3RFHA

Crystal structure of the yeast rack1 dimer in space group p21
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
315
structure length
291
Chain Sequence
b'SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSAAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
molecule tags Signaling protein
source organism Saccharomyces cerevisiae
publication title Structure of the RACK1 dimer from Saccharomyces cerevisiae
pubmed doi rcsb
total genus 67
structure length 291
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rfhA00
4FAND 3PXSD 1RI6A 2PM9B 3JROA 3L4OD 5AJAA 4H5IA 3RN1D 2CN2A 3SJLD 1N6EA 3EI1A 4XEIC 4FA9D 2CNXA 4LG9A 4CY5A 2CN3A 4GQBB 4O9DA 3I7LA 3K26A 4J8BA 3OL2A 4GGCA 2TRCB 5HE1B 2UZXB 3PXWD 5EM2B 4X61B 2I0TA 2B5MA 3SMRA 1NEXB 2H6NA 5HE3B 2Z2NA 5CXCA 4JSXC 4J87A 3A0FA 5EM2A 4QL1A 4Y7RA 1N6FA 1OLZA 5EMKB 3GREA 5EMMB 3DSMA 3UR4A 2UZYB 2G99A 3DM0A 4Z8LA 5EARA 4GZ8A 1SHYB 4CC9A 4D0KA 4D6VA 2MTAH 3I7OA 4FHLA 1PI6A 3AFCA 2CE9A 3EI1B 2AGZA 2P9PC 4YVDA 2IWFA 4O45A 3E0CA 3RSEC 3ORVD 2H47A 3I8CA 2H3XA 2B4EA 2QXVA 4NSXA 4A2LA 3V7DB 1PBYB 3DXKC 2XL3A 4FA1D 4JSPC 3SBPA 1SQ9A 3JB9L 3DXMC 2XYIA 4J78A 1TBGA 2PM7B 1U4CA 4JT6C 2CO0C 4E54A 4J86A 2AQ5A 4PXWA 2AH0A 2PM9A 4GGAA 3PSCB 1XKSA 3VH0A 2IUQA 3MMYA 2OVPB 3SLED 4BUJC 3RRMC 4AOWA 3ZWLB 4A0AB 3EU7A 3I2NA 3J81g 4K3JB 2BCJB 2YBAA 3I7HA 2P9KC 4L3HD 5I5IA 3P4FA 2QC5A 4J79A 3IJ1A 3BG0A 4U7AA 5I5MA 2AGYA 4A11A 5B4WA 3JZNA 4GM9A 3AL8A 2PBIB 3UVKA 5TEFA 2YNOA 2Z2OA 3J80g 3NVXA 4PC0A 4ERZA 5I5JA 5H14A 1PGUA 3RN0D 4UI9R 2XU7A 2OVRB 4MK0B 5TDHB 2B5LA 4J82A 3PSLA 5C9ZB 5IGQA 1VYHC 3JPXA 2HYEA 1MG3A 3AH8B 5CYKB 4FB1D 1JOFA 4A08A 2J56H 1NR0A 3W15A 4ZN4A 3PE7A 3MKQA 5K19A 3SWSD 2HJ4A 4O3UB 2HKMA 4CY3A 5GMKn 3IKOA 4GM8A 4CZVA 1MDAH 5IC7A 5FKQA 2G9AA 5THAA 5CXBB 2GC4A 5EMLB 1P22A 2H9LA 5CXBA 2HESX 4CI1A 4BH6A 4XYIA 3SFZA 3FRXA 5FA5B 3SVWD 4CI3A 2IUPA 4GM3A 3F3GA 3EWEA 3JZHA 1MG2A 3HFQA 3SHFA 4A08B 2BBKH 4EWRA 4OWRA 4CY2A 1A0RB 3JRPA 1SQJA 4FAVD 4FWWA 4E5ZA 3OKYB 4GQ1A 5TEEA 3OKTA 5IGOA 5EMJB 5H1MA 4A09A 3EI3A 2EBSA 1QNIA 4J0XA 3JZGA 5IT9g 4JSVC 4CI2A 3EI2A 3ULEC 4ZOVA 1GOTB 3IJCA 5GXHA 4A7JA 4ERYA 1FWXA 3CFSB 5FQDA 2IAAA 1R5MA 4Y5RD 5C2WB 5CXCB 3N0DA 2IURA 1XIPA 3UKUC 5HE2B 3F3FA 3CIKB 2I0SA 3OTTA 3RMZD 3K27A 1B9YA 2GC7A 1GXRA 4TZ4A 5C2VB 4R7AB 4ERQA 5KDOB 4LGNA 4GQ2P 4PSXB 3B7FA 4E54B 3SCYA 3IIYA 2OJYA 2AGXA 2CE8A 3MZLA 2HJBA 2H6KA 4JD2C 4JT5C 1PEVA 1N6DA 1GP2B 3I8EA 2P9NC 4LG8A 5AMSA 2H13A 3GFCA 3FGBA 3I7PA 2B5NA 2H68A 3PVUB 2PM6B 4O3TB 1B9XA 4ZOXA 4QRJA 5EAMA 3MZKA 3BG1A 5FKSA 3MKSB 3RLMD 2AH1A 3IJ0A 3F3PA 5EALA 4IMMA 3OKWA 4QT8A 3C99A 2YB8B 4CI8A 4GMBA 4CZXA 3UVOA 3V9FA 2I3TA 3EI2B 5FXYA 5GSAA 5AFU3 3UVLA 4L1QD 3BWSA 2P9IC 2IUVA 4ZOZA 4FA5D 3EI3B 3VA6A 1U2VC 3OKYA 3V5WB 4J73A 3N0EA 2XL2A 4J81A 2O9KA 2P9LC 5HQGA 4ZOYA 4J84A 4L9OA 3OL2B 3RFGA 5HYNB 4FA4D 2J55H 3SBRA 3I7KA 2YNNA 4N14A 2OK4A 2H6QA 3EG6A 4IA9A 3AL9A 4X60B 1OMWB 4PBYA 1YFQA 2J57G 4K3ID 4U1EI 1L0QA 4X3EA 2AGWA 2OIZA 4A09B 3PXTD 1GG2B 4J0WA 3UKRC 4E5ZB 4XYHA 3EMHA 3PVWB 4PSWB 3U4YA 3KRXB 5HE0B 5FKRA 4BL0A 4A0BB 4PNKB 3ODTA 3EI4B 5IJ8E 3EI4A 5FLXg 4OZUA 3FM0A 2H14A 4A2MA 2AGLA 2IWKA 2W18A 1ERJA 4JSNC 2HXCA 5H17A 1JMXB 4X63B 5JWZA 4L3GD 5CYKA 5A2Qg 3SBQA 1K8KC 3OW8A 3C75H 3C9CA 2HKRA 5K1CC 3JAMg 4CY1A 1S4UX 3NVNA 4J8GA 3RFHA 4CZYA 1JMZB 2P9UC 1JJUB 3SN6B 1TYQC 2YNPA 3IIWA 2P9SC 5EAPA 2CO0A 4JXMA 3MXXA 4PBZA 2YMUA 5TF2A 3VGZA 4KFMB 3I89A 5SXMA 2Q7QA 3DWLC 4J77A 3CFVA 3C5MA 3UVMA 3KRWB 4HDJA 4I79A 3AL8B 4GGDA 4ESGA 4G56B 4A11B 5GXIA 2I3SA 2H9NA 3I7NA 2OVQB 4O1QD 2H9PA 5FKTA 4QQEA 1XHMA 2I0RA 4A0BA 4AEZA 1K32A 4ES0A 1Q47A 5IJ7E 3L4MD 4A0AA 2GNQA 4H5JA 3NVQA 2Z2PA 3SXTD 2OK6A 3UVNA 2H9MA
