3RFHA

Crystal structure of the yeast rack1 dimer in space group p21
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
315
structure length
291
Chain Sequence
SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSAAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the RACK1 dimer from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
total genus 67
structure length 291
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rfhA00
1PGUA 4ZOYA 3SFZA 2OVRB 3SJLD 4LGNA 4PC0A 2HJBA 3PVWB 3DWLC 3MZLA 3MZKA 2H9MA 4O45A 3UR4A 3CFVA 3FM0A 4FHLA 5GSAA 3IIYA 4FA4D 1U4CA 3EI1B 5FA5B 5K19A 4A08A 3EI4B 4CY3A 2PM7B 5EMLB 2AQ5A 3BWSA 4X61B 2AH1A 2OIZA 4E5ZA 4PBYA 4IMMA 4G56B 2IWKA 4QRJA 2GC4A 4CY1A 2P9SC 2CN3A 2O9KA 2HESX 2IAAA 3C75H 1QNIA 4JSNC 4GM8A 2BBKH 4GMBA 5C2VB 3V5WB 5EMKB 4ERZA 3SN6B 3JZHA 3IJ0A 5H1MA 2HKMA 5AMSA 3EU7A 3RMZD 2QC5A 4FAND 2CO0C 3I7NA 3NVQA 3EI3B 1TYQC 3B7FA 1PEVA 4UI9R 3JPXA 3OTTA 4EWRA 4J82A 3OKTA 2H9NA 3EI2B 4D0KA 1Q47A 5A2Qg 1RI6A 3VGZA 3SWSD 2H9LA 4JSVC 3DXKC 4A0AB 3MKSB 1JMXB 3PSCB 3BG0A 2HYEA 2YB8B 3DM0A 2UZYB 3BG1A 4CZYA 4AEZA 4PNKB 5IJ8E 4TZ4A 5B4WA 3FRXA 3PVUB 3DXMC 1L0QA 4FAVD 5IJ7E 5FXYA 3PXTD 3I7PA 1TBGA 5GMKn 5GXIA 5C9ZB 4R7AB 5FKQA 2IUVA 5CYKB 4GQBB 4J8BA 4K3ID 4NSXA 3FGBA 4ERQA 2GC7A 3AL8A 4H5JA 2UZXB 4ERYA 3JAMg 5I5MA 4QL1A 2P9LC 3W15A 3N0DA 3JZGA 4H5IA 5IGOA 1SHYB 2Z2NA 2OVQB 4U7AA 2P9UC 3I8EA 2QXVA 2PM6B 4J86A 4AOWA 1P22A 2H13A 3C99A 5CXCB 4ES0A 4PSXB 4X60B 4YVDA 4ESGA 2H47A 4A0AA 3KRWB 4K3JB 2Q7QA 5SXMA 3IJCA 2YNOA 3SHFA 3ZWLB 4CZVA 1N6EA 5CXCA 3KRXB 2B4EA 3GREA 5HE2B 5THAA 2G99A 2BCJB 4O9DA 2YNNA 4GGDA 4GM3A 4LG8A 2B5NA 4GZ8A 4L9OA 1SQJA 2AGLA 2P9PC 3EI4A 2HKRA 4JD2C 3MMYA 4PBZA 2J56H 5HYNB 4A7JA 3L4OD 5EMJB 3UVOA 3V9FA 4E54A 5EAMA 4E5ZB 5CYKA 5HE3B 2AH0A 3AL8B 3EWEA 3ORVD 4BUJC 5CXBB 5GXHA 1A0RB 3VA6A 4ZOVA 3AH8B 3CIKB 3IJ1A 2H6KA 3OW8A 3OKYA 4J0XA 2CE9A 3I7HA 3SMRA 4FA5D 4GGAA 4CI1A 2P9NC 2I0SA 4J79A 4QQEA 3EG6A 3ODTA 1B9XA 2AGWA 3SBRA 3EMHA 5FKRA 1GOTB 2H6QA 5IGQA 1PI6A 4IA9A 4JT6C 4A09B 1PBYB 5I5IA 5TEFA 4ZOZA 2P9IC 3MKQA 2B5MA 5IT9g 4MK0B 4CY5A 4GM9A 5FQDA 4ZOXA 5TDHB 3C9CA 5EAPA 2AGXA 4J81A 3PXWD 3AL9A 3JROA 3MXXA 4J0WA 4J77A 5FLXg 3I7LA 3F3GA 2I0RA 2AGYA 4JT5C 4JSPC 1JMZB 2H9PA 1R5MA 1NEXB 2G9AA 4JXMA 4A08B 4KFMB 5I5JA 4CI2A 5HE1B 4L3GD 2H68A 1XKSA 3UKRC 1NR0A 5H17A 2TRCB 3E0CA 3RLMD 1GXRA 4Z8LA 3HFQA 4J87A 1XIPA 3PSLA 3GFCA 3UVMA 2PM9A 1VYHC 2I0TA 2AGZA 5HQGA 1XHMA 4A11A 2CO0A 2XYIA 3CFSB 4PSWB 2GNQA 1MG2A 2YMUA 3UVNA 5HE0B 4CC9A 3ULEC 2IWFA 1GP2B 3SBQA 2CNXA 2PM9B 3UVKA 5EMMB 1MDAH 1S4UX 2HJ4A 4O1QD 4FA1D 4HDJA 3OL2B 2P9KC 3A0FA 3EI1A 3SXTD 3UVLA 3SCYA 1JJUB 2OVPB 3J81g 3C5MA 4J73A 1B9YA 3PE7A 4A2LA 2EBSA 3PXSD 2YBAA 4J8GA 3SLED 3OL2A 3JRPA 2OK4A 5EARA 3IKOA 4X3EA 2J55H 3P4FA 5EM2A 3UKUC 2XU7A 4GQ2P 2H6NA 4L3HD 1U2VC 1GG2B 1OMWB 3JZNA 3NVXA 3K26A 5IC7A 4CI3A 3U4YA 3RFGA 3N0EA 4XYHA 5AJAA 4ZN4A 3RFHA 4OWRA 5K1CC 4I79A 4Y5RD 3F3PA 3I8CA 4FA9D 1SQ9A 4D6VA 2CE8A 3EI3A 2Z2OA 4GGCA 3VH0A 2J57G 3IIWA 2OK6A 4CY2A 4X63B 3J80g 4CI8A 3RN0D 5AFU3 3L4MD 3SVWD 2HXCA 1JOFA 4N14A 1MG3A 5JWZA 2PBIB 3EI2A 4L1QD 4BL0A 4O3TB 2OJYA 3SBPA 2YNPA 5TEEA 1ERJA 4A0BA 3RRMC 3AFCA 3DSMA 3JB9L 4GQ1A 1FWXA 1K32A 4Y7RA 2B5LA 1N6FA 4U1EI 2XL2A 2I3TA 5FKSA 3V7DB 4A0BB 1N6DA 5EM2B 2IUQA 4BH6A 2W18A 4XYIA 5CXBA 2H14A 4O3UB 3I89A 2H3XA 4LG9A 4OZUA 5FKTA 1K8KC 2Z2PA 4FB1D 2CN2A 2IURA 3I7KA 2IUPA 2XL3A 3OKYB 4J84A 4CZXA 1YFQA 3NVNA 3K27A 4QT8A 5C2WB 4PXWA 5KDOB 3F3FA 4E54B 2I3SA 5TF2A 3RSEC 3I7OA 4FWWA 4A09A 4XEIC 1OLZA 3RN1D 2MTAH 4JSXC 5EALA 3I2NA 4A11B 4J78A 5H14A 3OKWA 4A2MA
