2AH1A

Crystal structure of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 97
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ah1A01
2P9SC 1GG2B 1U4CA 4X60B 3BG1A 4N14A 5IJ7E 3EU7A 5AMSA 3FRXA 3AL8A 3SBRA 3EI3A 4JSPC 3IKOA 4PBYA 4BUJC 3IJCA 3PXSD 4Y5RD 4FA5D 1N6DA 3OL2B 3OKWA 5HE0B 4A0AA 4FWWA 3SVWD 4L3GD 4GQ1A 2BBKH 5C2VB 3JZNA 4A7JA 4CZVA 4CY5A 2H9MA 2IAAA 4J8BA 3MZKA 4A0BB 2QC5A 4L9OA 3EMHA 3SBQA 4A08B 2CN2A 3V5WB 5JWZA 4J81A 4D0KA 2H3XA 4QL1A 4AOWA 3HFQA 1A0RB 5K1CC 1JMZB 2OJYA 4IA9A 4NSXA 4CI1A 5EARA 5HYNB 2P9PC 3C9CA 5H1MA 2P9IC 3IIWA 3EI4B 4GQBB 2H6QA 4LG8A 1PI6A 4A08A 3OKYB 4FHLA 3VGZA 4Z8LA 3OKTA 2AGXA 3RFGA 4BL0A 4PSXB 2OVPB 3DSMA 2AH1A 3IJ0A 4LGNA 2OIZA 4ZOXA 2IWKA 2I3SA 4J79A 1XIPA 2P9KC 3EI4A 2PM7B 5I5IA 4QRJA 3OKYA 1L0QA 2I0RA 3UKUC 4K3ID 5H17A 4CI2A 5HQGA 4X3EA 2IUQA 5EAMA 2QXVA 2Z2NA 4J87A 5EAPA 3EI2B 4D6VA 2HKMA 1NR0A 2YNOA 3GFCA 4CY2A 3VA6A 2CO0C 3JROA 2H14A 3F3GA 1RI6A 5TEFA 1P22A 3I7OA 4JSXC 1B9XA 2PM6B 3ULEC 4KFMB 5C9ZB 2CN3A 2Z2OA 3JZHA 4O9DA 5FXYA 4HDJA 3RFHA 2J55H 3EI1B 3I7NA 5GXHA 1GP2B 5I5JA 2UZXB 3RMZD 3GREA 3NVNA 3PVUB 1Q47A 5GXIA 1PGUA 2GC4A 3IIYA 4GM8A 2IWFA 4ERZA 2B5MA 1JMXB 5EMKB 4IMMA 3J80g 2TRCB 3MKSB 4PNKB 4EWRA 4O3TB 4I79A 3N0EA 3UVOA 4E54B 1S4UX 1ERJA 1XKSA 2HXCA 3VH0A 3EG6A 4XYIA 4ESGA 2H13A 2GNQA 2H47A 4R7AB 4GGCA 2HJ4A 3I7KA 2OVQB 5K19A 4ZOVA 4E54A 2I0SA 2XL2A 3UVKA 5AFU3 4PSWB 3ODTA 3NVQA 3PE7A 3UVNA 3OL2A 5CYKB 3JAMg 3RLMD 4GZ8A 4A2MA 4J8GA 1VYHC 4OWRA 3BWSA 1K8KC 4CY1A 3FGBA 5GSAA 2OVRB 4PXWA 5EALA 2EBSA 4A0BA 3K26A 2W18A 3MZLA 3RSEC 1R5MA 2O9KA 1U2VC 4J86A 5THAA 3ZWLB 4J78A 4FB1D 2PM9B 4YVDA 2HJBA 3SXTD 2IUPA 2BCJB 2UZYB 5H14A 3PVWB 3A0FA 5IC7A 5TF2A 4CY3A 3SN6B 5A2Qg 5AJAA 3N0DA 1N6EA 3U4YA 5FLXg 3UKRC 2G9AA 4H5JA 3K27A 5EM2B 4GMBA 4J0XA 1GOTB 1PEVA 4J84A 2I3TA 5CXCB 5SXMA 3L4MD 5EMMB 4FAND 4X63B 2OK6A 4CC9A 4CZXA 4G56B 4PBZA 3UVLA 2AGZA 1SHYB 4JD2C 4A2LA 2AGWA 2IUVA 4CZYA 1N6FA 5FQDA 5EM2A 4OZUA 4J77A 3JRPA 1JOFA 4ES0A 5B4WA 1OLZA 4ZN4A 2YMUA 3J81g 3I7HA 3UVMA 4JSNC 3SHFA 4J73A 3C99A 4ZOYA 3EI2A 4BH6A 2I0TA 2P9LC 3C5MA 4L3HD 3I7LA 4ERQA 2YNNA 5FKRA 3RN1D 4ERYA 4GGAA 3UR4A 3JPXA 5HE1B 2MTAH 4FA4D 4GM9A 1MG3A 4JT6C 3EI1A 5TEEA 5CXBB 2AQ5A 3SFZA 4CI3A 1TBGA 4JT5C 3DM0A 4GM3A 2P9NC 2XU7A 4E5ZB 4GGDA 2J57G 2H6NA 2B5NA 3KRWB 3CFSB 3PSCB 1B9YA 4PC0A 4QT8A 2H9LA 4H5IA 4X61B 5CXBA 4UI9R 1SQ9A 3I8CA 3PXWD 3PSLA 2AGYA 4A0AB 2AGLA 2OK4A 5IT9g 2Z2PA 4JSVC 3F3PA 4J0WA 2YBAA 4E5ZA 4U7AA 2XL3A 5IGQA 3EWEA 1MG2A 3W15A 3SLED 4LG9A 1MDAH 1OMWB 2CE8A 3L4OD 3I2NA 3NVXA 4MK0B 3JB9L 4K3JB 4O1QD 3V7DB 3P4FA 5HE2B 1SQJA 3AL9A 1GXRA 5KDOB 2B4EA 3B7FA 5CYKA 4L1QD 3MXXA 2B5LA 3RRMC 3SMRA 2HESX 3IJ1A 4ZOZA 3CIKB 1FWXA 4JXMA 1K32A 2H6KA 5HE3B 3SBPA 3I8EA 5FKTA 2CO0A 3DXMC 2AH0A 3SCYA 5FA5B 3SJLD 5EMLB 2IURA 1QNIA 3OTTA 3FM0A 5GMKn 4CI8A 2PM9A 2CE9A 4FA1D 4A11B 3ORVD 4U1EI 2G99A 5EMJB 4AEZA 5TDHB 3KRXB 4FAVD 3AFCA 3F3FA 3BG0A 1XHMA 3SWSD 2PBIB 2YB8B 3I89A 4A09B 4TZ4A 5CXCA 4A11A 1YFQA 5C2WB 4GQ2P 3DXKC 4Y7RA 2CNXA 3DWLC 4XYHA 3OW8A 5I5MA 3C75H 2H9PA 3JZGA 2H68A 3V9FA 2YNPA 3CFVA 2Q7QA 3I7PA 4A09A 4O45A 2HYEA 5FKQA 4J82A 5IGOA 2HKRA 3MMYA 1NEXB 5IJ8E 3AH8B 1TYQC 2XYIA 5FKSA 1JJUB 4FA9D 2GC7A 3MKQA 3AL8B 2P9UC 3E0CA 3EI3B 3RN0D 4QQEA 4O3UB 2J56H 1PBYB 2H9NA 3PXTD 4XEIC
chains in the Genus database with same CATH superfamily
