3RFHA

Crystal structure of the yeast rack1 dimer in space group p21
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
315
structure length
291
Chain Sequence
SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSAAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
publication title Structure of the RACK1 dimer from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 67
structure length 291
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rfhA00
2HXCA 3BG0A 2XL3A 4PXWA 4UI9R 5FA5B 4I79A 2I3TA 3IIYA 4QRJA 4FWWA 3PXTD 4R7AB 4JXMA 2P9PC 2J56H 4Z8LA 4L1QD 1MDAH 3MKSB 2P9NC 3AH8B 3OW8A 4JD2C 3I8EA 5IGOA 3BG1A 2XU7A 3UVOA 2G9AA 3JROA 3MZKA 4CY3A 3AFCA 5TF2A 3V5WB 3PXWD 2B4EA 2H9PA 2CNXA 5SXMA 4J8GA 4ERQA 5AMSA 2HKRA 4HDJA 4PBYA 2IURA 1N6EA 1R5MA 4J78A 5TEFA 3VH0A 3PSLA 4GM8A 4ERYA 2YNPA 2H13A 3AL8B 4CC9A 3SMRA 2EBSA 3I7HA 3UVNA 5GXHA 4X63B 3UR4A 5JWZA 1S4UX 2I0SA 4A7JA 2GC4A 3SHFA 1B9XA 4ZOXA 4L9OA 4J0XA 5HE2B 4QT8A 2TRCB 2CO0C 3SBRA 4O1QD 4LG9A 4GGDA 1RI6A 2H14A 2PM7B 2AGZA 4J8BA 2XYIA 2AH0A 3RN1D 5EALA 2I0TA 5IC7A 4QQEA 3AL8A 4J86A 2H68A 3EI2B 5C2WB 2H6QA 2AGYA 3EI3B 5GXIA 4X3EA 3PXSD 1JMZB 2B5MA 2H9LA 1NR0A 4O3UB 2OVRB 2AQ5A 3JZNA 4L3GD 4A2MA 2QC5A 4GZ8A 3FRXA 3OL2B 4ESGA 4BL0A 4GQ2P 4JT6C 2IUVA 1SQJA 5FXYA 3DSMA 2P9KC 4A0BB 4H5JA 1FWXA 4K3JB 3EI2A 3EI4B 2IWKA 2AGXA 4CI8A 4J84A 2CE8A 3MZLA 3EI3A 1OMWB 3JAMg 4O45A 1U2VC 4LG8A 4H5IA 3GREA 4NSXA 5FKSA 3A0FA 4FA5D 3SCYA 3L4OD 4PSXB 2HYEA 3OL2A 3UVKA 3UVMA 4PC0A 2I3SA 3F3GA 2H9MA 3RRMC 2XL2A 3OKYB 5H17A 5HQGA 4A0BA 3CFVA 3I7LA 3EI4A 3DWLC 3RFGA 4CY1A 5C2VB 2OK4A 2HESX 5A2Qg 3I7OA 4J81A 2HJ4A 2G99A 3SLED 1XKSA 2Z2OA 5HE1B 2QXVA 2CO0A 4K3ID 4O3TB 2GNQA 4E54B 4A09B 3C99A 2P9IC 3I7NA 3CFSB 4J79A 1A0RB 5EMKB 4J77A 2AGLA 2J55H 3JZGA 4ES0A 2OJYA 3OKYA 4Y7RA 5CXCB 3IIWA 1SQ9A 5CYKA 5EMLB 5I5MA 3HFQA 3E0CA 2AGWA 4CY5A 5I5IA 5GSAA 1Q47A 1N6FA 2HJBA 4CZVA 4E54A 4A09A 3I8CA 1GP2B 3I7PA 2CN3A 5HYNB 3I7KA 4A08A 4TZ4A 4IA9A 2OIZA 4N14A 2CN2A 2PM6B 4PSWB 2I0RA 4A0AB 4BH6A 3N0DA 4PBZA 1XIPA 2PBIB 5CXCA 5FKTA 5EARA 3OTTA 5AJAA 4A11A 1TBGA 3W15A 4XYIA 3B7FA 4ERZA 3F3FA 4U1EI 4CY2A 3RFHA 4KFMB 3OKWA 5IJ7E 1TYQC 4G56B 3FM0A 3C75H 3L4MD 1JJUB 4GGAA 5IT9g 2IWFA 4AOWA 4A0AA 2OK6A 3MXXA 5H14A 1XHMA 1QNIA 3DXMC 3IJ0A 3IKOA 4AEZA 1YFQA 3K27A 3GFCA 5TEEA 1MG2A 3NVQA 4J82A 3C5MA 1SHYB 5C9ZB 4D0KA 4J0WA 2H3XA 2UZXB 4ZOYA 3EWEA 1GXRA 3ULEC 3SWSD 4CZXA 4O9DA 2CE9A 1JOFA 2OVPB 5IJ8E 2PM9B 1NEXB 3F3PA 5HE3B 4CZYA 3KRWB 3NVXA 2Z2NA 2YNNA 2H47A 4ZOZA 3PVUB 4E5ZA 4FA4D 4Y5RD 3EG6A 4GMBA 5EM2B 5CXBB 4JSVC 1PGUA 5CYKB 3SJLD 3V7DB 3V9FA 4GGCA 1L0QA 2IAAA 3FGBA 5K19A 5GMKn 3KRXB 2H6NA 4OZUA 3PE7A 4XEIC 3J80g 1U4CA 1PEVA 4YVDA 4IMMA 2PM9A 3SBQA 3SN6B 1GOTB 3C9CA 3DM0A 4J87A 5EAMA 3VGZA 4CI3A 3DXKC 3SXTD 4A08B 5KDOB 4FA9D 3ORVD 4D6VA 4FHLA 3BWSA 5FKRA 1B9YA 5EM2A 5CXBA 3ODTA 1P22A 3MMYA 5I5JA 1N6DA 2YBAA 4FAVD 4BUJC 3IJCA 4FA1D 2Z2PA 4A11B 1K8KC 4JSPC 4XYHA 3AL9A 3I89A 1OLZA 1PBYB 5IGQA 3NVNA 4A2LA 5B4WA 5EMMB 2W18A 4CI2A 4JSXC 1PI6A 2BCJB 2IUQA 2IUPA 3PVWB 2HKMA 3EU7A 3I2NA 3P4FA 5H1MA 4ZN4A 5FQDA 5AFU3 4J73A 1JMXB 3K26A 4PNKB 3EMHA 4ZOVA 3RN0D 1ERJA 2YB8B 4GQ1A 5HE0B 3JPXA 2P9SC 3OKTA 2H9NA 3VA6A 4JSNC 3JRPA 4CI1A 4MK0B 4LGNA 1VYHC 3MKQA 2Q7QA 3SFZA 2B5LA 2YMUA 2MTAH 4X60B 5K1CC 4X61B 5EMJB 2YNOA 4L3HD 3UKUC 3JB9L 4EWRA 3J81g 2P9UC 2AH1A 3EI1B 3U4YA 3IJ1A 3RLMD 3UKRC 3PSCB 3RMZD 3CIKB 1K32A 2GC7A 3JZHA 4U7AA 4OWRA 2B5NA 5THAA 5FLXg 4E5ZB 2P9LC 4QL1A 5FKQA 2UZYB 4JT5C 3ZWLB 2BBKH 1GG2B 4GQBB 3UVLA 4GM3A 4FAND 2OVQB 5TDHB 3SVWD 3EI1A 4GM9A 3SBPA 3RSEC 5EAPA 4FB1D 1MG3A 2J57G 2O9KA 2H6KA 3N0EA