chains in the Genus database with same CATH superfamily
5M61A 1PGUA 4ZOYA 3SFZA 1JTDB 2OVRB 3SJLD 4LGNA 4PC0A 2HJBA 3PVWB 3DWLC 4O2WA 3MZLA 3MZKA 2H9MA 4O45A 3UR4A 3CFVA 3IUJA 3FM0A 4FHLA 4O02A 5GSAA 5FFGA 3IIYA 4FA4D 1U4CA 3EI1B 5FA5B 5C86A 5K19A 4A08A 3EI4B 4CY3A 2PM7B 5EMLB 2AQ5A 3BWSA 4X61B 3NIGA 2AH1A 2OIZA 5E6UA 5E6SA 4E5ZA 4PBYA 4IMMA 4G56B 2IWKA 4QRJA 2BKLA 3K71A 3VI3A 2GC4A 2VDNA 2XZGA 4CY1A 5M5UA 2P9SC 2CN3A 2O9KA 2HESX 2IAAA 3C75H 1QNIA 4JSNC 4L1MA 2HU5A 4GM8A 2BBKH 4GMBA 4AX4A 5FFOA 5C2VB 3V5WB 5EMKB 4UM9A 4ERZA 3SN6B 3ZDXA 4AN0A 3JZHA 4WK4A 3IJ0A 5H1MA 2HKMA 5AMSA 3EU7A 3RMZD 2QC5A 4FAND 2CO0C 3I7NA 3NVQA 3EI3B 1TYQC 3B7FA 1PEVA 4UI9R 3JPXA 3OTTA 1QFSA 3IULA 4EWRA 4J82A 3OKTA 4WK2A 1QFMA 2H9NA 3IUQA 3EQ7A 3EI2B 4D0KA 1C9IA 1Q47A 5A2Qg 1RI6A 3VGZA 3SWSD 2H9LA 4JSVC 4DNVA 3DXKC 4A0AB 3MKSB 4RE5A 1JMXB 3PSCB 3BG0A 1L5GA 4NAAA 2HYEA 3FCUA 2YB8B 1U8CA 3DM0A 2UZYB 3BG1A 4CZYA 5M5SA 5HDBA 4AEZA 4MMXA 4PNKB 5IJ8E 4TZ4A 1K3IA 3MUOA 4NBMA 5B4WA 1O6FA 3EQ9A 3FRXA 3PVUB 3DXMC 1L0QA 4FAVD 5IJ7E 5FXYA 2JKXA 3PXTD 3I7PA 1TBGA 5GMKn 5GXIA 3NIDA 5C9ZB 4R7AB 5FKQA 2IUVA 5CYKB 4GQBB 4J8BA 4K3ID 4NSXA 3FGBA 4ERQA 2GC7A 3AL8A 4H5JA 2UZXB 4ERYA 3JAMg 5I5MA 4QL1A 2P9LC 3W15A 3N0DA 3JZGA 4Z7OA 4H5IA 5IGOA 5M5TA 1SHYB 2EICA 3ZDYA 2Z2NA 2OVQB 3ZE2A 4U7AA 2P9UC 3I8EA 1TYEA 2QXVA 2PM6B 2QZPA 3EQ8A 4J86A 4AOWA 3QHYB 1P22A 2H13A 3C99A 5CXCB 4ES0A 1GOGA 3IVMA 4PSXB 4X60B 4YVDA 4ESGA 2H47A 4A0AA 3KRWB 2VDKA 4K3JB 3ZE0A 2Q7QA 5SXMA 3GC3B 3IJCA 2YNOA 3SHFA 3ZWLB 4CZVA 1N6EA 5CXCA 3KRXB 2B4EA 3GREA 5HE2B 5THAA 2VDPA 2G99A 2BCJB 4O9DA 2YNNA 4GGDA 4GM3A 4LG8A 2EIBA 2B5NA 4QAMA 4WJKA 4GZ8A 2VDOA 4L9OA 1SQJA 4AMYA 2AGLA 2P9PC 3EI4A 3O4GA 2HKRA 4JD2C 3MMYA 1JV2A 3V4PA 4PBZA 2J56H 3NIFA 5HYNB 4A7JA 3O4IA 3L4OD 5EMJB 3UVOA 3V9FA 4E54A 5EAMA 4E5ZB 5CYKA 5HE3B 4AMZA 2AH0A 3AL8B 3EWEA 4JHNA 3ORVD 2VDLA 1VZ2A 3IURA 1GOHA 4BUJC 5CXBB 5GXHA 1A0RB 1GOFA 3VA6A 4ZOVA 3AH8B 3CIKB 3IJ1A 4WK0A 2H6KA 3O4HA 3OW8A 3IUNA 3OKYA 4J0XA 2CE9A 3I7HA 3SMRA 3K6SA 4FA5D 4GGAA 1UOOA 4CI1A 2P9NC 2I0SA 4J79A 4QQEA 3EG6A 3ODTA 4AN1A 1B9XA 2AGWA 3SBRA 3EMHA 5FKRA 1GOTB 1E8NA 2H6QA 5IGQA 1PI6A 4IA9A 4JT6C 4A09B 1PBYB 5I5IA 5TEFA 4ZOZA 2P9IC 3MKQA 2HU7A 2B5MA 5IT9g 4MK0B 4CY5A 4GM9A 1YR2A 4ZOXA 5FQDA 4JHPC 3MVDK 5TDHB 3C9CA 5EAPA 2AGXA 4J81A 2VC2A 3PXWD 3AL9A 3JROA 3MXXA 4J0WA 4J77A 5FLXg 3I7LA 3F3GA 2I0RA 2AGYA 4JT5C 4JSPC 1JMZB 2H9PA 1R5MA 2QR5A 4G1EA 1NEXB 2G9AA 4JXMA 4BP9A 4KFMB 3VI4A 4A08B 5I5JA 3ZE1A 4CI2A 5HE1B 1E8MA 4L3GD 2H68A 1XKSA 3UKRC 1NR0A 3V4VA 1H2YA 5H17A 1M1XA 2TRCB 3E0CA 3RLMD 1GXRA 4Z8LA 3HFQA 4J87A 1XIPA 3PSLA 3GFCA 3UVMA 2PM9A 1VYHC 2HU8A 2I0TA 2AGZA 5HQGA 1XHMA 3FCSA 2CO0A 4A11A 2XYIA 3CFSB 4PSWB 2GNQA 1MG2A 2YMUA 3UVNA 3T3PA 5HE0B 4CC9A 3ULEC 4BCCA 2IWFA 1BPOA 1GP2B 3SBQA 2CNXA 2PM9B 3UVKA 1H2WA 5EMMB 1MDAH 3QI0A 1S4UX 2HJ4A 2XDWA 4O1QD 4FA1D 4HDJA 3OL2B 2P9KC 3A0FA 3EI1A 3SXTD 3UVLA 3SCYA 1JJUB 1O6GA 5M5RA 2OVPB 3J81g 3C5MA 3O4JA 4J73A 1B9YA 3PE7A 4A2LA 2EBSA 3PXSD 2VDRA 2YBAA 4J8GA 2WQ8A 2XE4A 3SLED 3OL2A 3JRPA 2OK4A 5EARA 3IKOA 5C92A 4X3EA 2J55H 3P4FA 5EM2A 3UKUC 2XU7A 