4GM3A

Crystal structure of human wd repeat domain 5 with compound mm-101
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title High-affinity, small-molecule peptidomimetic inhibitors of MLL1/WDR5 protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 82
structure length 304
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm3A00
3C9CA 3UKRC 3OL2A 3VGZA 4XYHA 4X3EA 4IA9A 2B5NA 1K32A 2B5MA 2GC4A 2P9KC 4CZXA 3JROA 4O3TB 2XL3A 1XIPA 2PM9A 5I5IA 3DM0A 1FWXA 3MKQA 1XHMA 4A11A 5FKTA 1N6DA 3MZKA 4CY2A 3OW8A 4R7AB 5EARA 3RMZD 3EG6A 1U4CA 2B4EA 4ZOXA 4H5JA 5C2VB 4A09B 3PSLA 4J82A 2MTAH 2OK6A 4GGCA 2H9PA 3GREA 3SVWD 4A7JA 1S4UX 3MMYA 4H5IA 4E54B 4PSXB 3RN1D 2IAAA 2J56H 4QL1A 3OKYB 3EI2A 4D0KA 2QC5A 3I7NA 3A0FA 4I79A 4QRJA 2GC7A 5AJAA 4FA4D 4FA1D 3L4MD 1JMZB 5H14A 3I8EA 3OTTA 4JT5C 2W18A 1U2VC 4J77A 4O3UB 2O9KA 3JZHA 4PNKB 3C99A 2H6KA 2AGLA 3UR4A 5SXMA 3NVNA 4J79A 4IMMA 4ESGA 2P9UC 4FAND 3JZGA 2CE8A 3SLED 5EMJB 4GM9A 5I5JA 2IWFA 4CI8A 4E5ZA 5EMLB 1SHYB 4KFMB 2YBAA 4X60B 4L1QD 3MKSB 1OLZA 1TBGA 4A0AA 2OJYA 3I89A 3BG1A 5FLXg 3RRMC 1B9YA 4A08B 3CFVA 3EI4B 2P9NC 2G99A 3N0EA 5IC7A 5IGOA 4O9DA 4JXMA 5FKRA 2AQ5A 5TEEA 2HXCA 5C2WB 3RN0D 2PM6B 3PVUB 3EI1B 2H3XA 4FHLA 4A0BA 3DWLC 5IJ7E 2XU7A 3SFZA 2Z2OA 1SQJA 3JRPA 3AFCA 5HE2B 2IUQA 2AGWA 4CI3A 4Z8LA 3I7KA 2H9LA 2CNXA 2CN3A 1JJUB 2G9AA 5HYNB 4LG9A 2Z2PA 2OIZA 3AL8B 4GGDA 5C9ZB 3P4FA 3DSMA 2H47A 2I3SA 1N6EA 4X63B 4FA5D 4ES0A 2EBSA 4YVDA 3E0CA 5IGQA 4Y7RA 4NSXA 2OVQB 3OL2B 1VYHC 3I7OA 3RFGA 4L9OA 1TYQC 4ZOYA 2I3TA 4JSPC 2UZXB 4ERYA 3VA6A 2CE9A 4JSNC 3SBQA 2BCJB 3DXMC 1GP2B 4CY3A 3OKWA 2OK4A 3DXKC 2H14A 4O45A 3C5MA 4J86A 2HJ4A 4QQEA 5EAMA 4E54A 1RI6A 4ERQA 3SJLD 3OKYA 4ZN4A 3JPXA 4A2MA 3I7PA 5B4WA 2H9MA 2IUPA 2XYIA 3MZLA 1XKSA 3UVNA 2P9LC 5EM2B 3B7FA 2HYEA 3JZNA 2I0TA 2P9PC 3RLMD 3SMRA 3EWEA 3KRWB 4BL0A 5FQDA 3SN6B 3I7HA 4CY1A 5EMKB 3SXTD 3UVMA 2HKRA 2QXVA 4ZOVA 1N6FA 5THAA 5CXBB 2YB8B 4AOWA 2H13A 2AGYA 4CI2A 2P9IC 3K27A 4TZ4A 4XYIA 4GM8A 4OWRA 1NEXB 5GXIA 5FKQA 2HESX 2YNNA 3N0DA 5GSAA 1MDAH 3FRXA 5H1MA 2PBIB 3F3GA 4OZUA 3CIKB 3SWSD 4A08A 1GOTB 3EI4A 4GM3A 3UVOA 3I2NA 2CO0C 3EI3B 5AMSA 5TEFA 2Z2NA 3IJCA 4JT6C 3ODTA 3AL9A 4BH6A 1PGUA 1MG2A 4AEZA 4J8GA 3FGBA 3GFCA 3EI1A 3SBPA 2TRCB 2H68A 5H17A 2AH0A 1PEVA 1A0RB 4CZVA 4MK0B 1OMWB 5CXCB 4FAVD 1Q47A 4JD2C 5GMKn 3F3PA 2P9SC 3L4OD 3JB9L 2Q7QA 1K8KC 3AL8A 2I0RA 3PVWB 2H6NA 4Y5RD 1PI6A 2GNQA 3V5WB 3HFQA 4CI1A 5CYKB 5JWZA 2UZYB 5IJ8E 2J57G 3PE7A 3J81g 3UVLA 4J81A 4PSWB 5FKSA 1ERJA 2H6QA 3PXSD 3U4YA 3BG0A 4D6VA 2YNOA 3VH0A 4PBZA 4L3HD 5FXYA 4J0XA 3JAMg 4GMBA 3I7LA 3OKTA 1JMXB 1YFQA 3IIWA 4A09A 2I0SA 4J84A 1GXRA 2PM9B 4GGAA 4J73A 3J80g 5GXHA 3RSEC 2H9NA 4J78A 4A11B 4L3GD 3IIYA 3V9FA 2CO0A 4J87A 5HE1B 5HE3B 1B9XA 3IKOA 5I5MA 2PM7B 4FWWA 5TF2A 4G56B 3SHFA 1NR0A 3SBRA 4ZOZA 5EM2A 5HQGA 3C75H 3IJ0A 4GQ2P 4ERZA 4A2LA 2HKMA 3ULEC 1QNIA 4CC9A 4HDJA 4U1EI 4X61B 5EALA 2HJBA 2IURA 2AGZA 4LGNA 4JSVC 5HE0B 2IUVA 4UI9R 1L0QA 3NVQA 2CN2A 5CXBA 3EI2B 3W15A 2XL2A 4XEIC 4GQBB 4FA9D 1SQ9A 4J8BA 4QT8A 5EMMB 5FA5B 5EAPA 5KDOB 5K19A 2OVRB 3V7DB 3EU7A 1P22A 2BBKH 1JOFA 4GQ1A 3EI3A 3NVXA 3PXWD 3BWSA 4J0WA 3IJ1A 4O1QD 2B5LA 5TDHB 3PXTD 4PC0A 3EMHA 4K3JB 4PXWA 5K1CC 4GZ8A 4CZYA 2AH1A 4U7AA 1GG2B 4CY5A 2OVPB 4E5ZB 4JSXC 3UKUC 4N14A 1R5MA 3ZWLB 1PBYB 5CXCA 3K26A 3FM0A 3AH8B 4A0AB 4LG8A 2J55H 3UVKA 2AGXA 2YMUA 3RFHA 4FB1D 2IWKA 3SCYA 4BUJC 3I8CA 1MG3A 5AFU3 3CFSB 3ORVD 5CYKA 4PBYA 5A2Qg 3F3FA 5IT9g 2YNPA 3PSCB 3KRXB 4EWRA 4A0BB 3MXXA 4K3ID
