3RFHA

Crystal structure of the yeast rack1 dimer in space group p21
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
315
structure length
291
Chain Sequence
SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSAAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
publication title Structure of the RACK1 dimer from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 67
structure length 291
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rfhA00
4J84A 1XKSA 4Y7RA 5IT9g 4ZOYA 4CY5A 4A08B 1GXRA 4CI3A 3SVWD 5AJAA 4G56B 4I79A 4D6VA 3RSEC 4CY2A 1QNIA 3I7HA 2H9NA 1R5MA 3N0EA 2IUPA 2IUVA 3I7NA 5K1CC 3RN1D 5H14A 1GG2B 5IJ8E 4J8GA 4FB1D 4JSVC 3N0DA 3PSCB 4H5JA 2Z2PA 1NR0A 4A7JA 4L9OA 5K19A 2QC5A 3SCYA 3EI2A 3CFVA 2H68A 2P9NC 5HE1B 2UZYB 1JJUB 5FKRA 4CZXA 3NVXA 2AGWA 3UKRC 3ULEC 4PBYA 4CC9A 4FWWA 2GC7A 2I0RA 2YNOA 2G9AA 3W15A 2IURA 1JOFA 3KRWB 3EG6A 2H6KA 3V7DB 1VYHC 3NVNA 2YMUA 3JPXA 3I8CA 3MKQA 4ERZA 2BBKH 2OK6A 1P22A 4IMMA 4CZVA 4R7AB 3IJ1A 5FKQA 2PM9A 4GGAA 3UVNA 3E0CA 3OL2A 4GQBB 5EMLB 2H6QA 3EI3A 1SQJA 1TYQC 2Q7QA 3ZWLB 2B5NA 4JT5C 1N6DA 4UI9R 4FAVD 3L4OD 2B4EA 4BUJC 4ESGA 4A0BB 4K3JB 3MMYA 4OZUA 3EU7A 5FQDA 5JWZA 3RFHA 3EI1A 3OKYA 3PE7A 2UZXB 3GREA 3DM0A 4JSXC 4XYHA 2OVQB 4E5ZA 2EBSA 5FKTA 3SBPA 4E54A 4A11B 2P9IC 4QL1A 1L0QA 5EARA 3JROA 3AL9A 3ORVD 1Q47A 2MTAH 3SBRA 5C2WB 5EAPA 2CE9A 5CXCB 5IGQA 2AGXA 1MDAH 4BH6A 4H5IA 5FKSA 2I3SA 4PXWA 3JAMg 5EMMB 3L4MD 3DSMA 2H13A 4GZ8A 3RRMC 3C99A 4CI2A 3K27A 1RI6A 3GFCA 3PXSD 5A2Qg 2J55H 3C75H 4MK0B 5TDHB 4J82A 4CY1A 2G99A 3JRPA 4A08A 4JT6C 5IC7A 3UVLA 1NEXB 3OW8A 2CO0C 4XEIC 2HKRA 3DXKC 3EI4A 4A0AB 5CYKB 3UVKA 4A2LA 5CXBB 4X61B 3NVQA 3V5WB 2H47A 4GMBA 4ZOVA 5HE2B 4CI1A 4O45A 1PEVA 4PSXB 3VGZA 3F3PA 3PVWB 5I5IA 3B7FA 2I0SA 2IAAA 2AH1A 2IUQA 5TEFA 3MZKA 4K3ID 2PM7B 4QQEA 3FRXA 4J78A 5IJ7E 4GM9A 2GNQA 2OVRB 3UVMA 4J86A 5I5MA 3FM0A 2HYEA 4LGNA 3FGBA 1A0RB 2YNPA 4KFMB 3SWSD 5GXIA 2XL3A 2IWKA 4BL0A 5I5JA 2BCJB 2YNNA 1K8KC 4IA9A 2OIZA 4CI8A 2AGYA 5TEEA 3C9CA 3I7LA 4D0KA 2HXCA 3EMHA 3MKSB 3CIKB 1FWXA 2O9KA 4L3GD 3I7OA 3SJLD 1TBGA 4ES0A 3JZNA 4X60B 2OJYA 4J81A 3U4YA 2CE8A 5FA5B 4J77A 4A0BA 2CO0A 4Z8LA 5H1MA 2PM9B 4TZ4A 4FA9D 3AH8B 3V9FA 3OL2B 3K26A 4PC0A 3EI3B 3I8EA 2H9PA 5EM2A 4ERYA 4ZOXA 4ZOZA 4A11A 4A09A 4QRJA 4OWRA 2I3TA 2XU7A 3UKUC 4GM8A 5FLXg 3RN0D 4FAND 4EWRA 2J56H 3P4FA 2GC4A 3OKYB 4N14A 4HDJA 3AL8A 5CXCA 3I2NA 3C5MA 4FA1D 1N6EA 3JZGA 3VA6A 2AH0A 4E54B 3VH0A 1U4CA 2P9SC 4J0XA 1GOTB 4O1QD 2HJ4A 3PXWD 3UVOA 4FA4D 5C2VB 1JMZB 5GMKn 2AGLA 3JB9L 3F3GA 3I7KA 2OK4A 5HE0B 5TF2A 4O9DA 3KRXB 3ODTA 2IWFA 4O3TB 4A0AA 3SN6B 2OVPB 4J8BA 2CNXA 3CFSB 1S4UX 3BG0A 2P9KC 2PM6B 3DXMC 2CN2A 3IIYA 1ERJA 2YBAA 3I89A 2HESX 2QXVA 5KDOB 1OMWB 5H17A 2AGZA 4L1QD 3EI4B 4AOWA 3IIWA 3HFQA 4QT8A 4NSXA 4LG8A 3PSLA 4PSWB 4X3EA 2YB8B 2XL2A 2B5LA 4PBZA 5C9ZB 3OKTA 3EI2B 2W18A 3BG1A 5EALA 2P9LC 1PI6A 4JXMA 2H6NA 1MG3A 3MZLA 4GGCA 5HQGA 3OKWA 5HE3B 2AQ5A 3BWSA 4J79A 2P9PC 3RLMD 2PBIB 2HKMA 2P9UC 4JSPC 3RMZD 1PGUA 1MG2A 3OTTA 2H14A 1B9XA 1XHMA 2Z2OA 1U2VC 4J73A 5AMSA 4U1EI 5FXYA 4U7AA 3DWLC 3A0FA 1OLZA 5SXMA 3IJCA 4XYIA 3JZHA 4ZN4A 1B9YA 2I0TA 4O3UB 3IJ0A 3PXTD 3J81g 3SLED 3RFGA 4GQ2P 4J0WA 4JD2C 3SMRA 2Z2NA 2J57G 5THAA 2HJBA 2XYIA 2CN3A 4YVDA 3AFCA 2H3XA 3EI1B 5HYNB 4ERQA 3UR4A 1SQ9A 1XIPA 4GQ1A 3EWEA 1JMXB 4E5ZB 5EM2B 5GSAA 3J80g 4L3HD 1K32A 1YFQA 4A09B 4CY3A 3I7PA 2H9MA 1N6FA 2B5MA 4Y5RD 5EMKB 4FA5D 2H9LA 4X63B 4LG9A 5EMJB 4JSNC 4GGDA 1SHYB 2TRCB 3AL8B 4GM3A 3SXTD 3F3FA 4AEZA 4PNKB 5GXHA 3MXXA 3SFZA 1PBYB 5B4WA 5CYKA 3SHFA 5AFU3 5EAMA 3PVUB 5CXBA 1GP2B 5IGOA 3IKOA 4A2MA 4FHLA 4J87A 3SBQA 4CZYA