4GQ2P 2H6NA 4L3HD 1U2VC 1OMWB 1GG2B 4BP8A 4IRZA 1I2MB 3JZNA 3NVXA 3K26A 5IC7A 4CI3A 3U4YA 3RFGA 4DNWA 3N0EA 4XYHA 5AJAA 3K72A 4ZN4A 3RFHA 3IUMA 4OWRA 3T3MA 5K1CC 4I79A 1H2XA 3F3PA 4Y5RD 3I8CA 4FA9D 1SQ9A 4D6VA 2CE8A 3EI3A 2Z2OA 4GGCA 3VH0A 1VE7A 2VDMA 2J57G 3IIWA 2OK6A 4CY2A 4X63B 3J80g 4CI8A 4DNUA 4BCDA 4NENA 3RN0D 5AFU3 3L4MD 1C9LA 3SVWD 2HXCA 1JOFA 1VZ3A 4N14A 1MG3A 5JWZA 2PBIB 3EI2A 4L1QD 4BL0A 4O3TB 4G1MA 2OJYA 3SBPA 2YNPA 5TEEA 2VZ3A 1ERJA 4UM8A 4NC4A 3RRMC 4A0BA 3AFCA 2VZ1A 1E5TA 3DSMA 2EIDA 3JB9L 1T2XA 4GQ1A 4MMYA 1FWXA 1K32A 4Y7RA 2B5LA 1N6FA 4U1EI 2XL2A 4D9SA 2I3TA 5E6RA 5FKSA 3V7DB 3ZDZA 1N6DA 4A0BB 1UOQA 5EM2B 2IUQA 4BH6A 2EIEA 2W18A 4XYIA 5CXBA 2H14A 4O3UB 3I89A 4Z7QA 3DDUA 1UOPA 2H3XA 3MUNA 4LG9A 4OZUA 4G55A 5FKTA 1K8KC 1A12A 2Z2PA 3GD1I 4FB1D 4MMZA 2CN2A 5M5VA 2IURA 3I7KA 2IUPA 2XL3A 3OKYB 4J84A 4CZXA 1YFQA 3NVNA 3K27A 4Z7NA 1UTCA 4QT8A 5C2WB 4PXWA 5KDOB 3F3FA 3IJEA 3OF7A 4E54B 2I3SA 5TF2A 1H2ZA 2VDQA 3RSEC 3KCIA 3I7OA 4FWWA 4RE6A 4A09A 4XEIC 1OLZA 4BCBA 3RN1D 2MTAH 4JSXC 1VE6A 5EALA 3I2NA 4A11B 4J78A 5H14A 3OKWA 4A2MA
chains in the Genus database with same CATH topology
1PGUA 4ZOYA 3SFZA 2OVRB 3SJLD 4LGNA 4PC0A 2HJBA 3PVWB 3DWLC 3MZLA 3MZKA 2H9MA 4O45A 3UR4A 3CFVA 3FM0A 4FHLA 5GSAA 3IIYA 4FA4D 1U4CA 3EI1B 5FA5B 5K19A 4A08A 3EI4B 4CY3A 2PM7B 5EMLB 2AQ5A 3BWSA 4X61B 2AH1A 2OIZA 4E5ZA 4PBYA 4IMMA 4G56B 2IWKA 4QRJA 2GC4A 4CY1A 2P9SC 2CN3A 2O9KA 2HESX 2IAAA 3C75H 1QNIA 4JSNC 4GM8A 2BBKH 4GMBA 5C2VB 3V5WB 5EMKB 4ERZA 3SN6B 3JZHA 3IJ0A 5H1MA 2HKMA 5AMSA 3EU7A 3RMZD 2QC5A 4FAND 2CO0C 3I7NA 3NVQA 3EI3B 1TYQC 3B7FA 1PEVA 4UI9R 3JPXA 3OTTA 4EWRA 4J82A 3OKTA 2H9NA 3EI2B 4D0KA 1Q47A 5A2Qg 1RI6A 3VGZA 3SWSD 2H9LA 4JSVC 3DXKC 4A0AB 3MKSB 1JMXB 3PSCB 3BG0A 2HYEA 2YB8B 3DM0A 2UZYB 3BG1A 4CZYA 4AEZA 4PNKB 5IJ8E 4TZ4A 5B4WA 3FRXA 3PVUB 3DXMC 1L0QA 4FAVD 5IJ7E 5FXYA 3PXTD 3I7PA 1TBGA 5GMKn 5GXIA 5C9ZB 4R7AB 5FKQA 2IUVA 5CYKB 4GQBB 4J8BA 4K3ID 4NSXA 3FGBA 4ERQA 2GC7A 3AL8A 4H5JA 2UZXB 4ERYA 3JAMg 5I5MA 4QL1A 2P9LC 3W15A 3N0DA 3JZGA 4H5IA 5IGOA 1SHYB 2Z2NA 2OVQB 4U7AA 2P9UC 3I8EA 2QXVA 2PM6B 4J86A 4AOWA 1P22A 2H13A 3C99A 5CXCB 4ES0A 4PSXB 4X60B 4YVDA 4ESGA 2H47A 4A0AA 3KRWB 4K3JB 2Q7QA 5SXMA 3IJCA 2YNOA 3SHFA 3ZWLB 4CZVA 1N6EA 5CXCA 3KRXB 2B4EA 3GREA 5HE2B 5THAA 2G99A 2BCJB 4O9DA 2YNNA 4GGDA 4GM3A 4LG8A 2B5NA 4GZ8A 4L9OA 1SQJA 2AGLA 2P9PC 3EI4A 2HKRA 4JD2C 3MMYA 4PBZA 2J56H 5HYNB 4A7JA 3L4OD 5EMJB 3UVOA 3V9FA 4E54A 5EAMA 4E5ZB 5CYKA 5HE3B 2AH0A 3AL8B 3EWEA 3ORVD 4BUJC 5CXBB 5GXHA 1A0RB 3VA6A 4ZOVA 3AH8B 3CIKB 3IJ1A 2H6KA 3OW8A 3OKYA 4J0XA 2CE9A 3I7HA 3SMRA 4FA5D 4GGAA 4CI1A 2P9NC 2I0SA 4J79A 4QQEA 3EG6A 3ODTA 1B9XA 2AGWA 3SBRA 3EMHA 5FKRA 1GOTB 2H6QA 5IGQA 1PI6A 4IA9A 4JT6C 4A09B 1PBYB 5I5IA 5TEFA 4ZOZA 2P9IC 3MKQA 2B5MA 5IT9g 4MK0B 4CY5A 4GM9A 5FQDA 4ZOXA 5TDHB 3C9CA 5EAPA 2AGXA 4J81A 3PXWD 3AL9A 3JROA 3MXXA 4J0WA 4J77A 5FLXg 3I7LA 3F3GA 2I0RA 2AGYA 4JT5C 4JSPC 1JMZB 2H9PA 1R5MA 1NEXB 2G9AA 4JXMA 4A08B 4KFMB 5I5JA 4CI2A 5HE1B 4L3GD 2H68A 1XKSA 3UKRC 1NR0A 5H17A 2TRCB 3E0CA 3RLMD 1GXRA 4Z8LA 3HFQA 4J87A 1XIPA 3PSLA 3GFCA 3UVMA 2PM9A 1VYHC 2I0TA 2AGZA 5HQGA 1XHMA 4A11A 2CO0A 2XYIA 3CFSB 4PSWB 2GNQA 1MG2A 2YMUA 3UVNA 5HE0B 4CC9A 3ULEC 2IWFA 1GP2B 3SBQA 2CNXA 2PM9B 3UVKA 5EMMB 1MDAH 1S4UX 2HJ4A 4O1QD 4FA1D 4HDJA 3OL2B 2P9KC 3A0FA 3EI1A 3SXTD 3UVLA 3SCYA 1JJUB 2OVPB 