chains in the Genus database with same CATH superfamily
3C9CA 4DNWA 1JV2A 3UKRC 3OL2A 3VGZA 4XYHA 4X3EA 4IA9A 2B5NA 4JHNA 1K32A 2B5MA 2GC4A 2P9KC 3FCSA 2VDQA 4CZXA 3JROA 1QFSA 2XL3A 4O3TB 1XIPA 1O6FA 2PM9A 2WQ8A 5I5IA 3DM0A 1FWXA 2XZGA 3MKQA 1XHMA 4A11A 5FKTA 1N6DA 3O4JA 3MZKA 4CY2A 5E6SA 4G1EA 3OW8A 4R7AB 3ZDYA 4NENA 5EARA 5E6UA 3RMZD 3EG6A 1U4CA 2B4EA 4ZOXA 4H5JA 5C2VB 1GOHA 3PSLA 4J82A 4A09B 2MTAH 1H2WA 2OK6A 4GGCA 2BKLA 2H9PA 3GREA 3SVWD 4A7JA 1S4UX 3MMYA 4H5IA 1H2ZA 2VDNA 4RE6A 4PSXB 4E54B 4O2WA 2IAAA 3RN1D 2J56H 4QL1A 4NC4A 3EQ9A 3OKYB 3IVMA 3EI2A 2VDKA 2VZ1A 4D0KA 4AMZA 2QC5A 3V4PA 4JHPC 3I7NA 1VZ3A 3A0FA 4I79A 4QRJA 2GC7A 5AJAA 4FA4D 4NAAA 4FA1D 3L4MD 1JMZB 5H14A 4RE5A 3I8EA 3OTTA 4JT5C 2W18A 2QR5A 1U2VC 2HU7A 3QI0A 4J77A 4O3UB 2O9KA 3JZHA 2VDPA 4MMXA 2VDRA 3C99A 4PNKB 2H6KA 2AGLA 3UR4A 5SXMA 3NVNA 4J79A 4IMMA 4ESGA 2P9UC 2HU5A 4FAND 3JZGA 2CE8A 3SLED 1UOQA 4GM9A 3NIGA 5EMJB 5I5JA 2IWFA 4CI8A 5M61A 4E5ZA 5EMLB 1SHYB 2VDOA 4KFMB 2YBAA 4X60B 3OF7A 4L1QD 3MKSB 1OLZA 1TBGA 4A0AA 2OJYA 5M5RA 3I89A 3BG1A 5FLXg 3RRMC 1B9YA 3IJEA 4A08B 3CFVA 3EI4B 2P9NC 2G99A 3N0EA 5IC7A 5IGOA 4DNUA 3KCIA 4O9DA 4JXMA 5FKRA 1GOFA 3NIDA 2AQ5A 5TEEA 1H2XA 3K6SA 2HXCA 3O4HA 5C2WB 3RN0D 2PM6B 3PVUB 3EI1B 1T2XA 2H3XA 2XDWA 4FHLA 4A0BA 3DWLC 4WK4A 5IJ7E 2XU7A 3SFZA 2Z2OA 1SQJA 3JRPA 3AFCA 3MUOA 5HE2B 2IUQA 2AGWA 4CI3A 4Z8LA 3I7KA 2H9LA 2CNXA 2CN3A 1JJUB 2G9AA 5HYNB 4LG9A 2Z2PA 2OIZA 3AL8B 4GGDA 5C9ZB 3P4FA 3O4IA 3NIFA 3DSMA 2H47A 2I3SA 1N6EA 4BP9A 4X63B 4FA5D 4ES0A 2EBSA 4YVDA 3E0CA 3ZE2A 5IGQA 4Y7RA 4NSXA 2OVQB 3OL2B 1VYHC 3I7OA 3RFGA 4L9OA 1TYQC 4ZOYA 2I3TA 4JSPC 2UZXB 4ERYA 3VA6A 2CE9A 4O02A 4JSNC 3SBQA 2BCJB 3DXMC 1GP2B 2HU8A 4CY3A 3OKWA 2OK4A 3DXKC 2H14A 4O45A 3C5MA 4WK0A 4J86A 4MMZA 2HJ4A 4QQEA 5FFGA 5EAMA 2EIDA 4E54A 1RI6A 4ERQA 3SJLD 4Z7NA 3OKYA 2JKXA 4ZN4A 3VI3A 3JPXA 4A2MA 3I7PA 5B4WA 2H9MA 2EICA 2IUPA 2XYIA 3MZLA 1XKSA 3UVNA 2P9LC 5EM2B 3B7FA 2HYEA 3JZNA 2I0TA 2P9PC 3RLMD 3SMRA 3EWEA 2EIEA 3KRWB 5M5SA 4BL0A 5FQDA 3SN6B 3I7HA 4CY1A 5EMKB 3SXTD 3UVMA 2HKRA 1JTDB 3FCUA 5M5UA 2QXVA 4ZOVA 1N6FA 5THAA 5CXBB 2YB8B 4AOWA 2H13A 2AGYA 4CI2A 2P9IC 3K27A 4TZ4A 4XYIA 4GM8A 4OWRA 1NEXB 4AMYA 5GXIA 5FKQA 2HESX 4AN1A 2YNNA 3N0DA 5GSAA 1MDAH 3FRXA 5H1MA 1I2MB 2PBIB 3F3GA 4OZUA 5FFOA 3CIKB 3SWSD 3ZDZA 4A08A 1GOTB 3EI4A 4GM3A 3UVOA 1C9LA 3I2NA 2CO0C 3EI3B 4DNVA 4G55A 3MUNA 4MMYA 5AMSA 5TEFA 1C9IA 2Z2NA 3EQ8A 3IJCA 4JT6C 3ODTA 2QZPA 3AL9A 4BH6A 1PGUA 4L1MA 3ZE1A 1MG2A 4AEZA 4WK2A 4J8GA 3FGBA 3GFCA 2VZ3A 3EI1A 1E8NA 3SBPA 2TRCB 2H68A 5H17A 2AH0A 1PEVA 1A0RB 1UOPA 4CZVA 4MK0B 1U8CA 1OMWB 5CXCB 4FAVD 2XE4A 1Q47A 4JD2C 5GMKn 3F3PA 1QFMA 2P9SC 3L4OD 3JB9L 2Q7QA 1L5GA 4NBMA 1K8KC 3AL8A 2I0RA 3PVWB 1M1XA 2H6NA 4Y5RD 1PI6A 4AN0A 4D9SA 2GNQA 3V5WB 3HFQA 4CI1A 1A12A 1H2YA 5C92A 5CYKB 5JWZA 2UZYB 5IJ8E 2J57G 3PE7A 3J81g 3UVLA 4IRZA 4J81A 4PSWB 5FKSA 1ERJA 2H6QA 4G1MA 3PXSD 3U4YA 3T3PA 3BG0A 4D6VA 2YNOA 3K72A 3VH0A 4PBZA 3IULA 4L3HD 5FXYA 5M5TA 4J0XA 3JAMg 4GMBA 3IURA 3I7LA 3OKTA 1JMXB 1YFQA 3IIWA 4A09A 2I0SA 4J84A 1GXRA 2PM9B 4GGAA 4J73A 3J80g 1VZ2A 5GXHA 3RSEC 2H9NA 4WJKA 4J78A 4A11B 5C86A 3EQ7A 4L3GD 3IIYA 3V9FA 2CO0A 4J87A 5HE1B 5HE3B 1B9XA 1VE7A 