chains in the Genus database with same CATH superfamily
2VDRA 3MUNA 2HXCA 1C9IA 3BG0A 4BCCA 2XL3A 4PXWA 4UI9R 5FA5B 4I79A 2I3TA 3IIYA 4QRJA 4FWWA 3FCSA 3PXTD 4R7AB 4JXMA 1U8CA 2J56H 2P9PC 3QI0A 4Z8LA 4L1QD 1MDAH 3MKSB 2P9NC 4IRZA 4AN0A 3AH8B 3OW8A 4JD2C 3I8EA 2EIDA 5IGOA 3BG1A 3NIFA 4BP8A 2XU7A 3UVOA 2G9AA 3JROA 3MZKA 4QAMA 3NIDA 4CY3A 3IUQA 3AFCA 5TF2A 3V5WB 3V4PA 3PXWD 2VDPA 5M5TA 2B4EA 1UOPA 2H9PA 2CNXA 5SXMA 4BP9A 4DNVA 2QZPA 4J8GA 4ERQA 5AMSA 1I2MB 2HKRA 2EIBA 3V4VA 4HDJA 4D9SA 4PBYA 4G55A 2IURA 3MVDK 1N6EA 1E5TA 1R5MA 2VDKA 3O4HA 4J78A 5TEFA 3VH0A 3PSLA 4GM8A 4ERYA 2YNPA 2H13A 3AL8B 3O4GA 4CC9A 3SMRA 2EBSA 3OF7A 3I7HA 3UVNA 5E6SA 5GXHA 4X63B 3UR4A 1VE6A 5JWZA 1S4UX 2HU7A 2I0SA 4A7JA 2GC4A 3SHFA 1B9XA 4ZOXA 4L9OA 4J0XA 5HE2B 4QT8A 2TRCB 1K3IA 4NC4A 2CO0C 3SBRA 4O1QD 4LG9A 4NBMA 4GGDA 4O02A 2VDOA 1RI6A 2H14A 2PM7B 2AGZA 4J8BA 2XYIA 2AH0A 3RN1D 5EALA 2I0TA 5IC7A 4QQEA 3AL8A 4J86A 4WJKA 2H68A 3EI2B 3ZE2A 5C2WB 4RE6A 2H6QA 3FCUA 4G1EA 3EQ9A 2AGYA 3EI3B 2XZGA 5GXIA 1QFMA 4X3EA 3PXSD 1JMZB 2B5MA 2H9LA 1NR0A 4O3UB 2OVRB 2AQ5A 3JZNA 5FFGA 4L3GD 3IUNA 4DNWA 4A2MA 2VZ3A 2HU8A 2QC5A 3O4IA 4GZ8A 3FRXA 3OL2B 4ESGA 4BL0A 4GQ2P 4JT6C 2IUVA 3GC3B 1SQJA 5FXYA 4Z7NA 4AX4A 3DSMA 2P9KC 2VDQA 4H5JA 4Z7OA 4A0BB 1FWXA 4K3JB 3EI2A 3EI4B 2IWKA 3DDUA 2AGXA 4CI8A 4J84A 4BCBA 4L1MA 2CE8A 3MZLA 3EI3A 1OMWB 3JAMg 2VDLA 4O45A 1U2VC 4LG8A 4H5IA 2EIEA 3GREA 4NSXA 5FKSA 3A0FA 4FA5D 3SCYA 3L4OD 4PSXB 2HYEA 3OL2A 3UVKA 5FFOA 3UVMA 4PC0A 2I3SA 3F3GA 2H9MA 3RRMC 2XL2A 3OKYB 5H17A 5HQGA 4A0BA 3CFVA 3I7LA 3EI4A 3DWLC 3RFGA 4CY1A 3VI3A 5C2VB 2OK4A 3IUJA 2HESX 5A2Qg 3I7OA 4J81A 2HJ4A 1UOQA 2G99A 3SLED 3EQ7A 1XKSA 2Z2OA 5HE1B 2QXVA 1A12A 2CO0A 4K3ID 4O3TB 2GNQA 4E54B 4A09B 3C99A 2P9IC 3I7NA 3CFSB 4J79A 1A0RB 5M61A 5EMKB 4J77A 2AGLA 2J55H 3JZGA 4ES0A 2OJYA 3OKYA 3NIGA 4Y7RA 1UTCA 5CXCB 3IIWA 5C86A 1SQ9A 5CYKA 5EMLB 5I5MA 3KCIA 4MMYA 3HFQA 3E0CA 3K72A 2AGWA 1H2ZA 4CY5A 5I5IA 5GSAA 1Q47A 1N6FA 3O4JA 2HJBA 1H2WA 4MMXA 4CZVA 4E54A 4A09A 2JKXA 1UOOA 3I8CA 1GP2B 3I7PA 2CN3A 5HYNB 3I7KA 4A08A 4TZ4A 3IURA 2OIZA 4IA9A 1E8NA 2CN2A 2PM6B 3MUOA 4N14A 4PSWB 2I0RA 4A0AB 4BH6A 3N0DA 4PBZA 1L5GA 1XIPA 2PBIB 5M5VA 5CXCA 5FKTA 5EARA 3OTTA 5AJAA 4A11A 4UM8A 1TBGA 3W15A 1H2XA 4XYIA 3B7FA 4ERZA 1GOGA 4BCDA 3F3FA 1JTDB 4U1EI 4CY2A 3RFHA 1QFSA 4KFMB 4G1MA 3OKWA 5IJ7E 1TYQC 4G56B 3FM0A 3C75H 3L4MD 1JJUB 4GGAA 4AN1A 5IT9g 2IWFA 4AOWA 4A0AA 2OK6A 3MXXA 4WK0A 5H14A 1XHMA 1QNIA 2HU5A 3DXMC 3IJ0A 5C92A 5HDBA 4UM9A 3IKOA 4AEZA 1YFQA 2WQ8A 3K27A 2EICA 3GFCA 5TEEA 1MG2A 3NVQA 4J82A 3C5MA 1T2XA 2XE4A 1SHYB 5C9ZB 4D0KA 1VE7A 3GD1I 4J0WA 2H3XA 2UZXB 4ZOYA 3EWEA 1O6FA 5M5RA 1GXRA 3ULEC 1JV2A 3SWSD 4CZXA 4O9DA 2CE9A 4WK4A 1JOFA 2OVPB 5IJ8E 2PM9B 1NEXB 3F3PA 5HE3B 4CZYA 3KRWB 1M1XA 3NVXA 2BKLA 2Z2NA 3VI4A 2YNNA 2H47A 4ZOZA 3PVUB 4E5ZA 4FA4D 4Y5RD 3EG6A 4GMBA 5EM2B 5CXBB 4JSVC 1PGUA 5CYKB 1GOFA 3T3MA 3SJLD 2VZ1A 3V7DB 4WK2A 3V9FA 4JHNA 4GGCA 1L0QA 2IAAA 3FGBA 2QR5A 5K19A 5GMKn 3KRXB 4NENA 2H6NA 4OZUA 3PE7A 3IULA 4XEIC 3J80g 1U4CA 1PEVA 2XDWA 4YVDA 4IMMA 4NAAA 2PM9A 3SBQA 3SN6B 1GOTB 3C9CA 3DM0A 