2AH1A

Crystal structure of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 97
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ah1A01
5FQDA 2XL2A 4J73A 4ZOXA 5EMMB 3ODTA 3PXWD 4ES0A 5EARA 3SLED 4Z8LA 1MG2A 2OVRB 4O45A 3AL8A 3J81g 4A0AA 3JZNA 4JSNC 2AH0A 5C2WB 4QQEA 4O1QD 2GNQA 4A0AB 4JSXC 5C2VB 4H5IA 4ERYA 4E54B 1Q47A 3MKSB 2AGLA 3PVUB 3NVQA 4JSVC 3B7FA 4A09B 2I0SA 2UZYB 3ORVD 4GQ2P 3V7DB 5CYKA 2HJBA 4CZVA 2P9IC 1ERJA 4FAND 4FAVD 5CXBB 1TBGA 5I5MA 4QT8A 2AGZA 2B5NA 2XU7A 4GGDA 4J8BA 3F3PA 2I3SA 3OKYA 2XL3A 3OKTA 5H1MA 3HFQA 5HE3B 3I7NA 4JXMA 2PM7B 1U2VC 3MZLA 3AH8B 4CI1A 3FM0A 5AMSA 5EM2A 2YBAA 4X60B 5EM2B 4O3TB 3C5MA 3JZGA 2CN2A 3EU7A 4J86A 3V5WB 4A08A 3I7OA 5FKQA 3UVMA 5FKRA 2CO0C 4E5ZB 4BH6A 3W15A 1B9YA 3K27A 3N0DA 4GMBA 4FHLA 5FLXg 2H9MA 2IUPA 3DXKC 4YVDA 5FA5B 2Z2NA 2OIZA 3CFVA 3F3GA 3JRPA 3RFHA 3I2NA 2Z2PA 3RN0D 3UR4A 4CI2A 3OKWA 3FRXA 4LGNA 3EI3B 2IWKA 2QC5A 4D6VA 1GOTB 5K19A 5EMJB 3RMZD 4A2LA 2GC4A 2O9KA 1JJUB 4AOWA 3U4YA 1XKSA 4BUJC 3EI2B 4OWRA 2P9KC 3SBQA 1XHMA 2P9UC 1N6DA 3FGBA 4A0BB 3RRMC 3EG6A 1GXRA 4GQ1A 2PM9B 3IIYA 4XEIC 4LG9A 4A2MA 1P22A 2B5LA 2OK6A 2AGYA 3PVWB 2HESX 4IMMA 2PBIB 3SFZA 4ERZA 2AQ5A 4L3HD 3BWSA 2YNPA 1S4UX 4H5JA 2P9LC 1SQJA 4E54A 1VYHC 3DXMC 4CI3A 2CO0A 5AJAA 3C9CA 3IJCA 4A09A 5HE0B 2H68A 1N6FA 3MMYA 4Y7RA 3C99A 4FB1D 3I7PA 3UKRC 3I8CA 4TZ4A 2IAAA 4LG8A 4J78A 5CXBA 4A7JA 3JROA 2UZXB 2H13A 1XIPA 3SJLD 4CZXA 4GM3A 2YMUA 2YNOA 2H6KA 3I89A 2I0TA 4FA5D 3CIKB 4I79A 3EI4A 5I5JA 4PBYA 2CNXA 3EI4B 5IGQA 5IJ7E 2G99A 4PSXB 4PSWB 4ZOZA 1GG2B 2HJ4A 3A0FA 4GGCA 4J77A 5HYNB 2H9PA 3MZKA 4U7AA 3KRWB 2YNNA 2BCJB 4GM9A 5H14A 2H9NA 4ZN4A 1B9XA 4JD2C 4ESGA 2H3XA 2HKRA 2HKMA 5EAPA 4QL1A 4K3JB 4AEZA 2TRCB 4ERQA 5FKTA 3PXTD 4HDJA 1JOFA 3VH0A 4E5ZA 2J57G 3F3FA 1PGUA 3SWSD 4FA1D 1QNIA 5IC7A 2I0RA 2P9SC 4J0WA 2QXVA 5AFU3 1MG3A 4L3GD 4GGAA 1K32A 3C75H 3BG0A 3PE7A 4JT6C 4XYIA 3I7HA 1L0QA 4K3ID 5GMKn 3K26A 1YFQA 1RI6A 3IKOA 1GP2B 1TYQC 3EI3A 3JPXA 1OLZA 1SQ9A 2OK4A 1R5MA 3NVXA 2IURA 2HYEA 5FKSA 2H47A 2OVQB 4J8GA 4IA9A 3EWEA 5IT9g 3UKUC 5A2Qg 4GZ8A 3KRXB 4J81A 4CY1A 5C9ZB 1JMXB 5EMKB 1JMZB 4X61B 5TDHB 5TEEA 4J0XA 2AGXA 3EI2A 3RSEC 5HE1B 3JAMg 3I8EA 2H6NA 2HXCA 4GM8A 4A0BA 2CN3A 3SN6B 2H14A 3MKQA 1A0RB 3OL2A 1N6EA 2PM9A 3EI1B 2B5MA 5H17A 2YB8B 3OL2B 3SCYA 3SMRA 3GREA 4MK0B 3L4OD 4CC9A 3J80g 1NR0A 3N0EA 2MTAH 4OZUA 3V9FA 2Z2OA 4UI9R 3EMHA 5IGOA 3I7LA 2PM6B 4J87A 3SHFA 5EAMA 5B4WA 3ULEC 2H6QA 3RFGA 2GC7A 4CY5A 3UVOA 2P9PC 2I3TA 3RN1D 3SBRA 3AL9A 3DWLC 4JT5C 3P4FA 5CXCA 5EALA 3AL8B 4N14A 4X3EA 5CXCB 1PI6A 3BG1A 3OW8A 2AH1A 2XYIA 3CFSB 3PXSD 4JSPC 4R7AB 1K8KC 5JWZA 2EBSA 3DM0A 1OMWB 3UVNA 3IJ1A 5CYKB 3JZHA 5I5IA 1PBYB 1PEVA 1MDAH 4G56B 4CY2A 3UVLA 5GSAA 2OJYA 4O9DA 4O3UB 3E0CA 5EMLB 3OKYB 5GXIA 3RLMD 4Y5RD 4ZOVA 2J56H 3MXXA 2IUVA 2CE9A 3NVNA 4U1EI 2J55H 3AFCA 3OTTA 2W18A 2BBKH 4KFMB 1NEXB 5KDOB 4PNKB 2B4EA 4FA4D 4J79A 4BL0A 4X63B 3IIWA 4A08B 3ZWLB 2P9NC 5SXMA 5GXHA 1U4CA 5IJ8E 3PSLA 4PC0A 4XYHA 5K1CC 4QRJA 3L4MD 2H9LA 1FWXA 4ZOYA 4PXWA 3SXTD 2IUQA 3I7KA 3SVWD 5HE2B 4FA9D 2OVPB 4GQBB 3IJ0A 4CZYA 4CI8A 5HQGA 4A11A 4CY3A 5TEFA 3VA6A 3JB9L 3DSMA 3EI1A 5THAA 4EWRA 4A11B 3GFCA 4NSXA 4J82A 4PBZA 4L9OA 2CE8A 3PSCB 3VGZA 2Q7QA 4J84A 5TF2A 3UVKA 3SBPA 2IWFA 4D0KA 2AGWA 1SHYB 2G9AA 4FWWA 4L1QD 5FXYA