3V4VA 3IKOA 5I5MA 2PM7B 1E8MA 4FWWA 5TF2A 4G56B 3SHFA 3MVDK 1NR0A 3SBRA 3GD1I 4ZOZA 5EM2A 5HQGA 3C75H 1UOOA 3IUMA 3ZDXA 3IJ0A 4GQ2P 4ERZA 1UTCA 4A2LA 2HKMA 4UM8A 3ULEC 4BP8A 3IUQA 1QNIA 4CC9A 4HDJA 4U1EI 4Z7OA 4X61B 5EALA 2HJBA 2IURA 4QAMA 2AGZA 4LGNA 4JSVC 5HE0B 2IUVA 4UI9R 1L0QA 3NVQA 2CN2A 3O4GA 3GC3B 5CXBA 3T3MA 3EI2B 3W15A 2XL2A 4XEIC 4GQBB 4FA9D 1SQ9A 4J8BA 4QT8A 5EMMB 5FA5B 5EAPA 5KDOB 1K3IA 5K19A 2OVRB 5E6RA 3V7DB 1E5TA 3EU7A 1P22A 2BBKH 1JOFA 4Z7QA 4GQ1A 2VDMA 1TYEA 3EI3A 3NVXA 3PXWD 3VI4A 3BWSA 4J0WA 3IJ1A 4O1QD 2B5LA 5HDBA 5TDHB 3PXTD 4UM9A 4PC0A 3EMHA 4BCBA 4K3JB 4PXWA 5K1CC 4GZ8A 2VDLA 4CZYA 2AH1A 4U7AA 1GG2B 1O6GA 4CY5A 2OVPB 4E5ZB 3IUJA 4JSXC 3IUNA 3UKUC 4N14A 1R5MA 3ZE0A 3ZWLB 1PBYB 5CXCA 3K26A 1BPOA 3FM0A 4BCDA 5M5VA 3AH8B 4A0AB 1GOGA 4LG8A 2J55H 3UVKA 3K71A 4AX4A 2AGXA 2EIBA 2YMUA 3RFHA 2VC2A 4FB1D 2IWKA 3SCYA 4BUJC 3I8CA 1MG3A 1VE6A 1YR2A 5AFU3 3DDUA 4BCCA 3CFSB 3ORVD 5CYKA 4PBYA 5A2Qg 3F3FA 5IT9g 3QHYB 2YNPA 3PSCB 3KRXB 4EWRA 4A0BB 3MXXA 4K3ID
chains in the Genus database with same CATH topology
3C9CA 3UKRC 3OL2A 3VGZA 4XYHA 4X3EA 4IA9A 2B5NA 1K32A 2B5MA 2GC4A 2P9KC 4CZXA 3JROA 4O3TB 2XL3A 1XIPA 2PM9A 5I5IA 3DM0A 1FWXA 3MKQA 1XHMA 4A11A 5FKTA 1N6DA 3MZKA 4CY2A 3OW8A 4R7AB 5EARA 3RMZD 3EG6A 1U4CA 2B4EA 4ZOXA 4H5JA 5C2VB 4A09B 3PSLA 4J82A 2MTAH 2OK6A 4GGCA 2H9PA 3GREA 3SVWD 4A7JA 1S4UX 3MMYA 4H5IA 4E54B 4PSXB 3RN1D 2IAAA 2J56H 4QL1A 3OKYB 3EI2A 4D0KA 2QC5A 3I7NA 3A0FA 4I79A 4QRJA 2GC7A 5AJAA 4FA4D 4FA1D 3L4MD 1JMZB 5H14A 3I8EA 3OTTA 4JT5C 2W18A 1U2VC 4J77A 4O3UB 2O9KA 3JZHA 4PNKB 3C99A 2H6KA 2AGLA 3UR4A 5SXMA 3NVNA 4J79A 4IMMA 4ESGA 2P9UC 4FAND 3JZGA 2CE8A 3SLED 5EMJB 4GM9A 5I5JA 2IWFA 4CI8A 4E5ZA 5EMLB 1SHYB 4KFMB 2YBAA 4X60B 4L1QD 3MKSB 1OLZA 1TBGA 4A0AA 2OJYA 3I89A 3BG1A 5FLXg 3RRMC 1B9YA 4A08B 3CFVA 3EI4B 2P9NC 2G99A 3N0EA 5IC7A 5IGOA 4O9DA 4JXMA 5FKRA 2AQ5A 5TEEA 2HXCA 5C2WB 3RN0D 2PM6B 3PVUB 3EI1B 2H3XA 4FHLA 4A0BA 3DWLC 5IJ7E 2XU7A 3SFZA 2Z2OA 1SQJA 3JRPA 3AFCA 5HE2B 2IUQA 2AGWA 4CI3A 4Z8LA 3I7KA 2H9LA 2CNXA 2CN3A 1JJUB 2G9AA 5HYNB 4LG9A 2Z2PA 2OIZA 3AL8B 4GGDA 5C9ZB 3P4FA 3DSMA 2H47A 2I3SA 1N6EA 4X63B 4FA5D 4ES0A 2EBSA 4YVDA 3E0CA 5IGQA 4Y7RA 4NSXA 2OVQB 3OL2B 1VYHC 3I7OA 3RFGA 4L9OA 1TYQC 4ZOYA 2I3TA 4JSPC 2UZXB 4ERYA 3VA6A 2CE9A 4JSNC 3SBQA 2BCJB 3DXMC 1GP2B 4CY3A 3OKWA 2OK4A 3DXKC 2H14A 4O45A 3C5MA 4J86A 2HJ4A 4QQEA 5EAMA 4E54A 1RI6A 4ERQA 3SJLD 3OKYA 4ZN4A 3JPXA 4A2MA 3I7PA 5B4WA 2H9MA 2IUPA 2XYIA 3MZLA 1XKSA 3UVNA 2P9LC 5EM2B 3B7FA 2HYEA 3JZNA 2I0TA 2P9PC 3RLMD 3SMRA 3EWEA 3KRWB 4BL0A 5FQDA 3SN6B 3I7HA 4CY1A 5EMKB 3SXTD 3UVMA 2HKRA 2QXVA 4ZOVA 1N6FA 5THAA 5CXBB 2YB8B 4AOWA 2H13A 2AGYA 4CI2A 2P9IC 3K27A 4TZ4A 4XYIA 4GM8A 4OWRA 1NEXB 5GXIA 5FKQA 2HESX 2YNNA 3N0DA 5GSAA 1MDAH 3FRXA 5H1MA 2PBIB 3F3GA 4OZUA 3CIKB 3SWSD 4A08A 1GOTB 3EI4A 4GM3A 3UVOA 3I2NA 2CO0C 3EI3B 5AMSA 5TEFA 2Z2NA 3IJCA 4JT6C 3ODTA 3AL9A 4BH6A 1PGUA 1MG2A 4AEZA 4J8GA 3FGBA 3GFCA 3EI1A 3SBPA 2TRCB 2H68A 5H17A 2AH0A 1PEVA 1A0RB 4CZVA 4MK0B 1OMWB 5CXCB 4FAVD 1Q47A 4JD2C 5GMKn 3F3PA 2P9SC 3L4OD 3JB9L 2Q7QA 1K8KC 3AL8A 2I0RA 3PVWB 2H6NA 4Y5RD 1PI6A 2GNQA 3V5WB 3HFQA 4CI1A 5CYKB 5JWZA 2UZYB 5IJ8E 2J57G 3PE7A 3J81g 3UVLA 4J81A 4PSWB 5FKSA 1ERJA 2H6QA 3PXSD 3U4YA 3BG0A 4D6VA 2YNOA 3VH0A 4PBZA 4L3HD 5FXYA 4J0XA 3JAMg 4GMBA 3I7LA 3OKTA 1JMXB 1YFQA 3IIWA 4A09A 2I0SA 