chains in the Genus database with same CATH superfamily
4J84A 1XKSA 4Y7RA 5IT9g 4ZOYA 1H2WA 2QR5A 4CY5A 4A08B 1GXRA 4CI3A 3SVWD 5AJAA 4G56B 1O6GA 4I79A 4D6VA 3RSEC 4CY2A 1QNIA 3I7HA 2H9NA 1R5MA 3N0EA 2IUPA 2IUVA 3I7NA 5K1CC 3RN1D 5H14A 1GG2B 5IJ8E 4J8GA 4IRZA 4G1EA 4FB1D 4JSVC 3N0DA 3PSCB 3IVMA 5M5VA 4H5JA 2Z2PA 1NR0A 4A7JA 4L9OA 3IJEA 5K19A 2QC5A 3SCYA 3EI2A 3CFVA 2H68A 2P9NC 5HE1B 2UZYB 1JJUB 5FKRA 4CZXA 3NVXA 2AGWA 3UKRC 3ULEC 1GOHA 4PBYA 4CC9A 4FWWA 2GC7A 2I0RA 2YNOA 4BCCA 2G9AA 3W15A 2IURA 3GD1I 1JOFA 3KRWB 3EG6A 3IURA 2H6KA 4WK2A 3V7DB 2XDWA 1VYHC 3NVNA 2YMUA 3JPXA 3FCSA 3I8CA 4Z7OA 3MKQA 4NC4A 4ERZA 3T3MA 2BBKH 2OK6A 1H2XA 5FFOA 1P22A 4IMMA 4CZVA 1E8MA 3ZE1A 4R7AB 3IJ1A 5FKQA 2PM9A 4GGAA 4BP8A 3UVNA 3E0CA 3OL2A 2VDLA 4GQBB 5EMLB 1O6FA 2H6QA 4UM9A 3EI3A 1SQJA 1TYQC 5M5SA 2Q7QA 3V4VA 3ZWLB 2B5NA 3O4GA 4G55A 3K71A 4JT5C 3GC3B 1N6DA 3VI3A 3EQ7A 4UI9R 4FAVD 3L4OD 2B4EA 4BUJC 4ESGA 4A0BB 4K3JB 3MMYA 3ZDXA 4OZUA 4QAMA 3EU7A 5FQDA 5JWZA 3RFHA 3EI1A 3OKYA 3PE7A 3ZDYA 3IUQA 2UZXB 3GREA 3DM0A 4JSXC 4XYHA 2OVQB 4E5ZA 2EBSA 5FKTA 3SBPA 5HDBA 4E54A 4A11B 2P9IC 4QL1A 1L0QA 5EARA 4AN0A 3JROA 3AL9A 1H2ZA 3ORVD 1Q47A 2MTAH 3SBRA 5C2WB 5EAPA 2CE9A 4AMZA 5CXCB 5IGQA 2AGXA 1MDAH 2HU5A 4BH6A 4H5IA 5FKSA 2I3SA 4PXWA 1VE6A 2HU7A 3JAMg 5EMMB 3L4MD 3DSMA 2H13A 4GZ8A 3RRMC 3C99A 4CI2A 3K27A 1RI6A 1VZ2A 3GFCA 3PXSD 5A2Qg 1JTDB 5C86A 2J55H 3C75H 4MK0B 5TDHB 4J82A 4CY1A 2G99A 3JRPA 4A08A 4JT6C 5IC7A 3UVLA 3EQ8A 1NEXB 3OW8A 2CO0C 4XEIC 2HKRA 3DXKC 3EI4A 4Z7NA 4A0AB 5E6UA 5CYKB 3UVKA 4A2LA 5CXBB 4X61B 2VDMA 3NVQA 2H47A 3V5WB 4GMBA 4ZOVA 5HE2B 4CI1A 4AX4A 4O45A 1PEVA 4PSXB 3VGZA 3F3PA 3PVWB 5I5IA 3B7FA 5M61A 2I0SA 2VZ1A 2IAAA 2AH1A 2IUQA 5TEFA 3MZKA 2VDOA 4K3ID 2PM7B 4QQEA 3FRXA 4J78A 1U8CA 3ZE0A 5IJ7E 4GM9A 2GNQA 2OVRB 3UVMA 4J86A 5I5MA 3FM0A 3EQ9A 2HYEA 4LGNA 3FGBA 5FFGA 1A0RB 2YNPA 4KFMB 3SWSD 5GXIA 4G1MA 3T3PA 2XL3A 2IWKA 4BL0A 4RE5A 1GOGA 5I5JA 2BCJB 2YNNA 1K8KC 1E8NA 3OF7A 4IA9A 1QFMA 2OIZA 4CI8A 4O2WA 2AGYA 5TEEA 3C9CA 3I7LA 4D0KA 2HXCA 3EMHA 3MKSB 3CIKB 1FWXA 2O9KA 4L3GD 3I7OA 2EIBA 1TBGA 3SJLD 1VZ3A 4ES0A 3JZNA 4X60B 1UOOA 1L5GA 2OJYA 4J81A 3U4YA 2CE8A 5FA5B 4J77A 1YR2A 4AMYA 4A0BA 2CO0A 4Z8LA 5H1MA 2PM9B 4TZ4A 4FA9D 3IUJA 3AH8B 3V9FA 3OL2B 3K26A 4PC0A 3EI3B 3NIGA 3I8EA 2H9PA 5EM2A 3ZE2A 4ERYA 2XE4A 4ZOXA 4ZOZA 4A11A 4A09A 4QRJA 5M5TA 4OWRA 2I3TA 2XU7A 3UKUC 4DNVA 4GM8A 5FLXg 3RN0D 3MUNA 4EWRA 4FAND 5M5RA 2J56H 4NBMA 3P4FA 2XZGA 2GC4A 3OKYB 4AN1A 4N14A 2BKLA 3FCUA 4NENA 4HDJA 3AL8A 5CXCA 2EIDA 3I2NA 3C5MA 4FA1D 1N6EA 3JZGA 3VA6A 2AH0A 4E54B 3VH0A 1U4CA 2P9SC 4J0XA 4MMZA 1GOTB 4O1QD 1K3IA 1E5TA 5C92A 2HJ4A 3O4HA 3PXWD 3UVOA 4FA4D 5C2VB 2VDPA 1JMZB 5GMKn 2AGLA 3JB9L 3F3GA 3I7KA 2OK4A 3IUMA 5HE0B 5TF2A 4DNUA 4O9DA 3IULA 3KRXB 4DNWA 3ODTA 2IWFA 4O3TB 4A0AA 3SN6B 1T2XA 2OVPB 4J8BA 2CNXA 3CFSB 1S4UX 3BG0A 2P9KC 2PM6B 3O4IA 3DXMC 2CN2A 2JKXA 3IIYA 1ERJA 4L1MA 2YBAA 3I89A 2HESX 2QXVA 5KDOB 1OMWB 5H17A 4J87A 2AGZA 4L1QD 3K6SA 3EI4B 4AOWA 3IIWA 4WK4A 3HFQA 3DDUA 4QT8A 4NSXA 4LG8A 3PSLA 4PSWB 4X3EA 2YB8B 4BP9A 2XL2A 2B5LA 4PBZA 5C9ZB 3OKTA 4D9SA 