;  3ZDZ A;  4BP9 A;  5FKS A;  2OVR B;  4GM9 A;  5K1C C;  5AMS A;  3ORV D;  3IJ0 A;  4PBY A;  2XYI A;  3EQ9 A;  3I7L A;  2XL3 A;  4J79 A;  3NVN A;  3DSM A;  3DWL C;  3VH0 A;  3DXK C;  3PXS D;  1JOF A;  4BUJ C;  3AL8 B;  4PSX B;  2GNQ A;  3PXW D;  3PXT D;  3SCY A;  3IUL A;  4GGD A;  2CN2 A;  3EU7 A;  3FCU A;  5H14 A;  3SFZ A;  5FA5 B;  5K19 A;  1PEV A;  3K27 A;  3SHF A;  1H2Y A;  4J77 A;  3UKR C;  4QQE A;  2CE9 A;  3EWE A;  2B5M A;  4L1Q D;  3F3F A;  4RE6 A;  5M5R A;  4U1E I;  3ZE0 A;  5FLX g;  3IUJ A;  5M5V A;  2HYE A;  5EM2 B;  3MXX A;  5M61 A;  2P9N C;  3PSC B;  2Z2N A;  4JHN A;  1O6F A;  3RFH A;  4A11 B;  3BG1 A;  5EAM A;  1VZ2 A;  3EI1 A;  1UOP A;  4X61 B; 
#chains in the Genus database with same CATH homology
 3OKY A;  4ERZ A;  1N6E A;  1GP2 B;  3BWS A;  4FWW A;  4ESG A;  5HQG A;  3CFV A;  4H5I A;  4PXW A;  2PM9 B;  4JXM A;  3NVQ A;  2P9S C;  4HDJ A;  3MZL A;  3DXM C;  4X63 B;  4ZOV A;  1XKS A;  3I7H A;  2YB8 B;  1RI6 A;  3C5M A;  3KRX B;  3PVW B;  2Q7Q A;  3OKW A;  3UVM A;  1XHM A;  3JRP A;  5IT9 g;  4QT8 A;  2CN3 A;  3SN6 B;  4CI3 A;  1B9Y A;  2I3S A;  5AJA A;  2GC7 A;  5IGQ A;  3I8C A;  1B9X A;  1VYH C;  4TZ4 A;  4CY3 A;  3SXT D;  5EM2 A;  3EMH A;  2I0T A;  3JPX A;  4U7A A;  4CI2 A;  2CNX A;  3AH8 B;  2P9I C;  5HE1 B;  3EG6 A;  4Y5R D;  4A11 A;  4J78 A;  2CO0 A;  4K3J B;  2UZY B;  4KFM B;  4J81 A;  3UR4 A;  4PC0 A;  4Z8L A;  4ES0 A;  3JZN A;  5FKT A;  4FA5 D;  1JJU B;  3RMZ D;  2IAA A;  4UI9 R;  4E54 B;  2XU7 A;  4PNK B;  4GZ8 A;  5H17 A;  2MTA H;  4XYH A;  3CIK B;  2H68 A;  3OKT A;  2IUP A;  1SQJ A;  1MG3 A;  2HJB A;  2J55 H;  3MKS B;  2YNO A;  5H1M A;  4J86 A;  2HJ4 A;  2YBA A;  1YFQ A;  3J80 g;  3UVL A;  5A2Q g;  5GMK n;  2YNN A;  2BBK H;  4FHL A;  3RFG A;  1N6D A;  5C2W B;  4O3T B;  2J57 G;  4CY5 A;  4JSP C;  1PGU A;  3C9C A;  4LGN A;  4FA1 D;  1NEX B;  4CY2 A;  3BG0 A;  5I5J A;  2OVQ B;  5EAL A;  2BCJ B;  4A0B A;  4OZU A;  4J87 A;  1TBG A;  4FB1 D;  1FWX A;  1K8K C;  3NVX A;  4LG8 A;  4CY1 A;  3SLE D;  5HE3 B;  5JWZ A;  4CI1 A;  3JB9 L;  1OLZ A;  5IGO A;  2B5L A;  1K32 A;  2AQ5 A;  2AGX A;  5TF2 A;  3VGZ A;  2AH0 A;  3CFS B;  2IUQ A;  5CXB B;  4E54 A;  2H13 A;  4GGA A;  4XEI C;  4QRJ A;  5CYK A;  1PBY B;  4GMB A;  5EAR A;  5HE2 B;  2H9N A;  2PM6 B;  3MMY A;  1P22 A;  3RRM C;  3I7K A;  4D6V A;  3L4M D;  3JZH A;  3GFC A;  1L0Q A;  3IJC A;  1SQ9 A;  3E0C A;  3L4O D;  2IWF A;  1PI6 A;  4A09 B;  5TEE A;  2HXC A;  4JSN C;  3RN0 D;  4K3I D;  3JZG A;  3FRX A;  2H9L A;  3IIW A;  4JSV C;  2P9U C;  2AH1 A;  3IIY A;  1GG2 B;  4ERY A;  4BH6 A;  2B5N A;  4ERQ A;  1U4C A;  4ZOZ A;  1GOT B;  3RSE C;  4CZV A;  3B7F A;  3V5W B;  4PBZ A;  4OWR A;  3IJ1 A;  4J0X A;  1TYQ C;  2H14 A;  4CC9 A;  3SBR A;  