2P9SC 1GG2B 1U4CA 4X60B 3BG1A 4N14A 5IJ7E 3EU7A 2VDNA 5AMSA 3FRXA 3AL8A 3SBRA 3EI3A 4WJKA 4JSPC 3IKOA 4NENA 3QI0A 4PBYA 4BUJC 3IJCA 3PXSD 4Y5RD 2EIEA 4FA5D 1N6DA 3OL2B 4Z7NA 3OKWA 5HE0B 4A0AA 4FWWA 3SVWD 4L3GD 4GQ1A 2BBKH 5C2VB 3JZNA 4A7JA 1E8NA 4CZVA 1VE6A 3K72A 1GOFA 4CY5A 2H9MA 2IAAA 4J8BA 3MZKA 4A0BB 2QC5A 4L9OA 3QHYB 3EMHA 3SBQA 4A08B 4AMZA 2CN2A 3V5WB 5JWZA 4J81A 4D0KA 2H3XA 1C9LA 1UOPA 3HFQA 4QL1A 4AOWA 1A0RB 5K1CC 1JMZB 1O6FA 2OJYA 4IA9A 4NSXA 4CI1A 3MVDK 2HU8A 5EARA 1BPOA 5HYNB 2P9PC 1M1XA 3C9CA 5H1MA 2P9IC 3IIWA 3EI4B 4GQBB 3V4PA 2H6QA 4LG8A 1PI6A 4A08A 3OKYB 4FHLA 5E6UA 3VGZA 3O4GA 4Z8LA 3OKTA 2AGXA 3RFGA 4BL0A 4PSXB 2OVPB 4AN0A 3DSMA 2AH1A 4QAMA 3IJ0A 4LGNA 2OIZA 4ZOXA 2IWKA 2I3SA 4J79A 1XIPA 2P9KC 3EI4A 2PM7B 5I5IA 4QRJA 3OKYA 1I2MB 1L0QA 2I0RA 4O02A 3UKUC 4K3ID 4WK4A 5H17A 5E6RA 4CI2A 5HQGA 4X3EA 2IUQA 5EAMA 4Z7QA 2QXVA 2Z2NA 4J87A 2JKXA 5EAPA 3EI2B 3ZE0A 4D6VA 2HKMA 1NR0A 2YNOA 3GFCA 4CY2A 3ZDZA 3IJEA 2CO0C 3VA6A 2XE4A 3JROA 4MMXA 2H14A 3F3GA 1YR2A 1RI6A 5TEFA 1P22A 3I7OA 5HDBA 3EQ9A 4JSXC 1B9XA 2PM6B 3ULEC 4KFMB 5C9ZB 2CN3A 2Z2OA 3JZHA 4O9DA 5FXYA 4HDJA 3RFHA 2J55H 3EI1B 3I7NA 5GXHA 1GP2B 5I5JA 1H2WA 2UZXB 3RMZD 3GREA 3NVNA 3PVUB 2VDLA 1Q47A 1H2ZA 5GXIA 5FFOA 1PGUA 2GC4A 1UOOA 3ZE2A 3IIYA 4GM8A 2IWFA 4ERZA 3IUJA 2B5MA 3FCSA 1JMXB 5EMKB 2VDPA 4IMMA 3J80g 1VZ3A 2TRCB 3MKSB 3IUMA 4PNKB 4EWRA 3IUNA 2XZGA 4O3TB 1GOHA 1A12A 2BKLA 3ZE1A 4I79A 3N0EA 3NIGA 3UVOA 4E54B 1S4UX 1ERJA 1XKSA 2HXCA 3VH0A 1GOGA 3EG6A 3GD1I 3O4JA 4XYIA 2VDRA 3VI3A 1JTDB 4ESGA 3K6SA 5M5UA 2H13A 2GNQA 2H47A 4R7AB 4GGCA 2HJ4A 2WQ8A 2EIDA 3I7KA 2OVQB 5K19A 4ZOVA 1VE7A 3T3PA 4E54A 2I0SA 2EICA 2XL2A 3UVKA 5AFU3 4PSWB 4G1EA 3ODTA 3NVQA 3PE7A 3UVNA 5C86A 3OL2A 5CYKB 3JAMg 3RLMD 2VDKA 4GZ8A 4A2MA 4J8GA 1VYHC 1VZ2A 4BCCA 4DNUA 4OWRA 3BWSA 1K8KC 4CY1A 3FGBA 5GSAA 4Z7OA 2OVRB 4PXWA 4AN1A 3ZDXA 1T2XA 5EALA 2EBSA 4A0BA 3K26A 2W18A 3MZLA 3RSEC 1R5MA 2O9KA 1U2VC 4J86A 5THAA 3ZWLB 4J78A 4FB1D 2PM9B 4YVDA 2HJBA 3SXTD 4G1MA 3GC3B 2IUPA 3NIDA 2BCJB 2UZYB 5E6SA 5H14A 3VI4A 3PVWB 3OF7A 3A0FA 5IC7A 5TF2A 4CY3A 3SN6B 5A2Qg 5AJAA 3N0DA 1N6EA 3U4YA 5FLXg 3UKRC 2G9AA 4H5JA 3K27A 4AX4A 5EM2B 4G55A 4NBMA 4GMBA 4J0XA 5M5SA 1GOTB 2HU5A 1PEVA 5M61A 4DNVA 4J84A 2QR5A 2I3TA 3IVMA 5CXCB 5SXMA 3L4MD 5EMMB 4FAND 4X63B 2OK6A 4CC9A 4CZXA 4G56B 1QFMA 4NAAA 4PBZA 3UVLA 2AGZA 1SHYB 4JD2C 4A2LA 2AGWA 2IUVA 4CZYA 1N6FA 5FQDA 5EM2A 4OZUA 3EQ7A 4J77A 3JRPA 1L5GA 1JOFA 4ES0A 2VZ3A 5B4WA 1OLZA 4D9SA 4ZN4A 3V4VA 3T3MA 2YMUA 3J81g 4RE5A 3I7HA 3UVMA 4JSNC 3SHFA 4J73A 3C99A 4ZOYA 3EI2A 4BH6A 2I0TA 3DDUA 2P9LC 3C5MA 4L3HD 3I7LA 4ERQA 1E8MA 2YNNA 3IUQA 5FKRA 3RN1D 1H2YA 4ERYA 4GGAA 1QFSA 1U8CA 5M5VA 3UR4A 3JPXA 5HE1B 2MTAH 3O4HA 4FA4D 4GM9A 1MG3A 4JT6C 3EI1A 4BCBA 5TEEA 5CXBB 2AQ5A 1O6GA 3SFZA 4CI3A 1TBGA 4JT5C 3DM0A 4GM3A 2P9NC 2XU7A 4E5ZB 4GGDA 2J57G 3MUNA 2H6NA 4AMYA 2B5NA 3KRWB 3CFSB 5M5RA 3PSCB 1B9YA 1UOQA 4PC0A 4QT8A 2H9LA 4H5IA 4X61B 5CXBA 4UI9R 1SQ9A 3IULA 3I8CA 3PXWD 3PSLA 2AGYA 4A0AB 2AGLA 3ZDYA 2EIBA 2OK4A 4MMYA 5IT9g 2Z2PA 4JSVC 3NIFA 3F3PA 4J0WA 2YBAA 4E5ZA 3MUOA 4U7AA 2XL3A 5IGQA 3EWEA 1MG2A 3W15A 3SLED 4LG9A 4MMZA 1C9IA 4O2WA 1MDAH 1OMWB 2CE8A 3L4OD 3I2NA 3NVXA 4JHPC 4MK0B 4BCDA 5C92A 3EQ8A 4BP8A 3JB9L 4K3JB 4IRZA 4O1QD 3V7DB 3P4FA 5HE2B 1SQJA 3AL9A 1GXRA 