chains in the Genus database with same CATH superfamily
5FQDA 2HU5A 2XL2A 4J73A 4BCDA 4ZOXA 5EMMB 3ODTA 3PXWD 5E6RA 5EARA 4ES0A 3SLED 1C9IA 1VE6A 4Z8LA 1MG2A 3FCUA 2OVRB 4O45A 4RE6A 3AL8A 3J81g 4A0AA 3JZNA 1VZ2A 4JSNC 2AH0A 5C2WB 4QQEA 4O1QD 4AX4A 2GNQA 4A0AB 4JSXC 5C2VB 4H5IA 4ERYA 4E54B 1Q47A 4BCCA 4WK2A 3MKSB 2AGLA 3PVUB 3NVQA 4JSVC 3B7FA 4A09B 2I0SA 2UZYB 3ORVD 4GQ2P 3V7DB 5CYKA 2HJBA 4CZVA 3MUOA 3OF7A 2P9IC 1ERJA 4FAND 4FAVD 2VDKA 5CXBB 1VE7A 5M5RA 1TBGA 5I5MA 4QT8A 2AGZA 2B5NA 4O2WA 2XU7A 4GGDA 1GOHA 4J8BA 3F3PA 3NIFA 2I3SA 3OKYA 2XL3A 3OKTA 5H1MA 3HFQA 4WK4A 5HDBA 5HE3B 3I7NA 4JXMA 2PM7B 1U2VC 3MZLA 3AH8B 4CI1A 3FM0A 5AMSA 1E8MA 5EM2A 3GC3B 2HU7A 4WJKA 3T3PA 2YBAA 4X60B 5M5VA 3IUMA 5EM2B 4O3TB 3C5MA 4AMYA 3JZGA 2VC2A 2CN2A 3EU7A 4J86A 3V5WB 1TYEA 4A08A 3I7OA 5FKQA 3UVMA 2VDOA 5FKRA 3ZE2A 2CO0C 4E5ZB 4BH6A 3W15A 1B9YA 3K27A 3N0DA 4GMBA 3NIDA 4FHLA 5FLXg 1E5TA 4NAAA 2H9MA 2IUPA 3DXKC 3IUQA 4YVDA 5FA5B 2Z2NA 3ZDYA 2OIZA 3CFVA 4DNWA 3F3GA 1QFMA 3JRPA 2VZ3A 3I2NA 3RFHA 2Z2PA 3RN0D 3UR4A 4CI2A 3OKWA 3MVDK 3FRXA 4LGNA 3EI3B 2IWKA 2QC5A 4D6VA 3VI4A 1GOTB 5K19A 3MUNA 4Z7QA 5EMJB 1JV2A 5M5UA 3RMZD 4A2LA 1H2XA 2VDNA 5M5SA 2GC4A 2O9KA 1K3IA 1H2WA 1JJUB 4AOWA 3U4YA 1XKSA 4BUJC 3EI2B 4OWRA 2P9KC 3SBQA 4AMZA 1XHMA 2P9UC 1N6DA 3FGBA 3ZE1A 3IUJA 3VI3A 4A0BB 3RRMC 3EG6A 1GXRA 4G1EA 4GQ1A 1BPOA 2PM9B 3IIYA 4XEIC 4LG9A 4A2MA 1P22A 2B5LA 2OK6A 2AGYA 3PVWB 2HESX 4IMMA 2PBIB 3SFZA 4ERZA 1UOPA 2AQ5A 4L3HD 3BWSA 2YNPA 1S4UX 4H5JA 2P9LC 1SQJA 4G1MA 1VYHC 3DXMC 4E54A 4CI3A 2CO0A 2EIBA 5AJAA 2EICA 3C9CA 3IJCA 4A09A 5HE0B 1JTDB 2H68A 1N6FA 4G55A 3MMYA 4Y7RA 3C99A 4FB1D 3I7PA 3UKRC 3I8CA 4TZ4A 2IAAA 4LG8A 2HU8A 4J78A 5CXBA 4A7JA 5M61A 2QZPA 3JROA 2UZXB 2H13A 1UTCA 1XIPA 3SJLD 4CZXA 3QI0A 2YMUA 2YNOA 4GM3A 2H6KA 2JKXA 2I0TA 3I89A 4FA5D 3CIKB 4I79A 3EI4A 5I5JA 4PBYA 3K72A 2CNXA 2QR5A 3K6SA 3EI4B 5IGQA 5IJ7E 2G99A 4PSXB 3QHYB 4PSWB 4ZOZA 4UM8A 1A12A 1GG2B 2HJ4A 3A0FA 4GGCA 4J77A 2VDRA 3FCSA 5HYNB 2H9PA 3MZKA 4U7AA 3KRWB 2YNNA 2BCJB 4GM9A 5H14A 2H9NA 4ZN4A 1B9XA 4JD2C 4NC4A 4ESGA 2EIEA 1C9LA 2H3XA 2HKRA 2HKMA 5EAPA 4QL1A 5C92A 4K3JB 4AEZA 2TRCB 4RE5A 4ERQA 2XDWA 4NENA 5FKTA 3PXTD 1JOFA 3NIGA 4HDJA 3VH0A 4E5ZA 2J57G 3F3FA 1PGUA 5M5TA 3SWSD 4AN1A 1H2YA 4UM9A 4L1MA 1E8NA 1UOOA 4FA1D 4MMYA 1QNIA 5IC7A 2I0RA 2P9SC 4J0WA 2QXVA 5AFU3 1MG3A 4L3GD 4GGAA 1K32A 3C75H 3BG0A 3PE7A 4JT6C 4XYIA 3I7HA 1L0QA 4K3ID 5GMKn 3K26A 1YFQA 1RI6A 3IKOA 1T2XA 1GP2B 1TYQC 3EI3A 3JPXA 1OLZA 1SQ9A 2OK4A 5FFOA 1R5MA 3NVXA 2IURA 2HYEA 5FKSA 2H47A 3IULA 3EQ7A 2OVQB 4J8GA 4IA9A 3EWEA 5IT9g 1I2MB 3UKUC 5A2Qg 1QFSA 4GZ8A 3KRXB 4J81A 4CY1A 5C9ZB 1JMXB 5EMKB 1JMZB 4X61B 5TDHB 5TEEA 4J0XA 2AGXA 3EI2A 3RSEC 1GOGA 5HE1B 2VDQA 3JAMg 3I8EA 3ZDXA 2H6NA 2HXCA 4GM8A 4A0BA 2CN3A 3SN6B 2H14A 1VZ3A 1A0RB 3MKQA 3OL2A 1N6EA 3T3MA 2PM9A 3EI1B 2B5MA 3ZDZA 5H17A 2YB8B 1UOQA 3OL2B 3SCYA 3SMRA 3GREA 4MK0B 3L4OD 4CC9A 3J80g 1NR0A 3N0EA 2MTAH 4D9SA 4OZUA 3V9FA 2Z2OA 4UI9R 3EMHA 5IGOA 3I7LA 2PM6B 4J87A 3SHFA 5EAMA 5B4WA 3ULEC 2H6QA 3RFGA 2GC7A 4CY5A 3UVOA 2P9PC 3O4JA 2I3TA 4AN0A 3RN1D 4DNVA 5E6UA 3SBRA 2BKLA 