3RFHA

Crystal structure of the yeast rack1 dimer in space group p21
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
315
structure length
291
Chain Sequence
b'SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSAAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
publication title Structure of the RACK1 dimer from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 67
structure length 291
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rfhA00
3MMYA 4A09A 1RI6A 3SVWD 3N0DA 4JSXC 2P9SC 2PM9B 2H9PA 3EI4A 4FA9D 1JMZB 4CY1A 2B5LA 4NSXA 3FGBA 2I3TA 1SQJA 2H13A 5HE0B 4AOWA 2OJYA 3L4MD 5CXBA 5IC7A 3EI1B 2P9IC 3IKOA 2GC7A 4ZOXA 3RSEC 5CXCA 3BWSA 3CFVA 2PM7B 4BL0A 3JAMg 4FA1D 4CI8A 3PSCB 5EM2B 4QRJA 3F3GA 3AL8B 5EALA 2IAAA 3F3FA 4YVDA 3UVLA 3DXKC 4J84A 2TRCB 5C2VB 1QNIA 3B7FA 3RN0D 3CIKB 5AJAA 3UR4A 3JZGA 1XKSA 4A08B 4E54B 1GXRA 3EMHA 3I8EA 4PSXB 3SN6B 4A7JA 4A0BB 5FKTA 2H14A 1SHYB 3ODTA 3UVOA 2HJBA 4Y7RA 3UVMA 5JWZA 3EWEA 4D6VA 4CY5A 1Q47A 3RMZD 3UVKA 4J86A 1XHMA 4GQBB 3OTTA 3FM0A 3J80g 2AH0A 2IWFA 3PSLA 5EMMB 2B5NA 3JZNA 2AGZA 4XYHA 3PE7A 2P9UC 5AMSA 3I7HA 2OVQB 4J8BA 4PNKB 3I89A 4ZOVA 4AEZA 5GXHA 2BCJB 3RFGA 2XL2A 4FAVD 3N0EA 4J81A 4O1QD 3GREA 4FB1D 3KRWB 4PBZA 2AGXA 4J77A 4GM3A 3OKWA 4J87A 5H14A 2IUPA 2GNQA 1N6EA 3SXTD 3I7OA 2BBKH 2AH1A 4GQ2P 4ZOZA 4ZOYA 3IIWA 3MXXA 4LG8A 2H68A 2OK6A 4O3TB 3SLED 5K19A 3JB9L 4L3GD 4CZVA 2P9LC 4X61B 3SJLD 4J0XA 3C99A 4BH6A 4Y5RD 2AGYA 3V7DB 1VYHC 2YNOA 3DWLC 3JROA 4A11A 1PI6A 1TBGA 4J8GA 3L4OD 4GGDA 4E5ZB 1TYQC 3ORVD 2I0SA 4FHLA 3EG6A 4U7AA 2HKMA 5TDHB 3JPXA 2OIZA 5KDOB 4K3JB 3KRXB 4IA9A 3EI3B 2HJ4A 1ERJA 5EARA 4FWWA 5CYKB 2GC4A 5FLXg 4GGAA 4N14A 5I5JA 4JT5C 4G56B 3A0FA 2Z2NA 3K27A 1GG2B 4PC0A 3FRXA 4GM9A 3U4YA 2IUVA 3IJ1A 3SHFA 3PXTD 3EI2B 3UKRC 3OL2B 1K8KC 3OKYB 3RN1D 2P9PC 2CE8A 3EU7A 2YBAA 1PBYB 4EWRA 4D0KA 2CNXA 5GXIA 2UZYB 4L1QD 2QC5A 4GGCA 4CI2A 3SWSD 4PSWB 4O45A 4A09B 3BG0A 2H9LA 2UZXB 4UI9R 4OWRA 3EI4B 1OMWB 2W18A 3I7KA 4A11B 3VA6A 2Z2PA 4IMMA 1MG2A 3SFZA 4H5IA 1K32A 1MG3A 1NR0A 5IJ8E 4A0AA 5THAA 5TEEA 1MDAH 5EMKB 3C5MA 5CXBB 2OK4A 3AL9A 3I7PA 4Z8LA 1PEVA 4ERQA 4X3EA 3GFCA 5AFU3 5CXCB 2H6QA 1B9XA 4A2MA 4JT6C 5H17A 2H3XA 4ERYA 2AGWA 2G9AA 1SQ9A 4PXWA 4A2LA 2I3SA 1A0RB 1YFQA 5FA5B 3SBQA 3W15A 1OLZA 5B4WA 4J82A 3ZWLB 1FWXA 3NVQA 4ZN4A 4L9OA 3DM0A 2B5MA 2YB8B 3AL8A 2IURA 3NVXA 2YNPA 3OKTA 3J81g 5HYNB 2AGLA 2H9MA 5H1MA 5IGOA 3C75H 5SXMA 4GM8A 2IUQA 1P22A 1N6FA 4A08A 4HDJA 4E54A 2PM6B 5FQDA 5EAPA 4CZXA 4LG9A 1PGUA 2IWKA 3ULEC 4A0AB 3I7NA 2CN3A 5HE2B 5A2Qg 2P9NC 3V5WB 3AH8B 5TF2A 4ESGA 5HQGA 1S4UX 4QQEA 4KFMB 3DXMC 5HE3B 4GMBA 3SBPA 4CY3A 1B9YA 5K1CC 1XIPA 2P9KC 3NVNA 4CY2A 1U4CA 3VH0A 2J55H 2CN2A 4QT8A 2MTAH 4J78A 3MZKA 3DSMA 4FAND 3E0CA 2XU7A 5IGQA 4X63B 2HYEA 4BUJC 4X60B 3V9FA 5C2WB 2OVPB 4GQ1A 4J73A 4CI3A 4XEIC 4O9DA 4MK0B 3VGZA 4FA4D 4CC9A 3IJCA 1GP2B 2J56H 5EAMA 5FKRA 4CZYA 4FA5D 2H47A 3PXSD 3JRPA 3K26A 2PBIB 2CE9A 3BG1A 4H5JA 2OVRB 3HFQA 4XYIA 4GZ8A 4JSNC 1N6DA 4JSPC 4O3UB 4CI1A 2XL3A 5FKSA 5IJ7E 2HKRA 2H6KA 2EBSA 3IIYA 3MKSB 3MZLA 3SBRA 2G99A 5I5MA 3I7LA 5GMKn 2Q7QA 2HXCA 2PM9A 2Z2OA 2YNNA 2I0TA 3CFSB 2HESX 4E5ZA 2I0RA 3JZHA 1U2VC 4ERZA 5FKQA 4JSVC 2CO0A 2CO0C 2QXVA 3OW8A 2YMUA 5IT9g 4OZUA 4J0WA 4K3ID 3EI3A 3RRMC 5HE1B 5C9ZB 3EI1A 3MKQA 4LGNA 5EMJB 3RFHA 1GOTB 3F3PA 2H6NA 5CYKA 5I5IA 3P4FA 3IJ0A 3SMRA 1JMXB 5FXYA 4I79A 5EM2A 1R5MA 3SCYA 4U1EI 3UKUC 1L0QA 3I2NA 4ES0A 4J79A 1JJUB 4JD2C 3PXWD 3C9CA 5EMLB 4R7AB 2H9NA 2XYIA 1JOFA 2B4EA 5GSAA 4L3HD 3EI2A 4QL1A 3OL2A 3OKYA 2AQ5A 2J57G 3PVUB 5TEFA 4PBYA 2O9KA 4TZ4A 1NEXB 4A0BA 4JXMA 3UVNA 3PVWB 3RLMD 3AFCA 3I8CA