3IVMA 4J87A 5EAMA 3VGZA 4CI3A 1H2YA 3K6SA 3DXKC 3SXTD 4A08B 5KDOB 4FA9D 3ORVD 4D6VA 4FHLA 3BWSA 5FKRA 1B9YA 4AMYA 2VDMA 5EM2A 5CXBA 3ODTA 1P22A 3MMYA 5E6UA 5I5JA 2VC2A 1N6DA 2YBAA 4FAVD 4BUJC 3IJCA 4FA1D 2Z2PA 4A11B 1K8KC 1VZ3A 4JSPC 4XYHA 3AL9A 5M5SA 1O6GA 3I89A 1OLZA 1PBYB 1VZ2A 5IGQA 1GOHA 3NVNA 4A2LA 4O2WA 1YR2A 5B4WA 5EMMB 2W18A 4CI2A 4JSXC 1PI6A 2BCJB 2IUQA 5M5UA 2IUPA 3PVWB 4RE5A 2HKMA 3EU7A 3I2NA 3P4FA 5H1MA 4ZN4A 5FQDA 5AFU3 4J73A 1JMXB 3K26A 5E6RA 3T3PA 4PNKB 3EMHA 4ZOVA 3RN0D 1ERJA 2YB8B 4GQ1A 5HE0B 3ZE0A 3JPXA 2P9SC 3OKTA 2H9NA 3VA6A 4JSNC 3JRPA 4CI1A 4MK0B 3K71A 4LGNA 1VYHC 3MKQA 2Q7QA 3SFZA 3ZDXA 2B5LA 2YMUA 3IUMA 2MTAH 4MMZA 4X60B 5K1CC 4X61B 5EMJB 2YNOA 4L3HD 3UKUC 3JB9L 4EWRA 3QHYB 3J81g 2P9UC 1BPOA 2AH1A 4Z7QA 3EI1B 3U4YA 3IJ1A 1TYEA 3RLMD 3PSCB 3RMZD 3UKRC 3CIKB 1E8MA 1K32A 2GC7A 4DNUA 3JZHA 4U7AA 2VDNA 4OWRA 2B5NA 5THAA 5FLXg 4E5ZB 2P9LC 4QL1A 4JHPC 3IJEA 5FKQA 2UZYB 4JT5C 3ZWLB 3EQ8A 2BBKH 3ZDZA 1GG2B 4GQBB 3UVLA 4GM3A 4FAND 2OVQB 5TDHB 3SVWD 3EI1A 4GM9A 4AMZA 3ZE1A 3ZDYA 3SBPA 3RSEC 5EAPA 4FB1D 1C9LA 1MG3A 2J57G 2O9KA 2H6KA 3N0EA
chains in the Genus database with same CATH topology
2HXCA 3BG0A 2XL3A 4PXWA 4UI9R 5FA5B 4I79A 2I3TA 3IIYA 4QRJA 4FWWA 3PXTD 4R7AB 4JXMA 2P9PC 2J56H 4Z8LA 4L1QD 1MDAH 3MKSB 2P9NC 3AH8B 3OW8A 4JD2C 3I8EA 5IGOA 3BG1A 2XU7A 3UVOA 2G9AA 3JROA 3MZKA 4CY3A 3AFCA 5TF2A 3V5WB 3PXWD 2B4EA 2H9PA 2CNXA 5SXMA 4J8GA 4ERQA 5AMSA 2HKRA 4HDJA 4PBYA 2IURA 1N6EA 1R5MA 4J78A 5TEFA 3VH0A 3PSLA 4GM8A 4ERYA 2YNPA 2H13A 3AL8B 4CC9A 3SMRA 2EBSA 3I7HA 3UVNA 5GXHA 4X63B 3UR4A 5JWZA 1S4UX 2I0SA 4A7JA 2GC4A 3SHFA 1B9XA 4ZOXA 4L9OA 4J0XA 5HE2B 4QT8A 2TRCB 2CO0C 3SBRA 4O1QD 4LG9A 4GGDA 1RI6A 2H14A 2PM7B 2AGZA 4J8BA 2XYIA 2AH0A 3RN1D 5EALA 2I0TA 5IC7A 4QQEA 3AL8A 4J86A 2H68A 3EI2B 5C2WB 2H6QA 2AGYA 3EI3B 5GXIA 4X3EA 3PXSD 1JMZB 2B5MA 2H9LA 1NR0A 4O3UB 2OVRB 2AQ5A 3JZNA 4L3GD 4A2MA 2QC5A 4GZ8A 3FRXA 3OL2B 4ESGA 4BL0A 4GQ2P 4JT6C 2IUVA 1SQJA 5FXYA 3DSMA 2P9KC 4A0BB 4H5JA 1FWXA 4K3JB 3EI2A 3EI4B 2IWKA 2AGXA 4CI8A 4J84A 2CE8A 3MZLA 3EI3A 1OMWB 3JAMg 4O45A 1U2VC 4LG8A 4H5IA 3GREA 4NSXA 5FKSA 3A0FA 4FA5D 3SCYA 3L4OD 4PSXB 2HYEA 3OL2A 3UVKA 3UVMA 4PC0A 2I3SA 3F3GA 2H9MA 3RRMC 2XL2A 3OKYB 5H17A 5HQGA 4A0BA 3CFVA 3I7LA 3EI4A 3DWLC 3RFGA 4CY1A 5C2VB 2OK4A 2HESX 5A2Qg 3I7OA 4J81A 2HJ4A 2G99A 3SLED 1XKSA 2Z2OA 5HE1B 2QXVA 2CO0A 4K3ID 4O3TB 2GNQA 4E54B 4A09B 3C99A 2P9IC 3I7NA 3CFSB 4J79A 1A0RB 5EMKB 4J77A 2AGLA 2J55H 3JZGA 4ES0A 2OJYA 3OKYA 4Y7RA 5CXCB 3IIWA 1SQ9A 5CYKA 5EMLB 5I5MA 3HFQA 3E0CA 2AGWA 4CY5A 5I5IA 5GSAA 1Q47A 1N6FA 2HJBA 4CZVA 4E54A 4A09A 3I8CA 1GP2B 3I7PA 2CN3A 5HYNB 3I7KA 4A08A 4TZ4A 4IA9A 2OIZA 4N14A 2CN2A 2PM6B 4PSWB 2I0RA 4A0AB 4BH6A 3N0DA 4PBZA 1XIPA 2PBIB 5CXCA 5FKTA 5EARA 3OTTA 5AJAA 4A11A 1TBGA 3W15A 4XYIA 3B7FA 4ERZA 3F3FA 4U1EI 4CY2A 3RFHA 4KFMB 3OKWA 5IJ7E 1TYQC 4G56B 3FM0A 3C75H 3L4MD 1JJUB 4GGAA 5IT9g 2IWFA 4AOWA 4A0AA 2OK6A 3MXXA 5H14A 1XHMA 1QNIA 3DXMC 3IJ0A 3IKOA 4AEZA 1YFQA 3K27A 3GFCA 5TEEA 1MG2A 3NVQA 4J82A 3C5MA 1SHYB 5C9ZB 4D0KA 4J0WA 2H3XA 2UZXB 4ZOYA 3EWEA 1GXRA 3ULEC 3SWSD 4CZXA 4O9DA 2CE9A 1JOFA 2OVPB 5IJ8E 2PM9B 1NEXB 3F3PA 5HE3B 4CZYA 3KRWB 3NVXA 2Z2NA 2YNNA 2H47A 4ZOZA 3PVUB 4E5ZA 4FA4D 4Y5RD 3EG6A 4GMBA 5EM2B 5CXBB 4JSVC 1PGUA 5CYKB 3SJLD 3V7DB 3V9FA 4GGCA 1L0QA 2IAAA 3FGBA 5K19A 5GMKn 3KRXB 2H6NA 4OZUA 3PE7A 4XEIC 