3AL9A 4QAMA 3DWLC 4JT5C 3P4FA 5CXCA 2VDPA 5EALA 4WK0A 3AL8B 4N14A 4X3EA 5CXCB 4BP9A 3BG1A 1PI6A 3OW8A 2AH1A 4MMXA 2XYIA 3CFSB 3PXSD 1U8CA 4JSPC 4R7AB 2WQ8A 1K8KC 5JWZA 2EBSA 3DM0A 1OMWB 4O02A 3UVNA 3IJ1A 5CYKB 2XE4A 3JZHA 4IRZA 3V4PA 5I5IA 1PBYB 1PEVA 1MDAH 4G56B 4CY2A 4NBMA 3UVLA 5GSAA 4BP8A 2OJYA 4O9DA 3DDUA 4O3UB 3E0CA 5EMLB 3IURA 5FFGA 2VZ1A 3OKYB 3IJEA 5GXIA 4JHPC 4Z7OA 3RLMD 4Y5RD 4DNUA 4ZOVA 2J56H 3MXXA 1M1XA 2IUVA 2CE9A 3NVNA 4U1EI 1YR2A 5C86A 2J55H 3AFCA 3OTTA 2W18A 2BBKH 4KFMB 1NEXB 4BCBA 5KDOB 4PNKB 2B4EA 4FA4D 3EQ8A 4J79A 4BL0A 3KCIA 4X63B 3IIWA 2VDLA 4JHNA 4A08B 3ZWLB 2P9NC 5SXMA 1GOFA 5GXHA 1U4CA 5IJ8E 3PSLA 4PC0A 4XYHA 5K1CC 4QRJA 3L4MD 3EQ9A 2H9LA 1FWXA 5E6SA 3K71A 4ZOYA 2EIDA 4PXWA 3SXTD 3ZE0A 2IUQA 2XZGA 3I7KA 3SVWD 5HE2B 4FA9D 2OVPB 4GQBB 3IJ0A 4CZYA 4CI8A 5HQGA 4A11A 4CY3A 5TEFA 3VA6A 3O4HA 3JB9L 3DSMA 3EI1A 5THAA 4EWRA 4A11B 3GFCA 3O4GA 4NSXA 1O6FA 4J82A 4L9OA 4PBZA 2CE8A 3IVMA 3PSCB 1L5GA 3VGZA 4MMZA 4Z7NA 3IUNA 3O4IA 3GD1I 2Q7QA 4J84A 3V4VA 5TF2A 3UVKA 3SBPA 1O6GA 2IWFA 4D0KA 2AGWA 1SHYB 2G9AA 2VDMA 4FWWA 4L1QD 5FXYA 1H2ZA
chains in the Genus database with same CATH topology
5FQDA 2XL2A 4J73A 4ZOXA 5EMMB 3ODTA 3PXWD 4ES0A 5EARA 3SLED 4Z8LA 1MG2A 2OVRB 4O45A 3AL8A 3J81g 4A0AA 3JZNA 4JSNC 2AH0A 5C2WB 4QQEA 4O1QD 2GNQA 4A0AB 4JSXC 5C2VB 4H5IA 4ERYA 4E54B 1Q47A 3MKSB 2AGLA 3PVUB 3NVQA 4JSVC 3B7FA 4A09B 2I0SA 2UZYB 3ORVD 4GQ2P 3V7DB 5CYKA 2HJBA 4CZVA 2P9IC 1ERJA 4FAND 4FAVD 5CXBB 1TBGA 5I5MA 4QT8A 2AGZA 2B5NA 2XU7A 4GGDA 4J8BA 3F3PA 2I3SA 3OKYA 2XL3A 3OKTA 5H1MA 3HFQA 5HE3B 3I7NA 4JXMA 2PM7B 1U2VC 3MZLA 3AH8B 4CI1A 3FM0A 5AMSA 5EM2A 2YBAA 4X60B 5EM2B 4O3TB 3C5MA 3JZGA 2CN2A 3EU7A 4J86A 3V5WB 4A08A 3I7OA 5FKQA 3UVMA 5FKRA 2CO0C 4E5ZB 4BH6A 3W15A 1B9YA 3K27A 3N0DA 4GMBA 4FHLA 5FLXg 2H9MA 2IUPA 3DXKC 4YVDA 5FA5B 2Z2NA 2OIZA 3CFVA 3F3GA 3JRPA 3RFHA 3I2NA 2Z2PA 3RN0D 3UR4A 4CI2A 3OKWA 3FRXA 4LGNA 3EI3B 2IWKA 2QC5A 4D6VA 1GOTB 5K19A 5EMJB 3RMZD 4A2LA 2GC4A 2O9KA 1JJUB 4AOWA 3U4YA 1XKSA 4BUJC 3EI2B 4OWRA 2P9KC 3SBQA 1XHMA 2P9UC 1N6DA 3FGBA 4A0BB 3RRMC 3EG6A 1GXRA 4GQ1A 2PM9B 3IIYA 4XEIC 4LG9A 4A2MA 1P22A 2B5LA 2OK6A 2AGYA 3PVWB 2HESX 4IMMA 2PBIB 3SFZA 4ERZA 2AQ5A 4L3HD 3BWSA 2YNPA 1S4UX 4H5JA 2P9LC 1SQJA 4E54A 1VYHC 3DXMC 4CI3A 2CO0A 5AJAA 3C9CA 3IJCA 4A09A 5HE0B 2H68A 1N6FA 3MMYA 4Y7RA 3C99A 4FB1D 3I7PA 3UKRC 3I8CA 4TZ4A 2IAAA 4LG8A 4J78A 5CXBA 4A7JA 3JROA 2UZXB 2H13A 1XIPA 3SJLD 4CZXA 4GM3A 2YMUA 2YNOA 2H6KA 3I89A 2I0TA 4FA5D 3CIKB 4I79A 3EI4A 5I5JA 4PBYA 2CNXA 3EI4B 5IGQA 5IJ7E 2G99A 4PSXB 4PSWB 4ZOZA 1GG2B 2HJ4A 3A0FA 4GGCA 4J77A 5HYNB 2H9PA 3MZKA 4U7AA 3KRWB 2YNNA 2BCJB 4GM9A 5H14A 2H9NA 4ZN4A 1B9XA 4JD2C 4ESGA 2H3XA 2HKRA 2HKMA 5EAPA 4QL1A 4K3JB 4AEZA 2TRCB 4ERQA 5FKTA 3PXTD 4HDJA 1JOFA 3VH0A 4E5ZA 2J57G 3F3FA 1PGUA 3SWSD 4FA1D 1QNIA 5IC7A 2I0RA 2P9SC 4J0WA 2QXVA 5AFU3 1MG3A 4L3GD 4GGAA 1K32A 3C75H 3BG0A 3PE7A 4JT6C 4XYIA 3I7HA 1L0QA 4K3ID 5GMKn 3K26A 1YFQA 1RI6A 3IKOA 1GP2B 1TYQC 3EI3A 3JPXA 1OLZA 1SQ9A 2OK4A 1R5MA 3NVXA 2IURA 2HYEA 5FKSA 2H47A 2OVQB 4J8GA 4IA9A 3EWEA 5IT9g 3UKUC 5A2Qg 4GZ8A 3KRXB 4J81A 4CY1A 5C9ZB 1JMXB 5EMKB 1JMZB 4X61B 5TDHB 5TEEA 4J0XA 2AGXA 3EI2A 3RSEC 5HE1B 3JAMg 3I8EA 