chains in the Genus database with same CATH superfamily
3MMYA 4A09A 1RI6A 3SVWD 3N0DA 4JSXC 4O02A 2P9SC 2PM9B 3IJEA 2H9PA 3EI4A 3ZE2A 4WK2A 3O4IA 4FA9D 1JMZB 4CY1A 2B5LA 4NSXA 3FGBA 2I3TA 4MMYA 1SQJA 2H13A 5HE0B 4AOWA 2OJYA 3L4MD 4RE6A 5CXBA 5IC7A 3V4PA 3EI1B 4QAMA 2P9IC 3IKOA 2GC7A 4ZOXA 3RSEC 5CXCA 3BWSA 5M5UA 3CFVA 1VZ3A 2PM7B 4BL0A 3GD1I 3JAMg 4FA1D 4CI8A 1O6GA 3PSCB 5EM2B 3GC3B 4QRJA 3F3GA 3AL8B 5EALA 3FCUA 3ZDXA 4AN0A 2IAAA 3F3FA 4YVDA 3UVLA 3DXKC 4J84A 2TRCB 5C2VB 2VDRA 1QNIA 4MMZA 3B7FA 3RN0D 3CIKB 5AJAA 4BCBA 2EIEA 3UR4A 3JZGA 1VZ2A 1XKSA 4A08B 4E54B 1GXRA 3EMHA 3I8EA 4PSXB 3SN6B 4A7JA 4BCCA 4A0BB 5FKTA 1QFSA 2H14A 1SHYB 3ODTA 4UM9A 3UVOA 2HJBA 4Y7RA 3UVMA 5FFOA 5JWZA 3EWEA 4D6VA 4O2WA 1JTDB 4CY5A 1Q47A 3RMZD 3UVKA 2XE4A 4J86A 1XHMA 4GQBB 3OTTA 1VE7A 3FM0A 3J80g 3V4VA 5E6UA 2AH0A 2IWFA 3PSLA 2JKXA 4BP8A 4BCDA 5EMMB 4NC4A 2B5NA 1H2YA 3JZNA 2AGZA 4XYHA 5M5VA 3NIDA 3PE7A 2P9UC 5AMSA 3I7HA 2OVQB 4J8BA 4PNKB 3I89A 4ZOVA 4AEZA 5GXHA 4Z7OA 1T2XA 2BCJB 3RFGA 2XL2A 1TYEA 4NBMA 4FAVD 2VDOA 3N0EA 4J81A 4O1QD 3GREA 3EQ7A 1C9LA 1C9IA 4FB1D 3KRWB 4PBZA 2AGXA 4J77A 4GM3A 3OKWA 4J87A 5H14A 2IUPA 2GNQA 3EQ8A 4G1EA 1N6EA 2EIBA 3SXTD 3I7OA 5M5TA 2BBKH 1L5GA 2AH1A 4GQ2P 4ZOZA 4ZOYA 3IIWA 1M1XA 3MXXA 4LG8A 2H68A 2OK6A 1GOGA 4O3TB 3SLED 5K19A 3JB9L 4L3GD 4CZVA 2P9LC 4DNWA 4X61B 4UM8A 5M61A 3SJLD 4BP9A 4J0XA 3C99A 1O6FA 4Y5RD 1H2WA 2AGYA 4BH6A 3V7DB 1VYHC 2YNOA 4AMZA 2VDLA 3DWLC 3JROA 4A11A 4Z7NA 1PI6A 1TBGA 1VE6A 4J8GA 3L4OD 4GGDA 4E5ZB 1TYQC 3O4HA 3ORVD 4JHPC 4L1MA 2I0SA 4FHLA 3EG6A 3NIGA 4U7AA 2HKMA 5TDHB 3JPXA 2OIZA 3O4GA 5KDOB 4K3JB 3KRXB 4IA9A 5HDBA 3EI3B 4AN1A 2HJ4A 1ERJA 5EARA 4JHNA 1H2XA 4FWWA 4DNUA 5CYKB 2GC4A 5FLXg 5E6RA 4GGAA 3IURA 3MUNA 2WQ8A 4N14A 5I5JA 1UOQA 4G56B 4JT5C 1BPOA 3A0FA 2Z2NA 3K27A 1GG2B 4PC0A 3FRXA 4GM9A 4NENA 2IUVA 3IJ1A 3U4YA 3ZDZA 4G55A 3PXTD 3SHFA 3EI2B 3UKRC 2XDWA 3OL2B 1K8KC 3OKYB 3RN1D 2P9PC 2CE8A 3EU7A 2YBAA 1PBYB 4EWRA 3VI3A 4D0KA 4AMYA 2CNXA 5GXIA 2UZYB 4L1QD 2QC5A 4GGCA 4CI2A 1GOFA 3SWSD 4PSWB 1A12A 4O45A 1YR2A 4AX4A 1UOPA 3BG0A 4A09B 2H9LA 2UZXB 4UI9R 4OWRA 3NIFA 3EI4B 1OMWB 2W18A 3I7KA 3T3PA 4A11B 3VA6A 2Z2PA 4IMMA 3T3MA 1MG2A 3SFZA 4H5IA 1K32A 1MG3A 1NR0A 5IJ8E 4A0AA 4RE5A 5THAA 5TEEA 1MDAH 5EMKB 2VC2A 3C5MA 5CXBB 3K72A 2OK4A 3AL9A 3I7PA 4Z8LA 3ZDYA 1PEVA 4ERQA 4X3EA 3GFCA 3VI4A 5AFU3 5CXCB 2H6QA 1B9XA 4A2MA 3IVMA 4JT6C 4DNVA 3MVDK 4WJKA 5M5RA 5H17A 2H3XA 3MUOA 4ERYA 2AGWA 2G9AA 1SQ9A 4PXWA 4A2LA 2QZPA 2I3SA 3DDUA 1A0RB 1YFQA 5FA5B 1UTCA 3SBQA 3W15A 1OLZA 4IRZA 5B4WA 3IUQA 4J82A 3ZWLB 3ZE0A 2VZ1A 1E8MA 1FWXA 1UOOA 3NVQA 4L9OA 4ZN4A 3DM0A 2B5MA 2YB8B 3AL8A 2IURA 3NVXA 2YNPA 3OKTA 3J81g 5HYNB 2AGLA 2H9MA 5H1MA 5IGOA 3QHYB 3C75H 5SXMA 4GM8A 2IUQA 1I2MB 1P22A 2VDQA 1N6FA 1JV2A 4A08A 4HDJA 4E54A 2PM6B 2XZGA 5FQDA 5EAPA 2VZ3A 2BKLA 4CZXA 4LG9A 1PGUA 2IWKA 3ULEC 4A0AB 3I7NA 2CN3A 5HE2B 5A2Qg 2P9NC 3V5WB 3AH8B 5TF2A 4ESGA 5HQGA 1S4UX 4QQEA 4KFMB 3IULA 3DXMC 5HE3B 4GMBA 1U8CA 3SBPA 3IUMA 4CY3A 1B9YA 5K1CC 1XIPA 2P9KC 3NVNA 4CY2A 1U4CA 3VH0A 2J55H 2CN2A 4QT8A 2MTAH 4J78A 3MZKA 3DSMA 3EQ9A 3IUNA 4FAND 