3J80g 1U4CA 1PEVA 4YVDA 4IMMA 2PM9A 3SBQA 3SN6B 1GOTB 3C9CA 3DM0A 4J87A 5EAMA 3VGZA 4CI3A 3DXKC 3SXTD 4A08B 5KDOB 4FA9D 3ORVD 4D6VA 4FHLA 3BWSA 5FKRA 1B9YA 5EM2A 5CXBA 3ODTA 1P22A 3MMYA 5I5JA 1N6DA 2YBAA 4FAVD 4BUJC 3IJCA 4FA1D 2Z2PA 4A11B 1K8KC 4JSPC 4XYHA 3AL9A 3I89A 1OLZA 1PBYB 5IGQA 3NVNA 4A2LA 5B4WA 5EMMB 2W18A 4CI2A 4JSXC 1PI6A 2BCJB 2IUQA 2IUPA 3PVWB 2HKMA 3EU7A 3I2NA 3P4FA 5H1MA 4ZN4A 5FQDA 5AFU3 4J73A 1JMXB 3K26A 4PNKB 3EMHA 4ZOVA 3RN0D 1ERJA 2YB8B 4GQ1A 5HE0B 3JPXA 2P9SC 3OKTA 2H9NA 3VA6A 4JSNC 3JRPA 4CI1A 4MK0B 4LGNA 1VYHC 3MKQA 2Q7QA 3SFZA 2B5LA 2YMUA 2MTAH 4X60B 5K1CC 4X61B 5EMJB 2YNOA 4L3HD 3UKUC 3JB9L 4EWRA 3J81g 2P9UC 2AH1A 3EI1B 3U4YA 3IJ1A 3RLMD 3UKRC 3PSCB 3RMZD 3CIKB 1K32A 2GC7A 3JZHA 4U7AA 4OWRA 2B5NA 5THAA 5FLXg 4E5ZB 2P9LC 4QL1A 5FKQA 2UZYB 4JT5C 3ZWLB 2BBKH 1GG2B 4GQBB 3UVLA 4GM3A 4FAND 2OVQB 5TDHB 3SVWD 3EI1A 4GM9A 3SBPA 3RSEC 5EAPA 4FB1D 1MG3A 2J57G 2O9KA 2H6KA 3N0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXC A;  3BG0 A;  2XL3 A;  4PXW A;  4UI9 R;  5FA5 B;  4I79 A;  2I3T A;  3IIY A;  4QRJ A;  4FWW A;  3PXT D;  4R7A B;  4JXM A;  2P9P C;  2J56 H;  4Z8L A;  4L1Q D;  1MDA H;  3MKS B;  2P9N C;  3AH8 B;  3OW8 A;  4JD2 C;  3I8E A;  5IGO A;  3BG1 A;  2XU7 A;  3UVO A;  2G9A A;  3JRO A;  3MZK A;  4CY3 A;  3AFC A;  5TF2 A;  3V5W B;  3PXW D;  2B4E A;  2H9P A;  2CNX A;  5SXM A;  4J8G A;  4ERQ A;  5AMS A;  2HKR A;  4HDJ A;  4PBY A;  2IUR A;  1N6E A;  1R5M A;  4J78 A;  5TEF A;  3VH0 A;  3PSL A;  4GM8 A;  4ERY A;  2YNP A;  2H13 A;  3AL8 B;  4CC9 A;  3SMR A;  2EBS A;  3I7H A;  3UVN A;  5GXH A;  4X63 B;  3UR4 A;  5JWZ A;  1S4U X;  2I0S A;  4A7J A;  2GC4 A;  3SHF A;  1B9X A;  4ZOX A;  4L9O A;  4J0X A;  5HE2 B;  4QT8 A;  2TRC B;  2CO0 C;  3SBR A;  4O1Q D;  4LG9 A;  4GGD A;  1RI6 A;  2H14 A;  2PM7 B;  2AGZ A;  4J8B A;  2XYI A;  2AH0 A;  3RN1 D;  5EAL A;  2I0T A;  5IC7 A;  4QQE A;  3AL8 A;  4J86 A;  2H68 A;  3EI2 B;  5C2W B;  2H6Q A;  2AGY A;  3EI3 B;  5GXI A;  4X3E A;  3PXS D;  1JMZ B;  2B5M A;  2H9L A;  1NR0 A;  4O3U B;  2OVR B;  2AQ5 A;  3JZN A;  4L3G D;  4A2M A;  2QC5 A;  4GZ8 A;  3FRX A;  3OL2 B;  4ESG A;  4BL0 A;  4GQ2 P;  4JT6 C;  2IUV A;  1SQJ A;  5FXY A;  3DSM A;  2P9K C;  4A0B B;  4H5J A;  1FWX A;  4K3J B;  3EI2 A;  3EI4 B;  2IWK A;  2AGX A;  4CI8 A;  4J84 A;  2CE8 A;  3MZL A;  3EI3 A;  1OMW B;  3JAM g;  4O45 A;  1U2V C;  4LG8 A;  4H5I A;  3GRE A;  4NSX A;  5FKS A;  3A0F A;  4FA5 D;  3SCY A;  3L4O D;  4PSX B;  2HYE A;  3OL2 A;  3UVK A;  3UVM A;  4PC0 A;  2I3S A;  3F3G A;  2H9M A;  3RRM C;  2XL2 A;  3OKY B;  5H17 A;  5HQG A;  4A0B A;  3CFV A;  3I7L A;  3EI4 A;  3DWL C;  3RFG A;  4CY1 A;  5C2V B;  2OK4 A;  2HES X;  5A2Q g;  3I7O A;  4J81 A;  2HJ4 A;  2G99 A;  3SLE D;  1XKS A;  2Z2O A;  5HE1 B;  2QXV A;  2CO0 A;  4K3I D;  4O3T B;  2GNQ A;  4E54 B;  4A09 B;  3C99 A;  2P9I C;  3I7N A;  3CFS B;  4J79 A;  1A0R B;  5EMK B;  4J77 A;  2AGL A;  2J55 H;  3JZG A;  4ES0 A;  2OJY A;  3OKY A;  4Y7R A;  5CXC B;  3IIW A;  1SQ9 A;  5CYK A;  5EML B;  5I5M A;  3HFQ A;  3E0C A;  2AGW A;  4CY5 A;  5I5I A;  5GSA A;  1Q47 A;  1N6F A;  2HJB A;  4CZV A;  4E54 A;  4A09 A;  3I8C A;  1GP2 B;  3I7P A;  2CN3 A;  5HYN B;  3I7K A;  4A08 A;  4TZ4 A;  4IA9 A;  2OIZ A;  4N14 A;  2CN2 A;  2PM6 B;  4PSW B;  2I0R A;  4A0A B;  4BH6 A;  3N0D A;  4PBZ A;  1XIP A;  2PBI B;  5CXC A;  