2H6NA 2HXCA 4GM8A 4A0BA 2CN3A 3SN6B 2H14A 3MKQA 1A0RB 3OL2A 1N6EA 2PM9A 3EI1B 2B5MA 5H17A 2YB8B 3OL2B 3SCYA 3SMRA 3GREA 4MK0B 3L4OD 4CC9A 3J80g 1NR0A 3N0EA 2MTAH 4OZUA 3V9FA 2Z2OA 4UI9R 3EMHA 5IGOA 3I7LA 2PM6B 4J87A 3SHFA 5EAMA 5B4WA 3ULEC 2H6QA 3RFGA 2GC7A 4CY5A 3UVOA 2P9PC 2I3TA 3RN1D 3SBRA 3AL9A 3DWLC 4JT5C 3P4FA 5CXCA 5EALA 3AL8B 4N14A 4X3EA 5CXCB 1PI6A 3BG1A 3OW8A 2AH1A 2XYIA 3CFSB 3PXSD 4JSPC 4R7AB 1K8KC 5JWZA 2EBSA 3DM0A 1OMWB 3UVNA 3IJ1A 5CYKB 3JZHA 5I5IA 1PBYB 1PEVA 1MDAH 4G56B 4CY2A 3UVLA 5GSAA 2OJYA 4O9DA 4O3UB 3E0CA 5EMLB 3OKYB 5GXIA 3RLMD 4Y5RD 4ZOVA 2J56H 3MXXA 2IUVA 2CE9A 3NVNA 4U1EI 2J55H 3AFCA 3OTTA 2W18A 2BBKH 4KFMB 1NEXB 5KDOB 4PNKB 2B4EA 4FA4D 4J79A 4BL0A 4X63B 3IIWA 4A08B 3ZWLB 2P9NC 5SXMA 5GXHA 1U4CA 5IJ8E 3PSLA 4PC0A 4XYHA 5K1CC 4QRJA 3L4MD 2H9LA 1FWXA 4ZOYA 4PXWA 3SXTD 2IUQA 3I7KA 3SVWD 5HE2B 4FA9D 2OVPB 4GQBB 3IJ0A 4CZYA 4CI8A 5HQGA 4A11A 4CY3A 5TEFA 3VA6A 3JB9L 3DSMA 3EI1A 5THAA 4EWRA 4A11B 3GFCA 4NSXA 4J82A 4PBZA 4L9OA 2CE8A 3PSCB 3VGZA 2Q7QA 4J84A 5TF2A 3UVKA 3SBPA 2IWFA 4D0KA 2AGWA 1SHYB 2G9AA 4FWWA 4L1QD 5FXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQD A;  2XL2 A;  4J73 A;  4ZOX A;  5EMM B;  3ODT A;  3PXW D;  4ES0 A;  5EAR A;  3SLE D;  4Z8L A;  1MG2 A;  2OVR B;  4O45 A;  3AL8 A;  3J81 g;  4A0A A;  3JZN A;  4JSN C;  2AH0 A;  5C2W B;  4QQE A;  4O1Q D;  2GNQ A;  4A0A B;  4JSX C;  5C2V B;  4H5I A;  4ERY A;  4E54 B;  1Q47 A;  3MKS B;  2AGL A;  3PVU B;  3NVQ A;  4JSV C;  3B7F A;  4A09 B;  2I0S A;  2UZY B;  3ORV D;  4GQ2 P;  3V7D B;  5CYK A;  2HJB A;  4CZV A;  2P9I C;  1ERJ A;  4FAN D;  4FAV D;  5CXB B;  1TBG A;  5I5M A;  4QT8 A;  2AGZ A;  2B5N A;  2XU7 A;  4GGD A;  4J8B A;  3F3P A;  2I3S A;  3OKY A;  2XL3 A;  3OKT A;  5H1M A;  3HFQ A;  5HE3 B;  3I7N A;  4JXM A;  2PM7 B;  1U2V C;  3MZL A;  3AH8 B;  4CI1 A;  3FM0 A;  5AMS A;  5EM2 A;  2YBA A;  4X60 B;  5EM2 B;  4O3T B;  3C5M A;  3JZG A;  2CN2 A;  3EU7 A;  4J86 A;  3V5W B;  4A08 A;  3I7O A;  5FKQ A;  3UVM A;  5FKR A;  2CO0 C;  4E5Z B;  4BH6 A;  3W15 A;  1B9Y A;  3K27 A;  3N0D A;  4GMB A;  4FHL A;  5FLX g;  2H9M A;  2IUP A;  3DXK C;  4YVD A;  5FA5 B;  2Z2N A;  2OIZ A;  3CFV A;  3F3G A;  3JRP A;  3RFH A;  3I2N A;  2Z2P A;  3RN0 D;  3UR4 A;  4CI2 A;  3OKW A;  3FRX A;  4LGN A;  3EI3 B;  2IWK A;  2QC5 A;  4D6V A;  1GOT B;  5K19 A;  5EMJ B;  3RMZ D;  4A2L A;  2GC4 A;  2O9K A;  1JJU B;  4AOW A;  3U4Y A;  1XKS A;  4BUJ C;  3EI2 B;  4OWR A;  2P9K C;  3SBQ A;  1XHM A;  2P9U C;  1N6D A;  3FGB A;  4A0B B;  3RRM C;  3EG6 A;  1GXR A;  4GQ1 A;  2PM9 B;  3IIY A;  4XEI C;  4LG9 A;  4A2M A;  1P22 A;  2B5L A;  2OK6 A;  2AGY A;  3PVW B;  2HES X;  4IMM A;  2PBI B;  3SFZ A;  4ERZ A;  2AQ5 A;  4L3H D;  3BWS A;  2YNP A;  1S4U X;  4H5J A;  2P9L C;  1SQJ A;  4E54 A;  1VYH C;  3DXM C;  4CI3 A;  2CO0 A;  5AJA A;  3C9C A;  3IJC A;  4A09 A;  5HE0 B;  2H68 A;  1N6F A;  3MMY A;  4Y7R A;  3C99 A;  4FB1 D;  3I7P A;  3UKR C;  3I8C A;  4TZ4 A;  2IAA A;  4LG8 A;  4J78 A;  5CXB A;  4A7J A;  3JRO A;  2UZX B;  2H13 A;  1XIP A;  3SJL D;  4CZX A;  4GM3 A;  2YMU A;  2YNO A;  2H6K A;  3I89 A;  2I0T A;  4FA5 D;  3CIK B;  4I79 A;  3EI4 A;  5I5J A;  4PBY A;  2CNX A;  3EI4 