3E0CA 2XU7A 5IGQA 4X63B 2HYEA 4Z7QA 4BUJC 3FCSA 3K6SA 4X60B 3V9FA 4NAAA 5C2WB 2OVPB 4GQ1A 4J73A 4WK0A 4CI3A 4XEIC 5E6SA 4O9DA 4MK0B 3VGZA 3O4JA 4FA4D 4CC9A 3IJCA 4WK4A 1GP2B 2J56H 5EAMA 5FKRA 4CZYA 4FA5D 2H47A 3PXSD 3ZE1A 3JRPA 3K26A 2PBIB 2VDKA 2CE9A 3BG1A 4H5JA 4G1MA 2OVRB 3HFQA 4XYIA 4GZ8A 4JSNC 3KCIA 1N6DA 2VDMA 4JSPC 4O3UB 4CI1A 2XL3A 5FKSA 5IJ7E 2HKRA 2EIDA 2H6KA 4MMXA 2EBSA 3IIYA 3MKSB 3MZLA 3SBRA 2G99A 5I5MA 3I7LA 5C92A 5GMKn 2Q7QA 2HXCA 2PM9A 2Z2OA 2YNNA 2I0TA 2VDNA 3CFSB 2HESX 4E5ZA 2I0RA 1E5TA 3JZHA 1U2VC 4ERZA 5FKQA 4JSVC 2CO0A 2EICA 2CO0C 2QXVA 3OW8A 2YMUA 5IT9g 5C86A 4OZUA 4J0WA 4K3ID 3EI3A 3QI0A 3RRMC 5HE1B 5C9ZB 3EI1A 3MKQA 4LGNA 2VDPA 5EMJB 3RFHA 1GOTB 3F3PA 2H6NA 3OF7A 5CYKA 5I5IA 3P4FA 3IJ0A 3SMRA 5M5SA 1JMXB 5FXYA 4I79A 5EM2A 1R5MA 1GOHA 3SCYA 4U1EI 3UKUC 1L0QA 3I2NA 4ES0A 4J79A 1JJUB 4JD2C 2QR5A 3PXWD 3C9CA 5EMLB 4R7AB 2H9NA 2XYIA 1JOFA 1K3IA 2B4EA 1QFMA 2HU5A 5GSAA 4L3HD 5FFGA 3EI2A 4QL1A 3OL2A 3OKYA 2AQ5A 2J57G 3PVUB 5TEFA 3IUJA 4PBYA 2O9KA 3K71A 4TZ4A 1NEXB 1E8NA 4A0BA 4JXMA 3UVNA 3PVWB 4D9SA 3RLMD 1H2ZA 2HU7A 3AFCA 2HU8A 3I8CA
chains in the Genus database with same CATH topology
3MMYA 4A09A 1RI6A 3SVWD 3N0DA 4JSXC 2P9SC 2PM9B 2H9PA 3EI4A 4FA9D 1JMZB 4CY1A 2B5LA 4NSXA 3FGBA 2I3TA 1SQJA 2H13A 5HE0B 4AOWA 2OJYA 3L4MD 5CXBA 5IC7A 3EI1B 2P9IC 3IKOA 2GC7A 4ZOXA 3RSEC 5CXCA 3BWSA 3CFVA 2PM7B 4BL0A 3JAMg 4FA1D 4CI8A 3PSCB 5EM2B 4QRJA 3F3GA 3AL8B 5EALA 2IAAA 3F3FA 4YVDA 3UVLA 3DXKC 4J84A 2TRCB 5C2VB 1QNIA 3B7FA 3RN0D 3CIKB 5AJAA 3UR4A 3JZGA 1XKSA 4A08B 4E54B 1GXRA 3EMHA 3I8EA 4PSXB 3SN6B 4A7JA 4A0BB 5FKTA 2H14A 1SHYB 3ODTA 3UVOA 2HJBA 4Y7RA 3UVMA 5JWZA 3EWEA 4D6VA 4CY5A 1Q47A 3RMZD 3UVKA 4J86A 1XHMA 4GQBB 3OTTA 3FM0A 3J80g 2AH0A 2IWFA 3PSLA 5EMMB 2B5NA 3JZNA 2AGZA 4XYHA 3PE7A 2P9UC 5AMSA 3I7HA 2OVQB 4J8BA 4PNKB 3I89A 4ZOVA 4AEZA 5GXHA 2BCJB 3RFGA 2XL2A 4FAVD 3N0EA 4J81A 4O1QD 3GREA 4FB1D 3KRWB 4PBZA 2AGXA 4J77A 4GM3A 3OKWA 4J87A 5H14A 2IUPA 2GNQA 1N6EA 3SXTD 3I7OA 2BBKH 2AH1A 4GQ2P 4ZOZA 4ZOYA 3IIWA 3MXXA 4LG8A 2H68A 2OK6A 4O3TB 3SLED 5K19A 3JB9L 4L3GD 4CZVA 2P9LC 4X61B 3SJLD 4J0XA 3C99A 4BH6A 4Y5RD 2AGYA 3V7DB 1VYHC 2YNOA 3DWLC 3JROA 4A11A 1PI6A 1TBGA 4J8GA 3L4OD 4GGDA 4E5ZB 1TYQC 3ORVD 2I0SA 4FHLA 3EG6A 4U7AA 2HKMA 5TDHB 3JPXA 2OIZA 5KDOB 4K3JB 3KRXB 4IA9A 3EI3B 2HJ4A 1ERJA 5EARA 4FWWA 5CYKB 2GC4A 5FLXg 4GGAA 4N14A 5I5JA 4JT5C 4G56B 3A0FA 2Z2NA 3K27A 1GG2B 4PC0A 3FRXA 4GM9A 3U4YA 2IUVA 3IJ1A 3SHFA 3PXTD 3EI2B 3UKRC 3OL2B 1K8KC 3OKYB 3RN1D 2P9PC 2CE8A 3EU7A 2YBAA 1PBYB 4EWRA 4D0KA 2CNXA 5GXIA 2UZYB 4L1QD 2QC5A 4GGCA 4CI2A 3SWSD 4PSWB 4O45A 4A09B 3BG0A 2H9LA 2UZXB 4UI9R 4OWRA 3EI4B 1OMWB 2W18A 3I7KA 4A11B 3VA6A 2Z2PA 4IMMA 1MG2A 3SFZA 4H5IA 1K32A 1MG3A 1NR0A 5IJ8E 4A0AA 5THAA 5TEEA 1MDAH 5EMKB 3C5MA 5CXBB 2OK4A 3AL9A 3I7PA 4Z8LA 1PEVA 4ERQA 4X3EA 3GFCA 5AFU3 5CXCB 2H6QA 1B9XA 4A2MA 4JT6C 5H17A 2H3XA 4ERYA 2AGWA 2G9AA 1SQ9A 4PXWA 4A2LA 2I3SA 1A0RB 1YFQA 5FA5B 3SBQA 3W15A 1OLZA 5B4WA 4J82A 3ZWLB 1FWXA 3NVQA 4ZN4A 4L9OA 3DM0A 2B5MA 2YB8B 3AL8A 2IURA 3NVXA 2YNPA 3OKTA 3J81g 5HYNB 2AGLA 2H9MA 5H1MA 5IGOA 3C75H 5SXMA 4GM8A 2IUQA 1P22A 1N6FA 4A08A 4HDJA 4E54A 2PM6B 5FQDA 5EAPA 4CZXA 4LG9A 1PGUA 2IWKA 3ULEC 4A0AB 3I7NA 2CN3A 5HE2B 5A2Qg 2P9NC 3V5WB 3AH8B 5TF2A 4ESGA 5HQGA 1S4UX 4QQEA 4KFMB 3DXMC 5HE3B 4GMBA 3SBPA 4CY3A 1B9YA 5K1CC 1XIPA 2P9KC 3NVNA 4CY2A 