3J81g 3C5MA 4J73A 1B9YA 3PE7A 4A2LA 2EBSA 3PXSD 2YBAA 4J8GA 3SLED 3OL2A 3JRPA 2OK4A 5EARA 3IKOA 4X3EA 2J55H 3P4FA 5EM2A 3UKUC 2XU7A 4GQ2P 2H6NA 4L3HD 1U2VC 1GG2B 1OMWB 3JZNA 3NVXA 3K26A 5IC7A 4CI3A 3U4YA 3RFGA 3N0EA 4XYHA 5AJAA 4ZN4A 3RFHA 4OWRA 5K1CC 4I79A 4Y5RD 3F3PA 3I8CA 4FA9D 1SQ9A 4D6VA 2CE8A 3EI3A 2Z2OA 4GGCA 3VH0A 2J57G 3IIWA 2OK6A 4CY2A 4X63B 3J80g 4CI8A 3RN0D 5AFU3 3L4MD 3SVWD 2HXCA 1JOFA 4N14A 1MG3A 5JWZA 2PBIB 3EI2A 4L1QD 4BL0A 4O3TB 2OJYA 3SBPA 2YNPA 5TEEA 1ERJA 4A0BA 3RRMC 3AFCA 3DSMA 3JB9L 4GQ1A 1FWXA 1K32A 4Y7RA 2B5LA 1N6FA 4U1EI 2XL2A 2I3TA 5FKSA 3V7DB 4A0BB 1N6DA 5EM2B 2IUQA 4BH6A 2W18A 4XYIA 5CXBA 2H14A 4O3UB 3I89A 2H3XA 4LG9A 4OZUA 5FKTA 1K8KC 2Z2PA 4FB1D 2CN2A 2IURA 3I7KA 2IUPA 2XL3A 3OKYB 4J84A 4CZXA 1YFQA 3NVNA 3K27A 4QT8A 5C2WB 4PXWA 5KDOB 3F3FA 4E54B 2I3SA 5TF2A 3RSEC 3I7OA 4FWWA 4A09A 4XEIC 1OLZA 3RN1D 2MTAH 4JSXC 5EALA 3I2NA 4A11B 4J78A 5H14A 3OKWA 4A2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGU A;  4ZOY A;  3SFZ A;  2OVR B;  3SJL D;  4LGN A;  4PC0 A;  2HJB A;  3PVW B;  3DWL C;  3MZL A;  3MZK A;  2H9M A;  4O45 A;  3UR4 A;  3CFV A;  3FM0 A;  4FHL A;  5GSA A;  3IIY A;  4FA4 D;  1U4C A;  3EI1 B;  5FA5 B;  5K19 A;  4A08 A;  3EI4 B;  4CY3 A;  2PM7 B;  5EML B;  2AQ5 A;  3BWS A;  4X61 B;  2AH1 A;  2OIZ A;  4E5Z A;  4PBY A;  4IMM A;  4G56 B;  2IWK A;  4QRJ A;  2GC4 A;  4CY1 A;  2P9S C;  2CN3 A;  2O9K A;  2HES X;  2IAA A;  3C75 H;  1QNI A;  4JSN C;  4GM8 A;  2BBK H;  4GMB A;  5C2V B;  3V5W B;  5EMK B;  4ERZ A;  3SN6 B;  3JZH A;  3IJ0 A;  5H1M A;  2HKM A;  5AMS A;  3EU7 A;  3RMZ D;  2QC5 A;  4FAN D;  2CO0 C;  3I7N A;  3NVQ A;  3EI3 B;  1TYQ C;  3B7F A;  1PEV A;  4UI9 R;  3JPX A;  3OTT A;  4EWR A;  4J82 A;  3OKT A;  2H9N A;  3EI2 B;  4D0K A;  1Q47 A;  5A2Q g;  1RI6 A;  3VGZ A;  3SWS D;  2H9L A;  4JSV C;  3DXK C;  4A0A B;  3MKS B;  1JMX B;  3PSC B;  3BG0 A;  2HYE A;  2YB8 B;  3DM0 A;  2UZY B;  3BG1 A;  4CZY A;  4AEZ A;  4PNK B;  5IJ8 E;  4TZ4 A;  5B4W A;  3FRX A;  3PVU B;  3DXM C;  1L0Q A;  4FAV D;  5IJ7 E;  5FXY A;  3PXT D;  3I7P A;  1TBG A;  5GMK n;  5GXI A;  5C9Z B;  4R7A B;  5FKQ A;  2IUV A;  5CYK B;  4GQB B;  4J8B A;  4K3I D;  4NSX A;  3FGB A;  4ERQ A;  2GC7 A;  3AL8 A;  4H5J A;  2UZX B;  4ERY A;  3JAM g;  5I5M A;  4QL1 A;  2P9L C;  3W15 A;  3N0D A;  3JZG A;  4H5I A;  5IGO A;  1SHY B;  2Z2N A;  2OVQ B;  4U7A A;  2P9U C;  3I8E A;  2QXV A;  2PM6 B;  4J86 A;  4AOW A;  1P22 A;  2H13 A;  3C99 A;  5CXC B;  4ES0 A;  4PSX B;  4X60 B;  4YVD A;  4ESG A;  2H47 A;  4A0A A;  3KRW B;  4K3J B;  2Q7Q A;  5SXM A;  3IJC A;  2YNO A;  3SHF A;  3ZWL B;  4CZV A;  1N6E A;  5CXC A;  3KRX B;  2B4E A;  3GRE A;  5HE2 B;  5THA A;  2G99 A;  2BCJ B;  4O9D A;  2YNN A;  4GGD A;  4GM3 A;  4LG8 A;  2B5N A;  4GZ8 A;  4L9O A;  1SQJ A;  2AGL A;  2P9P C;  3EI4 A;  2HKR A;  4JD2 C;  3MMY A;  4PBZ A;  2J56 H;  5HYN B;  4A7J A;  3L4O D;  5EMJ B;  3UVO A;  3V9F A;  4E54 A;  5EAM A;  4E5Z B;  5CYK A;  5HE3 B;  2AH0 A;  3AL8 B;  3EWE A;  3ORV D;  4BUJ C;  5CXB B;  5GXH A;  1A0R B;  3VA6 A;  4ZOV A;  3AH8 B;  3CIK B;  3IJ1 A;  2H6K A;  3OW8 A;  3OKY A;  4J0X A;  2CE9 A;  3I7H A;  3SMR A;  4FA5 D;  4GGA A;  4CI1 A;  2P9N C;  2I0S A;  4J79 A;  4QQE A;  3EG6 A;  3ODT A;  1B9X A;  2AGW A;  3SBR A;  3EMH A;  5FKR A;  1GOT B;  2H6Q A;  5IGQ A;  1PI6 A;  4IA9 A;  4JT6 C;  4A09 B;  