5KDOB 2B4EA 3B7FA 5CYKA 4L1QD 3MXXA 2B5LA 3RRMC 3SMRA 2HESX 1JV2A 3IJ1A 4ZOZA 3CIKB 1FWXA 1H2XA 4UM8A 1TYEA 4JXMA 1K32A 2H6KA 5HE3B 4BP9A 3SBPA 3I8EA 5FKTA 2CO0A 3DXMC 2AH0A 3SCYA 5FA5B 3SJLD 5EMLB 2IURA 1QNIA 3OTTA 3FM0A 5GMKn 3IURA 4CI8A 2PM9A 1E5TA 2CE9A 4FA1D 4A11B 3ORVD 4U1EI 3FCUA 2G99A 5EMJB 4AEZA 5TDHB 3KCIA 2VZ1A 2VC2A 3KRXB 4FAVD 3AFCA 3F3FA 5M5TA 3O4IA 3BG0A 1XHMA 3SWSD 2PBIB 2YB8B 5FFGA 3I89A 4A09B 4TZ4A 5CXCA 4A11A 1YFQA 5C2WB 2VDMA 4GQ2P 4L1MA 3DXKC 4Y7RA 2CNXA 3DWLC 4XYHA 4WK0A 4WK2A 3OW8A 5I5MA 2QZPA 3C75H 2H9PA 3JZGA 2H68A 4RE6A 4UM9A 3V9FA 2YNPA 4NC4A 3CFVA 2Q7QA 2HU7A 3I7PA 4A09A 4O45A 2HYEA 5FKQA 4J82A 5IGOA 2HKRA 1UTCA 3MMYA 1NEXB 5IJ8E 3AH8B 1TYQC 1K3IA 3K71A 2XYIA 5FKSA 1JJUB 4FA9D 2GC7A 2XDWA 2VDQA 2VDOA 3MKQA 3AL8B 2P9UC 3E0CA 3EI3B 4JHNA 3RN0D 4QQEA 4O3UB 2J56H 1PBYB 2H9NA 3PXTD 4XEIC 4DNWA
chains in the Genus database with same CATH topology
2P9SC 1GG2B 1U4CA 4X60B 3BG1A 4N14A 5IJ7E 3EU7A 5AMSA 3FRXA 3AL8A 3SBRA 3EI3A 4JSPC 3IKOA 4PBYA 4BUJC 3IJCA 3PXSD 4Y5RD 4FA5D 1N6DA 3OL2B 3OKWA 5HE0B 4A0AA 4FWWA 3SVWD 4L3GD 4GQ1A 2BBKH 5C2VB 3JZNA 4A7JA 4CZVA 4CY5A 2H9MA 2IAAA 4J8BA 3MZKA 4A0BB 2QC5A 4L9OA 3EMHA 3SBQA 4A08B 2CN2A 3V5WB 5JWZA 4J81A 4D0KA 2H3XA 4QL1A 4AOWA 3HFQA 1A0RB 5K1CC 1JMZB 2OJYA 4IA9A 4NSXA 4CI1A 5EARA 5HYNB 2P9PC 3C9CA 5H1MA 2P9IC 3IIWA 3EI4B 4GQBB 2H6QA 4LG8A 1PI6A 4A08A 3OKYB 4FHLA 3VGZA 4Z8LA 3OKTA 2AGXA 3RFGA 4BL0A 4PSXB 2OVPB 3DSMA 2AH1A 3IJ0A 4LGNA 2OIZA 4ZOXA 2IWKA 2I3SA 4J79A 1XIPA 2P9KC 3EI4A 2PM7B 5I5IA 4QRJA 3OKYA 1L0QA 2I0RA 3UKUC 4K3ID 5H17A 4CI2A 5HQGA 4X3EA 2IUQA 5EAMA 2QXVA 2Z2NA 4J87A 5EAPA 3EI2B 4D6VA 2HKMA 1NR0A 2YNOA 3GFCA 4CY2A 3VA6A 2CO0C 3JROA 2H14A 3F3GA 1RI6A 5TEFA 1P22A 3I7OA 4JSXC 1B9XA 2PM6B 3ULEC 4KFMB 5C9ZB 2CN3A 2Z2OA 3JZHA 4O9DA 5FXYA 4HDJA 3RFHA 2J55H 3EI1B 3I7NA 5GXHA 1GP2B 5I5JA 2UZXB 3RMZD 3GREA 3NVNA 3PVUB 1Q47A 5GXIA 1PGUA 2GC4A 3IIYA 4GM8A 2IWFA 4ERZA 2B5MA 1JMXB 5EMKB 4IMMA 3J80g 2TRCB 3MKSB 4PNKB 4EWRA 4O3TB 4I79A 3N0EA 3UVOA 4E54B 1S4UX 1ERJA 1XKSA 2HXCA 3VH0A 3EG6A 4XYIA 4ESGA 2H13A 2GNQA 2H47A 4R7AB 4GGCA 2HJ4A 3I7KA 2OVQB 5K19A 4ZOVA 4E54A 2I0SA 2XL2A 3UVKA 5AFU3 4PSWB 3ODTA 3NVQA 3PE7A 3UVNA 3OL2A 5CYKB 3JAMg 3RLMD 4GZ8A 4A2MA 4J8GA 1VYHC 4OWRA 3BWSA 1K8KC 4CY1A 3FGBA 5GSAA 2OVRB 4PXWA 5EALA 2EBSA 4A0BA 3K26A 2W18A 3MZLA 3RSEC 1R5MA 2O9KA 1U2VC 4J86A 5THAA 3ZWLB 4J78A 4FB1D 2PM9B 4YVDA 2HJBA 3SXTD 2IUPA 2BCJB 2UZYB 5H14A 3PVWB 3A0FA 5IC7A 5TF2A 4CY3A 3SN6B 5A2Qg 5AJAA 3N0DA 1N6EA 3U4YA 5FLXg 3UKRC 2G9AA 4H5JA 3K27A 5EM2B 4GMBA 4J0XA 1GOTB 1PEVA 4J84A 2I3TA 5CXCB 5SXMA 3L4MD 5EMMB 4FAND 4X63B 2OK6A 4CC9A 4CZXA 4G56B 4PBZA 3UVLA 2AGZA 1SHYB 4JD2C 4A2LA 2AGWA 2IUVA 4CZYA 1N6FA 5FQDA 5EM2A 4OZUA 4J77A 3JRPA 1JOFA 4ES0A 5B4WA 1OLZA 4ZN4A 2YMUA 3J81g 3I7HA 3UVMA 4JSNC 3SHFA 4J73A 3C99A 4ZOYA 3EI2A 4BH6A 2I0TA 2P9LC 3C5MA 4L3HD 3I7LA 4ERQA 2YNNA 5FKRA 3RN1D 4ERYA 4GGAA 3UR4A 3JPXA 5HE1B 2MTAH 4FA4D 4GM9A 1MG3A 4JT6C 3EI1A 5TEEA 5CXBB 2AQ5A 3SFZA 4CI3A 1TBGA 4JT5C 3DM0A 4GM3A 2P9NC 2XU7A 4E5ZB 4GGDA 2J57G 2H6NA 2B5NA 3KRWB 3CFSB 3PSCB 1B9YA 4PC0A 4QT8A 2H9LA 4H5IA 4X61B 5CXBA 4UI9R 1SQ9A 3I8CA 3PXWD 3PSLA 2AGYA 4A0AB 2AGLA 2OK4A 5IT9g 2Z2PA 4JSVC 3F3PA 4J0WA 2YBAA 4E5ZA 4U7AA 2XL3A 5IGQA 3EWEA 1MG2A 3W15A 3SLED 4LG9A 1MDAH 1OMWB 2CE8A 3L4OD 3I2NA 3NVXA 