1U4CA 3VH0A 2J55H 2CN2A 4QT8A 2MTAH 4J78A 3MZKA 3DSMA 4FAND 3E0CA 2XU7A 5IGQA 4X63B 2HYEA 4BUJC 4X60B 3V9FA 5C2WB 2OVPB 4GQ1A 4J73A 4CI3A 4XEIC 4O9DA 4MK0B 3VGZA 4FA4D 4CC9A 3IJCA 1GP2B 2J56H 5EAMA 5FKRA 4CZYA 4FA5D 2H47A 3PXSD 3JRPA 3K26A 2PBIB 2CE9A 3BG1A 4H5JA 2OVRB 3HFQA 4XYIA 4GZ8A 4JSNC 1N6DA 4JSPC 4O3UB 4CI1A 2XL3A 5FKSA 5IJ7E 2HKRA 2H6KA 2EBSA 3IIYA 3MKSB 3MZLA 3SBRA 2G99A 5I5MA 3I7LA 5GMKn 2Q7QA 2HXCA 2PM9A 2Z2OA 2YNNA 2I0TA 3CFSB 2HESX 4E5ZA 2I0RA 3JZHA 1U2VC 4ERZA 5FKQA 4JSVC 2CO0A 2CO0C 2QXVA 3OW8A 2YMUA 5IT9g 4OZUA 4J0WA 4K3ID 3EI3A 3RRMC 5HE1B 5C9ZB 3EI1A 3MKQA 4LGNA 5EMJB 3RFHA 1GOTB 3F3PA 2H6NA 5CYKA 5I5IA 3P4FA 3IJ0A 3SMRA 1JMXB 5FXYA 4I79A 5EM2A 1R5MA 3SCYA 4U1EI 3UKUC 1L0QA 3I2NA 4ES0A 4J79A 1JJUB 4JD2C 3PXWD 3C9CA 5EMLB 4R7AB 2H9NA 2XYIA 1JOFA 2B4EA 5GSAA 4L3HD 3EI2A 4QL1A 3OL2A 3OKYA 2AQ5A 2J57G 3PVUB 5TEFA 4PBYA 2O9KA 4TZ4A 1NEXB 4A0BA 4JXMA 3UVNA 3PVWB 3RLMD 3AFCA 3I8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMY A;  4A09 A;  1RI6 A;  3SVW D;  3N0D A;  4JSX C;  2P9S C;  2PM9 B;  2H9P A;  3EI4 A;  4FA9 D;  1JMZ B;  4CY1 A;  2B5L A;  4NSX A;  3FGB A;  2I3T A;  1SQJ A;  2H13 A;  5HE0 B;  4AOW A;  2OJY A;  3L4M D;  5CXB A;  5IC7 A;  3EI1 B;  2P9I C;  3IKO A;  2GC7 A;  4ZOX A;  3RSE C;  5CXC A;  3BWS A;  3CFV A;  2PM7 B;  4BL0 A;  3JAM g;  4FA1 D;  4CI8 A;  3PSC B;  5EM2 B;  4QRJ A;  3F3G A;  3AL8 B;  5EAL A;  2IAA A;  3F3F A;  4YVD A;  3UVL A;  3DXK C;  4J84 A;  2TRC B;  5C2V B;  1QNI A;  3B7F A;  3RN0 D;  3CIK B;  5AJA A;  3UR4 A;  3JZG A;  1XKS A;  4A08 B;  4E54 B;  1GXR A;  3EMH A;  3I8E A;  4PSX B;  3SN6 B;  4A7J A;  4A0B B;  5FKT A;  2H14 A;  1SHY B;  3ODT A;  3UVO A;  2HJB A;  4Y7R A;  3UVM A;  5JWZ A;  3EWE A;  4D6V A;  4CY5 A;  1Q47 A;  3RMZ D;  3UVK A;  4J86 A;  1XHM A;  4GQB B;  3OTT A;  3FM0 A;  3J80 g;  2AH0 A;  2IWF A;  3PSL A;  5EMM B;  2B5N A;  3JZN A;  2AGZ A;  4XYH A;  3PE7 A;  2P9U C;  5AMS A;  3I7H A;  2OVQ B;  4J8B A;  4PNK B;  3I89 A;  4ZOV A;  4AEZ A;  5GXH A;  2BCJ B;  3RFG A;  2XL2 A;  4FAV D;  3N0E A;  4J81 A;  4O1Q D;  3GRE A;  4FB1 D;  3KRW B;  4PBZ A;  2AGX A;  4J77 A;  4GM3 A;  3OKW A;  4J87 A;  5H14 A;  2IUP A;  2GNQ A;  1N6E A;  3SXT D;  3I7O A;  2BBK H;  2AH1 A;  4GQ2 P;  4ZOZ A;  4ZOY A;  3IIW A;  3MXX A;  4LG8 A;  2H68 A;  2OK6 A;  4O3T B;  3SLE D;  5K19 A;  3JB9 L;  4L3G D;  4CZV A;  2P9L C;  4X61 B;  3SJL D;  4J0X A;  3C99 A;  4BH6 A;  4Y5R D;  2AGY A;  3V7D B;  1VYH C;  2YNO A;  3DWL C;  3JRO A;  4A11 A;  1PI6 A;  1TBG A;  4J8G A;  3L4O D;  4GGD A;  4E5Z B;  1TYQ C;  3ORV D;  2I0S A;  4FHL A;  3EG6 A;  4U7A A;  2HKM A;  5TDH B;  3JPX A;  2OIZ A;  5KDO B;  4K3J B;  3KRX B;  4IA9 A;  3EI3 B;  2HJ4 A;  1ERJ A;  5EAR A;  4FWW A;  5CYK B;  2GC4 A;  5FLX g;  4GGA A;  4N14 A;  5I5J A;  4JT5 C;  4G56 B;  3A0F A;  2Z2N A;  3K27 A;  1GG2 B;  4PC0 A;  3FRX A;  4GM9 A;  3U4Y A;  2IUV A;  3IJ1 A;  3SHF A;  3PXT D;  3EI2 B;  3UKR C;  3OL2 B;  1K8K C;  3OKY B;  3RN1 D;  2P9P C;  2CE8 A;  3EU7 A;  2YBA A;  1PBY B;  4EWR A;  4D0K A;  2CNX A;  5GXI A;  2UZY B;  4L1Q D;  2QC5 A;  4GGC A;  4CI2 A;  3SWS D;  4PSW B;  4O45 A;  4A09 B;  3BG0 A;  2H9L A;  2UZX B;  4UI9 R;  4OWR A;  3EI4 B;  1OMW B;  2W18 A;  3I7K A;  4A11 B;  3VA6 A;  2Z2P A;  4IMM A;  1MG2 A;  3SFZ A;  4H5I A;  1K32 A;  1MG3 A;  1NR0 A;  5IJ8 E;  4A0A A;  