chains in the Genus database with same CATH superfamily
4FAND 3T3MA 3PXSD 1RI6A 5M5RA 4D9SA 4Z7OA 2PM9B 3JROA 3L4OD 5AJAA 4H5IA 5M5UA 3RN1D 2CN2A 3SJLD 3FCUA 1N6EA 3EI1A 2VZ1A 3IURA 4XEIC 4FA9D 2HU8A 2CNXA 4LG9A 4CY5A 2CN3A 4WK4A 4GQBB 4O9DA 3I7LA 3K26A 2EIDA 4J8BA 4RE5A 3OL2A 4GGCA 2TRCB 4NAAA 5HE1B 2UZXB 5M5TA 3PXWD 5EM2B 4X61B 2I0TA 2B5MA 3SMRA 1NEXB 2H6NA 5HE3B 2Z2NA 4AX4A 5CXCA 4JSXC 4J87A 3A0FA 5EM2A 4QL1A 4UM8A 4Y7RA 3ZE1A 5E6RA 1N6FA 1OLZA 5EMKB 4G1MA 3GREA 5EMMB 3DSMA 3UR4A 2UZYB 2G99A 3DM0A 4Z8LA 4NENA 5EARA 4GZ8A 1SHYB 4CC9A 3MUOA 4D0KA 4D6VA 2MTAH 3I7OA 4FHLA 1PI6A 3AFCA 2CE9A 3EI1B 2AGZA 3IUJA 2P9PC 4YVDA 2IWFA 4O45A 3E0CA 3RSEC 3ORVD 2H47A 3I8CA 2H3XA 2B4EA 2QXVA 4NSXA 3IUMA 4G1EA 4MMXA 1GOFA 3ZDXA 1E5TA 4A2LA 2VDNA 3V7DB 1VE6A 1PBYB 1GOGA 3DXKC 4WK2A 4AMZA 2XL3A 3FCSA 4JHPC 4FA1D 5C86A 1QFSA 4JSPC 1H2ZA 3SBPA 1SQ9A 3JB9L 4O2WA 3DXMC 2XYIA 4J78A 3MVDK 1TBGA 2PM7B 3V4VA 2EIBA 1U4CA 1YR2A 4JT6C 2CO0C 4E54A 4J86A 2AQ5A 4PXWA 1C9LA 2AH0A 2EICA 3O4JA 2PM9A 4GGAA 3PSCB 1XKSA 3VH0A 1JTDB 2IUQA 1A12A 3MMYA 2OVPB 3SLED 4BUJC 3RRMC 4AOWA 1E8NA 3ZWLB 2HU7A 4A0AB 3EU7A 3I2NA 3J81g 4K3JB 2BCJB 4BCDA 5C92A 5M5SA 2YBAA 3I7HA 5HDBA 2P9KC 4L3HD 5I5IA 3P4FA 2QC5A 4J79A 3IJ1A 3BG0A 4U7AA 5I5MA 2AGYA 4A11A 5B4WA 5E6UA 3JZNA 4GM9A 3AL8A 2PBIB 2VDOA 3EQ7A 5TEFA 3UVKA 2YNOA 2Z2OA 2BKLA 4DNVA 3NVXA 3J80g 4PC0A 4ERZA 5I5JA 5H14A 1PGUA 3RN0D 4UI9R 2XU7A 2OVRB 4MK0B 5TDHB 2B5LA 4J82A 4WK0A 3PSLA 5C9ZB 5IGQA 3DDUA 1VYHC 3JPXA 2HYEA 1MG3A 3AH8B 4BCBA 5CYKB 4FB1D 1GOHA 3IJEA 1JOFA 4A08A 2J56H 1NR0A 1H2XA 3W15A 4ZN4A 3PE7A 3MKQA 5K19A 3SWSD 2QR5A 2HJ4A 4O02A 4O3UB 2HKMA 4CY3A 5GMKn 3IKOA 2QZPA 4GM8A 4CZVA 1MDAH 5IC7A 5FKQA 2G9AA 4NBMA 5FFOA 5THAA 5CXBB 2GC4A 5EMLB 1P22A 2H9LA 3IUQA 5CXBA 2HESX 3ZDYA 4CI1A 4BH6A 4XYIA 3SFZA 4Z7QA 5FFGA 3FRXA 5FA5B 3SVWD 2HU5A 2IUPA 4GM3A 3F3GA 4CI3A 2EIEA 3EWEA 3O4GA 3JZHA 1MG2A 3O4IA 5M61A 3HFQA 5M5VA 1C9IA 3SHFA 4A08B 2BBKH 4EWRA 4OWRA 4CY2A 1A0RB 3JRPA 1VE7A 1SQJA 4FAVD 4FWWA 4E5ZA 3OKYB 4GQ1A 5TEEA 3OKTA 5IGOA 5EMJB 5H1MA 4A09A 3EI3A 2EBSA 3NIDA 1QNIA 4J0XA 3JZGA 3OF7A 4JSVC 4CI2A 5IT9g 3EI2A 3ULEC 4ZOVA 1GOTB 3IJCA 5GXHA 4A7JA 1UOQA 4ERYA 1FWXA 3T3PA 3CFSB 4DNWA 5FQDA 3QHYB 2IAAA 4G55A 4JHNA 1R5MA 4QAMA 4Y5RD 3IULA 5C2WB 5CXCB 3N0DA 2IURA 3ZE0A 1XIPA 3GD1I 3UKUC 5HE2B 3F3FA 2XZGA 3CIKB 4AN0A 2I0SA 3OTTA 3RMZD 3K27A 2VDMA 4IRZA 1B9YA 2GC7A 1GXRA 4TZ4A 5C2VB 4R7AB 4ERQA 5KDOB 4LGNA 3GC3B 1UTCA 4GQ2P 2VDPA 4PSXB 3B7FA 4E54B 3SCYA 3IIYA 2OJYA 2AGXA 2CE8A 3MZLA 2HJBA 2H6KA 4JD2C 4JT5C 1U8CA 1PEVA 1N6DA 1GP2B 1E8MA 3I8EA 2P9NC 4LG8A 5AMSA 2H13A 3GFCA 3FGBA 3I7PA 2B5NA 2H68A 3PVUB 2PM6B 2VC2A 4O3TB 3O4HA 3K72A 2VZ3A 1B9XA 4ZOXA 4QRJA 5EAMA 3MZKA 3BG1A 5FKSA 3MKSB 1VZ3A 3RLMD 2AH1A 3IJ0A 3F3PA 5EALA 4IMMA 3OKWA 4QT8A 3C99A 2YB8B 4CI8A 1T2XA 4GMBA 4CZXA 3UVOA 3V9FA 2I3TA 3EI2B 5FXYA 5GSAA 5AFU3 3UVLA 4L1QD 3BWSA 2P9IC 2IUVA 4ZOZA 4FA5D 3EI3B 3K6SA 3VA6A 1U2VC 3OKYA 3V5WB 4J73A 3N0EA 2XL2A 4J81A 2O9KA 2P9LC 5HQGA 4ZOYA 4J84A 3KCIA 2XDWA 4L9OA 1M1XA 3OL2B 