3EI2B 2W18A 3BG1A 1UOPA 3O4JA 5E6RA 5EALA 2P9LC 1PI6A 4MMYA 4JXMA 3VI4A 1UOQA 3KCIA 4NAAA 1MG3A 3MZLA 4GGCA 5M5UA 5HQGA 3OKWA 5HE3B 2AQ5A 4JHPC 3BWSA 4J79A 2P9PC 3RLMD 2PBIB 2HKMA 2P9UC 1TYEA 3ZDZA 2VZ3A 4JSPC 3RMZD 1PGUA 1QFSA 1MG2A 3OTTA 2H14A 3QHYB 1B9XA 1XHMA 2Z2OA 1C9LA 2VDKA 1U2VC 4WJKA 4J73A 5AMSA 4U1EI 5FXYA 4U7AA 3DWLC 4UM8A 3IUNA 1A12A 2EIEA 3A0FA 1OLZA 5SXMA 3IJCA 4XYIA 2HU8A 3JZHA 4RE6A 4ZN4A 1B9YA 2I0TA 3K72A 4WK0A 5E6SA 4O3UB 3IJ0A 3PXTD 3J81g 3SLED 3RFGA 4GQ2P 4J0WA 4JD2C 1BPOA 3SMRA 4JHNA 2QZPA 2Z2NA 2J57G 5THAA 2HJBA 2XYIA 2CN3A 4YVDA 3AFCA 2H3XA 3EI1B 4Z7QA 4ERQA 5HYNB 3UR4A 1SQ9A 2WQ8A 1XIPA 4GQ1A 3EWEA 1JMXB 1M1XA 4E5ZB 5EM2B 5GSAA 3J80g 4L3HD 1K32A 1YFQA 4A09B 2VDNA 4CY3A 2EICA 2VDRA 3I7PA 2H9MA 4O02A 1N6FA 2B5MA 2VDQA 4Y5RD 5EMKB 1VE7A 2VC2A 4FA5D 2H9LA 4X63B 4LG9A 4BCDA 1JV2A 5EMJB 3V4PA 4JSNC 4GGDA 1SHYB 1I2MB 2TRCB 3AL8B 3QI0A 1H2YA 4GM3A 3SXTD 3F3FA 4AEZA 3NIDA 4PNKB 4BCBA 1C9IA 5GXHA 3MXXA 1GOFA 4MMXA 1PBYB 3MUOA 5CYKA 5B4WA 3SHFA 3SFZA 5AFU3 5EAMA 3PVUB 5CXBA 1GP2B 5IGOA 1UTCA 3IKOA 3NIFA 4A2MA 4FHLA 3MVDK 2H6NA 3SBQA 4CZYA
chains in the Genus database with same CATH topology
4J84A 1XKSA 4Y7RA 5IT9g 4ZOYA 4CY5A 4A08B 1GXRA 4CI3A 3SVWD 5AJAA 4G56B 4I79A 4D6VA 3RSEC 4CY2A 1QNIA 3I7HA 2H9NA 1R5MA 3N0EA 2IUPA 2IUVA 3I7NA 5K1CC 3RN1D 5H14A 1GG2B 5IJ8E 4J8GA 4FB1D 4JSVC 3N0DA 3PSCB 4H5JA 2Z2PA 1NR0A 4A7JA 4L9OA 5K19A 2QC5A 3SCYA 3EI2A 3CFVA 2H68A 2P9NC 5HE1B 2UZYB 1JJUB 5FKRA 4CZXA 3NVXA 2AGWA 3UKRC 3ULEC 4PBYA 4CC9A 4FWWA 2GC7A 2I0RA 2YNOA 2G9AA 3W15A 2IURA 1JOFA 3KRWB 3EG6A 2H6KA 3V7DB 1VYHC 3NVNA 2YMUA 3JPXA 3I8CA 3MKQA 4ERZA 2BBKH 2OK6A 1P22A 4IMMA 4CZVA 4R7AB 3IJ1A 5FKQA 2PM9A 4GGAA 3UVNA 3E0CA 3OL2A 4GQBB 5EMLB 2H6QA 3EI3A 1SQJA 1TYQC 2Q7QA 3ZWLB 2B5NA 4JT5C 1N6DA 4UI9R 4FAVD 3L4OD 2B4EA 4BUJC 4ESGA 4A0BB 4K3JB 3MMYA 4OZUA 3EU7A 5FQDA 5JWZA 3RFHA 3EI1A 3OKYA 3PE7A 2UZXB 3GREA 3DM0A 4JSXC 4XYHA 2OVQB 4E5ZA 2EBSA 5FKTA 3SBPA 4E54A 4A11B 2P9IC 4QL1A 1L0QA 5EARA 3JROA 3AL9A 3ORVD 1Q47A 2MTAH 3SBRA 5C2WB 5EAPA 2CE9A 5CXCB 5IGQA 2AGXA 1MDAH 4BH6A 4H5IA 5FKSA 2I3SA 4PXWA 3JAMg 5EMMB 3L4MD 3DSMA 2H13A 4GZ8A 3RRMC 3C99A 4CI2A 3K27A 1RI6A 3GFCA 3PXSD 5A2Qg 2J55H 3C75H 4MK0B 5TDHB 4J82A 4CY1A 2G99A 3JRPA 4A08A 4JT6C 5IC7A 3UVLA 1NEXB 3OW8A 2CO0C 4XEIC 2HKRA 3DXKC 3EI4A 4A0AB 5CYKB 3UVKA 4A2LA 5CXBB 4X61B 3NVQA 3V5WB 2H47A 4GMBA 4ZOVA 5HE2B 4CI1A 4O45A 1PEVA 4PSXB 3VGZA 3F3PA 3PVWB 5I5IA 3B7FA 2I0SA 2IAAA 2AH1A 2IUQA 5TEFA 3MZKA 4K3ID 2PM7B 4QQEA 3FRXA 4J78A 5IJ7E 4GM9A 2GNQA 2OVRB 3UVMA 4J86A 5I5MA 3FM0A 2HYEA 4LGNA 3FGBA 1A0RB 2YNPA 4KFMB 3SWSD 5GXIA 2XL3A 2IWKA 4BL0A 5I5JA 2BCJB 2YNNA 1K8KC 4IA9A 2OIZA 4CI8A 2AGYA 5TEEA 3C9CA 3I7LA 4D0KA 2HXCA 3EMHA 3MKSB 3CIKB 1FWXA 2O9KA 4L3GD 3I7OA 3SJLD 1TBGA 4ES0A 3JZNA 4X60B 2OJYA 4J81A 3U4YA 2CE8A 5FA5B 4J77A 4A0BA 2CO0A 4Z8LA 5H1MA 2PM9B 4TZ4A 4FA9D 3AH8B 3V9FA 3OL2B 3K26A 4PC0A 3EI3B 3I8EA 2H9PA 5EM2A 4ERYA 4ZOXA 4ZOZA 4A11A 4A09A 4QRJA 4OWRA 2I3TA 2XU7A 3UKUC 4GM8A 5FLXg 3RN0D 4FAND 4EWRA 2J56H 3P4FA 2GC4A 3OKYB 4N14A 4HDJA 3AL8A 5CXCA 3I2NA 3C5MA 4FA1D 1N6EA 3JZGA 3VA6A 2AH0A 4E54B 3VH0A 1U4CA 2P9SC 4J0XA 1GOTB 4O1QD 2HJ4A 3PXWD 3UVOA 4FA4D 5C2VB 1JMZB 5GMKn 2AGLA 3JB9L 3F3GA 3I7KA 2OK4A 5HE0B 5TF2A 4O9DA 3KRXB 3ODTA 2IWFA 4O3TB 4A0AA 3SN6B 2OVPB 4J8BA 2CNXA 3CFSB 1S4UX 3BG0A 2P9KC 2PM6B 3DXMC 2CN2A 