4J84A 1GXRA 2PM9B 4GGAA 4J73A 3J80g 5GXHA 3RSEC 2H9NA 4J78A 4A11B 4L3GD 3IIYA 3V9FA 2CO0A 4J87A 5HE1B 5HE3B 1B9XA 3IKOA 5I5MA 2PM7B 4FWWA 5TF2A 4G56B 3SHFA 1NR0A 3SBRA 4ZOZA 5EM2A 5HQGA 3C75H 3IJ0A 4GQ2P 4ERZA 4A2LA 2HKMA 3ULEC 1QNIA 4CC9A 4HDJA 4U1EI 4X61B 5EALA 2HJBA 2IURA 2AGZA 4LGNA 4JSVC 5HE0B 2IUVA 4UI9R 1L0QA 3NVQA 2CN2A 5CXBA 3EI2B 3W15A 2XL2A 4XEIC 4GQBB 4FA9D 1SQ9A 4J8BA 4QT8A 5EMMB 5FA5B 5EAPA 5KDOB 5K19A 2OVRB 3V7DB 3EU7A 1P22A 2BBKH 1JOFA 4GQ1A 3EI3A 3NVXA 3PXWD 3BWSA 4J0WA 3IJ1A 4O1QD 2B5LA 5TDHB 3PXTD 4PC0A 3EMHA 4K3JB 4PXWA 5K1CC 4GZ8A 4CZYA 2AH1A 4U7AA 1GG2B 4CY5A 2OVPB 4E5ZB 4JSXC 3UKUC 4N14A 1R5MA 3ZWLB 1PBYB 5CXCA 3K26A 3FM0A 3AH8B 4A0AB 4LG8A 2J55H 3UVKA 2AGXA 2YMUA 3RFHA 4FB1D 2IWKA 3SCYA 4BUJC 3I8CA 1MG3A 5AFU3 3CFSB 3ORVD 5CYKA 4PBYA 5A2Qg 3F3FA 5IT9g 2YNPA 3PSCB 3KRXB 4EWRA 4A0BB 3MXXA 4K3ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9C A;  3UKR C;  3OL2 A;  3VGZ A;  4XYH A;  4X3E A;  4IA9 A;  2B5N A;  1K32 A;  2B5M A;  2GC4 A;  2P9K C;  4CZX A;  3JRO A;  4O3T B;  2XL3 A;  1XIP A;  2PM9 A;  5I5I A;  3DM0 A;  1FWX A;  3MKQ A;  1XHM A;  4A11 A;  5FKT A;  1N6D A;  3MZK A;  4CY2 A;  3OW8 A;  4R7A B;  5EAR A;  3RMZ D;  3EG6 A;  1U4C A;  2B4E A;  4ZOX A;  4H5J A;  5C2V B;  4A09 B;  3PSL A;  4J82 A;  2MTA H;  2OK6 A;  4GGC A;  2H9P A;  3GRE A;  3SVW D;  4A7J A;  1S4U X;  3MMY A;  4H5I A;  4E54 B;  4PSX B;  3RN1 D;  2IAA A;  2J56 H;  4QL1 A;  3OKY B;  3EI2 A;  4D0K A;  2QC5 A;  3I7N A;  3A0F A;  4I79 A;  4QRJ A;  2GC7 A;  5AJA A;  4FA4 D;  4FA1 D;  3L4M D;  1JMZ B;  5H14 A;  3I8E A;  3OTT A;  4JT5 C;  2W18 A;  1U2V C;  4J77 A;  4O3U B;  2O9K A;  3JZH A;  4PNK B;  3C99 A;  2H6K A;  2AGL A;  3UR4 A;  5SXM A;  3NVN A;  4J79 A;  4IMM A;  4ESG A;  2P9U C;  4FAN D;  3JZG A;  2CE8 A;  3SLE D;  5EMJ B;  4GM9 A;  5I5J A;  2IWF A;  4CI8 A;  4E5Z A;  5EML B;  1SHY B;  4KFM B;  2YBA A;  4X60 B;  4L1Q D;  3MKS B;  1OLZ A;  1TBG A;  4A0A A;  2OJY A;  3I89 A;  3BG1 A;  5FLX g;  3RRM C;  1B9Y A;  4A08 B;  3CFV A;  3EI4 B;  2P9N C;  2G99 A;  3N0E A;  5IC7 A;  5IGO A;  4O9D A;  4JXM A;  5FKR A;  2AQ5 A;  5TEE A;  2HXC A;  5C2W B;  3RN0 D;  2PM6 B;  3PVU B;  3EI1 B;  2H3X A;  4FHL A;  4A0B A;  3DWL C;  5IJ7 E;  2XU7 A;  3SFZ A;  2Z2O A;  1SQJ A;  3JRP A;  3AFC A;  5HE2 B;  2IUQ A;  2AGW A;  4CI3 A;  4Z8L A;  3I7K A;  2H9L A;  2CNX A;  2CN3 A;  1JJU B;  2G9A A;  5HYN B;  4LG9 A;  2Z2P A;  2OIZ A;  3AL8 B;  4GGD A;  5C9Z B;  3P4F A;  3DSM A;  2H47 A;  2I3S A;  1N6E A;  4X63 B;  4FA5 D;  4ES0 A;  2EBS A;  4YVD A;  3E0C A;  5IGQ A;  4Y7R A;  4NSX A;  2OVQ B;  3OL2 B;  1VYH C;  3I7O A;  3RFG A;  4L9O A;  1TYQ C;  4ZOY A;  2I3T A;  4JSP C;  2UZX B;  4ERY A;  3VA6 A;  2CE9 A;  4JSN C;  3SBQ A;  2BCJ B;  3DXM C;  1GP2 B;  4CY3 A;  3OKW A;  2OK4 A;  3DXK C;  2H14 A;  4O45 A;  3C5M A;  4J86 A;  2HJ4 A;  4QQE A;  5EAM A;  4E54 A;  1RI6 A;  4ERQ A;  3SJL D;  3OKY A;  4ZN4 A;  3JPX A;  4A2M A;  3I7P A;  5B4W A;  2H9M A;  2IUP A;  2XYI A;  3MZL A;  1XKS A;  3UVN A;  2P9L C;  5EM2 B;  3B7F A;  2HYE A;  3JZN A;  2I0T A;  2P9P C;  3RLM D;  3SMR A;  3EWE A;  3KRW B;  4BL0 A;  5FQD A;  3SN6 B;  3I7H A;  4CY1 A;  5EMK B;  3SXT D;  3UVM A;  2HKR A;  2QXV A;  4ZOV A;  1N6F A;  5THA A;  5CXB B;  2YB8 B;  4AOW A;  2H13 A;  2AGY A;  4CI2 A;  2P9I C;  3K27 A;  4TZ4 A;  