1PBY B;  5I5I A;  5TEF A;  4ZOZ A;  2P9I C;  3MKQ A;  2B5M A;  5IT9 g;  4MK0 B;  4CY5 A;  4GM9 A;  5FQD A;  4ZOX A;  5TDH B;  3C9C A;  5EAP A;  2AGX A;  4J81 A;  3PXW D;  3AL9 A;  3JRO A;  3MXX A;  4J0W A;  4J77 A;  5FLX g;  3I7L A;  3F3G A;  2I0R A;  2AGY A;  4JT5 C;  4JSP C;  1JMZ B;  2H9P A;  1R5M A;  1NEX B;  2G9A A;  4JXM A;  4A08 B;  4KFM B;  5I5J A;  4CI2 A;  5HE1 B;  4L3G D;  2H68 A;  1XKS A;  3UKR C;  1NR0 A;  5H17 A;  2TRC B;  3E0C A;  3RLM D;  1GXR A;  4Z8L A;  3HFQ A;  4J87 A;  1XIP A;  3PSL A;  3GFC A;  3UVM A;  2PM9 A;  1VYH C;  2I0T A;  2AGZ A;  5HQG A;  1XHM A;  4A11 A;  2CO0 A;  2XYI A;  3CFS B;  4PSW B;  2GNQ A;  1MG2 A;  2YMU A;  3UVN A;  5HE0 B;  4CC9 A;  3ULE C;  2IWF A;  1GP2 B;  3SBQ A;  2CNX A;  2PM9 B;  3UVK A;  5EMM B;  1MDA H;  1S4U X;  2HJ4 A;  4O1Q D;  4FA1 D;  4HDJ A;  3OL2 B;  2P9K C;  3A0F A;  3EI1 A;  3SXT D;  3UVL A;  3SCY A;  1JJU B;  2OVP B;  3J81 g;  3C5M A;  4J73 A;  1B9Y A;  3PE7 A;  4A2L A;  2EBS A;  3PXS D;  2YBA A;  4J8G A;  3SLE D;  3OL2 A;  3JRP A;  2OK4 A;  5EAR A;  3IKO A;  4X3E A;  2J55 H;  3P4F A;  5EM2 A;  3UKU C;  2XU7 A;  4GQ2 P;  2H6N A;  4L3H D;  1U2V C;  1GG2 B;  1OMW B;  3JZN A;  3NVX A;  3K26 A;  5IC7 A;  4CI3 A;  3U4Y A;  3RFG A;  3N0E A;  4XYH A;  5AJA A;  4ZN4 A;  3RFH A;  4OWR A;  5K1C C;  4I79 A;  4Y5R D;  3F3P A;  3I8C A;  4FA9 D;  1SQ9 A;  4D6V A;  2CE8 A;  3EI3 A;  2Z2O A;  4GGC A;  3VH0 A;  2J57 G;  3IIW A;  2OK6 A;  4CY2 A;  4X63 B;  3J80 g;  4CI8 A;  3RN0 D;  5AFU 3;  3L4M D;  3SVW D;  2HXC A;  1JOF A;  4N14 A;  1MG3 A;  5JWZ A;  2PBI B;  3EI2 A;  4L1Q D;  4BL0 A;  4O3T B;  2OJY A;  3SBP A;  2YNP A;  5TEE A;  1ERJ A;  4A0B A;  3RRM C;  3AFC A;  3DSM A;  3JB9 L;  4GQ1 A;  1FWX A;  1K32 A;  4Y7R A;  2B5L A;  1N6F A;  4U1E I;  2XL2 A;  2I3T A;  5FKS A;  3V7D B;  4A0B B;  1N6D A;  5EM2 B;  2IUQ A;  4BH6 A;  2W18 A;  4XYI A;  5CXB A;  2H14 A;  4O3U B;  3I89 A;  2H3X A;  4LG9 A;  4OZU A;  5FKT A;  1K8K C;  2Z2P A;  4FB1 D;  2CN2 A;  2IUR A;  3I7K A;  2IUP A;  2XL3 A;  3OKY B;  4J84 A;  4CZX A;  1YFQ A;  3NVN A;  3K27 A;  4QT8 A;  5C2W B;  4PXW A;  5KDO B;  3F3F A;  4E54 B;  2I3S A;  5TF2 A;  3RSE C;  3I7O A;  4FWW A;  4A09 A;  4XEI C;  1OLZ A;  3RN1 D;  2MTA H;  4JSX C;  5EAL A;  3I2N A;  4A11 B;  4J78 A;  5H14 A;  3OKW A;  4A2M A; 
#chains in the Genus database with same CATH topology
 5M61 A;  1PGU A;  4ZOY A;  3SFZ A;  1JTD B;  2OVR B;  3SJL D;  4LGN A;  4PC0 A;  2HJB A;  3PVW B;  3DWL C;  4O2W A;  3MZL A;  3MZK A;  2H9M A;  4O45 A;  3UR4 A;  3CFV A;  3IUJ A;  3FM0 A;  4FHL A;  4O02 A;  5GSA A;  5FFG A;  3IIY A;  4FA4 D;  1U4C A;  3EI1 B;  5FA5 B;  5C86 A;  5K19 A;  4A08 A;  3EI4 B;  4CY3 A;  2PM7 B;  5EML B;  2AQ5 A;  3BWS A;  4X61 B;  3NIG A;  2AH1 A;  2OIZ A;  5E6U A;  5E6S A;  4E5Z A;  4PBY A;  4IMM A;  4G56 B;  2IWK A;  4QRJ A;  2BKL A;  3K71 A;  3VI3 A;  2GC4 A;  2VDN A;  2XZG A;  4CY1 A;  5M5U A;  2P9S C;  2CN3 A;  2O9K A;  2HES X;  2IAA A;  3C75 H;  1QNI A;  4JSN C;  4L1M A;  2HU5 A;  4GM8 A;  2BBK H;  4GMB A;  4AX4 A;  5FFO A;  5C2V B;  3V5W B;  5EMK B;  4UM9 A;  4ERZ A;  3SN6 B;  3ZDX A;  4AN0 A;  3JZH A;  4WK4 A;  3IJ0 A;  5H1M A;  2HKM A;  5AMS A;  3EU7 A;  3RMZ D;  2QC5 A;  4FAN D;  2CO0 C;  3I7N A;  3NVQ A;  3EI3 B;  1TYQ C;  3B7F A;  1PEV A;  4UI9 R;  3JPX A;  3OTT A;  1QFS A;  3IUL