5THA A;  5TEE A;  1MDA H;  5EMK B;  3C5M A;  5CXB B;  2OK4 A;  3AL9 A;  3I7P A;  4Z8L A;  1PEV A;  4ERQ A;  4X3E A;  3GFC A;  5AFU 3;  5CXC B;  2H6Q A;  1B9X A;  4A2M A;  4JT6 C;  5H17 A;  2H3X A;  4ERY A;  2AGW A;  2G9A A;  1SQ9 A;  4PXW A;  4A2L A;  2I3S A;  1A0R B;  1YFQ A;  5FA5 B;  3SBQ A;  3W15 A;  1OLZ A;  5B4W A;  4J82 A;  3ZWL B;  1FWX A;  3NVQ A;  4ZN4 A;  4L9O A;  3DM0 A;  2B5M A;  2YB8 B;  3AL8 A;  2IUR A;  3NVX A;  2YNP A;  3OKT A;  3J81 g;  5HYN B;  2AGL A;  2H9M A;  5H1M A;  5IGO A;  3C75 H;  5SXM A;  4GM8 A;  2IUQ A;  1P22 A;  1N6F A;  4A08 A;  4HDJ A;  4E54 A;  2PM6 B;  5FQD A;  5EAP A;  4CZX A;  4LG9 A;  1PGU A;  2IWK A;  3ULE C;  4A0A B;  3I7N A;  2CN3 A;  5HE2 B;  5A2Q g;  2P9N C;  3V5W B;  3AH8 B;  5TF2 A;  4ESG A;  5HQG A;  1S4U X;  4QQE A;  4KFM B;  3DXM C;  5HE3 B;  4GMB A;  3SBP A;  4CY3 A;  1B9Y A;  5K1C C;  1XIP A;  2P9K C;  3NVN A;  4CY2 A;  1U4C A;  3VH0 A;  2J55 H;  2CN2 A;  4QT8 A;  2MTA H;  4J78 A;  3MZK A;  3DSM A;  4FAN D;  3E0C A;  2XU7 A;  5IGQ A;  4X63 B;  2HYE A;  4BUJ C;  4X60 B;  3V9F A;  5C2W B;  2OVP B;  4GQ1 A;  4J73 A;  4CI3 A;  4XEI C;  4O9D A;  4MK0 B;  3VGZ A;  4FA4 D;  4CC9 A;  3IJC A;  1GP2 B;  2J56 H;  5EAM A;  5FKR A;  4CZY A;  4FA5 D;  2H47 A;  3PXS D;  3JRP A;  3K26 A;  2PBI B;  2CE9 A;  3BG1 A;  4H5J A;  2OVR B;  3HFQ A;  4XYI A;  4GZ8 A;  4JSN C;  1N6D A;  4JSP C;  4O3U B;  4CI1 A;  2XL3 A;  5FKS A;  5IJ7 E;  2HKR A;  2H6K A;  2EBS A;  3IIY A;  3MKS B;  3MZL A;  3SBR A;  2G99 A;  5I5M A;  3I7L A;  5GMK n;  2Q7Q A;  2HXC A;  2PM9 A;  2Z2O A;  2YNN A;  2I0T A;  3CFS B;  2HES X;  4E5Z A;  2I0R A;  3JZH A;  1U2V C;  4ERZ A;  5FKQ A;  4JSV C;  2CO0 A;  2CO0 C;  2QXV A;  3OW8 A;  2YMU A;  5IT9 g;  4OZU A;  4J0W A;  4K3I D;  3EI3 A;  3RRM C;  5HE1 B;  5C9Z B;  3EI1 A;  3MKQ A;  4LGN A;  5EMJ B;  3RFH A;  1GOT B;  3F3P A;  2H6N A;  5CYK A;  5I5I A;  3P4F A;  3IJ0 A;  3SMR A;  1JMX B;  5FXY A;  4I79 A;  5EM2 A;  1R5M A;  3SCY A;  4U1E I;  3UKU C;  1L0Q A;  3I2N A;  4ES0 A;  4J79 A;  1JJU B;  4JD2 C;  3PXW D;  3C9C A;  5EML B;  4R7A B;  2H9N A;  2XYI A;  1JOF A;  2B4E A;  5GSA A;  4L3H D;  3EI2 A;  4QL1 A;  3OL2 A;  3OKY A;  2AQ5 A;  2J57 G;  3PVU B;  5TEF A;  4PBY A;  2O9K A;  4TZ4 A;  1NEX B;  4A0B A;  4JXM A;  3UVN A;  3PVW B;  3RLM D;  3AFC A;  3I8C A; 
#chains in the Genus database with same CATH topology
 3MMY A;  4A09 A;  1RI6 A;  3SVW D;  3N0D A;  4JSX C;  4O02 A;  2P9S C;  2PM9 B;  3IJE A;  2H9P A;  3EI4 A;  3ZE2 A;  4WK2 A;  3O4I A;  4FA9 D;  1JMZ B;  4CY1 A;  2B5L A;  4NSX A;  3FGB A;  2I3T A;  4MMY A;  1SQJ A;  2H13 A;  5HE0 B;  4AOW A;  2OJY A;  3L4M D;  4RE6 A;  5CXB A;  5IC7 A;  3V4P A;  3EI1 B;  4QAM A;  2P9I C;  3IKO A;  2GC7 A;  4ZOX A;  3RSE C;  5CXC A;  3BWS A;  5M5U A;  3CFV A;  1VZ3 A;  2PM7 B;  4BL0 A;  3GD1 I;  3JAM g;  4FA1 D;  4CI8 A;  1O6G A;  3PSC B;  5EM2 B;  3GC3 B;  4QRJ A;  3F3G A;  3AL8 B;  5EAL A;  3FCU A;  3ZDX A;  4AN0 A;  2IAA A;  3F3F A;  4YVD A;  3UVL A;  3DXK C;  4J84 A;  2TRC B;  5C2V B;  2VDR A;  1QNI A;  4MMZ A;  3B7F A;  3RN0 D;  3CIK B;  5AJA A;  4BCB A;  2EIE A;  3UR4 A;  3JZG A;  1VZ2 A;  1XKS A;  4A08 B;  4E54 B;  1GXR A;  3EMH A;  3I8E A;  4PSX B;  3SN6 B;  4A7J A;  4BCC A;  4A0B B;  5FKT A;  1QFS A;  2H14 A;  1SHY B;  3ODT A;  4UM9 A;  3UVO A;  2HJB A;  4Y7R A;  3UVM A;  