4XYI A;  4GM8 A;  4OWR A;  1NEX B;  5GXI A;  5FKQ A;  2HES X;  2YNN A;  3N0D A;  5GSA A;  1MDA H;  3FRX A;  5H1M A;  2PBI B;  3F3G A;  4OZU A;  3CIK B;  3SWS D;  4A08 A;  1GOT B;  3EI4 A;  4GM3 A;  3UVO A;  3I2N A;  2CO0 C;  3EI3 B;  5AMS A;  5TEF A;  2Z2N A;  3IJC A;  4JT6 C;  3ODT A;  3AL9 A;  4BH6 A;  1PGU A;  1MG2 A;  4AEZ A;  4J8G A;  3FGB A;  3GFC A;  3EI1 A;  3SBP A;  2TRC B;  2H68 A;  5H17 A;  2AH0 A;  1PEV A;  1A0R B;  4CZV A;  4MK0 B;  1OMW B;  5CXC B;  4FAV D;  1Q47 A;  4JD2 C;  5GMK n;  3F3P A;  2P9S C;  3L4O D;  3JB9 L;  2Q7Q A;  1K8K C;  3AL8 A;  2I0R A;  3PVW B;  2H6N A;  4Y5R D;  1PI6 A;  2GNQ A;  3V5W B;  3HFQ A;  4CI1 A;  5CYK B;  5JWZ A;  2UZY B;  5IJ8 E;  2J57 G;  3PE7 A;  3J81 g;  3UVL A;  4J81 A;  4PSW B;  5FKS A;  1ERJ A;  2H6Q A;  3PXS D;  3U4Y A;  3BG0 A;  4D6V A;  2YNO A;  3VH0 A;  4PBZ A;  4L3H D;  5FXY A;  4J0X A;  3JAM g;  4GMB A;  3I7L A;  3OKT A;  1JMX B;  1YFQ A;  3IIW A;  4A09 A;  2I0S A;  4J84 A;  1GXR A;  2PM9 B;  4GGA A;  4J73 A;  3J80 g;  5GXH A;  3RSE C;  2H9N A;  4J78 A;  4A11 B;  4L3G D;  3IIY A;  3V9F A;  2CO0 A;  4J87 A;  5HE1 B;  5HE3 B;  1B9X A;  3IKO A;  5I5M A;  2PM7 B;  4FWW A;  5TF2 A;  4G56 B;  3SHF A;  1NR0 A;  3SBR A;  4ZOZ A;  5EM2 A;  5HQG A;  3C75 H;  3IJ0 A;  4GQ2 P;  4ERZ A;  4A2L A;  2HKM A;  3ULE C;  1QNI A;  4CC9 A;  4HDJ A;  4U1E I;  4X61 B;  5EAL A;  2HJB A;  2IUR A;  2AGZ A;  4LGN A;  4JSV C;  5HE0 B;  2IUV A;  4UI9 R;  1L0Q A;  3NVQ A;  2CN2 A;  5CXB A;  3EI2 B;  3W15 A;  2XL2 A;  4XEI C;  4GQB B;  4FA9 D;  1SQ9 A;  4J8B A;  4QT8 A;  5EMM B;  5FA5 B;  5EAP A;  5KDO B;  5K19 A;  2OVR B;  3V7D B;  3EU7 A;  1P22 A;  2BBK H;  1JOF A;  4GQ1 A;  3EI3 A;  3NVX A;  3PXW D;  3BWS A;  4J0W A;  3IJ1 A;  4O1Q D;  2B5L A;  5TDH B;  3PXT D;  4PC0 A;  3EMH A;  4K3J B;  4PXW A;  5K1C C;  4GZ8 A;  4CZY A;  2AH1 A;  4U7A A;  1GG2 B;  4CY5 A;  2OVP B;  4E5Z B;  4JSX C;  3UKU C;  4N14 A;  1R5M A;  3ZWL B;  1PBY B;  5CXC A;  3K26 A;  3FM0 A;  3AH8 B;  4A0A B;  4LG8 A;  2J55 H;  3UVK A;  2AGX A;  2YMU A;  3RFH A;  4FB1 D;  2IWK A;  3SCY A;  4BUJ C;  3I8C A;  1MG3 A;  5AFU 3;  3CFS B;  3ORV D;  5CYK A;  4PBY A;  5A2Q g;  3F3F A;  5IT9 g;  2YNP A;  3PSC B;  3KRX B;  4EWR A;  4A0B B;  3MXX A;  4K3I D; 
#chains in the Genus database with same CATH topology
 3C9C A;  4DNW A;  1JV2 A;  3UKR C;  3OL2 A;  3VGZ A;  4XYH A;  4X3E A;  4IA9 A;  2B5N A;  4JHN A;  1K32 A;  2B5M A;  2GC4 A;  2P9K C;  3FCS A;  2VDQ A;  4CZX A;  3JRO A;  1QFS A;  2XL3 A;  4O3T B;  1XIP A;  1O6F A;  2PM9 A;  2WQ8 A;  5I5I A;  3DM0 A;  1FWX A;  2XZG A;  3MKQ A;  1XHM A;  4A11 A;  5FKT A;  1N6D A;  3O4J A;  3MZK A;  4CY2 A;  5E6S A;  4G1E A;  3OW8 A;  4R7A B;  3ZDY A;  4NEN A;  5EAR A;  5E6U A;  3RMZ D;  3EG6 A;  1U4C A;  2B4E A;  4ZOX A;  4H5J A;  5C2V B;  1GOH A;  3PSL A;  4J82 A;  4A09 B;  2MTA H;  1H2W A;  2OK6 A;  4GGC A;  2BKL A;  2H9P A;  3GRE A;  3SVW D;  4A7J A;  1S4U X;  3MMY A;  4H5I A;  1H2Z A;  2VDN A;  4RE6 A;  4PSX B;  4E54 B;  4O2W A;  2IAA A;  3RN1 D;  2J56 H;  4QL1 A;  4NC4 A;  3EQ9 A;  3OKY B;  3IVM A;  3EI2 A;  2VDK A;  2VZ1 A;  4D0K A;  4AMZ A;  2QC5 A;  3V4P A;  4JHP C;  3I7N A;  1VZ3 A;  3A0F A;  4I79 A;  4QRJ A;  2GC7 A;  5AJA A;  4FA4 D;  4NAA A;  4FA1 D;  3L4M D;  1JMZ B;  5H14 A;  4RE5 A;  3I8E A;  3OTT A;  4JT5 C;  