3IIYA 1ERJA 2YBAA 3I89A 2HESX 2QXVA 5KDOB 1OMWB 5H17A 2AGZA 4L1QD 3EI4B 4AOWA 3IIWA 3HFQA 4QT8A 4NSXA 4LG8A 3PSLA 4PSWB 4X3EA 2YB8B 2XL2A 2B5LA 4PBZA 5C9ZB 3OKTA 3EI2B 2W18A 3BG1A 5EALA 2P9LC 1PI6A 4JXMA 2H6NA 1MG3A 3MZLA 4GGCA 5HQGA 3OKWA 5HE3B 2AQ5A 3BWSA 4J79A 2P9PC 3RLMD 2PBIB 2HKMA 2P9UC 4JSPC 3RMZD 1PGUA 1MG2A 3OTTA 2H14A 1B9XA 1XHMA 2Z2OA 1U2VC 4J73A 5AMSA 4U1EI 5FXYA 4U7AA 3DWLC 3A0FA 1OLZA 5SXMA 3IJCA 4XYIA 3JZHA 4ZN4A 1B9YA 2I0TA 4O3UB 3IJ0A 3PXTD 3J81g 3SLED 3RFGA 4GQ2P 4J0WA 4JD2C 3SMRA 2Z2NA 2J57G 5THAA 2HJBA 2XYIA 2CN3A 4YVDA 3AFCA 2H3XA 3EI1B 5HYNB 4ERQA 3UR4A 1SQ9A 1XIPA 4GQ1A 3EWEA 1JMXB 4E5ZB 5EM2B 5GSAA 3J80g 4L3HD 1K32A 1YFQA 4A09B 4CY3A 3I7PA 2H9MA 1N6FA 2B5MA 4Y5RD 5EMKB 4FA5D 2H9LA 4X63B 4LG9A 5EMJB 4JSNC 4GGDA 1SHYB 2TRCB 3AL8B 4GM3A 3SXTD 3F3FA 4AEZA 4PNKB 5GXHA 3MXXA 3SFZA 1PBYB 5B4WA 5CYKA 3SHFA 5AFU3 5EAMA 3PVUB 5CXBA 1GP2B 5IGOA 3IKOA 4A2MA 4FHLA 4J87A 3SBQA 4CZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J84 A;  1XKS A;  4Y7R A;  5IT9 g;  4ZOY A;  4CY5 A;  4A08 B;  1GXR A;  4CI3 A;  3SVW D;  5AJA A;  4G56 B;  4I79 A;  4D6V A;  3RSE C;  4CY2 A;  1QNI A;  3I7H A;  2H9N A;  1R5M A;  3N0E A;  2IUP A;  2IUV A;  3I7N A;  5K1C C;  3RN1 D;  5H14 A;  1GG2 B;  5IJ8 E;  4J8G A;  4FB1 D;  4JSV C;  3N0D A;  3PSC B;  4H5J A;  2Z2P A;  1NR0 A;  4A7J A;  4L9O A;  5K19 A;  2QC5 A;  3SCY A;  3EI2 A;  3CFV A;  2H68 A;  2P9N C;  5HE1 B;  2UZY B;  1JJU B;  5FKR A;  4CZX A;  3NVX A;  2AGW A;  3UKR C;  3ULE C;  4PBY A;  4CC9 A;  4FWW A;  2GC7 A;  2I0R A;  2YNO A;  2G9A A;  3W15 A;  2IUR A;  1JOF A;  3KRW B;  3EG6 A;  2H6K A;  3V7D B;  1VYH C;  3NVN A;  2YMU A;  3JPX A;  3I8C A;  3MKQ A;  4ERZ A;  2BBK H;  2OK6 A;  1P22 A;  4IMM A;  4CZV A;  4R7A B;  3IJ1 A;  5FKQ A;  2PM9 A;  4GGA A;  3UVN A;  3E0C A;  3OL2 A;  4GQB B;  5EML B;  2H6Q A;  3EI3 A;  1SQJ A;  1TYQ C;  2Q7Q A;  3ZWL B;  2B5N A;  4JT5 C;  1N6D A;  4UI9 R;  4FAV D;  3L4O D;  2B4E A;  4BUJ C;  4ESG A;  4A0B B;  4K3J B;  3MMY A;  4OZU A;  3EU7 A;  5FQD A;  5JWZ A;  3RFH A;  3EI1 A;  3OKY A;  3PE7 A;  2UZX B;  3GRE A;  3DM0 A;  4JSX C;  4XYH A;  2OVQ B;  4E5Z A;  2EBS A;  5FKT A;  3SBP A;  4E54 A;  4A11 B;  2P9I C;  4QL1 A;  1L0Q A;  5EAR A;  3JRO A;  3AL9 A;  3ORV D;  1Q47 A;  2MTA H;  3SBR A;  5C2W B;  5EAP A;  2CE9 A;  5CXC B;  5IGQ A;  2AGX A;  1MDA H;  4BH6 A;  4H5I A;  5FKS A;  2I3S A;  4PXW A;  3JAM g;  5EMM B;  3L4M D;  3DSM A;  2H13 A;  4GZ8 A;  3RRM C;  3C99 A;  4CI2 A;  3K27 A;  1RI6 A;  3GFC A;  3PXS D;  5A2Q g;  2J55 H;  3C75 H;  4MK0 B;  5TDH B;  4J82 A;  4CY1 A;  2G99 A;  3JRP A;  4A08 A;  4JT6 C;  5IC7 A;  3UVL A;  1NEX B;  3OW8 A;  2CO0 C;  4XEI C;  2HKR A;  3DXK C;  3EI4 A;  4A0A B;  5CYK B;  3UVK A;  4A2L A;  5CXB B;  4X61 B;  3NVQ A;  3V5W B;  2H47 A;  4GMB A;  4ZOV A;  5HE2 B;  4CI1 A;  4O45 A;  1PEV A;  4PSX B;  3VGZ A;  3F3P A;  3PVW B;  5I5I A;  3B7F A;  2I0S A;  2IAA A;  2AH1 A;  2IUQ A;  5TEF A;  3MZK A;  4K3I D;  2PM7 B;  4QQE A;  3FRX A;  4J78 A;  5IJ7 E;  4GM9 A;  2GNQ A;  2OVR B;  3UVM A;  4J86 A;  5I5M A;  3FM0 A;  2HYE A;  4LGN A;  3FGB A;  1A0R B;  2YNP A;  4KFM B;  3SWS D;  5GXI A;  2XL3 A;  2IWK A;  4BL0 A;  5I5J A;  2BCJ B;  2YNN A;  1K8K C;  4IA9 A;  2OIZ A;  4CI8 A;  2AGY A;  5TEE A;  3C9C A;  3I7L A;  4D0K A;  2HXC A;  3EMH A;  3MKS B;  3CIK B;  1FWX A;  