A;  4EWR A;  4J82 A;  3OKT A;  4WK2 A;  1QFM A;  2H9N A;  3IUQ A;  3EQ7 A;  3EI2 B;  4D0K A;  1C9I A;  1Q47 A;  5A2Q g;  1RI6 A;  3VGZ A;  3SWS D;  2H9L A;  4JSV C;  4DNV A;  3DXK C;  4A0A B;  3MKS B;  4RE5 A;  1JMX B;  3PSC B;  3BG0 A;  1L5G A;  4NAA A;  2HYE A;  3FCU A;  2YB8 B;  1U8C A;  3DM0 A;  2UZY B;  3BG1 A;  4CZY A;  5M5S A;  5HDB A;  4AEZ A;  4MMX A;  4PNK B;  5IJ8 E;  4TZ4 A;  1K3I A;  3MUO A;  4NBM A;  5B4W A;  1O6F A;  3EQ9 A;  3FRX A;  3PVU B;  3DXM C;  1L0Q A;  4FAV D;  5IJ7 E;  5FXY A;  2JKX A;  3PXT D;  3I7P A;  1TBG A;  5GMK n;  5GXI A;  3NID A;  5C9Z B;  4R7A B;  5FKQ A;  2IUV A;  5CYK B;  4GQB B;  4J8B A;  4K3I D;  4NSX A;  3FGB A;  4ERQ A;  2GC7 A;  3AL8 A;  4H5J A;  2UZX B;  4ERY A;  3JAM g;  5I5M A;  4QL1 A;  2P9L C;  3W15 A;  3N0D A;  3JZG A;  4Z7O A;  4H5I A;  5IGO A;  5M5T A;  1SHY B;  2EIC A;  3ZDY A;  2Z2N A;  2OVQ B;  3ZE2 A;  4U7A A;  2P9U C;  3I8E A;  1TYE A;  2QXV A;  2PM6 B;  2QZP A;  3EQ8 A;  4J86 A;  4AOW A;  3QHY B;  1P22 A;  2H13 A;  3C99 A;  5CXC B;  4ES0 A;  1GOG A;  3IVM A;  4PSX B;  4X60 B;  4YVD A;  4ESG A;  2H47 A;  4A0A A;  3KRW B;  2VDK A;  4K3J B;  3ZE0 A;  2Q7Q A;  5SXM A;  3GC3 B;  3IJC A;  2YNO A;  3SHF A;  3ZWL B;  4CZV A;  1N6E A;  5CXC A;  3KRX B;  2B4E A;  3GRE A;  5HE2 B;  5THA A;  2VDP A;  2G99 A;  2BCJ B;  4O9D A;  2YNN A;  4GGD A;  4GM3 A;  4LG8 A;  2EIB A;  2B5N A;  4QAM A;  4WJK A;  4GZ8 A;  2VDO A;  4L9O A;  1SQJ A;  4AMY A;  2AGL A;  2P9P C;  3EI4 A;  3O4G A;  2HKR A;  4JD2 C;  3MMY A;  1JV2 A;  3V4P A;  4PBZ A;  2J56 H;  3NIF A;  5HYN B;  4A7J A;  3O4I A;  3L4O D;  5EMJ B;  3UVO A;  3V9F A;  4E54 A;  5EAM A;  4E5Z B;  5CYK A;  5HE3 B;  4AMZ A;  2AH0 A;  3AL8 B;  3EWE A;  4JHN A;  3ORV D;  2VDL A;  1VZ2 A;  3IUR A;  1GOH A;  4BUJ C;  5CXB B;  5GXH A;  1A0R B;  1GOF A;  3VA6 A;  4ZOV A;  3AH8 B;  3CIK B;  3IJ1 A;  4WK0 A;  2H6K A;  3O4H A;  3OW8 A;  3IUN A;  3OKY A;  4J0X A;  2CE9 A;  3I7H A;  3SMR A;  3K6S A;  4FA5 D;  4GGA A;  1UOO A;  4CI1 A;  2P9N C;  2I0S A;  4J79 A;  4QQE A;  3EG6 A;  3ODT A;  4AN1 A;  1B9X A;  2AGW A;  3SBR A;  3EMH A;  5FKR A;  1GOT B;  1E8N A;  2H6Q A;  5IGQ A;  1PI6 A;  4IA9 A;  4JT6 C;  4A09 B;  1PBY B;  5I5I A;  5TEF A;  4ZOZ A;  2P9I C;  3MKQ A;  2HU7 A;  2B5M A;  5IT9 g;  4MK0 B;  4CY5 A;  4GM9 A;  1YR2 A;  4ZOX A;  5FQD A;  4JHP C;  3MVD K;  5TDH B;  3C9C A;  5EAP A;  2AGX A;  4J81 A;  2VC2 A;  3PXW D;  3AL9 A;  3JRO A;  3MXX A;  4J0W A;  4J77 A;  5FLX g;  3I7L A;  3F3G A;  2I0R A;  2AGY A;  4JT5 C;  4JSP C;  1JMZ B;  2H9P A;  1R5M A;  2QR5 A;  4G1E A;  1NEX B;  2G9A A;  4JXM A;  4BP9 A;  4KFM B;  3VI4 A;  4A08 B;  5I5J A;  3ZE1 A;  4CI2 A;  5HE1 B;  1E8M A;  4L3G D;  2H68 A;  1XKS A;  3UKR C;  1NR0 A;  3V4V A;  1H2Y A;  5H17 A;  1M1X A;  2TRC B;  3E0C A;  3RLM D;  1GXR A;  4Z8L A;  3HFQ A;  4J87 A;  1XIP A;  3PSL A;  3GFC A;  3UVM A;  2PM9 A;  1VYH C;  2HU8 A;  2I0T A;  2AGZ A;  5HQG A;  1XHM A;  3FCS A;  2CO0 A;  4A11 A;  2XYI A;  3CFS B;  4PSW B;  2GNQ A;  1MG2 A;  2YMU A;  3UVN A;  3T3P A;  5HE0 B;  4CC9 A;  3ULE C;  4BCC A;  2IWF A;  1BPO A;  1GP2 B;  3SBQ A;  2CNX A;  2PM9 B;  3UVK A;  1H2W A;  5EMM B;  1MDA H;  3QI0 A;  1S4U X;  2HJ4 A;  2XDW A;  4O1Q D;  4FA1 D;  4HDJ A;  3OL2 B;  2P9K C;  3A0F A;  3EI1 A;  3SXT D;  3UVL A;  3SCY A;  1JJU B;  1O6G A;  5M5R A;  2OVP