4MK0B 3JB9L 4K3JB 4O1QD 3V7DB 3P4FA 5HE2B 1SQJA 3AL9A 1GXRA 5KDOB 2B4EA 3B7FA 5CYKA 4L1QD 3MXXA 2B5LA 3RRMC 3SMRA 2HESX 3IJ1A 4ZOZA 3CIKB 1FWXA 4JXMA 1K32A 2H6KA 5HE3B 3SBPA 3I8EA 5FKTA 2CO0A 3DXMC 2AH0A 3SCYA 5FA5B 3SJLD 5EMLB 2IURA 1QNIA 3OTTA 3FM0A 5GMKn 4CI8A 2PM9A 2CE9A 4FA1D 4A11B 3ORVD 4U1EI 2G99A 5EMJB 4AEZA 5TDHB 3KRXB 4FAVD 3AFCA 3F3FA 3BG0A 1XHMA 3SWSD 2PBIB 2YB8B 3I89A 4A09B 4TZ4A 5CXCA 4A11A 1YFQA 5C2WB 4GQ2P 3DXKC 4Y7RA 2CNXA 3DWLC 4XYHA 3OW8A 5I5MA 3C75H 2H9PA 3JZGA 2H68A 3V9FA 2YNPA 3CFVA 2Q7QA 3I7PA 4A09A 4O45A 2HYEA 5FKQA 4J82A 5IGOA 2HKRA 3MMYA 1NEXB 5IJ8E 3AH8B 1TYQC 2XYIA 5FKSA 1JJUB 4FA9D 2GC7A 3MKQA 3AL8B 2P9UC 3E0CA 3EI3B 3RN0D 4QQEA 4O3UB 2J56H 1PBYB 2H9NA 3PXTD 4XEIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9S C;  1GG2 B;  1U4C A;  4X60 B;  3BG1 A;  4N14 A;  5IJ7 E;  3EU7 A;  5AMS A;  3FRX A;  3AL8 A;  3SBR A;  3EI3 A;  4JSP C;  3IKO A;  4PBY A;  4BUJ C;  3IJC A;  3PXS D;  4Y5R D;  4FA5 D;  1N6D A;  3OL2 B;  3OKW A;  5HE0 B;  4A0A A;  4FWW A;  3SVW D;  4L3G D;  4GQ1 A;  2BBK H;  5C2V B;  3JZN A;  4A7J A;  4CZV A;  4CY5 A;  2H9M A;  2IAA A;  4J8B A;  3MZK A;  4A0B B;  2QC5 A;  4L9O A;  3EMH A;  3SBQ A;  4A08 B;  2CN2 A;  3V5W B;  5JWZ A;  4J81 A;  4D0K A;  2H3X A;  4QL1 A;  4AOW A;  3HFQ A;  1A0R B;  5K1C C;  1JMZ B;  2OJY A;  4IA9 A;  4NSX A;  4CI1 A;  5EAR A;  5HYN B;  2P9P C;  3C9C A;  5H1M A;  2P9I C;  3IIW A;  3EI4 B;  4GQB B;  2H6Q A;  4LG8 A;  1PI6 A;  4A08 A;  3OKY B;  4FHL A;  3VGZ A;  4Z8L A;  3OKT A;  2AGX A;  3RFG A;  4BL0 A;  4PSX B;  2OVP B;  3DSM A;  2AH1 A;  3IJ0 A;  4LGN A;  2OIZ A;  4ZOX A;  2IWK A;  2I3S A;  4J79 A;  1XIP A;  2P9K C;  3EI4 A;  2PM7 B;  5I5I A;  4QRJ A;  3OKY A;  1L0Q A;  2I0R A;  3UKU C;  4K3I D;  5H17 A;  4CI2 A;  5HQG A;  4X3E A;  2IUQ A;  5EAM A;  2QXV A;  2Z2N A;  4J87 A;  5EAP A;  3EI2 B;  4D6V A;  2HKM A;  1NR0 A;  2YNO A;  3GFC A;  4CY2 A;  3VA6 A;  2CO0 C;  3JRO A;  2H14 A;  3F3G A;  1RI6 A;  5TEF A;  1P22 A;  3I7O A;  4JSX C;  1B9X A;  2PM6 B;  3ULE C;  4KFM B;  5C9Z B;  2CN3 A;  2Z2O A;  3JZH A;  4O9D A;  5FXY A;  4HDJ A;  3RFH A;  2J55 H;  3EI1 B;  3I7N A;  5GXH A;  1GP2 B;  5I5J A;  2UZX B;  3RMZ D;  3GRE A;  3NVN A;  3PVU B;  1Q47 A;  5GXI A;  1PGU A;  2GC4 A;  3IIY A;  4GM8 A;  2IWF A;  4ERZ A;  2B5M A;  1JMX B;  5EMK B;  4IMM A;  3J80 g;  2TRC B;  3MKS B;  4PNK B;  4EWR A;  4O3T B;  4I79 A;  3N0E A;  3UVO A;  4E54 B;  1S4U X;  1ERJ A;  1XKS A;  2HXC A;  3VH0 A;  3EG6 A;  4XYI A;  4ESG A;  2H13 A;  2GNQ A;  2H47 A;  4R7A B;  4GGC A;  2HJ4 A;  3I7K A;  2OVQ B;  5K19 A;  4ZOV A;  4E54 A;  2I0S A;  2XL2 A;  3UVK A;  5AFU 3;  4PSW B;  3ODT A;  3NVQ A;  3PE7 A;  3UVN A;  3OL2 A;  5CYK B;  3JAM g;  3RLM D;  4GZ8 A;  4A2M A;  4J8G A;  1VYH C;  4OWR A;  3BWS A;  1K8K C;  4CY1 A;  3FGB A;  5GSA A;  2OVR B;  4PXW A;  5EAL A;  2EBS A;  4A0B A;  3K26 A;  2W18 A;  3MZL A;  3RSE C;  1R5M A;  2O9K A;  1U2V C;  4J86 A;  5THA A;  3ZWL B;  4J78 A;  4FB1 D;  2PM9 B;  4YVD A;  2HJB A;  3SXT D;  2IUP A;  2BCJ B;  2UZY B;  5H14 A;  3PVW B;  3A0F A;  5IC7 A;  5TF2 A;  4CY3 A;  3SN6 B;  5A2Q g;  5AJA A;  3N0D A;  1N6E A;  3U4Y A;  5FLX g;  3UKR C;  2G9A A;  4H5J A;  3K27 A;  5EM2 B;  4GMB A;  4J0X A;  1GOT B;  1PEV A;  4J84 A;  2I3T A;  5CXC B;  5SXM A;  3L4M D;  