3RFGA 5HYNB 4FA4D 2J55H 3SBRA 3I7KA 2VDKA 2YNNA 2OK4A 4N14A 2H6QA 4AN1A 3EG6A 1UOPA 4UM9A 4IA9A 3AL9A 1OMWB 4X60B 4PBYA 4MMZA 1YFQA 2JKXA 5E6SA 2J57G 1I2MB 4K3ID 1VZ2A 4U1EI 3VI3A 1L0QA 2AGWA 4X3EA 2OIZA 4A09B 3IVMA 3NIFA 3PXTD 1GG2B 4J0WA 3UKRC 4E5ZB 3ZDZA 4XYHA 3EMHA 3PVWB 4PSWB 3IUNA 3QI0A 4BP8A 3U4YA 3KRXB 4L1MA 5HE0B 5FKRA 4BL0A 4A0BB 4PNKB 3ODTA 4RE6A 2WQ8A 3EI4B 5IJ8E 3EI4A 5FLXg 4OZUA 3FM0A 2H14A 4A2MA 2AGLA 2IWKA 2W18A 1ERJA 2VDRA 3EQ8A 4JSNC 2HXCA 5H17A 1JMXB 3NIGA 4X63B 5JWZA 4L3GD 1QFMA 1K3IA 5CYKA 5A2Qg 3SBQA 1K8KC 4BCCA 3VI4A 3OW8A 3C75H 3C9CA 2HKRA 5K1CC 3JAMg 4CY1A 4DNUA 3EQ9A 1S4UX 3NVNA 4J8GA 3RFHA 4CZYA 4NC4A 1O6GA 1JMZB 2P9UC 1JJUB 3SN6B 1TYQC 2YNPA 3IIWA 3V4PA 2P9SC 1JV2A 5EAPA 2CO0A 4JXMA 3MXXA 4PBZA 4MMYA 3ZE2A 2YMUA 5TF2A 1UOOA 3VGZA 4KFMB 3MUNA 4WJKA 3I89A 5SXMA 1H2WA 2Q7QA 3DWLC 4Z7NA 4BP9A 1TYEA 1O6FA 2VDQA 4J77A 3CFVA 4AMYA 3K71A 3C5MA 3UVMA 3KRWB 4HDJA 4I79A 2XE4A 1L5GA 3AL8B 4GGDA 4ESGA 4G56B 4A11B 5GXIA 2I3SA 2H9NA 2VDLA 3I7NA 2OVQB 4O1QD 2H9PA 5FKTA 4QQEA 1XHMA 1BPOA 2I0RA 4A0BA 4AEZA 1H2YA 1K32A 4ES0A 1Q47A 5IJ7E 3L4MD 4A0AA 2GNQA 4H5JA 3NVQA 2Z2PA 3SXTD 2OK6A 3UVNA 2H9MA
chains in the Genus database with same CATH topology
4FAND 3PXSD 1RI6A 2PM9B 3JROA 3L4OD 5AJAA 4H5IA 3RN1D 2CN2A 3SJLD 1N6EA 3EI1A 4XEIC 4FA9D 2CNXA 4LG9A 4CY5A 2CN3A 4GQBB 4O9DA 3I7LA 3K26A 4J8BA 3OL2A 4GGCA 2TRCB 5HE1B 2UZXB 3PXWD 5EM2B 4X61B 2I0TA 2B5MA 3SMRA 1NEXB 2H6NA 5HE3B 2Z2NA 5CXCA 4JSXC 4J87A 3A0FA 5EM2A 4QL1A 4Y7RA 1N6FA 1OLZA 5EMKB 3GREA 5EMMB 3DSMA 3UR4A 2UZYB 2G99A 3DM0A 4Z8LA 5EARA 4GZ8A 1SHYB 4CC9A 4D0KA 4D6VA 2MTAH 3I7OA 4FHLA 1PI6A 3AFCA 2CE9A 3EI1B 2AGZA 2P9PC 4YVDA 2IWFA 4O45A 3E0CA 3RSEC 3ORVD 2H47A 3I8CA 2H3XA 2B4EA 2QXVA 4NSXA 4A2LA 3V7DB 1PBYB 3DXKC 2XL3A 4FA1D 4JSPC 3SBPA 1SQ9A 3JB9L 3DXMC 2XYIA 4J78A 1TBGA 2PM7B 1U4CA 4JT6C 2CO0C 4E54A 4J86A 2AQ5A 4PXWA 2AH0A 2PM9A 4GGAA 3PSCB 1XKSA 3VH0A 2IUQA 3MMYA 2OVPB 3SLED 4BUJC 3RRMC 4AOWA 3ZWLB 4A0AB 3EU7A 3I2NA 3J81g 4K3JB 2BCJB 2YBAA 3I7HA 2P9KC 4L3HD 5I5IA 3P4FA 2QC5A 4J79A 3IJ1A 3BG0A 4U7AA 5I5MA 2AGYA 4A11A 5B4WA 3JZNA 4GM9A 3AL8A 2PBIB 3UVKA 5TEFA 2YNOA 2Z2OA 3J80g 3NVXA 4PC0A 4ERZA 5I5JA 5H14A 1PGUA 3RN0D 4UI9R 2XU7A 2OVRB 4MK0B 5TDHB 2B5LA 4J82A 3PSLA 5C9ZB 5IGQA 1VYHC 3JPXA 2HYEA 1MG3A 3AH8B 5CYKB 4FB1D 1JOFA 4A08A 2J56H 1NR0A 3W15A 4ZN4A 3PE7A 3MKQA 5K19A 3SWSD 2HJ4A 4O3UB 2HKMA 4CY3A 5GMKn 3IKOA 4GM8A 4CZVA 1MDAH 5IC7A 5FKQA 2G9AA 5THAA 5CXBB 2GC4A 5EMLB 1P22A 2H9LA 5CXBA 2HESX 4CI1A 4BH6A 4XYIA 3SFZA 3FRXA 5FA5B 3SVWD 4CI3A 2IUPA 4GM3A 3F3GA 3EWEA 3JZHA 1MG2A 3HFQA 3SHFA 4A08B 2BBKH 4EWRA 4OWRA 4CY2A 1A0RB 3JRPA 1SQJA 4FAVD 4FWWA 4E5ZA 3OKYB 4GQ1A 5TEEA 3OKTA 5IGOA 5EMJB 5H1MA 4A09A 3EI3A 2EBSA 1QNIA 4J0XA 3JZGA 5IT9g 4JSVC 4CI2A 3EI2A 3ULEC 4ZOVA 1GOTB 3IJCA 5GXHA 4A7JA 4ERYA 1FWXA 3CFSB 5FQDA 2IAAA 1R5MA 4Y5RD 5C2WB 5CXCB 3N0DA 2IURA 1XIPA 3UKUC 5HE2B 3F3FA 3CIKB 2I0SA 3OTTA 3RMZD 3K27A 1B9YA 2GC7A 1GXRA 4TZ4A 5C2VB 4R7AB 4ERQA 5KDOB 4LGNA 4GQ2P 4PSXB 3B7FA 4E54B 3SCYA 3IIYA 2OJYA 2AGXA 2CE8A 3MZLA 2HJBA 2H6KA 4JD2C 4JT5C 1PEVA 1N6DA 1GP2B 3I8EA 2P9NC 4LG8A 5AMSA 2H13A 3GFCA 3FGBA 3I7PA 2B5NA 2H68A 3PVUB 2PM6B 4O3TB 1B9XA 4ZOXA 4QRJA 5EAMA 3MZKA 3BG1A 5FKSA 3MKSB 3RLMD 2AH1A 3IJ0A 3F3PA 5EALA 4IMMA 3OKWA 4QT8A 3C99A 2YB8B 4CI8A 4GMBA 4CZXA 3UVOA 3V9FA 2I3TA 3EI2B 5FXYA 5GSAA 5AFU3 3UVLA 