5FKT A;  5EAR A;  3OTT A;  5AJA A;  4A11 A;  1TBG A;  3W15 A;  4XYI A;  3B7F A;  4ERZ A;  3F3F A;  4U1E I;  4CY2 A;  3RFH A;  4KFM B;  3OKW A;  5IJ7 E;  1TYQ C;  4G56 B;  3FM0 A;  3C75 H;  3L4M D;  1JJU B;  4GGA A;  5IT9 g;  2IWF A;  4AOW A;  4A0A A;  2OK6 A;  3MXX A;  5H14 A;  1XHM A;  1QNI A;  3DXM C;  3IJ0 A;  3IKO A;  4AEZ A;  1YFQ A;  3K27 A;  3GFC A;  5TEE A;  1MG2 A;  3NVQ A;  4J82 A;  3C5M A;  1SHY B;  5C9Z B;  4D0K A;  4J0W A;  2H3X A;  2UZX B;  4ZOY A;  3EWE A;  1GXR A;  3ULE C;  3SWS D;  4CZX A;  4O9D A;  2CE9 A;  1JOF A;  2OVP B;  5IJ8 E;  2PM9 B;  1NEX B;  3F3P A;  5HE3 B;  4CZY A;  3KRW B;  3NVX A;  2Z2N A;  2YNN A;  2H47 A;  4ZOZ A;  3PVU B;  4E5Z A;  4FA4 D;  4Y5R D;  3EG6 A;  4GMB A;  5EM2 B;  5CXB B;  4JSV C;  1PGU A;  5CYK B;  3SJL D;  3V7D B;  3V9F A;  4GGC A;  1L0Q A;  2IAA A;  3FGB A;  5K19 A;  5GMK n;  3KRX B;  2H6N A;  4OZU A;  3PE7 A;  4XEI C;  3J80 g;  1U4C A;  1PEV A;  4YVD A;  4IMM A;  2PM9 A;  3SBQ A;  3SN6 B;  1GOT B;  3C9C A;  3DM0 A;  4J87 A;  5EAM A;  3VGZ A;  4CI3 A;  3DXK C;  3SXT D;  4A08 B;  5KDO B;  4FA9 D;  3ORV D;  4D6V A;  4FHL A;  3BWS A;  5FKR A;  1B9Y A;  5EM2 A;  5CXB A;  3ODT A;  1P22 A;  3MMY A;  5I5J A;  1N6D A;  2YBA A;  4FAV D;  4BUJ C;  3IJC A;  4FA1 D;  2Z2P A;  4A11 B;  1K8K C;  4JSP C;  4XYH A;  3AL9 A;  3I89 A;  1OLZ A;  1PBY B;  5IGQ A;  3NVN A;  4A2L A;  5B4W A;  5EMM B;  2W18 A;  4CI2 A;  4JSX C;  1PI6 A;  2BCJ B;  2IUQ A;  2IUP A;  3PVW B;  2HKM A;  3EU7 A;  3I2N A;  3P4F A;  5H1M A;  4ZN4 A;  5FQD A;  5AFU 3;  4J73 A;  1JMX B;  3K26 A;  4PNK B;  3EMH A;  4ZOV A;  3RN0 D;  1ERJ A;  2YB8 B;  4GQ1 A;  5HE0 B;  3JPX A;  2P9S C;  3OKT A;  2H9N A;  3VA6 A;  4JSN C;  3JRP A;  4CI1 A;  4MK0 B;  4LGN A;  1VYH C;  3MKQ A;  2Q7Q A;  3SFZ A;  2B5L A;  2YMU A;  2MTA H;  4X60 B;  5K1C C;  4X61 B;  5EMJ B;  2YNO A;  4L3H D;  3UKU C;  3JB9 L;  4EWR A;  3J81 g;  2P9U C;  2AH1 A;  3EI1 B;  3U4Y A;  3IJ1 A;  3RLM D;  3UKR C;  3PSC B;  3RMZ D;  3CIK B;  1K32 A;  2GC7 A;  3JZH A;  4U7A A;  4OWR A;  2B5N A;  5THA A;  5FLX g;  4E5Z B;  2P9L C;  4QL1 A;  5FKQ A;  2UZY B;  4JT5 C;  3ZWL B;  2BBK H;  1GG2 B;  4GQB B;  3UVL A;  4GM3 A;  4FAN D;  2OVQ B;  5TDH B;  3SVW D;  3EI1 A;  4GM9 A;  3SBP A;  3RSE C;  5EAP A;  4FB1 D;  1MG3 A;  2J57 G;  2O9K A;  2H6K A;  3N0E A; 
#chains in the Genus database with same CATH topology
 2VDR A;  3MUN A;  2HXC A;  1C9I A;  3BG0 A;  4BCC A;  2XL3 A;  4PXW A;  4UI9 R;  5FA5 B;  4I79 A;  2I3T A;  3IIY A;  4QRJ A;  4FWW A;  3FCS A;  3PXT D;  4R7A B;  4JXM A;  1U8C A;  2J56 H;  2P9P C;  3QI0 A;  4Z8L A;  4L1Q D;  1MDA H;  3MKS B;  2P9N C;  4IRZ A;  4AN0 A;  3AH8 B;  3OW8 A;  4JD2 C;  3I8E A;  2EID A;  5IGO A;  3BG1 A;  3NIF A;  4BP8 A;  2XU7 A;  3UVO A;  2G9A A;  3JRO A;  3MZK A;  4QAM A;  3NID A;  4CY3 A;  3IUQ A;  3AFC A;  5TF2 A;  3V5W B;  3V4P A;  3PXW D;  2VDP A;  5M5T A;  2B4E A;  1UOP A;  2H9P A;  2CNX A;  5SXM A;  4BP9 A;  4DNV A;  2QZP A;  4J8G A;  4ERQ A;  5AMS A;  1I2M B;  2HKR A;  2EIB A;  3V4V A;  4HDJ A;  4D9S A;  4PBY A;  4G55 A;  2IUR A;  3MVD K;  1N6E A;  1E5T A;  1R5M A;  2VDK A;  3O4H A;  4J78 A;  5TEF A;  3VH0 A;  3PSL A;  4GM8 A;  4ERY A;  2YNP A;  2H13 A;  3AL8 B;  3O4G A;  4CC9 A;  3SMR A;  2EBS A;  3OF7 A;  3I7H A;  3UVN A;  5E6S A;  5GXH A;  4X63 B;  3UR4 A;  1VE6 A;  5JWZ A;  