5FFO A;  5JWZ A;  3EWE A;  4D6V A;  4O2W A;  1JTD B;  4CY5 A;  1Q47 A;  3RMZ D;  3UVK A;  2XE4 A;  4J86 A;  1XHM A;  4GQB B;  3OTT A;  1VE7 A;  3FM0 A;  3J80 g;  3V4V A;  5E6U A;  2AH0 A;  2IWF A;  3PSL A;  2JKX A;  4BP8 A;  4BCD A;  5EMM B;  4NC4 A;  2B5N A;  1H2Y A;  3JZN A;  2AGZ A;  4XYH A;  5M5V A;  3NID A;  3PE7 A;  2P9U C;  5AMS A;  3I7H A;  2OVQ B;  4J8B A;  4PNK B;  3I89 A;  4ZOV A;  4AEZ A;  5GXH A;  4Z7O A;  1T2X A;  2BCJ B;  3RFG A;  2XL2 A;  1TYE A;  4NBM A;  4FAV D;  2VDO A;  3N0E A;  4J81 A;  4O1Q D;  3GRE A;  3EQ7 A;  1C9L A;  1C9I A;  4FB1 D;  3KRW B;  4PBZ A;  2AGX A;  4J77 A;  4GM3 A;  3OKW A;  4J87 A;  5H14 A;  2IUP A;  2GNQ A;  3EQ8 A;  4G1E A;  1N6E A;  2EIB A;  3SXT D;  3I7O A;  5M5T A;  2BBK H;  1L5G A;  2AH1 A;  4GQ2 P;  4ZOZ A;  4ZOY A;  3IIW A;  1M1X A;  3MXX A;  4LG8 A;  2H68 A;  2OK6 A;  1GOG A;  4O3T B;  3SLE D;  5K19 A;  3JB9 L;  4L3G D;  4CZV A;  2P9L C;  4DNW A;  4X61 B;  4UM8 A;  5M61 A;  3SJL D;  4BP9 A;  4J0X A;  3C99 A;  1O6F A;  4Y5R D;  1H2W A;  2AGY A;  4BH6 A;  3V7D B;  1VYH C;  2YNO A;  4AMZ A;  2VDL A;  3DWL C;  3JRO A;  4A11 A;  4Z7N A;  1PI6 A;  1TBG A;  1VE6 A;  4J8G A;  3L4O D;  4GGD A;  4E5Z B;  1TYQ C;  3O4H A;  3ORV D;  4JHP C;  4L1M A;  2I0S A;  4FHL A;  3EG6 A;  3NIG A;  4U7A A;  2HKM A;  5TDH B;  3JPX A;  2OIZ A;  3O4G A;  5KDO B;  4K3J B;  3KRX B;  4IA9 A;  5HDB A;  3EI3 B;  4AN1 A;  2HJ4 A;  1ERJ A;  5EAR A;  4JHN A;  1H2X A;  4FWW A;  4DNU A;  5CYK B;  2GC4 A;  5FLX g;  5E6R A;  4GGA A;  3IUR A;  3MUN A;  2WQ8 A;  4N14 A;  5I5J A;  1UOQ A;  4G56 B;  4JT5 C;  1BPO A;  3A0F A;  2Z2N A;  3K27 A;  1GG2 B;  4PC0 A;  3FRX A;  4GM9 A;  4NEN A;  2IUV A;  3IJ1 A;  3U4Y A;  3ZDZ A;  4G55 A;  3PXT D;  3SHF A;  3EI2 B;  3UKR C;  2XDW A;  3OL2 B;  1K8K C;  3OKY B;  3RN1 D;  2P9P C;  2CE8 A;  3EU7 A;  2YBA A;  1PBY B;  4EWR A;  3VI3 A;  4D0K A;  4AMY A;  2CNX A;  5GXI A;  2UZY B;  4L1Q D;  2QC5 A;  4GGC A;  4CI2 A;  1GOF A;  3SWS D;  4PSW B;  1A12 A;  4O45 A;  1YR2 A;  4AX4 A;  1UOP A;  3BG0 A;  4A09 B;  2H9L A;  2UZX B;  4UI9 R;  4OWR A;  3NIF A;  3EI4 B;  1OMW B;  2W18 A;  3I7K A;  3T3P A;  4A11 B;  3VA6 A;  2Z2P A;  4IMM A;  3T3M A;  1MG2 A;  3SFZ A;  4H5I A;  1K32 A;  1MG3 A;  1NR0 A;  5IJ8 E;  4A0A A;  4RE5 A;  5THA A;  5TEE A;  1MDA H;  5EMK B;  2VC2 A;  3C5M A;  5CXB B;  3K72 A;  2OK4 A;  3AL9 A;  3I7P A;  4Z8L A;  3ZDY A;  1PEV A;  4ERQ A;  4X3E A;  3GFC A;  3VI4 A;  5AFU 3;  5CXC B;  2H6Q A;  1B9X A;  4A2M A;  3IVM A;  4JT6 C;  4DNV A;  3MVD K;  4WJK A;  5M5R A;  5H17 A;  2H3X A;  3MUO A;  4ERY A;  2AGW A;  2G9A A;  1SQ9 A;  4PXW A;  4A2L A;  2QZP A;  2I3S A;  3DDU A;  1A0R B;  1YFQ A;  5FA5 B;  1UTC A;  3SBQ A;  3W15 A;  1OLZ A;  4IRZ A;  5B4W A;  3IUQ A;  4J82 A;  3ZWL B;  3ZE0 A;  2VZ1 A;  1E8M A;  1FWX A;  1UOO A;  3NVQ A;  4L9O A;  4ZN4 A;  3DM0 A;  2B5M A;  2YB8 B;  3AL8 A;  2IUR A;  3NVX A;  2YNP A;  3OKT A;  3J81 g;  5HYN B;  2AGL A;  2H9M A;  5H1M A;  5IGO A;  3QHY B;  3C75 H;  5SXM A;  4GM8 A;  2IUQ A;  1I2M B;  1P22 A;  2VDQ A;  1N6F A;  1JV2 A;  4A08 A;  4HDJ A;  4E54 A;  2PM6 B;  2XZG A;  5FQD A;  5EAP A;  2VZ3 A;  2BKL A;  4CZX A;  4LG9 A;  1PGU A;  2IWK A;  3ULE C;  4A0A B;  3I7N A;  2CN3 A;  5HE2 B;  5A2Q g;  2P9N C;  3V5W B;  3AH8 B;  5TF2 A;  4ESG A;  5HQG A;  1S4U X;  4QQE A;  4KFM B;  3IUL