4L1QD 3BWSA 2P9IC 2IUVA 4ZOZA 4FA5D 3EI3B 3VA6A 1U2VC 3OKYA 3V5WB 4J73A 3N0EA 2XL2A 4J81A 2O9KA 2P9LC 5HQGA 4ZOYA 4J84A 4L9OA 3OL2B 3RFGA 5HYNB 4FA4D 2J55H 3SBRA 3I7KA 2YNNA 4N14A 2OK4A 2H6QA 3EG6A 4IA9A 3AL9A 4X60B 1OMWB 4PBYA 1YFQA 2J57G 4K3ID 4U1EI 1L0QA 4X3EA 2AGWA 2OIZA 4A09B 3PXTD 1GG2B 4J0WA 3UKRC 4E5ZB 4XYHA 3EMHA 3PVWB 4PSWB 3U4YA 3KRXB 5HE0B 5FKRA 4BL0A 4A0BB 4PNKB 3ODTA 3EI4B 5IJ8E 3EI4A 5FLXg 4OZUA 3FM0A 2H14A 4A2MA 2AGLA 2IWKA 2W18A 1ERJA 4JSNC 2HXCA 5H17A 1JMXB 4X63B 5JWZA 4L3GD 5CYKA 5A2Qg 3SBQA 1K8KC 3OW8A 3C75H 3C9CA 2HKRA 5K1CC 3JAMg 4CY1A 1S4UX 3NVNA 4J8GA 3RFHA 4CZYA 1JMZB 2P9UC 1JJUB 3SN6B 1TYQC 2YNPA 3IIWA 2P9SC 5EAPA 2CO0A 4JXMA 3MXXA 4PBZA 2YMUA 5TF2A 3VGZA 4KFMB 3I89A 5SXMA 2Q7QA 3DWLC 4J77A 3CFVA 3C5MA 3UVMA 3KRWB 4HDJA 4I79A 3AL8B 4GGDA 4ESGA 4G56B 4A11B 5GXIA 2I3SA 2H9NA 3I7NA 2OVQB 4O1QD 2H9PA 5FKTA 4QQEA 1XHMA 2I0RA 4A0BA 4AEZA 1K32A 4ES0A 1Q47A 5IJ7E 3L4MD 4A0AA 2GNQA 4H5JA 3NVQA 2Z2PA 3SXTD 2OK6A 3UVNA 2H9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAN D;  3PXS D;  1RI6 A;  2PM9 B;  3JRO A;  3L4O D;  5AJA A;  4H5I A;  3RN1 D;  2CN2 A;  3SJL D;  1N6E A;  3EI1 A;  4XEI C;  4FA9 D;  2CNX A;  4LG9 A;  4CY5 A;  2CN3 A;  4GQB B;  4O9D A;  3I7L A;  3K26 A;  4J8B A;  3OL2 A;  4GGC A;  2TRC B;  5HE1 B;  2UZX B;  3PXW D;  5EM2 B;  4X61 B;  2I0T A;  2B5M A;  3SMR A;  1NEX B;  2H6N A;  5HE3 B;  2Z2N A;  5CXC A;  4JSX C;  4J87 A;  3A0F A;  5EM2 A;  4QL1 A;  4Y7R A;  1N6F A;  1OLZ A;  5EMK B;  3GRE A;  5EMM B;  3DSM A;  3UR4 A;  2UZY B;  2G99 A;  3DM0 A;  4Z8L A;  5EAR A;  4GZ8 A;  1SHY B;  4CC9 A;  4D0K A;  4D6V A;  2MTA H;  3I7O A;  4FHL A;  1PI6 A;  3AFC A;  2CE9 A;  3EI1 B;  2AGZ A;  2P9P C;  4YVD A;  2IWF A;  4O45 A;  3E0C A;  3RSE C;  3ORV D;  2H47 A;  3I8C A;  2H3X A;  2B4E A;  2QXV A;  4NSX A;  4A2L A;  3V7D B;  1PBY B;  3DXK C;  2XL3 A;  4FA1 D;  4JSP C;  3SBP A;  1SQ9 A;  3JB9 L;  3DXM C;  2XYI A;  4J78 A;  1TBG A;  2PM7 B;  1U4C A;  4JT6 C;  2CO0 C;  4E54 A;  4J86 A;  2AQ5 A;  4PXW A;  2AH0 A;  2PM9 A;  4GGA A;  3PSC B;  1XKS A;  3VH0 A;  2IUQ A;  3MMY A;  2OVP B;  3SLE D;  4BUJ C;  3RRM C;  4AOW A;  3ZWL B;  4A0A B;  3EU7 A;  3I2N A;  3J81 g;  4K3J B;  2BCJ B;  2YBA A;  3I7H A;  2P9K C;  4L3H D;  5I5I A;  3P4F A;  2QC5 A;  4J79 A;  3IJ1 A;  3BG0 A;  4U7A A;  5I5M A;  2AGY A;  4A11 A;  5B4W A;  3JZN A;  4GM9 A;  3AL8 A;  2PBI B;  3UVK A;  5TEF A;  2YNO A;  2Z2O A;  3J80 g;  3NVX A;  4PC0 A;  4ERZ A;  5I5J A;  5H14 A;  1PGU A;  3RN0 D;  4UI9 R;  2XU7 A;  2OVR B;  4MK0 B;  5TDH B;  2B5L A;  4J82 A;  3PSL A;  5C9Z B;  5IGQ A;  1VYH C;  3JPX A;  2HYE A;  1MG3 A;  3AH8 B;  5CYK B;  4FB1 D;  1JOF A;  4A08 A;  2J56 H;  1NR0 A;  3W15 A;  4ZN4 A;  3PE7 A;  3MKQ A;  5K19 A;  3SWS D;  2HJ4 A;  4O3U B;  2HKM A;  4CY3 A;  5GMK n;  3IKO A;  4GM8 A;  4CZV A;  1MDA H;  5IC7 A;  5FKQ A;  2G9A A;  5THA A;  5CXB B;  2GC4 A;  5EML B;  1P22 A;  2H9L A;  5CXB A;  2HES X;  4CI1 A;  4BH6 A;  4XYI A;  3SFZ A;  3FRX A;  5FA5 B;  3SVW D;  4CI3 A;  2IUP A;  4GM3 A;  3F3G A;  3EWE A;  3JZH A;  1MG2 A;  3HFQ A;  3SHF A;  4A08 B;  2BBK H;  4EWR A;  4OWR A;  4CY2 A;  1A0R B;  3JRP A;  1SQJ A;  4FAV D;  4FWW A;  4E5Z A;  3OKY B;  4GQ1 A;  5TEE A;  3OKT A;  5IGO A;  5EMJ B;  5H1M A;  4A09 A;  3EI3 A;  2EBS A;  1QNI A;  4J0X A;  3JZG A;  5IT9 g;  4JSV C;  4CI2 A;  3EI2 A;  