1S4U X;  2HU7 A;  2I0S A;  4A7J A;  2GC4 A;  3SHF A;  1B9X A;  4ZOX A;  4L9O A;  4J0X A;  5HE2 B;  4QT8 A;  2TRC B;  1K3I A;  4NC4 A;  2CO0 C;  3SBR A;  4O1Q D;  4LG9 A;  4NBM A;  4GGD A;  4O02 A;  2VDO A;  1RI6 A;  2H14 A;  2PM7 B;  2AGZ A;  4J8B A;  2XYI A;  2AH0 A;  3RN1 D;  5EAL A;  2I0T A;  5IC7 A;  4QQE A;  3AL8 A;  4J86 A;  4WJK A;  2H68 A;  3EI2 B;  3ZE2 A;  5C2W B;  4RE6 A;  2H6Q A;  3FCU A;  4G1E A;  3EQ9 A;  2AGY A;  3EI3 B;  2XZG A;  5GXI A;  1QFM A;  4X3E A;  3PXS D;  1JMZ B;  2B5M A;  2H9L A;  1NR0 A;  4O3U B;  2OVR B;  2AQ5 A;  3JZN A;  5FFG A;  4L3G D;  3IUN A;  4DNW A;  4A2M A;  2VZ3 A;  2HU8 A;  2QC5 A;  3O4I A;  4GZ8 A;  3FRX A;  3OL2 B;  4ESG A;  4BL0 A;  4GQ2 P;  4JT6 C;  2IUV A;  3GC3 B;  1SQJ A;  5FXY A;  4Z7N A;  4AX4 A;  3DSM A;  2P9K C;  2VDQ A;  4H5J A;  4Z7O A;  4A0B B;  1FWX A;  4K3J B;  3EI2 A;  3EI4 B;  2IWK A;  3DDU A;  2AGX A;  4CI8 A;  4J84 A;  4BCB A;  4L1M A;  2CE8 A;  3MZL A;  3EI3 A;  1OMW B;  3JAM g;  2VDL A;  4O45 A;  1U2V C;  4LG8 A;  4H5I A;  2EIE A;  3GRE A;  4NSX A;  5FKS A;  3A0F A;  4FA5 D;  3SCY A;  3L4O D;  4PSX B;  2HYE A;  3OL2 A;  3UVK A;  5FFO A;  3UVM A;  4PC0 A;  2I3S A;  3F3G A;  2H9M A;  3RRM C;  2XL2 A;  3OKY B;  5H17 A;  5HQG A;  4A0B A;  3CFV A;  3I7L A;  3EI4 A;  3DWL C;  3RFG A;  4CY1 A;  3VI3 A;  5C2V B;  2OK4 A;  3IUJ A;  2HES X;  5A2Q g;  3I7O A;  4J81 A;  2HJ4 A;  1UOQ A;  2G99 A;  3SLE D;  3EQ7 A;  1XKS A;  2Z2O A;  5HE1 B;  2QXV A;  1A12 A;  2CO0 A;  4K3I D;  4O3T B;  2GNQ A;  4E54 B;  4A09 B;  3C99 A;  2P9I C;  3I7N A;  3CFS B;  4J79 A;  1A0R B;  5M61 A;  5EMK B;  4J77 A;  2AGL A;  2J55 H;  3JZG A;  4ES0 A;  2OJY A;  3OKY A;  3NIG A;  4Y7R A;  1UTC A;  5CXC B;  3IIW A;  5C86 A;  1SQ9 A;  5CYK A;  5EML B;  5I5M A;  3KCI A;  4MMY A;  3HFQ A;  3E0C A;  3K72 A;  2AGW A;  1H2Z A;  4CY5 A;  5I5I A;  5GSA A;  1Q47 A;  1N6F A;  3O4J A;  2HJB A;  1H2W A;  4MMX A;  4CZV A;  4E54 A;  4A09 A;  2JKX A;  1UOO A;  3I8C A;  1GP2 B;  3I7P A;  2CN3 A;  5HYN B;  3I7K A;  4A08 A;  4TZ4 A;  3IUR A;  2OIZ A;  4IA9 A;  1E8N A;  2CN2 A;  2PM6 B;  3MUO A;  4N14 A;  4PSW B;  2I0R A;  4A0A B;  4BH6 A;  3N0D A;  4PBZ A;  1L5G A;  1XIP A;  2PBI B;  5M5V A;  5CXC A;  5FKT A;  5EAR A;  3OTT A;  5AJA A;  4A11 A;  4UM8 A;  1TBG A;  3W15 A;  1H2X A;  4XYI A;  3B7F A;  4ERZ A;  1GOG A;  4BCD A;  3F3F A;  1JTD B;  4U1E I;  4CY2 A;  3RFH A;  1QFS A;  4KFM B;  4G1M A;  3OKW A;  5IJ7 E;  1TYQ C;  4G56 B;  3FM0 A;  3C75 H;  3L4M D;  1JJU B;  4GGA A;  4AN1 A;  5IT9 g;  2IWF A;  4AOW A;  4A0A A;  2OK6 A;  3MXX A;  4WK0 A;  5H14 A;  1XHM A;  1QNI A;  2HU5 A;  3DXM C;  3IJ0 A;  5C92 A;  5HDB A;  4UM9 A;  3IKO A;  4AEZ A;  1YFQ A;  2WQ8 A;  3K27 A;  2EIC A;  3GFC A;  5TEE A;  1MG2 A;  3NVQ A;  4J82 A;  3C5M A;  1T2X A;  2XE4 A;  1SHY B;  5C9Z B;  4D0K A;  1VE7 A;  3GD1 I;  4J0W A;  2H3X A;  2UZX B;  4ZOY A;  3EWE A;  1O6F A;  5M5R A;  1GXR A;  3ULE C;  1JV2 A;  3SWS D;  4CZX A;  4O9D A;  2CE9 A;  4WK4 A;  1JOF A;  2OVP B;  5IJ8 E;  2PM9 B;  1NEX B;  3F3P A;  5HE3 B;  4CZY A;  3KRW B;  1M1X A;  3NVX A;  2BKL A;  2Z2N A;  3VI4 A;  2YNN A;  2H47 A;  4ZOZ A;  3PVU B;  4E5Z A;  4FA4 D;  4Y5R D;  3EG6 A;  4GMB A;  5EM2 B;  5CXB B;  4JSV C;  1PGU A;  5CYK B;  1GOF A;  3T3M A;  3SJL D;  2VZ1 A;  3V7D B;  4WK2 A;  3V9F A;  4JHN A;  4GGC A;  1L0Q A;  