2O9K A;  4L3G D;  3I7O A;  3SJL D;  1TBG A;  4ES0 A;  3JZN A;  4X60 B;  2OJY A;  4J81 A;  3U4Y A;  2CE8 A;  5FA5 B;  4J77 A;  4A0B A;  2CO0 A;  4Z8L A;  5H1M A;  2PM9 B;  4TZ4 A;  4FA9 D;  3AH8 B;  3V9F A;  3OL2 B;  3K26 A;  4PC0 A;  3EI3 B;  3I8E A;  2H9P A;  5EM2 A;  4ERY A;  4ZOX A;  4ZOZ A;  4A11 A;  4A09 A;  4QRJ A;  4OWR A;  2I3T A;  2XU7 A;  3UKU C;  4GM8 A;  5FLX g;  3RN0 D;  4FAN D;  4EWR A;  2J56 H;  3P4F A;  2GC4 A;  3OKY B;  4N14 A;  4HDJ A;  3AL8 A;  5CXC A;  3I2N A;  3C5M A;  4FA1 D;  1N6E A;  3JZG A;  3VA6 A;  2AH0 A;  4E54 B;  3VH0 A;  1U4C A;  2P9S C;  4J0X A;  1GOT B;  4O1Q D;  2HJ4 A;  3PXW D;  3UVO A;  4FA4 D;  5C2V B;  1JMZ B;  5GMK n;  2AGL A;  3JB9 L;  3F3G A;  3I7K A;  2OK4 A;  5HE0 B;  5TF2 A;  4O9D A;  3KRX B;  3ODT A;  2IWF A;  4O3T B;  4A0A A;  3SN6 B;  2OVP B;  4J8B A;  2CNX A;  3CFS B;  1S4U X;  3BG0 A;  2P9K C;  2PM6 B;  3DXM C;  2CN2 A;  3IIY A;  1ERJ A;  2YBA A;  3I89 A;  2HES X;  2QXV A;  5KDO B;  1OMW B;  5H17 A;  2AGZ A;  4L1Q D;  3EI4 B;  4AOW A;  3IIW A;  3HFQ A;  4QT8 A;  4NSX A;  4LG8 A;  3PSL A;  4PSW B;  4X3E A;  2YB8 B;  2XL2 A;  2B5L A;  4PBZ A;  5C9Z B;  3OKT A;  3EI2 B;  2W18 A;  3BG1 A;  5EAL A;  2P9L C;  1PI6 A;  4JXM A;  2H6N A;  1MG3 A;  3MZL A;  4GGC A;  5HQG A;  3OKW A;  5HE3 B;  2AQ5 A;  3BWS A;  4J79 A;  2P9P C;  3RLM D;  2PBI B;  2HKM A;  2P9U C;  4JSP C;  3RMZ D;  1PGU A;  1MG2 A;  3OTT A;  2H14 A;  1B9X A;  1XHM A;  2Z2O A;  1U2V C;  4J73 A;  5AMS A;  4U1E I;  5FXY A;  4U7A A;  3DWL C;  3A0F A;  1OLZ A;  5SXM A;  3IJC A;  4XYI A;  3JZH A;  4ZN4 A;  1B9Y A;  2I0T A;  4O3U B;  3IJ0 A;  3PXT D;  3J81 g;  3SLE D;  3RFG A;  4GQ2 P;  4J0W A;  4JD2 C;  3SMR A;  2Z2N A;  2J57 G;  5THA A;  2HJB A;  2XYI A;  2CN3 A;  4YVD A;  3AFC A;  2H3X A;  3EI1 B;  5HYN B;  4ERQ A;  3UR4 A;  1SQ9 A;  1XIP A;  4GQ1 A;  3EWE A;  1JMX B;  4E5Z B;  5EM2 B;  5GSA A;  3J80 g;  4L3H D;  1K32 A;  1YFQ A;  4A09 B;  4CY3 A;  3I7P A;  2H9M A;  1N6F A;  2B5M A;  4Y5R D;  5EMK B;  4FA5 D;  2H9L A;  4X63 B;  4LG9 A;  5EMJ B;  4JSN C;  4GGD A;  1SHY B;  2TRC B;  3AL8 B;  4GM3 A;  3SXT D;  3F3F A;  4AEZ A;  4PNK B;  5GXH A;  3MXX A;  3SFZ A;  1PBY B;  5B4W A;  5CYK A;  3SHF A;  5AFU 3;  5EAM A;  3PVU B;  5CXB A;  1GP2 B;  5IGO A;  3IKO A;  4A2M A;  4FHL A;  4J87 A;  3SBQ A;  4CZY A; 
#chains in the Genus database with same CATH topology
 4J84 A;  1XKS A;  4Y7R A;  5IT9 g;  4ZOY A;  1H2W A;  2QR5 A;  4CY5 A;  4A08 B;  1GXR A;  4CI3 A;  3SVW D;  5AJA A;  4G56 B;  1O6G A;  4I79 A;  4D6V A;  3RSE C;  4CY2 A;  1QNI A;  3I7H A;  2H9N A;  1R5M A;  3N0E A;  2IUP A;  2IUV A;  3I7N A;  5K1C C;  3RN1 D;  5H14 A;  1GG2 B;  5IJ8 E;  4J8G A;  4IRZ A;  4G1E A;  4FB1 D;  4JSV C;  3N0D A;  3PSC B;  3IVM A;  5M5V A;  4H5J A;  2Z2P A;  1NR0 A;  4A7J A;  4L9O A;  3IJE A;  5K19 A;  2QC5 A;  3SCY A;  3EI2 A;  3CFV A;  2H68 A;  2P9N C;  5HE1 B;  2UZY B;  1JJU B;  5FKR A;  4CZX A;  3NVX A;  2AGW A;  3UKR C;  3ULE C;  1GOH A;  4PBY A;  4CC9 A;  4FWW A;  2GC7 A;  2I0R A;  2YNO A;  4BCC A;  2G9A A;  3W15 A;  2IUR A;  3GD1 I;  1JOF A;  3KRW B;  3EG6 A;  3IUR A;  2H6K A;  4WK2 A;  3V7D B;  2XDW A;  1VYH C;  3NVN A;  2YMU A;  3JPX A;  3FCS A;  3I8C A;  4Z7O A;  3MKQ A;  4NC4 A;  4ERZ A;  3T3M A;  2BBK H;  2OK6 A;  1H2X A;  5FFO A;  1P22 A;  4IMM A;  4CZV A;  1E8M A;  3ZE1 A;  