3ULE C;  4ZOV A;  1GOT B;  3IJC A;  5GXH A;  4A7J A;  4ERY A;  1FWX A;  3CFS B;  5FQD A;  2IAA A;  1R5M A;  4Y5R D;  5C2W B;  5CXC B;  3N0D A;  2IUR A;  1XIP A;  3UKU C;  5HE2 B;  3F3F A;  3CIK B;  2I0S A;  3OTT A;  3RMZ D;  3K27 A;  1B9Y A;  2GC7 A;  1GXR A;  4TZ4 A;  5C2V B;  4R7A B;  4ERQ A;  5KDO B;  4LGN A;  4GQ2 P;  4PSX B;  3B7F A;  4E54 B;  3SCY A;  3IIY A;  2OJY A;  2AGX A;  2CE8 A;  3MZL A;  2HJB A;  2H6K A;  4JD2 C;  4JT5 C;  1PEV A;  1N6D A;  1GP2 B;  3I8E A;  2P9N C;  4LG8 A;  5AMS A;  2H13 A;  3GFC A;  3FGB A;  3I7P A;  2B5N A;  2H68 A;  3PVU B;  2PM6 B;  4O3T B;  1B9X A;  4ZOX A;  4QRJ A;  5EAM A;  3MZK A;  3BG1 A;  5FKS A;  3MKS B;  3RLM D;  2AH1 A;  3IJ0 A;  3F3P A;  5EAL A;  4IMM A;  3OKW A;  4QT8 A;  3C99 A;  2YB8 B;  4CI8 A;  4GMB A;  4CZX A;  3UVO A;  3V9F A;  2I3T A;  3EI2 B;  5FXY A;  5GSA A;  5AFU 3;  3UVL A;  4L1Q D;  3BWS A;  2P9I C;  2IUV A;  4ZOZ A;  4FA5 D;  3EI3 B;  3VA6 A;  1U2V C;  3OKY A;  3V5W B;  4J73 A;  3N0E A;  2XL2 A;  4J81 A;  2O9K A;  2P9L C;  5HQG A;  4ZOY A;  4J84 A;  4L9O A;  3OL2 B;  3RFG A;  5HYN B;  4FA4 D;  2J55 H;  3SBR A;  3I7K A;  2YNN A;  4N14 A;  2OK4 A;  2H6Q A;  3EG6 A;  4IA9 A;  3AL9 A;  4X60 B;  1OMW B;  4PBY A;  1YFQ A;  2J57 G;  4K3I D;  4U1E I;  1L0Q A;  4X3E A;  2AGW A;  2OIZ A;  4A09 B;  3PXT D;  1GG2 B;  4J0W A;  3UKR C;  4E5Z B;  4XYH A;  3EMH A;  3PVW B;  4PSW B;  3U4Y A;  3KRX B;  5HE0 B;  5FKR A;  4BL0 A;  4A0B B;  4PNK B;  3ODT A;  3EI4 B;  5IJ8 E;  3EI4 A;  5FLX g;  4OZU A;  3FM0 A;  2H14 A;  4A2M A;  2AGL A;  2IWK A;  2W18 A;  1ERJ A;  4JSN C;  2HXC A;  5H17 A;  1JMX B;  4X63 B;  5JWZ A;  4L3G D;  5CYK A;  5A2Q g;  3SBQ A;  1K8K C;  3OW8 A;  3C75 H;  3C9C A;  2HKR A;  5K1C C;  3JAM g;  4CY1 A;  1S4U X;  3NVN A;  4J8G A;  3RFH A;  4CZY A;  1JMZ B;  2P9U C;  1JJU B;  3SN6 B;  1TYQ C;  2YNP A;  3IIW A;  2P9S C;  5EAP A;  2CO0 A;  4JXM A;  3MXX A;  4PBZ A;  2YMU A;  5TF2 A;  3VGZ A;  4KFM B;  3I89 A;  5SXM A;  2Q7Q A;  3DWL C;  4J77 A;  3CFV A;  3C5M A;  3UVM A;  3KRW B;  4HDJ A;  4I79 A;  3AL8 B;  4GGD A;  4ESG A;  4G56 B;  4A11 B;  5GXI A;  2I3S A;  2H9N A;  3I7N A;  2OVQ B;  4O1Q D;  2H9P A;  5FKT A;  4QQE A;  1XHM A;  2I0R A;  4A0B A;  4AEZ A;  1K32 A;  4ES0 A;  1Q47 A;  5IJ7 E;  3L4M D;  4A0A A;  2GNQ A;  4H5J A;  3NVQ A;  2Z2P A;  3SXT D;  2OK6 A;  3UVN A;  2H9M A; 
#chains in the Genus database with same CATH topology
 4FAN D;  3T3M A;  3PXS D;  1RI6 A;  5M5R A;  4D9S A;  4Z7O A;  2PM9 B;  3JRO A;  3L4O D;  5AJA A;  4H5I A;  5M5U A;  3RN1 D;  2CN2 A;  3SJL D;  3FCU A;  1N6E A;  3EI1 A;  2VZ1 A;  3IUR A;  4XEI C;  4FA9 D;  2HU8 A;  2CNX A;  4LG9 A;  4CY5 A;  2CN3 A;  4WK4 A;  4GQB B;  4O9D A;  3I7L A;  3K26 A;  2EID A;  4J8B A;  4RE5 A;  3OL2 A;  4GGC A;  2TRC B;  4NAA A;  5HE1 B;  2UZX B;  5M5T A;  3PXW D;  5EM2 B;  4X61 B;  2I0T A;  2B5M A;  3SMR A;  1NEX B;  2H6N A;  5HE3 B;  2Z2N A;  4AX4 A;  5CXC A;  4JSX C;  4J87 A;  3A0F A;  5EM2 A;  4QL1 A;  4UM8 A;  4Y7R A;  3ZE1 A;  5E6R A;  1N6F A;  1OLZ A;  5EMK B;  4G1M A;  3GRE A;  5EMM B;  3DSM A;  3UR4 A;  2UZY B;  2G99 A;  3DM0 A;  4Z8L A;  4NEN A;  5EAR A;  4GZ8 A;  1SHY B;  4CC9 A;  3MUO A;  4D0K A;  4D6V A;  2MTA H;  3I7O A;  4FHL A;  1PI6 A;  3AFC A;  2CE9 A;  3EI1 B;  2AGZ A;  3IUJ A;  2P9P C;  4YVD A;  2IWF A;  4O45 A;  3E0C A;  3RSE C;  3ORV D;  