B;  3J81 g;  3C5M A;  3O4J A;  4J73 A;  1B9Y A;  3PE7 A;  4A2L A;  2EBS A;  3PXS D;  2VDR A;  2YBA A;  4J8G A;  2WQ8 A;  2XE4 A;  3SLE D;  3OL2 A;  3JRP A;  2OK4 A;  5EAR A;  3IKO A;  5C92 A;  4X3E A;  2J55 H;  3P4F A;  5EM2 A;  3UKU C;  2XU7 A;  4GQ2 P;  2H6N A;  4L3H D;  1U2V C;  1OMW B;  1GG2 B;  4BP8 A;  4IRZ A;  1I2M B;  3JZN A;  3NVX A;  3K26 A;  5IC7 A;  4CI3 A;  3U4Y A;  3RFG A;  4DNW A;  3N0E A;  4XYH A;  5AJA A;  3K72 A;  4ZN4 A;  3RFH A;  3IUM A;  4OWR A;  3T3M A;  5K1C C;  4I79 A;  1H2X A;  3F3P A;  4Y5R D;  3I8C A;  4FA9 D;  1SQ9 A;  4D6V A;  2CE8 A;  3EI3 A;  2Z2O A;  4GGC A;  3VH0 A;  1VE7 A;  2VDM A;  2J57 G;  3IIW A;  2OK6 A;  4CY2 A;  4X63 B;  3J80 g;  4CI8 A;  4DNU A;  4BCD A;  4NEN A;  3RN0 D;  5AFU 3;  3L4M D;  1C9L A;  3SVW D;  2HXC A;  1JOF A;  1VZ3 A;  4N14 A;  1MG3 A;  5JWZ A;  2PBI B;  3EI2 A;  4L1Q D;  4BL0 A;  4O3T B;  4G1M A;  2OJY A;  3SBP A;  2YNP A;  5TEE A;  2VZ3 A;  1ERJ A;  4UM8 A;  4NC4 A;  3RRM C;  4A0B A;  3AFC A;  2VZ1 A;  1E5T A;  3DSM A;  2EID A;  3JB9 L;  1T2X A;  4GQ1 A;  4MMY A;  1FWX A;  1K32 A;  4Y7R A;  2B5L A;  1N6F A;  4U1E I;  2XL2 A;  4D9S A;  2I3T A;  5E6R A;  5FKS A;  3V7D B;  3ZDZ A;  1N6D A;  4A0B B;  1UOQ A;  5EM2 B;  2IUQ A;  4BH6 A;  2EIE A;  2W18 A;  4XYI A;  5CXB A;  2H14 A;  4O3U B;  3I89 A;  4Z7Q A;  3DDU A;  1UOP A;  2H3X A;  3MUN A;  4LG9 A;  4OZU A;  4G55 A;  5FKT A;  1K8K C;  1A12 A;  2Z2P A;  3GD1 I;  4FB1 D;  4MMZ A;  2CN2 A;  5M5V A;  2IUR A;  3I7K A;  2IUP A;  2XL3 A;  3OKY B;  4J84 A;  4CZX A;  1YFQ A;  3NVN A;  3K27 A;  4Z7N A;  1UTC A;  4QT8 A;  5C2W B;  4PXW A;  5KDO B;  3F3F A;  3IJE A;  3OF7 A;  4E54 B;  2I3S A;  5TF2 A;  1H2Z A;  2VDQ A;  3RSE C;  3KCI A;  3I7O A;  4FWW A;  4RE6 A;  4A09 A;  4XEI C;  1OLZ A;  4BCB A;  3RN1 D;  2MTA H;  4JSX C;  1VE6 A;  5EAL A;  3I2N A;  4A11 B;  4J78 A;  5H14 A;  3OKW A;  4A2M A; 
#chains in the Genus database with same CATH homology
 1PGU A;  4ZOY A;  3SFZ A;  2OVR B;  3SJL D;  4LGN A;  4PC0 A;  2HJB A;  3PVW B;  3DWL C;  3MZL A;  3MZK A;  2H9M A;  4O45 A;  3UR4 A;  3CFV A;  3FM0 A;  4FHL A;  5GSA A;  3IIY A;  4FA4 D;  1U4C A;  3EI1 B;  5FA5 B;  5K19 A;  4A08 A;  3EI4 B;  4CY3 A;  2PM7 B;  5EML B;  2AQ5 A;  3BWS A;  4X61 B;  2AH1 A;  2OIZ A;  4E5Z A;  4PBY A;  4IMM A;  4G56 B;  2IWK A;  4QRJ A;  2GC4 A;  4CY1 A;  2P9S C;  2CN3 A;  2O9K A;  2HES X;  2IAA A;  3C75 H;  1QNI A;  4JSN C;  4GM8 A;  2BBK H;  4GMB A;  5C2V B;  3V5W B;  5EMK B;  4ERZ A;  3SN6 B;  3JZH A;  3IJ0 A;  5H1M A;  2HKM A;  5AMS A;  3EU7 A;  3RMZ D;  2QC5 A;  4FAN D;  2CO0 C;  3I7N A;  3NVQ A;  3EI3 B;  1TYQ C;  3B7F A;  1PEV A;  4UI9 R;  3JPX A;  3OTT A;  4EWR A;  4J82 A;  3OKT A;  2H9N A;  3EI2 B;  4D0K A;  1Q47 A;  5A2Q g;  1RI6 A;  3VGZ A;  3SWS D;  2H9L A;  4JSV C;  3DXK C;  4A0A B;  3MKS B;  1JMX B;  3PSC B;  3BG0 A;  2HYE A;  2YB8 B;  3DM0 A;  2UZY B;  3BG1 A;  4CZY A;  4AEZ A;  4PNK B;  5IJ8 E;  4TZ4 A;  5B4W A;  3FRX A;  3PVU B;  3DXM C;  1L0Q A;  4FAV D;  5IJ7 E;  5FXY A;  3PXT D;  3I7P A;  1TBG A;  5GMK n;  5GXI A;  5C9Z B;  4R7A B;  5FKQ A;  2IUV A;  5CYK B;  4GQB B;  4J8B A;  4K3I D;  4NSX A;  3FGB A;  4ERQ A;  2GC7 A;  3AL8 A;  4H5J A;  2UZX B;  4ERY A;  3JAM g;  5I5M A;  4QL1 A;  2P9L C;  3W15 A;  3N0D A;  3JZG A;  4H5I A;  5IGO A;  1SHY B;  2Z2N A;  2OVQ B;  4U7A A;  