B;  5IGQ A;  5IJ7 E;  2G99 A;  4PSX B;  4PSW B;  4ZOZ A;  1GG2 B;  2HJ4 A;  3A0F A;  4GGC A;  4J77 A;  5HYN B;  2H9P A;  3MZK A;  4U7A A;  3KRW B;  2YNN A;  2BCJ B;  4GM9 A;  5H14 A;  2H9N A;  4ZN4 A;  1B9X A;  4JD2 C;  4ESG A;  2H3X A;  2HKR A;  2HKM A;  5EAP A;  4QL1 A;  4K3J B;  4AEZ A;  2TRC B;  4ERQ A;  5FKT A;  3PXT D;  4HDJ A;  1JOF A;  3VH0 A;  4E5Z A;  2J57 G;  3F3F A;  1PGU A;  3SWS D;  4FA1 D;  1QNI A;  5IC7 A;  2I0R A;  2P9S C;  4J0W A;  2QXV A;  5AFU 3;  1MG3 A;  4L3G D;  4GGA A;  1K32 A;  3C75 H;  3BG0 A;  3PE7 A;  4JT6 C;  4XYI A;  3I7H A;  1L0Q A;  4K3I D;  5GMK n;  3K26 A;  1YFQ A;  1RI6 A;  3IKO A;  1GP2 B;  1TYQ C;  3EI3 A;  3JPX A;  1OLZ A;  1SQ9 A;  2OK4 A;  1R5M A;  3NVX A;  2IUR A;  2HYE A;  5FKS A;  2H47 A;  2OVQ B;  4J8G A;  4IA9 A;  3EWE A;  5IT9 g;  3UKU C;  5A2Q g;  4GZ8 A;  3KRX B;  4J81 A;  4CY1 A;  5C9Z B;  1JMX B;  5EMK B;  1JMZ B;  4X61 B;  5TDH B;  5TEE A;  4J0X A;  2AGX A;  3EI2 A;  3RSE C;  5HE1 B;  3JAM g;  3I8E A;  2H6N A;  2HXC A;  4GM8 A;  4A0B A;  2CN3 A;  3SN6 B;  2H14 A;  3MKQ A;  1A0R B;  3OL2 A;  1N6E A;  2PM9 A;  3EI1 B;  2B5M A;  5H17 A;  2YB8 B;  3OL2 B;  3SCY A;  3SMR A;  3GRE A;  4MK0 B;  3L4O D;  4CC9 A;  3J80 g;  1NR0 A;  3N0E A;  2MTA H;  4OZU A;  3V9F A;  2Z2O A;  4UI9 R;  3EMH A;  5IGO A;  3I7L A;  2PM6 B;  4J87 A;  3SHF A;  5EAM A;  5B4W A;  3ULE C;  2H6Q A;  3RFG A;  2GC7 A;  4CY5 A;  3UVO A;  2P9P C;  2I3T A;  3RN1 D;  3SBR A;  3AL9 A;  3DWL C;  4JT5 C;  3P4F A;  5CXC A;  5EAL A;  3AL8 B;  4N14 A;  4X3E A;  5CXC B;  1PI6 A;  3BG1 A;  3OW8 A;  2AH1 A;  2XYI A;  3CFS B;  3PXS D;  4JSP C;  4R7A B;  1K8K C;  5JWZ A;  2EBS A;  3DM0 A;  1OMW B;  3UVN A;  3IJ1 A;  5CYK B;  3JZH A;  5I5I A;  1PBY B;  1PEV A;  1MDA H;  4G56 B;  4CY2 A;  3UVL A;  5GSA A;  2OJY A;  4O9D A;  4O3U B;  3E0C A;  5EML B;  3OKY B;  5GXI A;  3RLM D;  4Y5R D;  4ZOV A;  2J56 H;  3MXX A;  2IUV A;  2CE9 A;  3NVN A;  4U1E I;  2J55 H;  3AFC A;  3OTT A;  2W18 A;  2BBK H;  4KFM B;  1NEX B;  5KDO B;  4PNK B;  2B4E A;  4FA4 D;  4J79 A;  4BL0 A;  4X63 B;  3IIW A;  4A08 B;  3ZWL B;  2P9N C;  5SXM A;  5GXH A;  1U4C A;  5IJ8 E;  3PSL A;  4PC0 A;  4XYH A;  5K1C C;  4QRJ A;  3L4M D;  2H9L A;  1FWX A;  4ZOY A;  4PXW A;  3SXT D;  2IUQ A;  3I7K A;  3SVW D;  5HE2 B;  4FA9 D;  2OVP B;  4GQB B;  3IJ0 A;  4CZY A;  4CI8 A;  5HQG A;  4A11 A;  4CY3 A;  5TEF A;  3VA6 A;  3JB9 L;  3DSM A;  3EI1 A;  5THA A;  4EWR A;  4A11 B;  3GFC A;  4NSX A;  4J82 A;  4PBZ A;  4L9O A;  2CE8 A;  3PSC B;  3VGZ A;  2Q7Q A;  4J84 A;  5TF2 A;  3UVK A;  3SBP A;  2IWF A;  4D0K A;  2AGW A;  1SHY B;  2G9A A;  4FWW A;  4L1Q D;  5FXY A; 
#chains in the Genus database with same CATH topology
 5FQD A;  2HU5 A;  2XL2 A;  4J73 A;  4BCD A;  4ZOX A;  5EMM B;  3ODT A;  3PXW D;  5E6R A;  5EAR A;  4ES0 A;  3SLE D;  1C9I A;  1VE6 A;  4Z8L A;  1MG2 A;  3FCU A;  2OVR B;  4O45 A;  4RE6 A;  3AL8 A;  3J81 g;  4A0A A;  3JZN A;  1VZ2 A;  4JSN C;  2AH0 A;  5C2W B;  4QQE A;  4O1Q D;  4AX4 A;  2GNQ A;  4A0A B;  4JSX C;  5C2V B;  4H5I A;  4ERY A;  4E54 B;  1Q47 A;  4BCC A;  4WK2 A;  3MKS B;  2AGL A;  3PVU B;  3NVQ A;  4JSV C;  3B7F A;  4A09 B;  2I0S A;  2UZY B;  