2H47 A;  3I8C A;  2H3X A;  2B4E A;  2QXV A;  4NSX A;  3IUM A;  4G1E A;  4MMX A;  1GOF A;  3ZDX A;  1E5T A;  4A2L A;  2VDN A;  3V7D B;  1VE6 A;  1PBY B;  1GOG A;  3DXK C;  4WK2 A;  4AMZ A;  2XL3 A;  3FCS A;  4JHP C;  4FA1 D;  5C86 A;  1QFS A;  4JSP C;  1H2Z A;  3SBP A;  1SQ9 A;  3JB9 L;  4O2W A;  3DXM C;  2XYI A;  4J78 A;  3MVD K;  1TBG A;  2PM7 B;  3V4V A;  2EIB A;  1U4C A;  1YR2 A;  4JT6 C;  2CO0 C;  4E54 A;  4J86 A;  2AQ5 A;  4PXW A;  1C9L A;  2AH0 A;  2EIC A;  3O4J A;  2PM9 A;  4GGA A;  3PSC B;  1XKS A;  3VH0 A;  1JTD B;  2IUQ A;  1A12 A;  3MMY A;  2OVP B;  3SLE D;  4BUJ C;  3RRM C;  4AOW A;  1E8N A;  3ZWL B;  2HU7 A;  4A0A B;  3EU7 A;  3I2N A;  3J81 g;  4K3J B;  2BCJ B;  4BCD A;  5C92 A;  5M5S A;  2YBA A;  3I7H A;  5HDB A;  2P9K C;  4L3H D;  5I5I A;  3P4F A;  2QC5 A;  4J79 A;  3IJ1 A;  3BG0 A;  4U7A A;  5I5M A;  2AGY A;  4A11 A;  5B4W A;  5E6U A;  3JZN A;  4GM9 A;  3AL8 A;  2PBI B;  2VDO A;  3EQ7 A;  5TEF A;  3UVK A;  2YNO A;  2Z2O A;  2BKL A;  4DNV A;  3NVX A;  3J80 g;  4PC0 A;  4ERZ A;  5I5J A;  5H14 A;  1PGU A;  3RN0 D;  4UI9 R;  2XU7 A;  2OVR B;  4MK0 B;  5TDH B;  2B5L A;  4J82 A;  4WK0 A;  3PSL A;  5C9Z B;  5IGQ A;  3DDU A;  1VYH C;  3JPX A;  2HYE A;  1MG3 A;  3AH8 B;  4BCB A;  5CYK B;  4FB1 D;  1GOH A;  3IJE A;  1JOF A;  4A08 A;  2J56 H;  1NR0 A;  1H2X A;  3W15 A;  4ZN4 A;  3PE7 A;  3MKQ A;  5K19 A;  3SWS D;  2QR5 A;  2HJ4 A;  4O02 A;  4O3U B;  2HKM A;  4CY3 A;  5GMK n;  3IKO A;  2QZP A;  4GM8 A;  4CZV A;  1MDA H;  5IC7 A;  5FKQ A;  2G9A A;  4NBM A;  5FFO A;  5THA A;  5CXB B;  2GC4 A;  5EML B;  1P22 A;  2H9L A;  3IUQ A;  5CXB A;  2HES X;  3ZDY A;  4CI1 A;  4BH6 A;  4XYI A;  3SFZ A;  4Z7Q A;  5FFG A;  3FRX A;  5FA5 B;  3SVW D;  2HU5 A;  2IUP A;  4GM3 A;  3F3G A;  4CI3 A;  2EIE A;  3EWE A;  3O4G A;  3JZH A;  1MG2 A;  3O4I A;  5M61 A;  3HFQ A;  5M5V A;  1C9I A;  3SHF A;  4A08 B;  2BBK H;  4EWR A;  4OWR A;  4CY2 A;  1A0R B;  3JRP A;  1VE7 A;  1SQJ A;  4FAV D;  4FWW A;  4E5Z A;  3OKY B;  4GQ1 A;  5TEE A;  3OKT A;  5IGO A;  5EMJ B;  5H1M A;  4A09 A;  3EI3 A;  2EBS A;  3NID A;  1QNI A;  4J0X A;  3JZG A;  3OF7 A;  4JSV C;  4CI2 A;  5IT9 g;  3EI2 A;  3ULE C;  4ZOV A;  1GOT B;  3IJC A;  5GXH A;  4A7J A;  1UOQ A;  4ERY A;  1FWX A;  3T3P A;  3CFS B;  4DNW A;  5FQD A;  3QHY B;  2IAA A;  4G55 A;  4JHN A;  1R5M A;  4QAM A;  4Y5R D;  3IUL A;  5C2W B;  5CXC B;  3N0D A;  2IUR A;  3ZE0 A;  1XIP A;  3GD1 I;  3UKU C;  5HE2 B;  3F3F A;  2XZG A;  3CIK B;  4AN0 A;  2I0S A;  3OTT A;  3RMZ D;  3K27 A;  2VDM A;  4IRZ A;  1B9Y A;  2GC7 A;  1GXR A;  4TZ4 A;  5C2V B;  4R7A B;  4ERQ A;  5KDO B;  4LGN A;  3GC3 B;  1UTC A;  4GQ2 P;  2VDP A;  4PSX B;  3B7F A;  4E54 B;  3SCY A;  3IIY A;  2OJY A;  2AGX A;  2CE8 A;  3MZL A;  2HJB A;  2H6K A;  4JD2 C;  4JT5 C;  1U8C A;  1PEV A;  1N6D A;  1GP2 B;  1E8M A;  3I8E A;  2P9N C;  4LG8 A;  5AMS A;  2H13 A;  3GFC A;  3FGB A;  3I7P A;  2B5N A;  2H68 A;  3PVU B;  2PM6 B;  2VC2 A;  4O3T B;  3O4H A;  3K72 A;  2VZ3 A;  1B9X A;  4ZOX A;  4QRJ A;  5EAM A;  3MZK A;  3BG1 A;  5FKS A;  3MKS B;  1VZ3 A;  3RLM D;  2AH1 A;  3IJ0 A;  3F3P A;  5EAL A;  4IMM A;  3OKW A;  4QT8 A;  3C99 A;  2YB8 B;  4CI8 A;  1T2X A;  4GMB A;  4CZX A;  3UVO A;  3V9F A;  2I3T A;  3EI2 B;  5FXY A;  5GSA A;  5AFU 3;  3UVL A;  4L1Q D;  3BWS A;  2P9I C;  2IUV A;  4ZOZ A;  4FA5 D;  3EI3 B;  3K6S