4R7A B;  3IJ1 A;  5FKQ A;  2PM9 A;  4GGA A;  4BP8 A;  3UVN A;  3E0C A;  3OL2 A;  2VDL A;  4GQB B;  5EML B;  1O6F A;  2H6Q A;  4UM9 A;  3EI3 A;  1SQJ A;  1TYQ C;  5M5S A;  2Q7Q A;  3V4V A;  3ZWL B;  2B5N A;  3O4G A;  4G55 A;  3K71 A;  4JT5 C;  3GC3 B;  1N6D A;  3VI3 A;  3EQ7 A;  4UI9 R;  4FAV D;  3L4O D;  2B4E A;  4BUJ C;  4ESG A;  4A0B B;  4K3J B;  3MMY A;  3ZDX A;  4OZU A;  4QAM A;  3EU7 A;  5FQD A;  5JWZ A;  3RFH A;  3EI1 A;  3OKY A;  3PE7 A;  3ZDY A;  3IUQ A;  2UZX B;  3GRE A;  3DM0 A;  4JSX C;  4XYH A;  2OVQ B;  4E5Z A;  2EBS A;  5FKT A;  3SBP A;  5HDB A;  4E54 A;  4A11 B;  2P9I C;  4QL1 A;  1L0Q A;  5EAR A;  4AN0 A;  3JRO A;  3AL9 A;  1H2Z A;  3ORV D;  1Q47 A;  2MTA H;  3SBR A;  5C2W B;  5EAP A;  2CE9 A;  4AMZ A;  5CXC B;  5IGQ A;  2AGX A;  1MDA H;  2HU5 A;  4BH6 A;  4H5I A;  5FKS A;  2I3S A;  4PXW A;  1VE6 A;  2HU7 A;  3JAM g;  5EMM B;  3L4M D;  3DSM A;  2H13 A;  4GZ8 A;  3RRM C;  3C99 A;  4CI2 A;  3K27 A;  1RI6 A;  1VZ2 A;  3GFC A;  3PXS D;  5A2Q g;  1JTD B;  5C86 A;  2J55 H;  3C75 H;  4MK0 B;  5TDH B;  4J82 A;  4CY1 A;  2G99 A;  3JRP A;  4A08 A;  4JT6 C;  5IC7 A;  3UVL A;  3EQ8 A;  1NEX B;  3OW8 A;  2CO0 C;  4XEI C;  2HKR A;  3DXK C;  3EI4 A;  4Z7N A;  4A0A B;  5E6U A;  5CYK B;  3UVK A;  4A2L A;  5CXB B;  4X61 B;  2VDM A;  3NVQ A;  2H47 A;  3V5W B;  4GMB A;  4ZOV A;  5HE2 B;  4CI1 A;  4AX4 A;  4O45 A;  1PEV A;  4PSX B;  3VGZ A;  3F3P A;  3PVW B;  5I5I A;  3B7F A;  5M61 A;  2I0S A;  2VZ1 A;  2IAA A;  2AH1 A;  2IUQ A;  5TEF A;  3MZK A;  2VDO A;  4K3I D;  2PM7 B;  4QQE A;  3FRX A;  4J78 A;  1U8C A;  3ZE0 A;  5IJ7 E;  4GM9 A;  2GNQ A;  2OVR B;  3UVM A;  4J86 A;  5I5M A;  3FM0 A;  3EQ9 A;  2HYE A;  4LGN A;  3FGB A;  5FFG A;  1A0R B;  2YNP A;  4KFM B;  3SWS D;  5GXI A;  4G1M A;  3T3P A;  2XL3 A;  2IWK A;  4BL0 A;  4RE5 A;  1GOG A;  5I5J A;  2BCJ B;  2YNN A;  1K8K C;  1E8N A;  3OF7 A;  4IA9 A;  1QFM A;  2OIZ A;  4CI8 A;  4O2W A;  2AGY A;  5TEE A;  3C9C A;  3I7L A;  4D0K A;  2HXC A;  3EMH A;  3MKS B;  3CIK B;  1FWX A;  2O9K A;  4L3G D;  3I7O A;  2EIB A;  1TBG A;  3SJL D;  1VZ3 A;  4ES0 A;  3JZN A;  4X60 B;  1UOO A;  1L5G A;  2OJY A;  4J81 A;  3U4Y A;  2CE8 A;  5FA5 B;  4J77 A;  1YR2 A;  4AMY A;  4A0B A;  2CO0 A;  4Z8L A;  5H1M A;  2PM9 B;  4TZ4 A;  4FA9 D;  3IUJ A;  3AH8 B;  3V9F A;  3OL2 B;  3K26 A;  4PC0 A;  3EI3 B;  3NIG A;  3I8E A;  2H9P A;  5EM2 A;  3ZE2 A;  4ERY A;  2XE4 A;  4ZOX A;  4ZOZ A;  4A11 A;  4A09 A;  4QRJ A;  5M5T A;  4OWR A;  2I3T A;  2XU7 A;  3UKU C;  4DNV A;  4GM8 A;  5FLX g;  3RN0 D;  3MUN A;  4EWR A;  4FAN D;  5M5R A;  2J56 H;  4NBM A;  3P4F A;  2XZG A;  2GC4 A;  3OKY B;  4AN1 A;  4N14 A;  2BKL A;  3FCU A;  4NEN A;  4HDJ A;  3AL8 A;  5CXC A;  2EID A;  3I2N A;  3C5M A;  4FA1 D;  1N6E A;  3JZG A;  3VA6 A;  2AH0 A;  4E54 B;  3VH0 A;  1U4C A;  2P9S C;  4J0X A;  4MMZ A;  1GOT B;  4O1Q D;  1K3I A;  1E5T A;  5C92 A;  2HJ4 A;  3O4H A;  3PXW D;  3UVO A;  4FA4 D;  5C2V B;  2VDP A;  1JMZ B;  5GMK n;  2AGL A;  3JB9 L;  3F3G A;  3I7K A;  2OK4 A;  3IUM A;  5HE0 B;  5TF2 A;  4DNU A;  4O9D A;  3IUL A;  3KRX B;  4DNW A;  3ODT A;  2IWF A;  4O3T B;  4A0A A;  3SN6 B;  1T2X A;  2OVP B;  4J8B A;  2CNX A;  3CFS B;  1S4U X;  3BG0 A;  2P9K C;  2PM6 B;  3O4I A;  3DXM C;  2CN2 A;  2JKX A;  3IIY A;  1ERJ A;  4L1M A;  2YBA A;  3I89 A;  2HES X;  2QXV A;  5KDO B;  1OMW B;  