3ORV D;  4GQ2 P;  3V7D B;  5CYK A;  2HJB A;  4CZV A;  3MUO A;  3OF7 A;  2P9I C;  1ERJ A;  4FAN D;  4FAV D;  2VDK A;  5CXB B;  1VE7 A;  5M5R A;  1TBG A;  5I5M A;  4QT8 A;  2AGZ A;  2B5N A;  4O2W A;  2XU7 A;  4GGD A;  1GOH A;  4J8B A;  3F3P A;  3NIF A;  2I3S A;  3OKY A;  2XL3 A;  3OKT A;  5H1M A;  3HFQ A;  4WK4 A;  5HDB A;  5HE3 B;  3I7N A;  4JXM A;  2PM7 B;  1U2V C;  3MZL A;  3AH8 B;  4CI1 A;  3FM0 A;  5AMS A;  1E8M A;  5EM2 A;  3GC3 B;  2HU7 A;  4WJK A;  3T3P A;  2YBA A;  4X60 B;  5M5V A;  3IUM A;  5EM2 B;  4O3T B;  3C5M A;  4AMY A;  3JZG A;  2VC2 A;  2CN2 A;  3EU7 A;  4J86 A;  3V5W B;  1TYE A;  4A08 A;  3I7O A;  5FKQ A;  3UVM A;  2VDO A;  5FKR A;  3ZE2 A;  2CO0 C;  4E5Z B;  4BH6 A;  3W15 A;  1B9Y A;  3K27 A;  3N0D A;  4GMB A;  3NID A;  4FHL A;  5FLX g;  1E5T A;  4NAA A;  2H9M A;  2IUP A;  3DXK C;  3IUQ A;  4YVD A;  5FA5 B;  2Z2N A;  3ZDY A;  2OIZ A;  3CFV A;  4DNW A;  3F3G A;  1QFM A;  3JRP A;  2VZ3 A;  3I2N A;  3RFH A;  2Z2P A;  3RN0 D;  3UR4 A;  4CI2 A;  3OKW A;  3MVD K;  3FRX A;  4LGN A;  3EI3 B;  2IWK A;  2QC5 A;  4D6V A;  3VI4 A;  1GOT B;  5K19 A;  3MUN A;  4Z7Q A;  5EMJ B;  1JV2 A;  5M5U A;  3RMZ D;  4A2L A;  1H2X A;  2VDN A;  5M5S A;  2GC4 A;  2O9K A;  1K3I A;  1H2W A;  1JJU B;  4AOW A;  3U4Y A;  1XKS A;  4BUJ C;  3EI2 B;  4OWR A;  2P9K C;  3SBQ A;  4AMZ A;  1XHM A;  2P9U C;  1N6D A;  3FGB A;  3ZE1 A;  3IUJ A;  3VI3 A;  4A0B B;  3RRM C;  3EG6 A;  1GXR A;  4G1E A;  4GQ1 A;  1BPO A;  2PM9 B;  3IIY A;  4XEI C;  4LG9 A;  4A2M A;  1P22 A;  2B5L A;  2OK6 A;  2AGY A;  3PVW B;  2HES X;  4IMM A;  2PBI B;  3SFZ A;  4ERZ A;  1UOP A;  2AQ5 A;  4L3H D;  3BWS A;  2YNP A;  1S4U X;  4H5J A;  2P9L C;  1SQJ A;  4G1M A;  1VYH C;  3DXM C;  4E54 A;  4CI3 A;  2CO0 A;  2EIB A;  5AJA A;  2EIC A;  3C9C A;  3IJC A;  4A09 A;  5HE0 B;  1JTD B;  2H68 A;  1N6F A;  4G55 A;  3MMY A;  4Y7R A;  3C99 A;  4FB1 D;  3I7P A;  3UKR C;  3I8C A;  4TZ4 A;  2IAA A;  4LG8 A;  2HU8 A;  4J78 A;  5CXB A;  4A7J A;  5M61 A;  2QZP A;  3JRO A;  2UZX B;  2H13 A;  1UTC A;  1XIP A;  3SJL D;  4CZX A;  3QI0 A;  2YMU A;  2YNO A;  4GM3 A;  2H6K A;  2JKX A;  2I0T A;  3I89 A;  4FA5 D;  3CIK B;  4I79 A;  3EI4 A;  5I5J A;  4PBY A;  3K72 A;  2CNX A;  2QR5 A;  3K6S A;  3EI4 B;  5IGQ A;  5IJ7 E;  2G99 A;  4PSX B;  3QHY B;  4PSW B;  4ZOZ A;  4UM8 A;  1A12 A;  1GG2 B;  2HJ4 A;  3A0F A;  4GGC A;  4J77 A;  2VDR A;  3FCS A;  5HYN B;  2H9P A;  3MZK A;  4U7A A;  3KRW B;  2YNN A;  2BCJ B;  4GM9 A;  5H14 A;  2H9N A;  4ZN4 A;  1B9X A;  4JD2 C;  4NC4 A;  4ESG A;  2EIE A;  1C9L A;  2H3X A;  2HKR A;  2HKM A;  5EAP A;  4QL1 A;  5C92 A;  4K3J B;  4AEZ A;  2TRC B;  4RE5 A;  4ERQ A;  2XDW A;  4NEN A;  5FKT A;  3PXT D;  1JOF A;  3NIG A;  4HDJ A;  3VH0 A;  4E5Z A;  2J57 G;  3F3F A;  1PGU A;  5M5T A;  3SWS D;  4AN1 A;  1H2Y A;  4UM9 A;  4L1M A;  1E8N A;  1UOO A;  4FA1 D;  4MMY A;  1QNI A;  5IC7 A;  2I0R A;  2P9S C;  4J0W A;  2QXV A;  5AFU 3;  1MG3 A;  4L3G D;  4GGA A;  1K32 A;  3C75 H;  3BG0 A;  3PE7 A;  4JT6 C;  4XYI A;  3I7H A;  1L0Q A;  4K3I D;  5GMK n;  3K26 A;  1YFQ A;  1RI6 A;  3IKO A;  1T2X A;  1GP2 B;  1TYQ C;  3EI3 A;  3JPX A;  1OLZ A;  1SQ9 A;  2OK4 A;  5FFO A;  1R5M A;  3NVX