2W18 A;  2QR5 A;  1U2V C;  2HU7 A;  3QI0 A;  4J77 A;  4O3U B;  2O9K A;  3JZH A;  2VDP A;  4MMX A;  2VDR A;  3C99 A;  4PNK B;  2H6K A;  2AGL A;  3UR4 A;  5SXM A;  3NVN A;  4J79 A;  4IMM A;  4ESG A;  2P9U C;  2HU5 A;  4FAN D;  3JZG A;  2CE8 A;  3SLE D;  1UOQ A;  4GM9 A;  3NIG A;  5EMJ B;  5I5J A;  2IWF A;  4CI8 A;  5M61 A;  4E5Z A;  5EML B;  1SHY B;  2VDO A;  4KFM B;  2YBA A;  4X60 B;  3OF7 A;  4L1Q D;  3MKS B;  1OLZ A;  1TBG A;  4A0A A;  2OJY A;  5M5R A;  3I89 A;  3BG1 A;  5FLX g;  3RRM C;  1B9Y A;  3IJE A;  4A08 B;  3CFV A;  3EI4 B;  2P9N C;  2G99 A;  3N0E A;  5IC7 A;  5IGO A;  4DNU A;  3KCI A;  4O9D A;  4JXM A;  5FKR A;  1GOF A;  3NID A;  2AQ5 A;  5TEE A;  1H2X A;  3K6S A;  2HXC A;  3O4H A;  5C2W B;  3RN0 D;  2PM6 B;  3PVU B;  3EI1 B;  1T2X A;  2H3X A;  2XDW A;  4FHL A;  4A0B A;  3DWL C;  4WK4 A;  5IJ7 E;  2XU7 A;  3SFZ A;  2Z2O A;  1SQJ A;  3JRP A;  3AFC A;  3MUO A;  5HE2 B;  2IUQ A;  2AGW A;  4CI3 A;  4Z8L A;  3I7K A;  2H9L A;  2CNX A;  2CN3 A;  1JJU B;  2G9A A;  5HYN B;  4LG9 A;  2Z2P A;  2OIZ A;  3AL8 B;  4GGD A;  5C9Z B;  3P4F A;  3O4I A;  3NIF A;  3DSM A;  2H47 A;  2I3S A;  1N6E A;  4BP9 A;  4X63 B;  4FA5 D;  4ES0 A;  2EBS A;  4YVD A;  3E0C A;  3ZE2 A;  5IGQ A;  4Y7R A;  4NSX A;  2OVQ B;  3OL2 B;  1VYH C;  3I7O A;  3RFG A;  4L9O A;  1TYQ C;  4ZOY A;  2I3T A;  4JSP C;  2UZX B;  4ERY A;  3VA6 A;  2CE9 A;  4O02 A;  4JSN C;  3SBQ A;  2BCJ B;  3DXM C;  1GP2 B;  2HU8 A;  4CY3 A;  3OKW A;  2OK4 A;  3DXK C;  2H14 A;  4O45 A;  3C5M A;  4WK0 A;  4J86 A;  4MMZ A;  2HJ4 A;  4QQE A;  5FFG A;  5EAM A;  2EID A;  4E54 A;  1RI6 A;  4ERQ A;  3SJL D;  4Z7N A;  3OKY A;  2JKX A;  4ZN4 A;  3VI3 A;  3JPX A;  4A2M A;  3I7P A;  5B4W A;  2H9M A;  2EIC A;  2IUP A;  2XYI A;  3MZL A;  1XKS A;  3UVN A;  2P9L C;  5EM2 B;  3B7F A;  2HYE A;  3JZN A;  2I0T A;  2P9P C;  3RLM D;  3SMR A;  3EWE A;  2EIE A;  3KRW B;  5M5S A;  4BL0 A;  5FQD A;  3SN6 B;  3I7H A;  4CY1 A;  5EMK B;  3SXT D;  3UVM A;  2HKR A;  1JTD B;  3FCU A;  5M5U A;  2QXV A;  4ZOV A;  1N6F A;  5THA A;  5CXB B;  2YB8 B;  4AOW A;  2H13 A;  2AGY A;  4CI2 A;  2P9I C;  3K27 A;  4TZ4 A;  4XYI A;  4GM8 A;  4OWR A;  1NEX B;  4AMY A;  5GXI A;  5FKQ A;  2HES X;  4AN1 A;  2YNN A;  3N0D A;  5GSA A;  1MDA H;  3FRX A;  5H1M A;  1I2M B;  2PBI B;  3F3G A;  4OZU A;  5FFO A;  3CIK B;  3SWS D;  3ZDZ A;  4A08 A;  1GOT B;  3EI4 A;  4GM3 A;  3UVO A;  1C9L A;  3I2N A;  2CO0 C;  3EI3 B;  4DNV A;  4G55 A;  3MUN A;  4MMY A;  5AMS A;  5TEF A;  1C9I A;  2Z2N A;  3EQ8 A;  3IJC A;  4JT6 C;  3ODT A;  2QZP A;  3AL9 A;  4BH6 A;  1PGU A;  4L1M A;  3ZE1 A;  1MG2 A;  4AEZ A;  4WK2 A;  4J8G A;  3FGB A;  3GFC A;  2VZ3 A;  3EI1 A;  1E8N A;  3SBP A;  2TRC B;  2H68 A;  5H17 A;  2AH0 A;  1PEV A;  1A0R B;  1UOP A;  4CZV A;  4MK0 B;  1U8C A;  1OMW B;  5CXC B;  4FAV D;  2XE4 A;  1Q47 A;  4JD2 C;  5GMK n;  3F3P A;  1QFM A;  2P9S C;  3L4O D;  3JB9 L;  2Q7Q A;  1L5G A;  4NBM A;  1K8K C;  3AL8 A;  2I0R A;  3PVW B;  1M1X A;  2H6N A;  4Y5R D;  1PI6 A;  4AN0 A;  4D9S A;  2GNQ A;  3V5W B;  3HFQ A;  4CI1 A;  1A12 A;  1H2Y A;  5C92 A;  5CYK B;  5JWZ A;  2UZY B;  5IJ8 E;  2J57 G;  3PE7 A;  3J81 g;  3UVL A;  4IRZ A;  4J81 A;  4PSW B;  5FKS A;  1ERJ A;  2H6Q A;  4G1M A;  3PXS D;  3U4Y A;  3T3P A;  3BG0 A;  4D6V A;  2YNO A;  3K72 A;  3VH0 A;  4PBZ A;  3IUL A;  4L3H D;  