5H17 A;  4J87 A;  2AGZ A;  4L1Q D;  3K6S A;  3EI4 B;  4AOW A;  3IIW A;  4WK4 A;  3HFQ A;  3DDU A;  4QT8 A;  4NSX A;  4LG8 A;  3PSL A;  4PSW B;  4X3E A;  2YB8 B;  4BP9 A;  2XL2 A;  2B5L A;  4PBZ A;  5C9Z B;  3OKT A;  4D9S A;  3EI2 B;  2W18 A;  3BG1 A;  1UOP A;  3O4J A;  5E6R A;  5EAL A;  2P9L C;  1PI6 A;  4MMY A;  4JXM A;  3VI4 A;  1UOQ A;  3KCI A;  4NAA A;  1MG3 A;  3MZL A;  4GGC A;  5M5U A;  5HQG A;  3OKW A;  5HE3 B;  2AQ5 A;  4JHP C;  3BWS A;  4J79 A;  2P9P C;  3RLM D;  2PBI B;  2HKM A;  2P9U C;  1TYE A;  3ZDZ A;  2VZ3 A;  4JSP C;  3RMZ D;  1PGU A;  1QFS A;  1MG2 A;  3OTT A;  2H14 A;  3QHY B;  1B9X A;  1XHM A;  2Z2O A;  1C9L A;  2VDK A;  1U2V C;  4WJK A;  4J73 A;  5AMS A;  4U1E I;  5FXY A;  4U7A A;  3DWL C;  4UM8 A;  3IUN A;  1A12 A;  2EIE A;  3A0F A;  1OLZ A;  5SXM A;  3IJC A;  4XYI A;  2HU8 A;  3JZH A;  4RE6 A;  4ZN4 A;  1B9Y A;  2I0T A;  3K72 A;  4WK0 A;  5E6S A;  4O3U B;  3IJ0 A;  3PXT D;  3J81 g;  3SLE D;  3RFG A;  4GQ2 P;  4J0W A;  4JD2 C;  1BPO A;  3SMR A;  4JHN A;  2QZP A;  2Z2N A;  2J57 G;  5THA A;  2HJB A;  2XYI A;  2CN3 A;  4YVD A;  3AFC A;  2H3X A;  3EI1 B;  4Z7Q A;  4ERQ A;  5HYN B;  3UR4 A;  1SQ9 A;  2WQ8 A;  1XIP A;  4GQ1 A;  3EWE A;  1JMX B;  1M1X A;  4E5Z B;  5EM2 B;  5GSA A;  3J80 g;  4L3H D;  1K32 A;  1YFQ A;  4A09 B;  2VDN A;  4CY3 A;  2EIC A;  2VDR A;  3I7P A;  2H9M A;  4O02 A;  1N6F A;  2B5M A;  2VDQ A;  4Y5R D;  5EMK B;  1VE7 A;  2VC2 A;  4FA5 D;  2H9L A;  4X63 B;  4LG9 A;  4BCD A;  1JV2 A;  5EMJ B;  3V4P A;  4JSN C;  4GGD A;  1SHY B;  1I2M B;  2TRC B;  3AL8 B;  3QI0 A;  1H2Y A;  4GM3 A;  3SXT D;  3F3F A;  4AEZ A;  3NID A;  4PNK B;  4BCB A;  1C9I A;  5GXH A;  3MXX A;  1GOF A;  4MMX A;  1PBY B;  3MUO A;  5CYK A;  5B4W A;  3SHF A;  3SFZ A;  5AFU 3;  5EAM A;  3PVU B;  5CXB A;  1GP2 B;  5IGO A;  1UTC A;  3IKO A;  3NIF A;  4A2M A;  4FHL A;  3MVD K;  2H6N A;  3SBQ A;  4CZY A; 
#chains in the Genus database with same CATH homology
 4J84 A;  1XKS A;  4Y7R A;  5IT9 g;  4ZOY A;  4CY5 A;  4A08 B;  1GXR A;  4CI3 A;  3SVW D;  5AJA A;  4G56 B;  4I79 A;  4D6V A;  3RSE C;  4CY2 A;  1QNI A;  3I7H A;  2H9N A;  1R5M A;  3N0E A;  2IUP A;  2IUV A;  3I7N A;  5K1C C;  3RN1 D;  5H14 A;  1GG2 B;  5IJ8 E;  4J8G A;  4FB1 D;  4JSV C;  3N0D A;  3PSC B;  4H5J A;  2Z2P A;  1NR0 A;  4A7J A;  4L9O A;  5K19 A;  2QC5 A;  3SCY A;  3EI2 A;  3CFV A;  2H68 A;  2P9N C;  5HE1 B;  2UZY B;  1JJU B;  5FKR A;  4CZX A;  3NVX A;  2AGW A;  3UKR C;  3ULE C;  4PBY A;  4CC9 A;  4FWW A;  2GC7 A;  2I0R A;  2YNO A;  2G9A A;  3W15 A;  2IUR A;  1JOF A;  3KRW B;  3EG6 A;  2H6K A;  3V7D B;  1VYH C;  3NVN A;  2YMU A;  3JPX A;  3I8C A;  3MKQ A;  4ERZ A;  2BBK H;  2OK6 A;  1P22 A;  4IMM A;  4CZV A;  4R7A B;  3IJ1 A;  5FKQ A;  2PM9 A;  4GGA A;  3UVN A;  3E0C A;  3OL2 A;  4GQB B;  5EML B;  2H6Q A;  3EI3 A;  1SQJ A;  1TYQ C;  2Q7Q A;  3ZWL B;  2B5N A;  4JT5 C;  1N6D A;  4UI9 R;  4FAV D;  3L4O D;  2B4E A;  4BUJ C;  4ESG A;  4A0B B;  4K3J B;  3MMY A;  4OZU A;  3EU7 A;  5FQD A;  5JWZ A;  3RFH A;  3EI1 A;  3OKY A;  3PE7 A;  2UZX B;  3GRE A;  3DM0 A;  4JSX C;  4XYH A;  2OVQ B;  4E5Z A;  2EBS A;  5FKT A;  3SBP A;  4E54 A;  4A11 B;  2P9I C;  4QL1 A;  1L0Q A;  5EAR A;  3JRO A;  3AL9 A;  3ORV D;  1Q47 A;  2MTA H;  3SBR A;  5C2W B;  5EAP A;  2CE9 A;  5CXC B;  5IGQ A;  2AGX A;  1MDA H;  4BH6 A;  4H5I A;  5FKS