A;  2IUR A;  2HYE A;  5FKS A;  2H47 A;  3IUL A;  3EQ7 A;  2OVQ B;  4J8G A;  4IA9 A;  3EWE A;  5IT9 g;  1I2M B;  3UKU C;  5A2Q g;  1QFS A;  4GZ8 A;  3KRX B;  4J81 A;  4CY1 A;  5C9Z B;  1JMX B;  5EMK B;  1JMZ B;  4X61 B;  5TDH B;  5TEE A;  4J0X A;  2AGX A;  3EI2 A;  3RSE C;  1GOG A;  5HE1 B;  2VDQ A;  3JAM g;  3I8E A;  3ZDX A;  2H6N A;  2HXC A;  4GM8 A;  4A0B A;  2CN3 A;  3SN6 B;  2H14 A;  1VZ3 A;  1A0R B;  3MKQ A;  3OL2 A;  1N6E A;  3T3M A;  2PM9 A;  3EI1 B;  2B5M A;  3ZDZ A;  5H17 A;  2YB8 B;  1UOQ A;  3OL2 B;  3SCY A;  3SMR A;  3GRE A;  4MK0 B;  3L4O D;  4CC9 A;  3J80 g;  1NR0 A;  3N0E A;  2MTA H;  4D9S A;  4OZU A;  3V9F A;  2Z2O A;  4UI9 R;  3EMH A;  5IGO A;  3I7L A;  2PM6 B;  4J87 A;  3SHF A;  5EAM A;  5B4W A;  3ULE C;  2H6Q A;  3RFG A;  2GC7 A;  4CY5 A;  3UVO A;  2P9P C;  3O4J A;  2I3T A;  4AN0 A;  3RN1 D;  4DNV A;  5E6U A;  3SBR A;  2BKL A;  3AL9 A;  4QAM A;  3DWL C;  4JT5 C;  3P4F A;  5CXC A;  2VDP A;  5EAL A;  4WK0 A;  3AL8 B;  4N14 A;  4X3E A;  5CXC B;  4BP9 A;  3BG1 A;  1PI6 A;  3OW8 A;  2AH1 A;  4MMX A;  2XYI A;  3CFS B;  3PXS D;  1U8C A;  4JSP C;  4R7A B;  2WQ8 A;  1K8K C;  5JWZ A;  2EBS A;  3DM0 A;  1OMW B;  4O02 A;  3UVN A;  3IJ1 A;  5CYK B;  2XE4 A;  3JZH A;  4IRZ A;  3V4P A;  5I5I A;  1PBY B;  1PEV A;  1MDA H;  4G56 B;  4CY2 A;  4NBM A;  3UVL A;  5GSA A;  4BP8 A;  2OJY A;  4O9D A;  3DDU A;  4O3U B;  3E0C A;  5EML B;  3IUR A;  5FFG A;  2VZ1 A;  3OKY B;  3IJE A;  5GXI A;  4JHP C;  4Z7O A;  3RLM D;  4Y5R D;  4DNU A;  4ZOV A;  2J56 H;  3MXX A;  1M1X A;  2IUV A;  2CE9 A;  3NVN A;  4U1E I;  1YR2 A;  5C86 A;  2J55 H;  3AFC A;  3OTT A;  2W18 A;  2BBK H;  4KFM B;  1NEX B;  4BCB A;  5KDO B;  4PNK B;  2B4E A;  4FA4 D;  3EQ8 A;  4J79 A;  4BL0 A;  3KCI A;  4X63 B;  3IIW A;  2VDL A;  4JHN A;  4A08 B;  3ZWL B;  2P9N C;  5SXM A;  1GOF A;  5GXH A;  1U4C A;  5IJ8 E;  3PSL A;  4PC0 A;  4XYH A;  5K1C C;  4QRJ A;  3L4M D;  3EQ9 A;  2H9L A;  1FWX A;  5E6S A;  3K71 A;  4ZOY A;  2EID A;  4PXW A;  3SXT D;  3ZE0 A;  2IUQ A;  2XZG A;  3I7K A;  3SVW D;  5HE2 B;  4FA9 D;  2OVP B;  4GQB B;  3IJ0 A;  4CZY A;  4CI8 A;  5HQG A;  4A11 A;  4CY3 A;  5TEF A;  3VA6 A;  3O4H A;  3JB9 L;  3DSM A;  3EI1 A;  5THA A;  4EWR A;  4A11 B;  3GFC A;  3O4G A;  4NSX A;  1O6F A;  4J82 A;  4L9O A;  4PBZ A;  2CE8 A;  3IVM A;  3PSC B;  1L5G A;  3VGZ A;  4MMZ A;  4Z7N A;  3IUN A;  3O4I A;  3GD1 I;  2Q7Q A;  4J84 A;  3V4V A;  5TF2 A;  3UVK A;  3SBP A;  1O6G A;  2IWF A;  4D0K A;  2AGW A;  1SHY B;  2G9A A;  2VDM A;  4FWW A;  4L1Q D;  5FXY A;  1H2Z A; 
#chains in the Genus database with same CATH homology
 5FQD A;  2XL2 A;  4J73 A;  4ZOX A;  5EMM B;  3ODT A;  3PXW D;  4ES0 A;  5EAR A;  3SLE D;  4Z8L A;  1MG2 A;  2OVR B;  4O45 A;  3AL8 A;  3J81 g;  4A0A A;  3JZN A;  4JSN C;  2AH0 A;  5C2W B;  4QQE A;  4O1Q D;  2GNQ A;  4A0A B;  4JSX C;  5C2V B;  4H5I A;  4ERY A;  4E54 B;  1Q47 A;  3MKS B;  2AGL A;  3PVU B;  3NVQ A;  4JSV C;  3B7F A;  4A09 B;  2I0S A;  2UZY B;  3ORV D;  4GQ2 P;  3V7D B;  5CYK A;  2HJB A;  4CZV A;  2P9I C;  1ERJ A;  4FAN D;  4FAV D;  5CXB B;  1TBG A;  5I5M A;  4QT8 A;  2AGZ A;  2B5N A;  2XU7 A;  4GGD A;  4J8B A;  3F3P A;  2I3S A;  3OKY A;  