2P9U C;  3I8E A;  2QXV A;  2PM6 B;  4J86 A;  4AOW A;  1P22 A;  2H13 A;  3C99 A;  5CXC B;  4ES0 A;  4PSX B;  4X60 B;  4YVD A;  4ESG A;  2H47 A;  4A0A A;  3KRW B;  4K3J B;  2Q7Q A;  5SXM A;  3IJC A;  2YNO A;  3SHF A;  3ZWL B;  4CZV A;  1N6E A;  5CXC A;  3KRX B;  2B4E A;  3GRE A;  5HE2 B;  5THA A;  2G99 A;  2BCJ B;  4O9D A;  2YNN A;  4GGD A;  4GM3 A;  4LG8 A;  2B5N A;  4GZ8 A;  4L9O A;  1SQJ A;  2AGL A;  2P9P C;  3EI4 A;  2HKR A;  4JD2 C;  3MMY A;  4PBZ A;  2J56 H;  5HYN B;  4A7J A;  3L4O D;  5EMJ B;  3UVO A;  3V9F A;  4E54 A;  5EAM A;  4E5Z B;  5CYK A;  5HE3 B;  2AH0 A;  3AL8 B;  3EWE A;  3ORV D;  4BUJ C;  5CXB B;  5GXH A;  1A0R B;  3VA6 A;  4ZOV A;  3AH8 B;  3CIK B;  3IJ1 A;  2H6K A;  3OW8 A;  3OKY A;  4J0X A;  2CE9 A;  3I7H A;  3SMR A;  4FA5 D;  4GGA A;  4CI1 A;  2P9N C;  2I0S A;  4J79 A;  4QQE A;  3EG6 A;  3ODT A;  1B9X A;  2AGW A;  3SBR A;  3EMH A;  5FKR A;  1GOT B;  2H6Q A;  5IGQ A;  1PI6 A;  4IA9 A;  4JT6 C;  4A09 B;  1PBY B;  5I5I A;  5TEF A;  4ZOZ A;  2P9I C;  3MKQ A;  2B5M A;  5IT9 g;  4MK0 B;  4CY5 A;  4GM9 A;  5FQD A;  4ZOX A;  5TDH B;  3C9C A;  5EAP A;  2AGX A;  4J81 A;  3PXW D;  3AL9 A;  3JRO A;  3MXX A;  4J0W A;  4J77 A;  5FLX g;  3I7L A;  3F3G A;  2I0R A;  2AGY A;  4JT5 C;  4JSP C;  1JMZ B;  2H9P A;  1R5M A;  1NEX B;  2G9A A;  4JXM A;  4A08 B;  4KFM B;  5I5J A;  4CI2 A;  5HE1 B;  4L3G D;  2H68 A;  1XKS A;  3UKR C;  1NR0 A;  5H17 A;  2TRC B;  3E0C A;  3RLM D;  1GXR A;  4Z8L A;  3HFQ A;  4J87 A;  1XIP A;  3PSL A;  3GFC A;  3UVM A;  2PM9 A;  1VYH C;  2I0T A;  2AGZ A;  5HQG A;  1XHM A;  4A11 A;  2CO0 A;  2XYI A;  3CFS B;  4PSW B;  2GNQ A;  1MG2 A;  2YMU A;  3UVN A;  5HE0 B;  4CC9 A;  3ULE C;  2IWF A;  1GP2 B;  3SBQ A;  2CNX A;  2PM9 B;  3UVK A;  5EMM B;  1MDA H;  1S4U X;  2HJ4 A;  4O1Q D;  4FA1 D;  4HDJ A;  3OL2 B;  2P9K C;  3A0F A;  3EI1 A;  3SXT D;  3UVL A;  3SCY A;  1JJU B;  2OVP B;  3J81 g;  3C5M A;  4J73 A;  1B9Y A;  3PE7 A;  4A2L A;  2EBS A;  3PXS D;  2YBA A;  4J8G A;  3SLE D;  3OL2 A;  3JRP A;  2OK4 A;  5EAR A;  3IKO A;  4X3E A;  2J55 H;  3P4F A;  5EM2 A;  3UKU C;  2XU7 A;  4GQ2 P;  2H6N A;  4L3H D;  1U2V C;  1GG2 B;  1OMW B;  3JZN A;  3NVX A;  3K26 A;  5IC7 A;  4CI3 A;  3U4Y A;  3RFG A;  3N0E A;  4XYH A;  5AJA A;  4ZN4 A;  3RFH A;  4OWR A;  5K1C C;  4I79 A;  4Y5R D;  3F3P A;  3I8C A;  4FA9 D;  1SQ9 A;  4D6V A;  2CE8 A;  3EI3 A;  2Z2O A;  4GGC A;  3VH0 A;  2J57 G;  3IIW A;  2OK6 A;  4CY2 A;  4X63 B;  3J80 g;  4CI8 A;  3RN0 D;  5AFU 3;  3L4M D;  3SVW D;  2HXC A;  1JOF A;  4N14 A;  1MG3 A;  5JWZ A;  2PBI B;  3EI2 A;  4L1Q D;  4BL0 A;  4O3T B;  2OJY A;  3SBP A;  2YNP A;  5TEE A;  1ERJ A;  4A0B A;  3RRM C;  3AFC A;  3DSM A;  3JB9 L;  4GQ1 A;  1FWX A;  1K32 A;  4Y7R A;  2B5L A;  1N6F A;  4U1E I;  2XL2 A;  2I3T A;  5FKS A;  3V7D B;  4A0B B;  1N6D A;  5EM2 B;  2IUQ A;  4BH6 A;  2W18 A;  4XYI A;  5CXB A;  2H14 A;  4O3U B;  3I89 A;  2H3X A;  4LG9 A;  4OZU A;  5FKT A;  1K8K C;  2Z2P A;  4FB1 D;  2CN2 A;  2IUR A;  3I7K A;  2IUP A;  2XL3 A;  3OKY B;  4J84 A;  4CZX A;  1YFQ A;  3NVN A;  3K27 A;  4QT8 A;  5C2W B;  4PXW A;  5KDO B;  3F3F A;  4E54 B;  2I3S A;  5TF2 A;  3RSE C;  3I7O A;  4FWW A;  4A09 A;  4XEI C;  1OLZ A;  3RN1 D;  2MTA H;  4JSX C;  5EAL A;  3I2N A;  4A11 B;  4J78 A;  5H14 A;  3OKW A;  4A2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...