5EMM B;  4FAN D;  4X63 B;  2OK6 A;  4CC9 A;  4CZX A;  4G56 B;  4PBZ A;  3UVL A;  2AGZ A;  1SHY B;  4JD2 C;  4A2L A;  2AGW A;  2IUV A;  4CZY A;  1N6F A;  5FQD A;  5EM2 A;  4OZU A;  4J77 A;  3JRP A;  1JOF A;  4ES0 A;  5B4W A;  1OLZ A;  4ZN4 A;  2YMU A;  3J81 g;  3I7H A;  3UVM A;  4JSN C;  3SHF A;  4J73 A;  3C99 A;  4ZOY A;  3EI2 A;  4BH6 A;  2I0T A;  2P9L C;  3C5M A;  4L3H D;  3I7L A;  4ERQ A;  2YNN A;  5FKR A;  3RN1 D;  4ERY A;  4GGA A;  3UR4 A;  3JPX A;  5HE1 B;  2MTA H;  4FA4 D;  4GM9 A;  1MG3 A;  4JT6 C;  3EI1 A;  5TEE A;  5CXB B;  2AQ5 A;  3SFZ A;  4CI3 A;  1TBG A;  4JT5 C;  3DM0 A;  4GM3 A;  2P9N C;  2XU7 A;  4E5Z B;  4GGD A;  2J57 G;  2H6N A;  2B5N A;  3KRW B;  3CFS B;  3PSC B;  1B9Y A;  4PC0 A;  4QT8 A;  2H9L A;  4H5I A;  4X61 B;  5CXB A;  4UI9 R;  1SQ9 A;  3I8C A;  3PXW D;  3PSL A;  2AGY A;  4A0A B;  2AGL A;  2OK4 A;  5IT9 g;  2Z2P A;  4JSV C;  3F3P A;  4J0W A;  2YBA A;  4E5Z A;  4U7A A;  2XL3 A;  5IGQ A;  3EWE A;  1MG2 A;  3W15 A;  3SLE D;  4LG9 A;  1MDA H;  1OMW B;  2CE8 A;  3L4O D;  3I2N A;  3NVX A;  4MK0 B;  3JB9 L;  4K3J B;  4O1Q D;  3V7D B;  3P4F A;  5HE2 B;  1SQJ A;  3AL9 A;  1GXR A;  5KDO B;  2B4E A;  3B7F A;  5CYK A;  4L1Q D;  3MXX A;  2B5L A;  3RRM C;  3SMR A;  2HES X;  3IJ1 A;  4ZOZ A;  3CIK B;  1FWX A;  4JXM A;  1K32 A;  2H6K A;  5HE3 B;  3SBP A;  3I8E A;  5FKT A;  2CO0 A;  3DXM C;  2AH0 A;  3SCY A;  5FA5 B;  3SJL D;  5EML B;  2IUR A;  1QNI A;  3OTT A;  3FM0 A;  5GMK n;  4CI8 A;  2PM9 A;  2CE9 A;  4FA1 D;  4A11 B;  3ORV D;  4U1E I;  2G99 A;  5EMJ B;  4AEZ A;  5TDH B;  3KRX B;  4FAV D;  3AFC A;  3F3F A;  3BG0 A;  1XHM A;  3SWS D;  2PBI B;  2YB8 B;  3I89 A;  4A09 B;  4TZ4 A;  5CXC A;  4A11 A;  1YFQ A;  5C2W B;  4GQ2 P;  3DXK C;  4Y7R A;  2CNX A;  3DWL C;  4XYH A;  3OW8 A;  5I5M A;  3C75 H;  2H9P A;  3JZG A;  2H68 A;  3V9F A;  2YNP A;  3CFV A;  2Q7Q A;  3I7P A;  4A09 A;  4O45 A;  2HYE A;  5FKQ A;  4J82 A;  5IGO A;  2HKR A;  3MMY A;  1NEX B;  5IJ8 E;  3AH8 B;  1TYQ C;  2XYI A;  5FKS A;  1JJU B;  4FA9 D;  2GC7 A;  3MKQ A;  3AL8 B;  2P9U C;  3E0C A;  3EI3 B;  3RN0 D;  4QQE A;  4O3U B;  2J56 H;  1PBY B;  2H9N A;  3PXT D;  4XEI C; 
#chains in the Genus database with same CATH topology
 2P9S C;  1GG2 B;  1U4C A;  4X60 B;  3BG1 A;  4N14 A;  5IJ7 E;  3EU7 A;  2VDN A;  5AMS A;  3FRX A;  3AL8 A;  3SBR A;  3EI3 A;  4WJK A;  4JSP C;  3IKO A;  4NEN A;  3QI0 A;  4PBY A;  4BUJ C;  3IJC A;  3PXS D;  4Y5R D;  2EIE A;  4FA5 D;  1N6D A;  3OL2 B;  4Z7N A;  3OKW A;  5HE0 B;  4A0A A;  4FWW A;  3SVW D;  4L3G D;  4GQ1 A;  2BBK H;  5C2V B;  3JZN A;  4A7J A;  1E8N A;  4CZV A;  1VE6 A;  3K72 A;  1GOF A;  4CY5 A;  2H9M A;  2IAA A;  4J8B A;  3MZK A;  4A0B B;  2QC5 A;  4L9O A;  3QHY B;  3EMH A;  3SBQ A;  4A08 B;  4AMZ A;  2CN2 A;  3V5W B;  5JWZ A;  4J81 A;  4D0K A;  2H3X A;  1C9L A;  1UOP A;  3HFQ A;  4QL1 A;  4AOW A;  1A0R B;  5K1C C;  1JMZ B;  1O6F A;  2OJY A;  4IA9 A;  4NSX A;  4CI1 A;  3MVD K;  2HU8 A;  5EAR A;  1BPO A;  5HYN B;  2P9P C;  1M1X A;  3C9C A;  5H1M A;  2P9I C;  3IIW A;  3EI4 B;  4GQB B;  3V4P A;  2H6Q A;  4LG8 A;  1PI6 A;  4A08 A;  3OKY B;  4FHL A;  5E6U A;  3VGZ A;  3O4G A;  4Z8L A;  3OKT A;  2AGX A;  3RFG A;  4BL0 A;  4PSX B;  2OVP B;  4AN0 A;  3DSM A;  2AH1 A;  4QAM A;  3IJ0 A;  4LGN A;  2OIZ A;  4ZOX A;  2IWK A;  