A;  3VA6 A;  1U2V C;  3OKY A;  3V5W B;  4J73 A;  3N0E A;  2XL2 A;  4J81 A;  2O9K A;  2P9L C;  5HQG A;  4ZOY A;  4J84 A;  3KCI A;  2XDW A;  4L9O A;  1M1X A;  3OL2 B;  3RFG A;  5HYN B;  4FA4 D;  2J55 H;  3SBR A;  3I7K A;  2VDK A;  2YNN A;  2OK4 A;  4N14 A;  2H6Q A;  4AN1 A;  3EG6 A;  1UOP A;  4UM9 A;  4IA9 A;  3AL9 A;  1OMW B;  4X60 B;  4PBY A;  4MMZ A;  1YFQ A;  2JKX A;  5E6S A;  2J57 G;  1I2M B;  4K3I D;  1VZ2 A;  4U1E I;  3VI3 A;  1L0Q A;  2AGW A;  4X3E A;  2OIZ A;  4A09 B;  3IVM A;  3NIF A;  3PXT D;  1GG2 B;  4J0W A;  3UKR C;  4E5Z B;  3ZDZ A;  4XYH A;  3EMH A;  3PVW B;  4PSW B;  3IUN A;  3QI0 A;  4BP8 A;  3U4Y A;  3KRX B;  4L1M A;  5HE0 B;  5FKR A;  4BL0 A;  4A0B B;  4PNK B;  3ODT A;  4RE6 A;  2WQ8 A;  3EI4 B;  5IJ8 E;  3EI4 A;  5FLX g;  4OZU A;  3FM0 A;  2H14 A;  4A2M A;  2AGL A;  2IWK A;  2W18 A;  1ERJ A;  2VDR A;  3EQ8 A;  4JSN C;  2HXC A;  5H17 A;  1JMX B;  3NIG A;  4X63 B;  5JWZ A;  4L3G D;  1QFM A;  1K3I A;  5CYK A;  5A2Q g;  3SBQ A;  1K8K C;  4BCC A;  3VI4 A;  3OW8 A;  3C75 H;  3C9C A;  2HKR A;  5K1C C;  3JAM g;  4CY1 A;  4DNU A;  3EQ9 A;  1S4U X;  3NVN A;  4J8G A;  3RFH A;  4CZY A;  4NC4 A;  1O6G A;  1JMZ B;  2P9U C;  1JJU B;  3SN6 B;  1TYQ C;  2YNP A;  3IIW A;  3V4P A;  2P9S C;  1JV2 A;  5EAP A;  2CO0 A;  4JXM A;  3MXX A;  4PBZ A;  4MMY A;  3ZE2 A;  2YMU A;  5TF2 A;  1UOO A;  3VGZ A;  4KFM B;  3MUN A;  4WJK A;  3I89 A;  5SXM A;  1H2W A;  2Q7Q A;  3DWL C;  4Z7N A;  4BP9 A;  1TYE A;  1O6F A;  2VDQ A;  4J77 A;  3CFV A;  4AMY A;  3K71 A;  3C5M A;  3UVM A;  3KRW B;  4HDJ A;  4I79 A;  2XE4 A;  1L5G A;  3AL8 B;  4GGD A;  4ESG A;  4G56 B;  4A11 B;  5GXI A;  2I3S A;  2H9N A;  2VDL A;  3I7N A;  2OVQ B;  4O1Q D;  2H9P A;  5FKT A;  4QQE A;  1XHM A;  1BPO A;  2I0R A;  4A0B A;  4AEZ A;  1H2Y A;  1K32 A;  4ES0 A;  1Q47 A;  5IJ7 E;  3L4M D;  4A0A A;  2GNQ A;  4H5J A;  3NVQ A;  2Z2P A;  3SXT D;  2OK6 A;  3UVN A;  2H9M A; 
#chains in the Genus database with same CATH homology
 4FAN D;  3PXS D;  1RI6 A;  2PM9 B;  3JRO A;  3L4O D;  5AJA A;  4H5I A;  3RN1 D;  2CN2 A;  3SJL D;  1N6E A;  3EI1 A;  4XEI C;  4FA9 D;  2CNX A;  4LG9 A;  4CY5 A;  2CN3 A;  4GQB B;  4O9D A;  3I7L A;  3K26 A;  4J8B A;  3OL2 A;  4GGC A;  2TRC B;  5HE1 B;  2UZX B;  3PXW D;  5EM2 B;  4X61 B;  2I0T A;  2B5M A;  3SMR A;  1NEX B;  2H6N A;  5HE3 B;  2Z2N A;  5CXC A;  4JSX C;  4J87 A;  3A0F A;  5EM2 A;  4QL1 A;  4Y7R A;  1N6F A;  1OLZ A;  5EMK B;  3GRE A;  5EMM B;  3DSM A;  3UR4 A;  2UZY B;  2G99 A;  3DM0 A;  4Z8L A;  5EAR A;  4GZ8 A;  1SHY B;  4CC9 A;  4D0K A;  4D6V A;  2MTA H;  3I7O A;  4FHL A;  1PI6 A;  3AFC A;  2CE9 A;  3EI1 B;  2AGZ A;  2P9P C;  4YVD A;  2IWF A;  4O45 A;  3E0C A;  3RSE C;  3ORV D;  2H47 A;  3I8C A;  2H3X A;  2B4E A;  2QXV A;  4NSX A;  4A2L A;  3V7D B;  1PBY B;  3DXK C;  2XL3 A;  4FA1 D;  4JSP C;  3SBP A;  1SQ9 A;  3JB9 L;  3DXM C;  2XYI A;  4J78 A;  1TBG A;  2PM7 B;  1U4C A;  4JT6 C;  2CO0 C;  4E54 A;  4J86 A;  2AQ5 A;  4PXW A;  2AH0 A;  2PM9 A;  4GGA A;  3PSC B;  1XKS A;  3VH0 A;  2IUQ A;  3MMY A;  2OVP B;  3SLE D;  4BUJ C;  3RRM C;  4AOW A;  3ZWL B;  4A0A B;  3EU7 A;  3I2N A;  3J81 g;  4K3J B;  2BCJ B;  2YBA A;  3I7H A;  2P9K C;  4L3H D;  5I5I A;  3P4F A;  2QC5 A;  4J79 A;  3IJ1 A;  3BG0 A;  4U7A A;  5I5M A;  2AGY A;  4A11 A;  5B4W A;  3JZN A;  4GM9 A;  3AL8 A;  2PBI B;  3UVK A;  5TEF A;  2YNO