A;  3DXM C;  5HE3 B;  4GMB A;  1U8C A;  3SBP A;  3IUM A;  4CY3 A;  1B9Y A;  5K1C C;  1XIP A;  2P9K C;  3NVN A;  4CY2 A;  1U4C A;  3VH0 A;  2J55 H;  2CN2 A;  4QT8 A;  2MTA H;  4J78 A;  3MZK A;  3DSM A;  3EQ9 A;  3IUN A;  4FAN D;  3E0C A;  2XU7 A;  5IGQ A;  4X63 B;  2HYE A;  4Z7Q A;  4BUJ C;  3FCS A;  3K6S A;  4X60 B;  3V9F A;  4NAA A;  5C2W B;  2OVP B;  4GQ1 A;  4J73 A;  4WK0 A;  4CI3 A;  4XEI C;  5E6S A;  4O9D A;  4MK0 B;  3VGZ A;  3O4J A;  4FA4 D;  4CC9 A;  3IJC A;  4WK4 A;  1GP2 B;  2J56 H;  5EAM A;  5FKR A;  4CZY A;  4FA5 D;  2H47 A;  3PXS D;  3ZE1 A;  3JRP A;  3K26 A;  2PBI B;  2VDK A;  2CE9 A;  3BG1 A;  4H5J A;  4G1M A;  2OVR B;  3HFQ A;  4XYI A;  4GZ8 A;  4JSN C;  3KCI A;  1N6D A;  2VDM A;  4JSP C;  4O3U B;  4CI1 A;  2XL3 A;  5FKS A;  5IJ7 E;  2HKR A;  2EID A;  2H6K A;  4MMX A;  2EBS A;  3IIY A;  3MKS B;  3MZL A;  3SBR A;  2G99 A;  5I5M A;  3I7L A;  5C92 A;  5GMK n;  2Q7Q A;  2HXC A;  2PM9 A;  2Z2O A;  2YNN A;  2I0T A;  2VDN A;  3CFS B;  2HES X;  4E5Z A;  2I0R A;  1E5T A;  3JZH A;  1U2V C;  4ERZ A;  5FKQ A;  4JSV C;  2CO0 A;  2EIC A;  2CO0 C;  2QXV A;  3OW8 A;  2YMU A;  5IT9 g;  5C86 A;  4OZU A;  4J0W A;  4K3I D;  3EI3 A;  3QI0 A;  3RRM C;  5HE1 B;  5C9Z B;  3EI1 A;  3MKQ A;  4LGN A;  2VDP A;  5EMJ B;  3RFH A;  1GOT B;  3F3P A;  2H6N A;  3OF7 A;  5CYK A;  5I5I A;  3P4F A;  3IJ0 A;  3SMR A;  5M5S A;  1JMX B;  5FXY A;  4I79 A;  5EM2 A;  1R5M A;  1GOH A;  3SCY A;  4U1E I;  3UKU C;  1L0Q A;  3I2N A;  4ES0 A;  4J79 A;  1JJU B;  4JD2 C;  2QR5 A;  3PXW D;  3C9C A;  5EML B;  4R7A B;  2H9N A;  2XYI A;  1JOF A;  1K3I A;  2B4E A;  1QFM A;  2HU5 A;  5GSA A;  4L3H D;  5FFG A;  3EI2 A;  4QL1 A;  3OL2 A;  3OKY A;  2AQ5 A;  2J57 G;  3PVU B;  5TEF A;  3IUJ A;  4PBY A;  2O9K A;  3K71 A;  4TZ4 A;  1NEX B;  1E8N A;  4A0B A;  4JXM A;  3UVN A;  3PVW B;  4D9S A;  3RLM D;  1H2Z A;  2HU7 A;  3AFC A;  2HU8 A;  3I8C A; 
#chains in the Genus database with same CATH homology
 3MMY A;  4A09 A;  1RI6 A;  3SVW D;  3N0D A;  4JSX C;  2P9S C;  2PM9 B;  2H9P A;  3EI4 A;  4FA9 D;  1JMZ B;  4CY1 A;  2B5L A;  4NSX A;  3FGB A;  2I3T A;  1SQJ A;  2H13 A;  5HE0 B;  4AOW A;  2OJY A;  3L4M D;  5CXB A;  5IC7 A;  3EI1 B;  2P9I C;  3IKO A;  2GC7 A;  4ZOX A;  3RSE C;  5CXC A;  3BWS A;  3CFV A;  2PM7 B;  4BL0 A;  3JAM g;  4FA1 D;  4CI8 A;  3PSC B;  5EM2 B;  4QRJ A;  3F3G A;  3AL8 B;  5EAL A;  2IAA A;  3F3F A;  4YVD A;  3UVL A;  3DXK C;  4J84 A;  2TRC B;  5C2V B;  1QNI A;  3B7F A;  3RN0 D;  3CIK B;  5AJA A;  3UR4 A;  3JZG A;  1XKS A;  4A08 B;  4E54 B;  1GXR A;  3EMH A;  3I8E A;  4PSX B;  3SN6 B;  4A7J A;  4A0B B;  5FKT A;  2H14 A;  1SHY B;  3ODT A;  3UVO A;  2HJB A;  4Y7R A;  3UVM A;  5JWZ A;  3EWE A;  4D6V A;  4CY5 A;  1Q47 A;  3RMZ D;  3UVK A;  4J86 A;  1XHM A;  4GQB B;  3OTT A;  3FM0 A;  3J80 g;  2AH0 A;  2IWF A;  3PSL A;  5EMM B;  2B5N A;  3JZN A;  2AGZ A;  4XYH A;  3PE7 A;  2P9U C;  5AMS A;  3I7H A;  2OVQ B;  4J8B A;  4PNK B;  3I89 A;  4ZOV A;  4AEZ A;  5GXH A;  2BCJ B;  3RFG A;  2XL2 A;  4FAV D;  3N0E A;  4J81 A;  4O1Q D;  3GRE A;  4FB1 D;  3KRW B;  4PBZ A;  2AGX A;  4J77 A;  4GM3 A;  3OKW A;  4J87 A;  5H14 A;  2IUP A;  2GNQ A;  1N6E A;  3SXT D;  3I7O A;  2BBK H;  2AH1 A;  4GQ2 P;  4ZOZ A;  4ZOY A;  3IIW A;  3MXX A;  4LG8 A;  2H68 A;  2OK6 A;  4O3T B;  3SLE D;  5K19 A;  3JB9 L;  4L3G D;  4CZV A;  2P9L