2I3S A;  4J79 A;  1XIP A;  2P9K C;  3EI4 A;  2PM7 B;  5I5I A;  4QRJ A;  3OKY A;  1I2M B;  1L0Q A;  2I0R A;  4O02 A;  3UKU C;  4K3I D;  4WK4 A;  5H17 A;  5E6R A;  4CI2 A;  5HQG A;  4X3E A;  2IUQ A;  5EAM A;  4Z7Q A;  2QXV A;  2Z2N A;  4J87 A;  2JKX A;  5EAP A;  3EI2 B;  3ZE0 A;  4D6V A;  2HKM A;  1NR0 A;  2YNO A;  3GFC A;  4CY2 A;  3ZDZ A;  3IJE A;  2CO0 C;  3VA6 A;  2XE4 A;  3JRO A;  4MMX A;  2H14 A;  3F3G A;  1YR2 A;  1RI6 A;  5TEF A;  1P22 A;  3I7O A;  5HDB A;  3EQ9 A;  4JSX C;  1B9X A;  2PM6 B;  3ULE C;  4KFM B;  5C9Z B;  2CN3 A;  2Z2O A;  3JZH A;  4O9D A;  5FXY A;  4HDJ A;  3RFH A;  2J55 H;  3EI1 B;  3I7N A;  5GXH A;  1GP2 B;  5I5J A;  1H2W A;  2UZX B;  3RMZ D;  3GRE A;  3NVN A;  3PVU B;  2VDL A;  1Q47 A;  1H2Z A;  5GXI A;  5FFO A;  1PGU A;  2GC4 A;  1UOO A;  3ZE2 A;  3IIY A;  4GM8 A;  2IWF A;  4ERZ A;  3IUJ A;  2B5M A;  3FCS A;  1JMX B;  5EMK B;  2VDP A;  4IMM A;  3J80 g;  1VZ3 A;  2TRC B;  3MKS B;  3IUM A;  4PNK B;  4EWR A;  3IUN A;  2XZG A;  4O3T B;  1GOH A;  1A12 A;  2BKL A;  3ZE1 A;  4I79 A;  3N0E A;  3NIG A;  3UVO A;  4E54 B;  1S4U X;  1ERJ A;  1XKS A;  2HXC A;  3VH0 A;  1GOG A;  3EG6 A;  3GD1 I;  3O4J A;  4XYI A;  2VDR A;  3VI3 A;  1JTD B;  4ESG A;  3K6S A;  5M5U A;  2H13 A;  2GNQ A;  2H47 A;  4R7A B;  4GGC A;  2HJ4 A;  2WQ8 A;  2EID A;  3I7K A;  2OVQ B;  5K19 A;  4ZOV A;  1VE7 A;  3T3P A;  4E54 A;  2I0S A;  2EIC A;  2XL2 A;  3UVK A;  5AFU 3;  4PSW B;  4G1E A;  3ODT A;  3NVQ A;  3PE7 A;  3UVN A;  5C86 A;  3OL2 A;  5CYK B;  3JAM g;  3RLM D;  2VDK A;  4GZ8 A;  4A2M A;  4J8G A;  1VYH C;  1VZ2 A;  4BCC A;  4DNU A;  4OWR A;  3BWS A;  1K8K C;  4CY1 A;  3FGB A;  5GSA A;  4Z7O A;  2OVR B;  4PXW A;  4AN1 A;  3ZDX A;  1T2X A;  5EAL A;  2EBS A;  4A0B A;  3K26 A;  2W18 A;  3MZL A;  3RSE C;  1R5M A;  2O9K A;  1U2V C;  4J86 A;  5THA A;  3ZWL B;  4J78 A;  4FB1 D;  2PM9 B;  4YVD A;  2HJB A;  3SXT D;  4G1M A;  3GC3 B;  2IUP A;  3NID A;  2BCJ B;  2UZY B;  5E6S A;  5H14 A;  3VI4 A;  3PVW B;  3OF7 A;  3A0F A;  5IC7 A;  5TF2 A;  4CY3 A;  3SN6 B;  5A2Q g;  5AJA A;  3N0D A;  1N6E A;  3U4Y A;  5FLX g;  3UKR C;  2G9A A;  4H5J A;  3K27 A;  4AX4 A;  5EM2 B;  4G55 A;  4NBM A;  4GMB A;  4J0X A;  5M5S A;  1GOT B;  2HU5 A;  1PEV A;  5M61 A;  4DNV A;  4J84 A;  2QR5 A;  2I3T A;  3IVM A;  5CXC B;  5SXM A;  3L4M D;  5EMM B;  4FAN D;  4X63 B;  2OK6 A;  4CC9 A;  4CZX A;  4G56 B;  1QFM A;  4NAA A;  4PBZ A;  3UVL A;  2AGZ A;  1SHY B;  4JD2 C;  4A2L A;  2AGW A;  2IUV A;  4CZY A;  1N6F A;  5FQD A;  5EM2 A;  4OZU A;  3EQ7 A;  4J77 A;  3JRP A;  1L5G A;  1JOF A;  4ES0 A;  2VZ3 A;  5B4W A;  1OLZ A;  4D9S A;  4ZN4 A;  3V4V A;  3T3M A;  2YMU A;  3J81 g;  4RE5 A;  3I7H A;  3UVM A;  4JSN C;  3SHF A;  4J73 A;  3C99 A;  4ZOY A;  3EI2 A;  4BH6 A;  2I0T A;  3DDU A;  2P9L C;  3C5M A;  4L3H D;  3I7L A;  4ERQ A;  1E8M A;  2YNN A;  3IUQ A;  5FKR A;  3RN1 D;  1H2Y A;  4ERY A;  4GGA A;  1QFS A;  1U8C A;  5M5V A;  3UR4 A;  3JPX A;  5HE1 B;  2MTA H;  3O4H A;  4FA4 D;  4GM9 A;  1MG3 A;  4JT6 C;  3EI1 A;  4BCB A;  5TEE A;  5CXB B;  2AQ5 A;  1O6G A;  3SFZ A;  4CI3 A;  1TBG A;  4JT5 C;  3DM0 A;  4GM3 A;  2P9N C;  2XU7 A;  4E5Z B;  4GGD A;  2J57 G;  3MUN A;  2H6N A;  4AMY A;  2B5N A;  3KRW B;  3CFS B;  5M5R A;  3PSC B;  1B9Y A;  1UOQ A;  4PC0 A;  4QT8 A;  2H9L A;  4H5I A;  4X61 