5FXY A;  5M5T A;  4J0X A;  3JAM g;  4GMB A;  3IUR A;  3I7L A;  3OKT A;  1JMX B;  1YFQ A;  3IIW A;  4A09 A;  2I0S A;  4J84 A;  1GXR A;  2PM9 B;  4GGA A;  4J73 A;  3J80 g;  1VZ2 A;  5GXH A;  3RSE C;  2H9N A;  4WJK A;  4J78 A;  4A11 B;  5C86 A;  3EQ7 A;  4L3G D;  3IIY A;  3V9F A;  2CO0 A;  4J87 A;  5HE1 B;  5HE3 B;  1B9X A;  1VE7 A;  3V4V A;  3IKO A;  5I5M A;  2PM7 B;  1E8M A;  4FWW A;  5TF2 A;  4G56 B;  3SHF A;  3MVD K;  1NR0 A;  3SBR A;  3GD1 I;  4ZOZ A;  5EM2 A;  5HQG A;  3C75 H;  1UOO A;  3IUM A;  3ZDX A;  3IJ0 A;  4GQ2 P;  4ERZ A;  1UTC A;  4A2L A;  2HKM A;  4UM8 A;  3ULE C;  4BP8 A;  3IUQ A;  1QNI A;  4CC9 A;  4HDJ A;  4U1E I;  4Z7O A;  4X61 B;  5EAL A;  2HJB A;  2IUR A;  4QAM A;  2AGZ A;  4LGN A;  4JSV C;  5HE0 B;  2IUV A;  4UI9 R;  1L0Q A;  3NVQ A;  2CN2 A;  3O4G A;  3GC3 B;  5CXB A;  3T3M A;  3EI2 B;  3W15 A;  2XL2 A;  4XEI C;  4GQB B;  4FA9 D;  1SQ9 A;  4J8B A;  4QT8 A;  5EMM B;  5FA5 B;  5EAP A;  5KDO B;  1K3I A;  5K19 A;  2OVR B;  5E6R A;  3V7D B;  1E5T A;  3EU7 A;  1P22 A;  2BBK H;  1JOF A;  4Z7Q A;  4GQ1 A;  2VDM A;  1TYE A;  3EI3 A;  3NVX A;  3PXW D;  3VI4 A;  3BWS A;  4J0W A;  3IJ1 A;  4O1Q D;  2B5L A;  5HDB A;  5TDH B;  3PXT D;  4UM9 A;  4PC0 A;  3EMH A;  4BCB A;  4K3J B;  4PXW A;  5K1C C;  4GZ8 A;  2VDL A;  4CZY A;  2AH1 A;  4U7A A;  1GG2 B;  1O6G A;  4CY5 A;  2OVP B;  4E5Z B;  3IUJ A;  4JSX C;  3IUN A;  3UKU C;  4N14 A;  1R5M A;  3ZE0 A;  3ZWL B;  1PBY B;  5CXC A;  3K26 A;  1BPO A;  3FM0 A;  4BCD A;  5M5V A;  3AH8 B;  4A0A B;  1GOG A;  4LG8 A;  2J55 H;  3UVK A;  3K71 A;  4AX4 A;  2AGX A;  2EIB A;  2YMU A;  3RFH A;  2VC2 A;  4FB1 D;  2IWK A;  3SCY A;  4BUJ C;  3I8C A;  1MG3 A;  1VE6 A;  1YR2 A;  5AFU 3;  3DDU A;  4BCC A;  3CFS B;  3ORV D;  5CYK A;  4PBY A;  5A2Q g;  3F3F A;  5IT9 g;  3QHY B;  2YNP A;  3PSC B;  3KRX B;  4EWR A;  4A0B B;  3MXX A;  4K3I D; 
#chains in the Genus database with same CATH homology
 3C9C A;  3UKR C;  3OL2 A;  3VGZ A;  4XYH A;  4X3E A;  4IA9 A;  2B5N A;  1K32 A;  2B5M A;  2GC4 A;  2P9K C;  4CZX A;  3JRO A;  4O3T B;  2XL3 A;  1XIP A;  2PM9 A;  5I5I A;  3DM0 A;  1FWX A;  3MKQ A;  1XHM A;  4A11 A;  5FKT A;  1N6D A;  3MZK A;  4CY2 A;  3OW8 A;  4R7A B;  5EAR A;  3RMZ D;  3EG6 A;  1U4C A;  2B4E A;  4ZOX A;  4H5J A;  5C2V B;  4A09 B;  3PSL A;  4J82 A;  2MTA H;  2OK6 A;  4GGC A;  2H9P A;  3GRE A;  3SVW D;  4A7J A;  1S4U X;  3MMY A;  4H5I A;  4E54 B;  4PSX B;  3RN1 D;  2IAA A;  2J56 H;  4QL1 A;  3OKY B;  3EI2 A;  4D0K A;  2QC5 A;  3I7N A;  3A0F A;  4I79 A;  4QRJ A;  2GC7 A;  5AJA A;  4FA4 D;  4FA1 D;  3L4M D;  1JMZ B;  5H14 A;  3I8E A;  3OTT A;  4JT5 C;  2W18 A;  1U2V C;  4J77 A;  4O3U B;  2O9K A;  3JZH A;  4PNK B;  3C99 A;  2H6K A;  2AGL A;  3UR4 A;  5SXM A;  3NVN A;  4J79 A;  4IMM A;  4ESG A;  2P9U C;  4FAN D;  3JZG A;  2CE8 A;  3SLE D;  5EMJ B;  4GM9 A;  5I5J A;  2IWF A;  4CI8 A;  4E5Z A;  5EML B;  1SHY B;  4KFM B;  2YBA A;  4X60 B;  4L1Q D;  3MKS B;  1OLZ A;  1TBG A;  4A0A A;  2OJY A;  3I89 A;  3BG1 A;  5FLX g;  3RRM C;  1B9Y A;  4A08 B;  3CFV A;  3EI4 B;  2P9N C;  2G99 A;  3N0E A;  5IC7 A;  5IGO A;  4O9D A;  4JXM A;  5FKR A;  2AQ5 A;  5TEE A;  2HXC A;  5C2W B;  3RN0 D;  2PM6 B;  3PVU B;  3EI1 B;  2H3X A;  4FHL A;  4A0B A;  3DWL C;  5IJ7 E;  2XU7 A;  3SFZ A;  2Z2O A;  1SQJ A;  3JRP A;  3AFC A;  5HE2 B;  2IUQ A;  2AGW