C;  4X61 B;  3SJL D;  4J0X A;  3C99 A;  4BH6 A;  4Y5R D;  2AGY A;  3V7D B;  1VYH C;  2YNO A;  3DWL C;  3JRO A;  4A11 A;  1PI6 A;  1TBG A;  4J8G A;  3L4O D;  4GGD A;  4E5Z B;  1TYQ C;  3ORV D;  2I0S A;  4FHL A;  3EG6 A;  4U7A A;  2HKM A;  5TDH B;  3JPX A;  2OIZ A;  5KDO B;  4K3J B;  3KRX B;  4IA9 A;  3EI3 B;  2HJ4 A;  1ERJ A;  5EAR A;  4FWW A;  5CYK B;  2GC4 A;  5FLX g;  4GGA A;  4N14 A;  5I5J A;  4JT5 C;  4G56 B;  3A0F A;  2Z2N A;  3K27 A;  1GG2 B;  4PC0 A;  3FRX A;  4GM9 A;  3U4Y A;  2IUV A;  3IJ1 A;  3SHF A;  3PXT D;  3EI2 B;  3UKR C;  3OL2 B;  1K8K C;  3OKY B;  3RN1 D;  2P9P C;  2CE8 A;  3EU7 A;  2YBA A;  1PBY B;  4EWR A;  4D0K A;  2CNX A;  5GXI A;  2UZY B;  4L1Q D;  2QC5 A;  4GGC A;  4CI2 A;  3SWS D;  4PSW B;  4O45 A;  4A09 B;  3BG0 A;  2H9L A;  2UZX B;  4UI9 R;  4OWR A;  3EI4 B;  1OMW B;  2W18 A;  3I7K A;  4A11 B;  3VA6 A;  2Z2P A;  4IMM A;  1MG2 A;  3SFZ A;  4H5I A;  1K32 A;  1MG3 A;  1NR0 A;  5IJ8 E;  4A0A A;  5THA A;  5TEE A;  1MDA H;  5EMK B;  3C5M A;  5CXB B;  2OK4 A;  3AL9 A;  3I7P A;  4Z8L A;  1PEV A;  4ERQ A;  4X3E A;  3GFC A;  5AFU 3;  5CXC B;  2H6Q A;  1B9X A;  4A2M A;  4JT6 C;  5H17 A;  2H3X A;  4ERY A;  2AGW A;  2G9A A;  1SQ9 A;  4PXW A;  4A2L A;  2I3S A;  1A0R B;  1YFQ A;  5FA5 B;  3SBQ A;  3W15 A;  1OLZ A;  5B4W A;  4J82 A;  3ZWL B;  1FWX A;  3NVQ A;  4ZN4 A;  4L9O A;  3DM0 A;  2B5M A;  2YB8 B;  3AL8 A;  2IUR A;  3NVX A;  2YNP A;  3OKT A;  3J81 g;  5HYN B;  2AGL A;  2H9M A;  5H1M A;  5IGO A;  3C75 H;  5SXM A;  4GM8 A;  2IUQ A;  1P22 A;  1N6F A;  4A08 A;  4HDJ A;  4E54 A;  2PM6 B;  5FQD A;  5EAP A;  4CZX A;  4LG9 A;  1PGU A;  2IWK A;  3ULE C;  4A0A B;  3I7N A;  2CN3 A;  5HE2 B;  5A2Q g;  2P9N C;  3V5W B;  3AH8 B;  5TF2 A;  4ESG A;  5HQG A;  1S4U X;  4QQE A;  4KFM B;  3DXM C;  5HE3 B;  4GMB A;  3SBP A;  4CY3 A;  1B9Y A;  5K1C C;  1XIP A;  2P9K C;  3NVN A;  4CY2 A;  1U4C A;  3VH0 A;  2J55 H;  2CN2 A;  4QT8 A;  2MTA H;  4J78 A;  3MZK A;  3DSM A;  4FAN D;  3E0C A;  2XU7 A;  5IGQ A;  4X63 B;  2HYE A;  4BUJ C;  4X60 B;  3V9F A;  5C2W B;  2OVP B;  4GQ1 A;  4J73 A;  4CI3 A;  4XEI C;  4O9D A;  4MK0 B;  3VGZ A;  4FA4 D;  4CC9 A;  3IJC A;  1GP2 B;  2J56 H;  5EAM A;  5FKR A;  4CZY A;  4FA5 D;  2H47 A;  3PXS D;  3JRP A;  3K26 A;  2PBI B;  2CE9 A;  3BG1 A;  4H5J A;  2OVR B;  3HFQ A;  4XYI A;  4GZ8 A;  4JSN C;  1N6D A;  4JSP C;  4O3U B;  4CI1 A;  2XL3 A;  5FKS A;  5IJ7 E;  2HKR A;  2H6K A;  2EBS A;  3IIY A;  3MKS B;  3MZL A;  3SBR A;  2G99 A;  5I5M A;  3I7L A;  5GMK n;  2Q7Q A;  2HXC A;  2PM9 A;  2Z2O A;  2YNN A;  2I0T A;  3CFS B;  2HES X;  4E5Z A;  2I0R A;  3JZH A;  1U2V C;  4ERZ A;  5FKQ A;  4JSV C;  2CO0 A;  2CO0 C;  2QXV A;  3OW8 A;  2YMU A;  5IT9 g;  4OZU A;  4J0W A;  4K3I D;  3EI3 A;  3RRM C;  5HE1 B;  5C9Z B;  3EI1 A;  3MKQ A;  4LGN A;  5EMJ B;  3RFH A;  1GOT B;  3F3P A;  2H6N A;  5CYK A;  5I5I A;  3P4F A;  3IJ0 A;  3SMR A;  1JMX B;  5FXY A;  4I79 A;  5EM2 A;  1R5M A;  3SCY A;  4U1E I;  3UKU C;  1L0Q A;  3I2N A;  4ES0 A;  4J79 A;  1JJU B;  4JD2 C;  3PXW D;  3C9C A;  5EML B;  4R7A B;  2H9N A;  2XYI A;  1JOF A;  2B4E A;  5GSA A;  4L3H D;  3EI2 A;  4QL1 A;  3OL2 A;  3OKY A;  2AQ5 A;  2J57 G;  3PVU B;  5TEF A;  4PBY A;  2O9K A;  4TZ4 A;  1NEX B;  4A0B A;  4JXM A;  3UVN A;  3PVW B;  3RLM D;  3AFC A;  3I8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...