B;  5CXB A;  4UI9 R;  1SQ9 A;  3IUL A;  3I8C A;  3PXW D;  3PSL A;  2AGY A;  4A0A B;  2AGL A;  3ZDY A;  2EIB A;  2OK4 A;  4MMY A;  5IT9 g;  2Z2P A;  4JSV C;  3NIF A;  3F3P A;  4J0W A;  2YBA A;  4E5Z A;  3MUO A;  4U7A A;  2XL3 A;  5IGQ A;  3EWE A;  1MG2 A;  3W15 A;  3SLE D;  4LG9 A;  4MMZ A;  1C9I A;  4O2W A;  1MDA H;  1OMW B;  2CE8 A;  3L4O D;  3I2N A;  3NVX A;  4JHP C;  4MK0 B;  4BCD A;  5C92 A;  3EQ8 A;  4BP8 A;  3JB9 L;  4K3J B;  4IRZ A;  4O1Q D;  3V7D B;  3P4F A;  5HE2 B;  1SQJ A;  3AL9 A;  1GXR A;  5KDO B;  2B4E A;  3B7F A;  5CYK A;  4L1Q D;  3MXX A;  2B5L A;  3RRM C;  3SMR A;  2HES X;  1JV2 A;  3IJ1 A;  4ZOZ A;  3CIK B;  1FWX A;  1H2X A;  4UM8 A;  1TYE A;  4JXM A;  1K32 A;  2H6K A;  5HE3 B;  4BP9 A;  3SBP A;  3I8E A;  5FKT A;  2CO0 A;  3DXM C;  2AH0 A;  3SCY A;  5FA5 B;  3SJL D;  5EML B;  2IUR A;  1QNI A;  3OTT A;  3FM0 A;  5GMK n;  3IUR A;  4CI8 A;  2PM9 A;  1E5T A;  2CE9 A;  4FA1 D;  4A11 B;  3ORV D;  4U1E I;  3FCU A;  2G99 A;  5EMJ B;  4AEZ A;  5TDH B;  3KCI A;  2VZ1 A;  2VC2 A;  3KRX B;  4FAV D;  3AFC A;  3F3F A;  5M5T A;  3O4I A;  3BG0 A;  1XHM A;  3SWS D;  2PBI B;  2YB8 B;  5FFG A;  3I89 A;  4A09 B;  4TZ4 A;  5CXC A;  4A11 A;  1YFQ A;  5C2W B;  2VDM A;  4GQ2 P;  4L1M A;  3DXK C;  4Y7R A;  2CNX A;  3DWL C;  4XYH A;  4WK0 A;  4WK2 A;  3OW8 A;  5I5M A;  2QZP A;  3C75 H;  2H9P A;  3JZG A;  2H68 A;  4RE6 A;  4UM9 A;  3V9F A;  2YNP A;  4NC4 A;  3CFV A;  2Q7Q A;  2HU7 A;  3I7P A;  4A09 A;  4O45 A;  2HYE A;  5FKQ A;  4J82 A;  5IGO A;  2HKR A;  1UTC A;  3MMY A;  1NEX B;  5IJ8 E;  3AH8 B;  1TYQ C;  1K3I A;  3K71 A;  2XYI A;  5FKS A;  1JJU B;  4FA9 D;  2GC7 A;  2XDW A;  2VDQ A;  2VDO A;  3MKQ A;  3AL8 B;  2P9U C;  3E0C A;  3EI3 B;  4JHN A;  3RN0 D;  4QQE A;  4O3U B;  2J56 H;  1PBY B;  2H9N A;  3PXT D;  4XEI C;  4DNW A; 
#chains in the Genus database with same CATH homology
 2P9S C;  1GG2 B;  1U4C A;  4X60 B;  3BG1 A;  4N14 A;  5IJ7 E;  3EU7 A;  5AMS A;  3FRX A;  3AL8 A;  3SBR A;  3EI3 A;  4JSP C;  3IKO A;  4PBY A;  4BUJ C;  3IJC A;  3PXS D;  4Y5R D;  4FA5 D;  1N6D A;  3OL2 B;  3OKW A;  5HE0 B;  4A0A A;  4FWW A;  3SVW D;  4L3G D;  4GQ1 A;  2BBK H;  5C2V B;  3JZN A;  4A7J A;  4CZV A;  4CY5 A;  2H9M A;  2IAA A;  4J8B A;  3MZK A;  4A0B B;  2QC5 A;  4L9O A;  3EMH A;  3SBQ A;  4A08 B;  2CN2 A;  3V5W B;  5JWZ A;  4J81 A;  4D0K A;  2H3X A;  4QL1 A;  4AOW A;  3HFQ A;  1A0R B;  5K1C C;  1JMZ B;  2OJY A;  4IA9 A;  4NSX A;  4CI1 A;  5EAR A;  5HYN B;  2P9P C;  3C9C A;  5H1M A;  2P9I C;  3IIW A;  3EI4 B;  4GQB B;  2H6Q A;  4LG8 A;  1PI6 A;  4A08 A;  3OKY B;  4FHL A;  3VGZ A;  4Z8L A;  3OKT A;  2AGX A;  3RFG A;  4BL0 A;  4PSX B;  2OVP B;  3DSM A;  2AH1 A;  3IJ0 A;  4LGN A;  2OIZ A;  4ZOX A;  2IWK A;  2I3S A;  4J79 A;  1XIP A;  2P9K C;  3EI4 A;  2PM7 B;  5I5I A;  4QRJ A;  3OKY A;  1L0Q A;  2I0R A;  3UKU C;  4K3I D;  5H17 A;  4CI2 A;  5HQG A;  4X3E A;  2IUQ A;  5EAM A;  2QXV A;  2Z2N A;  4J87 A;  5EAP A;  3EI2 B;  4D6V A;  2HKM A;  1NR0 A;  2YNO A;  3GFC A;  4CY2 A;  3VA6 A;  2CO0 C;  3JRO A;  2H14 A;  3F3G A;  1RI6 A;  5TEF A;  1P22 A;  3I7O A;  4JSX C;  1B9X A;  2PM6 B;  3ULE C;  4KFM B;  5C9Z B;  2CN3 A;  2Z2O A;  3JZH A;  4O9D A;  5FXY A;  4HDJ A;  3RFH A;  2J55 H;  3EI1 B;  3I7N A;  5GXH A;  1GP2 B;  5I5J A;  2UZX B;  3RMZ D;  3GRE A;  