A;  2Z2O A;  3J80 g;  3NVX A;  4PC0 A;  4ERZ A;  5I5J A;  5H14 A;  1PGU A;  3RN0 D;  4UI9 R;  2XU7 A;  2OVR B;  4MK0 B;  5TDH B;  2B5L A;  4J82 A;  3PSL A;  5C9Z B;  5IGQ A;  1VYH C;  3JPX A;  2HYE A;  1MG3 A;  3AH8 B;  5CYK B;  4FB1 D;  1JOF A;  4A08 A;  2J56 H;  1NR0 A;  3W15 A;  4ZN4 A;  3PE7 A;  3MKQ A;  5K19 A;  3SWS D;  2HJ4 A;  4O3U B;  2HKM A;  4CY3 A;  5GMK n;  3IKO A;  4GM8 A;  4CZV A;  1MDA H;  5IC7 A;  5FKQ A;  2G9A A;  5THA A;  5CXB B;  2GC4 A;  5EML B;  1P22 A;  2H9L A;  5CXB A;  2HES X;  4CI1 A;  4BH6 A;  4XYI A;  3SFZ A;  3FRX A;  5FA5 B;  3SVW D;  4CI3 A;  2IUP A;  4GM3 A;  3F3G A;  3EWE A;  3JZH A;  1MG2 A;  3HFQ A;  3SHF A;  4A08 B;  2BBK H;  4EWR A;  4OWR A;  4CY2 A;  1A0R B;  3JRP A;  1SQJ A;  4FAV D;  4FWW A;  4E5Z A;  3OKY B;  4GQ1 A;  5TEE A;  3OKT A;  5IGO A;  5EMJ B;  5H1M A;  4A09 A;  3EI3 A;  2EBS A;  1QNI A;  4J0X A;  3JZG A;  5IT9 g;  4JSV C;  4CI2 A;  3EI2 A;  3ULE C;  4ZOV A;  1GOT B;  3IJC A;  5GXH A;  4A7J A;  4ERY A;  1FWX A;  3CFS B;  5FQD A;  2IAA A;  1R5M A;  4Y5R D;  5C2W B;  5CXC B;  3N0D A;  2IUR A;  1XIP A;  3UKU C;  5HE2 B;  3F3F A;  3CIK B;  2I0S A;  3OTT A;  3RMZ D;  3K27 A;  1B9Y A;  2GC7 A;  1GXR A;  4TZ4 A;  5C2V B;  4R7A B;  4ERQ A;  5KDO B;  4LGN A;  4GQ2 P;  4PSX B;  3B7F A;  4E54 B;  3SCY A;  3IIY A;  2OJY A;  2AGX A;  2CE8 A;  3MZL A;  2HJB A;  2H6K A;  4JD2 C;  4JT5 C;  1PEV A;  1N6D A;  1GP2 B;  3I8E A;  2P9N C;  4LG8 A;  5AMS A;  2H13 A;  3GFC A;  3FGB A;  3I7P A;  2B5N A;  2H68 A;  3PVU B;  2PM6 B;  4O3T B;  1B9X A;  4ZOX A;  4QRJ A;  5EAM A;  3MZK A;  3BG1 A;  5FKS A;  3MKS B;  3RLM D;  2AH1 A;  3IJ0 A;  3F3P A;  5EAL A;  4IMM A;  3OKW A;  4QT8 A;  3C99 A;  2YB8 B;  4CI8 A;  4GMB A;  4CZX A;  3UVO A;  3V9F A;  2I3T A;  3EI2 B;  5FXY A;  5GSA A;  5AFU 3;  3UVL A;  4L1Q D;  3BWS A;  2P9I C;  2IUV A;  4ZOZ A;  4FA5 D;  3EI3 B;  3VA6 A;  1U2V C;  3OKY A;  3V5W B;  4J73 A;  3N0E A;  2XL2 A;  4J81 A;  2O9K A;  2P9L C;  5HQG A;  4ZOY A;  4J84 A;  4L9O A;  3OL2 B;  3RFG A;  5HYN B;  4FA4 D;  2J55 H;  3SBR A;  3I7K A;  2YNN A;  4N14 A;  2OK4 A;  2H6Q A;  3EG6 A;  4IA9 A;  3AL9 A;  4X60 B;  1OMW B;  4PBY A;  1YFQ A;  2J57 G;  4K3I D;  4U1E I;  1L0Q A;  4X3E A;  2AGW A;  2OIZ A;  4A09 B;  3PXT D;  1GG2 B;  4J0W A;  3UKR C;  4E5Z B;  4XYH A;  3EMH A;  3PVW B;  4PSW B;  3U4Y A;  3KRX B;  5HE0 B;  5FKR A;  4BL0 A;  4A0B B;  4PNK B;  3ODT A;  3EI4 B;  5IJ8 E;  3EI4 A;  5FLX g;  4OZU A;  3FM0 A;  2H14 A;  4A2M A;  2AGL A;  2IWK A;  2W18 A;  1ERJ A;  4JSN C;  2HXC A;  5H17 A;  1JMX B;  4X63 B;  5JWZ A;  4L3G D;  5CYK A;  5A2Q g;  3SBQ A;  1K8K C;  3OW8 A;  3C75 H;  3C9C A;  2HKR A;  5K1C C;  3JAM g;  4CY1 A;  1S4U X;  3NVN A;  4J8G A;  3RFH A;  4CZY A;  1JMZ B;  2P9U C;  1JJU B;  3SN6 B;  1TYQ C;  2YNP A;  3IIW A;  2P9S C;  5EAP A;  2CO0 A;  4JXM A;  3MXX A;  4PBZ A;  2YMU A;  5TF2 A;  3VGZ A;  4KFM B;  3I89 A;  5SXM A;  2Q7Q A;  3DWL C;  4J77 A;  3CFV A;  3C5M A;  3UVM A;  3KRW B;  4HDJ A;  4I79 A;  3AL8 B;  4GGD A;  4ESG A;  4G56 B;  4A11 B;  5GXI A;  2I3S A;  2H9N A;  3I7N A;  2OVQ B;  4O1Q D;  2H9P A;  5FKT A;  4QQE A;  1XHM A;  2I0R A;  4A0B A;  4AEZ A;  1K32 A;  4ES0 A;  1Q47 A;  5IJ7 E;  3L4M D;  4A0A A;  2GNQ A;  4H5J A;  3NVQ A;  2Z2P A;  3SXT D;  2OK6 A;  3UVN A;  2H9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...