2IAA A;  3FGB A;  2QR5 A;  5K19 A;  5GMK n;  3KRX B;  4NEN A;  2H6N A;  4OZU A;  3PE7 A;  3IUL A;  4XEI C;  3J80 g;  1U4C A;  1PEV A;  2XDW A;  4YVD A;  4IMM A;  4NAA A;  2PM9 A;  3SBQ A;  3SN6 B;  1GOT B;  3C9C A;  3DM0 A;  3IVM A;  4J87 A;  5EAM A;  3VGZ A;  4CI3 A;  1H2Y A;  3K6S A;  3DXK C;  3SXT D;  4A08 B;  5KDO B;  4FA9 D;  3ORV D;  4D6V A;  4FHL A;  3BWS A;  5FKR A;  1B9Y A;  4AMY A;  2VDM A;  5EM2 A;  5CXB A;  3ODT A;  1P22 A;  3MMY A;  5E6U A;  5I5J A;  2VC2 A;  1N6D A;  2YBA A;  4FAV D;  4BUJ C;  3IJC A;  4FA1 D;  2Z2P A;  4A11 B;  1K8K C;  1VZ3 A;  4JSP C;  4XYH A;  3AL9 A;  5M5S A;  1O6G A;  3I89 A;  1OLZ A;  1PBY B;  1VZ2 A;  5IGQ A;  1GOH A;  3NVN A;  4A2L A;  4O2W A;  1YR2 A;  5B4W A;  5EMM B;  2W18 A;  4CI2 A;  4JSX C;  1PI6 A;  2BCJ B;  2IUQ A;  5M5U A;  2IUP A;  3PVW B;  4RE5 A;  2HKM A;  3EU7 A;  3I2N A;  3P4F A;  5H1M A;  4ZN4 A;  5FQD A;  5AFU 3;  4J73 A;  1JMX B;  3K26 A;  5E6R A;  3T3P A;  4PNK B;  3EMH A;  4ZOV A;  3RN0 D;  1ERJ A;  2YB8 B;  4GQ1 A;  5HE0 B;  3ZE0 A;  3JPX A;  2P9S C;  3OKT A;  2H9N A;  3VA6 A;  4JSN C;  3JRP A;  4CI1 A;  4MK0 B;  3K71 A;  4LGN A;  1VYH C;  3MKQ A;  2Q7Q A;  3SFZ A;  3ZDX A;  2B5L A;  2YMU A;  3IUM A;  2MTA H;  4MMZ A;  4X60 B;  5K1C C;  4X61 B;  5EMJ B;  2YNO A;  4L3H D;  3UKU C;  3JB9 L;  4EWR A;  3QHY B;  3J81 g;  2P9U C;  1BPO A;  2AH1 A;  4Z7Q A;  3EI1 B;  3U4Y A;  3IJ1 A;  1TYE A;  3RLM D;  3PSC B;  3RMZ D;  3UKR C;  3CIK B;  1E8M A;  1K32 A;  2GC7 A;  4DNU A;  3JZH A;  4U7A A;  2VDN A;  4OWR A;  2B5N A;  5THA A;  5FLX g;  4E5Z B;  2P9L C;  4QL1 A;  4JHP C;  3IJE A;  5FKQ A;  2UZY B;  4JT5 C;  3ZWL B;  3EQ8 A;  2BBK H;  3ZDZ A;  1GG2 B;  4GQB B;  3UVL A;  4GM3 A;  4FAN D;  2OVQ B;  5TDH B;  3SVW D;  3EI1 A;  4GM9 A;  4AMZ A;  3ZE1 A;  3ZDY A;  3SBP A;  3RSE C;  5EAP A;  4FB1 D;  1C9L A;  1MG3 A;  2J57 G;  2O9K A;  2H6K A;  3N0E A; 
#chains in the Genus database with same CATH homology
 2HXC A;  3BG0 A;  2XL3 A;  4PXW A;  4UI9 R;  5FA5 B;  4I79 A;  2I3T A;  3IIY A;  4QRJ A;  4FWW A;  3PXT D;  4R7A B;  4JXM A;  2P9P C;  2J56 H;  4Z8L A;  4L1Q D;  1MDA H;  3MKS B;  2P9N C;  3AH8 B;  3OW8 A;  4JD2 C;  3I8E A;  5IGO A;  3BG1 A;  2XU7 A;  3UVO A;  2G9A A;  3JRO A;  3MZK A;  4CY3 A;  3AFC A;  5TF2 A;  3V5W B;  3PXW D;  2B4E A;  2H9P A;  2CNX A;  5SXM A;  4J8G A;  4ERQ A;  5AMS A;  2HKR A;  4HDJ A;  4PBY A;  2IUR A;  1N6E A;  1R5M A;  4J78 A;  5TEF A;  3VH0 A;  3PSL A;  4GM8 A;  4ERY A;  2YNP A;  2H13 A;  3AL8 B;  4CC9 A;  3SMR A;  2EBS A;  3I7H A;  3UVN A;  5GXH A;  4X63 B;  3UR4 A;  5JWZ A;  1S4U X;  2I0S A;  4A7J A;  2GC4 A;  3SHF A;  1B9X A;  4ZOX A;  4L9O A;  4J0X A;  5HE2 B;  4QT8 A;  2TRC B;  2CO0 C;  3SBR A;  4O1Q D;  4LG9 A;  4GGD A;  1RI6 A;  2H14 A;  2PM7 B;  2AGZ A;  4J8B A;  2XYI A;  2AH0 A;  3RN1 D;  5EAL A;  2I0T A;  5IC7 A;  4QQE A;  3AL8 A;  4J86 A;  2H68 A;  3EI2 B;  5C2W B;  2H6Q A;  2AGY A;  3EI3 B;  5GXI A;  4X3E A;  3PXS D;  1JMZ B;  2B5M A;  2H9L A;  1NR0 A;  4O3U B;  2OVR B;  2AQ5 A;  3JZN A;  4L3G D;  4A2M A;  2QC5 A;  4GZ8 A;  3FRX A;  3OL2 B;  4ESG A;  4BL0 A;  4GQ2 P;  4JT6 C;  2IUV A;  1SQJ A;  5FXY A;  3DSM A;  2P9K C;  4A0B B;  4H5J A;  1FWX A;  4K3J B;  3EI2 A;  3EI4 B;  2IWK A;  2AGX A;  4CI8 A;  4J84 A;  2CE8 A;  3MZL A;  3EI3 A;  1OMW B;  3JAM g;  4O45 A;  1U2V C;  4LG8 