3NVN A;  3PVU B;  1Q47 A;  5GXI A;  1PGU A;  2GC4 A;  3IIY A;  4GM8 A;  2IWF A;  4ERZ A;  2B5M A;  1JMX B;  5EMK B;  4IMM A;  3J80 g;  2TRC B;  3MKS B;  4PNK B;  4EWR A;  4O3T B;  4I79 A;  3N0E A;  3UVO A;  4E54 B;  1S4U X;  1ERJ A;  1XKS A;  2HXC A;  3VH0 A;  3EG6 A;  4XYI A;  4ESG A;  2H13 A;  2GNQ A;  2H47 A;  4R7A B;  4GGC A;  2HJ4 A;  3I7K A;  2OVQ B;  5K19 A;  4ZOV A;  4E54 A;  2I0S A;  2XL2 A;  3UVK A;  5AFU 3;  4PSW B;  3ODT A;  3NVQ A;  3PE7 A;  3UVN A;  3OL2 A;  5CYK B;  3JAM g;  3RLM D;  4GZ8 A;  4A2M A;  4J8G A;  1VYH C;  4OWR A;  3BWS A;  1K8K C;  4CY1 A;  3FGB A;  5GSA A;  2OVR B;  4PXW A;  5EAL A;  2EBS A;  4A0B A;  3K26 A;  2W18 A;  3MZL A;  3RSE C;  1R5M A;  2O9K A;  1U2V C;  4J86 A;  5THA A;  3ZWL B;  4J78 A;  4FB1 D;  2PM9 B;  4YVD A;  2HJB A;  3SXT D;  2IUP A;  2BCJ B;  2UZY B;  5H14 A;  3PVW B;  3A0F A;  5IC7 A;  5TF2 A;  4CY3 A;  3SN6 B;  5A2Q g;  5AJA A;  3N0D A;  1N6E A;  3U4Y A;  5FLX g;  3UKR C;  2G9A A;  4H5J A;  3K27 A;  5EM2 B;  4GMB A;  4J0X A;  1GOT B;  1PEV A;  4J84 A;  2I3T A;  5CXC B;  5SXM A;  3L4M D;  5EMM B;  4FAN D;  4X63 B;  2OK6 A;  4CC9 A;  4CZX A;  4G56 B;  4PBZ A;  3UVL A;  2AGZ A;  1SHY B;  4JD2 C;  4A2L A;  2AGW A;  2IUV A;  4CZY A;  1N6F A;  5FQD A;  5EM2 A;  4OZU A;  4J77 A;  3JRP A;  1JOF A;  4ES0 A;  5B4W A;  1OLZ A;  4ZN4 A;  2YMU A;  3J81 g;  3I7H A;  3UVM A;  4JSN C;  3SHF A;  4J73 A;  3C99 A;  4ZOY A;  3EI2 A;  4BH6 A;  2I0T A;  2P9L C;  3C5M A;  4L3H D;  3I7L A;  4ERQ A;  2YNN A;  5FKR A;  3RN1 D;  4ERY A;  4GGA A;  3UR4 A;  3JPX A;  5HE1 B;  2MTA H;  4FA4 D;  4GM9 A;  1MG3 A;  4JT6 C;  3EI1 A;  5TEE A;  5CXB B;  2AQ5 A;  3SFZ A;  4CI3 A;  1TBG A;  4JT5 C;  3DM0 A;  4GM3 A;  2P9N C;  2XU7 A;  4E5Z B;  4GGD A;  2J57 G;  2H6N A;  2B5N A;  3KRW B;  3CFS B;  3PSC B;  1B9Y A;  4PC0 A;  4QT8 A;  2H9L A;  4H5I A;  4X61 B;  5CXB A;  4UI9 R;  1SQ9 A;  3I8C A;  3PXW D;  3PSL A;  2AGY A;  4A0A B;  2AGL A;  2OK4 A;  5IT9 g;  2Z2P A;  4JSV C;  3F3P A;  4J0W A;  2YBA A;  4E5Z A;  4U7A A;  2XL3 A;  5IGQ A;  3EWE A;  1MG2 A;  3W15 A;  3SLE D;  4LG9 A;  1MDA H;  1OMW B;  2CE8 A;  3L4O D;  3I2N A;  3NVX A;  4MK0 B;  3JB9 L;  4K3J B;  4O1Q D;  3V7D B;  3P4F A;  5HE2 B;  1SQJ A;  3AL9 A;  1GXR A;  5KDO B;  2B4E A;  3B7F A;  5CYK A;  4L1Q D;  3MXX A;  2B5L A;  3RRM C;  3SMR A;  2HES X;  3IJ1 A;  4ZOZ A;  3CIK B;  1FWX A;  4JXM A;  1K32 A;  2H6K A;  5HE3 B;  3SBP A;  3I8E A;  5FKT A;  2CO0 A;  3DXM C;  2AH0 A;  3SCY A;  5FA5 B;  3SJL D;  5EML B;  2IUR A;  1QNI A;  3OTT A;  3FM0 A;  5GMK n;  4CI8 A;  2PM9 A;  2CE9 A;  4FA1 D;  4A11 B;  3ORV D;  4U1E I;  2G99 A;  5EMJ B;  4AEZ A;  5TDH B;  3KRX B;  4FAV D;  3AFC A;  3F3F A;  3BG0 A;  1XHM A;  3SWS D;  2PBI B;  2YB8 B;  3I89 A;  4A09 B;  4TZ4 A;  5CXC A;  4A11 A;  1YFQ A;  5C2W B;  4GQ2 P;  3DXK C;  4Y7R A;  2CNX A;  3DWL C;  4XYH A;  3OW8 A;  5I5M A;  3C75 H;  2H9P A;  3JZG A;  2H68 A;  3V9F A;  2YNP A;  3CFV A;  2Q7Q A;  3I7P A;  4A09 A;  4O45 A;  2HYE A;  5FKQ A;  4J82 A;  5IGO A;  2HKR A;  3MMY A;  1NEX B;  5IJ8 E;  3AH8 B;  1TYQ C;  2XYI A;  5FKS A;  1JJU B;  4FA9 D;  2GC7 A;  3MKQ A;  3AL8 B;  2P9U C;  3E0C A;  3EI3 B;  3RN0 D;  4QQE A;  4O3U B;  2J56 H;  1PBY B;  2H9N A;  3PXT D;  4XEI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...