A;  2I3S A;  4PXW A;  3JAM g;  5EMM B;  3L4M D;  3DSM A;  2H13 A;  4GZ8 A;  3RRM C;  3C99 A;  4CI2 A;  3K27 A;  1RI6 A;  3GFC A;  3PXS D;  5A2Q g;  2J55 H;  3C75 H;  4MK0 B;  5TDH B;  4J82 A;  4CY1 A;  2G99 A;  3JRP A;  4A08 A;  4JT6 C;  5IC7 A;  3UVL A;  1NEX B;  3OW8 A;  2CO0 C;  4XEI C;  2HKR A;  3DXK C;  3EI4 A;  4A0A B;  5CYK B;  3UVK A;  4A2L A;  5CXB B;  4X61 B;  3NVQ A;  3V5W B;  2H47 A;  4GMB A;  4ZOV A;  5HE2 B;  4CI1 A;  4O45 A;  1PEV A;  4PSX B;  3VGZ A;  3F3P A;  3PVW B;  5I5I A;  3B7F A;  2I0S A;  2IAA A;  2AH1 A;  2IUQ A;  5TEF A;  3MZK A;  4K3I D;  2PM7 B;  4QQE A;  3FRX A;  4J78 A;  5IJ7 E;  4GM9 A;  2GNQ A;  2OVR B;  3UVM A;  4J86 A;  5I5M A;  3FM0 A;  2HYE A;  4LGN A;  3FGB A;  1A0R B;  2YNP A;  4KFM B;  3SWS D;  5GXI A;  2XL3 A;  2IWK A;  4BL0 A;  5I5J A;  2BCJ B;  2YNN A;  1K8K C;  4IA9 A;  2OIZ A;  4CI8 A;  2AGY A;  5TEE A;  3C9C A;  3I7L A;  4D0K A;  2HXC A;  3EMH A;  3MKS B;  3CIK B;  1FWX A;  2O9K A;  4L3G D;  3I7O A;  3SJL D;  1TBG A;  4ES0 A;  3JZN A;  4X60 B;  2OJY A;  4J81 A;  3U4Y A;  2CE8 A;  5FA5 B;  4J77 A;  4A0B A;  2CO0 A;  4Z8L A;  5H1M A;  2PM9 B;  4TZ4 A;  4FA9 D;  3AH8 B;  3V9F A;  3OL2 B;  3K26 A;  4PC0 A;  3EI3 B;  3I8E A;  2H9P A;  5EM2 A;  4ERY A;  4ZOX A;  4ZOZ A;  4A11 A;  4A09 A;  4QRJ A;  4OWR A;  2I3T A;  2XU7 A;  3UKU C;  4GM8 A;  5FLX g;  3RN0 D;  4FAN D;  4EWR A;  2J56 H;  3P4F A;  2GC4 A;  3OKY B;  4N14 A;  4HDJ A;  3AL8 A;  5CXC A;  3I2N A;  3C5M A;  4FA1 D;  1N6E A;  3JZG A;  3VA6 A;  2AH0 A;  4E54 B;  3VH0 A;  1U4C A;  2P9S C;  4J0X A;  1GOT B;  4O1Q D;  2HJ4 A;  3PXW D;  3UVO A;  4FA4 D;  5C2V B;  1JMZ B;  5GMK n;  2AGL A;  3JB9 L;  3F3G A;  3I7K A;  2OK4 A;  5HE0 B;  5TF2 A;  4O9D A;  3KRX B;  3ODT A;  2IWF A;  4O3T B;  4A0A A;  3SN6 B;  2OVP B;  4J8B A;  2CNX A;  3CFS B;  1S4U X;  3BG0 A;  2P9K C;  2PM6 B;  3DXM C;  2CN2 A;  3IIY A;  1ERJ A;  2YBA A;  3I89 A;  2HES X;  2QXV A;  5KDO B;  1OMW B;  5H17 A;  2AGZ A;  4L1Q D;  3EI4 B;  4AOW A;  3IIW A;  3HFQ A;  4QT8 A;  4NSX A;  4LG8 A;  3PSL A;  4PSW B;  4X3E A;  2YB8 B;  2XL2 A;  2B5L A;  4PBZ A;  5C9Z B;  3OKT A;  3EI2 B;  2W18 A;  3BG1 A;  5EAL A;  2P9L C;  1PI6 A;  4JXM A;  2H6N A;  1MG3 A;  3MZL A;  4GGC A;  5HQG A;  3OKW A;  5HE3 B;  2AQ5 A;  3BWS A;  4J79 A;  2P9P C;  3RLM D;  2PBI B;  2HKM A;  2P9U C;  4JSP C;  3RMZ D;  1PGU A;  1MG2 A;  3OTT A;  2H14 A;  1B9X A;  1XHM A;  2Z2O A;  1U2V C;  4J73 A;  5AMS A;  4U1E I;  5FXY A;  4U7A A;  3DWL C;  3A0F A;  1OLZ A;  5SXM A;  3IJC A;  4XYI A;  3JZH A;  4ZN4 A;  1B9Y A;  2I0T A;  4O3U B;  3IJ0 A;  3PXT D;  3J81 g;  3SLE D;  3RFG A;  4GQ2 P;  4J0W A;  4JD2 C;  3SMR A;  2Z2N A;  2J57 G;  5THA A;  2HJB A;  2XYI A;  2CN3 A;  4YVD A;  3AFC A;  2H3X A;  3EI1 B;  5HYN B;  4ERQ A;  3UR4 A;  1SQ9 A;  1XIP A;  4GQ1 A;  3EWE A;  1JMX B;  4E5Z B;  5EM2 B;  5GSA A;  3J80 g;  4L3H D;  1K32 A;  1YFQ A;  4A09 B;  4CY3 A;  3I7P A;  2H9M A;  1N6F A;  2B5M A;  4Y5R D;  5EMK B;  4FA5 D;  2H9L A;  4X63 B;  4LG9 A;  5EMJ B;  4JSN C;  4GGD A;  1SHY B;  2TRC B;  3AL8 B;  4GM3 A;  3SXT D;  3F3F A;  4AEZ A;  4PNK B;  5GXH A;  3MXX A;  3SFZ A;  1PBY B;  5B4W A;  5CYK A;  3SHF A;  5AFU 3;  5EAM A;  3PVU B;  5CXB A;  1GP2 B;  5IGO A;  3IKO A;  4A2M A;  4FHL A;  4J87 A;  3SBQ A;  4CZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...