A;  4CI3 A;  4Z8L A;  3I7K A;  2H9L A;  2CNX A;  2CN3 A;  1JJU B;  2G9A A;  5HYN B;  4LG9 A;  2Z2P A;  2OIZ A;  3AL8 B;  4GGD A;  5C9Z B;  3P4F A;  3DSM A;  2H47 A;  2I3S A;  1N6E A;  4X63 B;  4FA5 D;  4ES0 A;  2EBS A;  4YVD A;  3E0C A;  5IGQ A;  4Y7R A;  4NSX A;  2OVQ B;  3OL2 B;  1VYH C;  3I7O A;  3RFG A;  4L9O A;  1TYQ C;  4ZOY A;  2I3T A;  4JSP C;  2UZX B;  4ERY A;  3VA6 A;  2CE9 A;  4JSN C;  3SBQ A;  2BCJ B;  3DXM C;  1GP2 B;  4CY3 A;  3OKW A;  2OK4 A;  3DXK C;  2H14 A;  4O45 A;  3C5M A;  4J86 A;  2HJ4 A;  4QQE A;  5EAM A;  4E54 A;  1RI6 A;  4ERQ A;  3SJL D;  3OKY A;  4ZN4 A;  3JPX A;  4A2M A;  3I7P A;  5B4W A;  2H9M A;  2IUP A;  2XYI A;  3MZL A;  1XKS A;  3UVN A;  2P9L C;  5EM2 B;  3B7F A;  2HYE A;  3JZN A;  2I0T A;  2P9P C;  3RLM D;  3SMR A;  3EWE A;  3KRW B;  4BL0 A;  5FQD A;  3SN6 B;  3I7H A;  4CY1 A;  5EMK B;  3SXT D;  3UVM A;  2HKR A;  2QXV A;  4ZOV A;  1N6F A;  5THA A;  5CXB B;  2YB8 B;  4AOW A;  2H13 A;  2AGY A;  4CI2 A;  2P9I C;  3K27 A;  4TZ4 A;  4XYI A;  4GM8 A;  4OWR A;  1NEX B;  5GXI A;  5FKQ A;  2HES X;  2YNN A;  3N0D A;  5GSA A;  1MDA H;  3FRX A;  5H1M A;  2PBI B;  3F3G A;  4OZU A;  3CIK B;  3SWS D;  4A08 A;  1GOT B;  3EI4 A;  4GM3 A;  3UVO A;  3I2N A;  2CO0 C;  3EI3 B;  5AMS A;  5TEF A;  2Z2N A;  3IJC A;  4JT6 C;  3ODT A;  3AL9 A;  4BH6 A;  1PGU A;  1MG2 A;  4AEZ A;  4J8G A;  3FGB A;  3GFC A;  3EI1 A;  3SBP A;  2TRC B;  2H68 A;  5H17 A;  2AH0 A;  1PEV A;  1A0R B;  4CZV A;  4MK0 B;  1OMW B;  5CXC B;  4FAV D;  1Q47 A;  4JD2 C;  5GMK n;  3F3P A;  2P9S C;  3L4O D;  3JB9 L;  2Q7Q A;  1K8K C;  3AL8 A;  2I0R A;  3PVW B;  2H6N A;  4Y5R D;  1PI6 A;  2GNQ A;  3V5W B;  3HFQ A;  4CI1 A;  5CYK B;  5JWZ A;  2UZY B;  5IJ8 E;  2J57 G;  3PE7 A;  3J81 g;  3UVL A;  4J81 A;  4PSW B;  5FKS A;  1ERJ A;  2H6Q A;  3PXS D;  3U4Y A;  3BG0 A;  4D6V A;  2YNO A;  3VH0 A;  4PBZ A;  4L3H D;  5FXY A;  4J0X A;  3JAM g;  4GMB A;  3I7L A;  3OKT A;  1JMX B;  1YFQ A;  3IIW A;  4A09 A;  2I0S A;  4J84 A;  1GXR A;  2PM9 B;  4GGA A;  4J73 A;  3J80 g;  5GXH A;  3RSE C;  2H9N A;  4J78 A;  4A11 B;  4L3G D;  3IIY A;  3V9F A;  2CO0 A;  4J87 A;  5HE1 B;  5HE3 B;  1B9X A;  3IKO A;  5I5M A;  2PM7 B;  4FWW A;  5TF2 A;  4G56 B;  3SHF A;  1NR0 A;  3SBR A;  4ZOZ A;  5EM2 A;  5HQG A;  3C75 H;  3IJ0 A;  4GQ2 P;  4ERZ A;  4A2L A;  2HKM A;  3ULE C;  1QNI A;  4CC9 A;  4HDJ A;  4U1E I;  4X61 B;  5EAL A;  2HJB A;  2IUR A;  2AGZ A;  4LGN A;  4JSV C;  5HE0 B;  2IUV A;  4UI9 R;  1L0Q A;  3NVQ A;  2CN2 A;  5CXB A;  3EI2 B;  3W15 A;  2XL2 A;  4XEI C;  4GQB B;  4FA9 D;  1SQ9 A;  4J8B A;  4QT8 A;  5EMM B;  5FA5 B;  5EAP A;  5KDO B;  5K19 A;  2OVR B;  3V7D B;  3EU7 A;  1P22 A;  2BBK H;  1JOF A;  4GQ1 A;  3EI3 A;  3NVX A;  3PXW D;  3BWS A;  4J0W A;  3IJ1 A;  4O1Q D;  2B5L A;  5TDH B;  3PXT D;  4PC0 A;  3EMH A;  4K3J B;  4PXW A;  5K1C C;  4GZ8 A;  4CZY A;  2AH1 A;  4U7A A;  1GG2 B;  4CY5 A;  2OVP B;  4E5Z B;  4JSX C;  3UKU C;  4N14 A;  1R5M A;  3ZWL B;  1PBY B;  5CXC A;  3K26 A;  3FM0 A;  3AH8 B;  4A0A B;  4LG8 A;  2J55 H;  3UVK A;  2AGX A;  2YMU A;  3RFH A;  4FB1 D;  2IWK A;  3SCY A;  4BUJ C;  3I8C A;  1MG3 A;  5AFU 3;  3CFS B;  3ORV D;  5CYK A;  4PBY A;  5A2Q g;  3F3F A;  5IT9 g;  2YNP A;  3PSC B;  3KRX B;  4EWR A;  4A0B B;  3MXX A;  4K3I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...