3SBP A;  5EMM B;  3K26 A;  4A2L A;  4A0B B;  3JAM g;  3IKO A;  3I2N A;  3RLM D;  4A08 A;  2P9L C;  4I79 A;  5CXB A;  5CXC A;  1MDA H;  3OTT A;  4XYI A;  3DM0 A;  3W15 A;  2HKR A;  3C99 A;  5I5I A;  2OJY A;  5HYN B;  3PVU B;  2AGZ A;  4ZOY A;  2IUR A;  4JD2 C;  2AGW A;  4JT6 C;  4FA9 D;  4A09 A;  2PM7 B;  1S4U X;  4GQ2 P;  3I7O A;  2B4E A;  3ODT A;  5GSA A;  5TEF A;  5CYK B;  3SVW D;  3PE7 A;  4GQB B;  3JRO A;  3EI2 A;  1U2V C;  2H9P A;  3I89 A;  2OIZ A;  3AFC A;  4H5J A;  5FKR A;  1NR0 A;  2EBS A;  4GGC A;  4CI8 A;  3SMR A;  4Y7R A;  3N0E A;  5TDH B;  5FXY A;  5B4W A;  4A0A B;  4G56 B;  2P9P C;  1MG2 A;  4J84 A;  4NSX A;  4FA4 D;  4CZX A;  2OK4 A;  4E5Z A;  2AGL A;  3J81 g;  2CE8 A;  2HES X;  4FAN D;  4IA9 A;  1JMX B;  5IC7 A;  3OL2 A;  4X60 B;  5FKQ A;  2OVP B;  3EI3 A;  2H47 A;  5C9Z B;  3F3G A;  2I0S A;  4GM8 A;  4A2M A;  5GXI A;  4ZN4 A;  4FAV D;  5EMJ B;  4L3G D;  5SXM A;  4GM3 A;  4YVD A;  4A08 B;  3C75 H;  5CXC B;  5HE0 B;  5AFU 3;  5EML B;  2XL2 A;  3EI4 A;  4GQ1 A;  3GRE A;  4L3H D;  4EWR A;  3UVK A;  5GXH A;  1XIP A;  1SHY B;  4MK0 B;  4LG9 A;  5THA A;  4JT5 C;  4L9O A;  4PSW B;  4BL0 A;  1Q47 A;  3AL9 A;  2UZX B;  4ZOX A;  4R7A B;  2H3X A;  1R5M A;  2CO0 C;  4O9D A;  3F3P A;  2AGY A;  3UKU C;  2QXV A;  2J56 H;  1QNI A;  2I3T A;  3A0F A;  1GXR A;  3MKQ A;  4N14 A;  3EI2 B;  4A0A A;  2IWK A;  3SWS D;  5IJ8 E;  3ULE C;  4AEZ A;  2G9A A;  4J0W A;  3VA6 A;  3RN1 D;  3KRW B;  1JMZ B;  5C2V B;  3ZWL B;  2I0R A;  3P4F A;  5I5M A;  3V7D B;  4QL1 A;  4AOW A;  4E5Z B;  1ERJ A;  2TRC B;  5EAP A;  3V9F A;  3AL8 A;  4CZY A;  3FGB A;  3UVO A;  2G99 A;  3I7P A;  2YMU A;  3OL2 B;  3SJL D;  4A7J A;  5EMK B;  3EI3 B;  2IUV A;  4D0K A;  4O45 A;  1A0R B;  2Z2P A;  2Z2O A;  4J8B A;  4O1Q D;  3OW8 A;  2H6Q A;  2H6N A;  2W18 A;  3SBQ A;  2OK6 A;  4O3U B;  2GC4 A;  5FQD A;  3I8E A;  4IMM A;  3EI4 B;  4X3E A;  3FM0 A;  5KDO B;  1N6F A;  3I7N A;  3PSL A;  2QC5 A;  2PBI B;  3HFQ A;  3N0D A;  1OMW B;  3UVN A;  3MZK A;  2P9K C;  2H9M A;  4J82 A;  2PM9 A;  2YNP A;  3EI1 B;  3OKY B;  2O9K A;  2H6K A;  4JSX C;  2HKM A;  4J8G A;  5IJ7 E;  3U4Y A;  4J73 A;  5FKS A;  2OVR B;  4GM9 A;  5K1C C;  5AMS A;  3ORV D;  3IJ0 A;  4PBY A;  2XYI A;  3I7L A;  2XL3 A;  4J79 A;  3NVN A;  3DSM A;  3DWL C;  3VH0 A;  3DXK C;  3PXS D;  1JOF A;  4BUJ C;  3AL8 B;  4PSX B;  3PXT D;  2GNQ A;  3PXW D;  3SCY A;  4GGD A;  2CN2 A;  3EU7 A;  5H14 A;  3SFZ A;  5FA5 B;  5K19 A;  1PEV A;  3K27 A;  3SHF A;  4J77 A;  3UKR C;  4QQE A;  2CE9 A;  3EWE A;  2B5M A;  4L1Q D;  3F3F A;  4U1E I;  5FLX g;  2HYE A;  5EM2 B;  3MXX A;  2P9N C;  3PSC B;  2Z2N A;  3RFH A;  4A11 B;  3BG1 A;  3EI1 A;  5EAM A;  4X61 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...