A;  4H5I A;  3GRE A;  4NSX A;  5FKS A;  3A0F A;  4FA5 D;  3SCY A;  3L4O D;  4PSX B;  2HYE A;  3OL2 A;  3UVK A;  3UVM A;  4PC0 A;  2I3S A;  3F3G A;  2H9M A;  3RRM C;  2XL2 A;  3OKY B;  5H17 A;  5HQG A;  4A0B A;  3CFV A;  3I7L A;  3EI4 A;  3DWL C;  3RFG A;  4CY1 A;  5C2V B;  2OK4 A;  2HES X;  5A2Q g;  3I7O A;  4J81 A;  2HJ4 A;  2G99 A;  3SLE D;  1XKS A;  2Z2O A;  5HE1 B;  2QXV A;  2CO0 A;  4K3I D;  4O3T B;  2GNQ A;  4E54 B;  4A09 B;  3C99 A;  2P9I C;  3I7N A;  3CFS B;  4J79 A;  1A0R B;  5EMK B;  4J77 A;  2AGL A;  2J55 H;  3JZG A;  4ES0 A;  2OJY A;  3OKY A;  4Y7R A;  5CXC B;  3IIW A;  1SQ9 A;  5CYK A;  5EML B;  5I5M A;  3HFQ A;  3E0C A;  2AGW A;  4CY5 A;  5I5I A;  5GSA A;  1Q47 A;  1N6F A;  2HJB A;  4CZV A;  4E54 A;  4A09 A;  3I8C A;  1GP2 B;  3I7P A;  2CN3 A;  5HYN B;  3I7K A;  4A08 A;  4TZ4 A;  4IA9 A;  2OIZ A;  4N14 A;  2CN2 A;  2PM6 B;  4PSW B;  2I0R A;  4A0A B;  4BH6 A;  3N0D A;  4PBZ A;  1XIP A;  2PBI B;  5CXC A;  5FKT A;  5EAR A;  3OTT A;  5AJA A;  4A11 A;  1TBG A;  3W15 A;  4XYI A;  3B7F A;  4ERZ A;  3F3F A;  4U1E I;  4CY2 A;  3RFH A;  4KFM B;  3OKW A;  5IJ7 E;  1TYQ C;  4G56 B;  3FM0 A;  3C75 H;  3L4M D;  1JJU B;  4GGA A;  5IT9 g;  2IWF A;  4AOW A;  4A0A A;  2OK6 A;  3MXX A;  5H14 A;  1XHM A;  1QNI A;  3DXM C;  3IJ0 A;  3IKO A;  4AEZ A;  1YFQ A;  3K27 A;  3GFC A;  5TEE A;  1MG2 A;  3NVQ A;  4J82 A;  3C5M A;  1SHY B;  5C9Z B;  4D0K A;  4J0W A;  2H3X A;  2UZX B;  4ZOY A;  3EWE A;  1GXR A;  3ULE C;  3SWS D;  4CZX A;  4O9D A;  2CE9 A;  1JOF A;  2OVP B;  5IJ8 E;  2PM9 B;  1NEX B;  3F3P A;  5HE3 B;  4CZY A;  3KRW B;  3NVX A;  2Z2N A;  2YNN A;  2H47 A;  4ZOZ A;  3PVU B;  4E5Z A;  4FA4 D;  4Y5R D;  3EG6 A;  4GMB A;  5EM2 B;  5CXB B;  4JSV C;  1PGU A;  5CYK B;  3SJL D;  3V7D B;  3V9F A;  4GGC A;  1L0Q A;  2IAA A;  3FGB A;  5K19 A;  5GMK n;  3KRX B;  2H6N A;  4OZU A;  3PE7 A;  4XEI C;  3J80 g;  1U4C A;  1PEV A;  4YVD A;  4IMM A;  2PM9 A;  3SBQ A;  3SN6 B;  1GOT B;  3C9C A;  3DM0 A;  4J87 A;  5EAM A;  3VGZ A;  4CI3 A;  3DXK C;  3SXT D;  4A08 B;  5KDO B;  4FA9 D;  3ORV D;  4D6V A;  4FHL A;  3BWS A;  5FKR A;  1B9Y A;  5EM2 A;  5CXB A;  3ODT A;  1P22 A;  3MMY A;  5I5J A;  1N6D A;  2YBA A;  4FAV D;  4BUJ C;  3IJC A;  4FA1 D;  2Z2P A;  4A11 B;  1K8K C;  4JSP C;  4XYH A;  3AL9 A;  3I89 A;  1OLZ A;  1PBY B;  5IGQ A;  3NVN A;  4A2L A;  5B4W A;  5EMM B;  2W18 A;  4CI2 A;  4JSX C;  1PI6 A;  2BCJ B;  2IUQ A;  2IUP A;  3PVW B;  2HKM A;  3EU7 A;  3I2N A;  3P4F A;  5H1M A;  4ZN4 A;  5FQD A;  5AFU 3;  4J73 A;  1JMX B;  3K26 A;  4PNK B;  3EMH A;  4ZOV A;  3RN0 D;  1ERJ A;  2YB8 B;  4GQ1 A;  5HE0 B;  3JPX A;  2P9S C;  3OKT A;  2H9N A;  3VA6 A;  4JSN C;  3JRP A;  4CI1 A;  4MK0 B;  4LGN A;  1VYH C;  3MKQ A;  2Q7Q A;  3SFZ A;  2B5L A;  2YMU A;  2MTA H;  4X60 B;  5K1C C;  4X61 B;  5EMJ B;  2YNO A;  4L3H D;  3UKU C;  3JB9 L;  4EWR A;  3J81 g;  2P9U C;  2AH1 A;  3EI1 B;  3U4Y A;  3IJ1 A;  3RLM D;  3UKR C;  3PSC B;  3RMZ D;  3CIK B;  1K32 A;  2GC7 A;  3JZH A;  4U7A A;  4OWR A;  2B5N A;  5THA A;  5FLX g;  4E5Z B;  2P9L C;  4QL1 A;  5FKQ A;  2UZY B;  4JT5 C;  3ZWL B;  2BBK H;  1GG2 B;  4GQB B;  3UVL A;  4GM3 A;  4FAN D;  2OVQ B;  5TDH B;  3SVW D;  3EI1 A;  4GM9 A;  3SBP A;  3RSE C;  5EAP A;  4FB1 D;  1MG3 A;  2J57 G;  2O9K A;  2H6K A;  3N0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...