2XL3 A;  3OKT A;  5H1M A;  3HFQ A;  5HE3 B;  3I7N A;  4JXM A;  2PM7 B;  1U2V C;  3MZL A;  3AH8 B;  4CI1 A;  3FM0 A;  5AMS A;  5EM2 A;  2YBA A;  4X60 B;  5EM2 B;  4O3T B;  3C5M A;  3JZG A;  2CN2 A;  3EU7 A;  4J86 A;  3V5W B;  4A08 A;  3I7O A;  5FKQ A;  3UVM A;  5FKR A;  2CO0 C;  4E5Z B;  4BH6 A;  3W15 A;  1B9Y A;  3K27 A;  3N0D A;  4GMB A;  4FHL A;  5FLX g;  2H9M A;  2IUP A;  3DXK C;  4YVD A;  5FA5 B;  2Z2N A;  2OIZ A;  3CFV A;  3F3G A;  3JRP A;  3RFH A;  3I2N A;  2Z2P A;  3RN0 D;  3UR4 A;  4CI2 A;  3OKW A;  3FRX A;  4LGN A;  3EI3 B;  2IWK A;  2QC5 A;  4D6V A;  1GOT B;  5K19 A;  5EMJ B;  3RMZ D;  4A2L A;  2GC4 A;  2O9K A;  1JJU B;  4AOW A;  3U4Y A;  1XKS A;  4BUJ C;  3EI2 B;  4OWR A;  2P9K C;  3SBQ A;  1XHM A;  2P9U C;  1N6D A;  3FGB A;  4A0B B;  3RRM C;  3EG6 A;  1GXR A;  4GQ1 A;  2PM9 B;  3IIY A;  4XEI C;  4LG9 A;  4A2M A;  1P22 A;  2B5L A;  2OK6 A;  2AGY A;  3PVW B;  2HES X;  4IMM A;  2PBI B;  3SFZ A;  4ERZ A;  2AQ5 A;  4L3H D;  3BWS A;  2YNP A;  1S4U X;  4H5J A;  2P9L C;  1SQJ A;  4E54 A;  1VYH C;  3DXM C;  4CI3 A;  2CO0 A;  5AJA A;  3C9C A;  3IJC A;  4A09 A;  5HE0 B;  2H68 A;  1N6F A;  3MMY A;  4Y7R A;  3C99 A;  4FB1 D;  3I7P A;  3UKR C;  3I8C A;  4TZ4 A;  2IAA A;  4LG8 A;  4J78 A;  5CXB A;  4A7J A;  3JRO A;  2UZX B;  2H13 A;  1XIP A;  3SJL D;  4CZX A;  4GM3 A;  2YMU A;  2YNO A;  2H6K A;  3I89 A;  2I0T A;  4FA5 D;  3CIK B;  4I79 A;  3EI4 A;  5I5J A;  4PBY A;  2CNX A;  3EI4 B;  5IGQ A;  5IJ7 E;  2G99 A;  4PSX B;  4PSW B;  4ZOZ A;  1GG2 B;  2HJ4 A;  3A0F A;  4GGC A;  4J77 A;  5HYN B;  2H9P A;  3MZK A;  4U7A A;  3KRW B;  2YNN A;  2BCJ B;  4GM9 A;  5H14 A;  2H9N A;  4ZN4 A;  1B9X A;  4JD2 C;  4ESG A;  2H3X A;  2HKR A;  2HKM A;  5EAP A;  4QL1 A;  4K3J B;  4AEZ A;  2TRC B;  4ERQ A;  5FKT A;  3PXT D;  4HDJ A;  1JOF A;  3VH0 A;  4E5Z A;  2J57 G;  3F3F A;  1PGU A;  3SWS D;  4FA1 D;  1QNI A;  5IC7 A;  2I0R A;  2P9S C;  4J0W A;  2QXV A;  5AFU 3;  1MG3 A;  4L3G D;  4GGA A;  1K32 A;  3C75 H;  3BG0 A;  3PE7 A;  4JT6 C;  4XYI A;  3I7H A;  1L0Q A;  4K3I D;  5GMK n;  3K26 A;  1YFQ A;  1RI6 A;  3IKO A;  1GP2 B;  1TYQ C;  3EI3 A;  3JPX A;  1OLZ A;  1SQ9 A;  2OK4 A;  1R5M A;  3NVX A;  2IUR A;  2HYE A;  5FKS A;  2H47 A;  2OVQ B;  4J8G A;  4IA9 A;  3EWE A;  5IT9 g;  3UKU C;  5A2Q g;  4GZ8 A;  3KRX B;  4J81 A;  4CY1 A;  5C9Z B;  1JMX B;  5EMK B;  1JMZ B;  4X61 B;  5TDH B;  5TEE A;  4J0X A;  2AGX A;  3EI2 A;  3RSE C;  5HE1 B;  3JAM g;  3I8E A;  2H6N A;  2HXC A;  4GM8 A;  4A0B A;  2CN3 A;  3SN6 B;  2H14 A;  3MKQ A;  1A0R B;  3OL2 A;  1N6E A;  2PM9 A;  3EI1 B;  2B5M A;  5H17 A;  2YB8 B;  3OL2 B;  3SCY A;  3SMR A;  3GRE A;  4MK0 B;  3L4O D;  4CC9 A;  3J80 g;  1NR0 A;  3N0E A;  2MTA H;  4OZU A;  3V9F A;  2Z2O A;  4UI9 R;  3EMH A;  5IGO A;  3I7L A;  2PM6 B;  4J87 A;  3SHF A;  5EAM A;  5B4W A;  3ULE C;  2H6Q A;  3RFG A;  2GC7 A;  4CY5 A;  3UVO A;  2P9P C;  2I3T A;  3RN1 D;  3SBR A;  3AL9 A;  3DWL C;  4JT5 C;  3P4F A;  5CXC A;  5EAL A;  3AL8 B;  4N14 A;  4X3E A;  5CXC B;  1PI6 A;  3BG1 A;  3OW8 A;  2AH1 A;  2XYI A;  3CFS B;  3PXS D;  4JSP C;  4R7A B;  1K8K C;  5JWZ A;  2EBS A;  3DM0 A;  1OMW B;  3UVN A;  3IJ1 A;  5CYK B;  3JZH A;  5I5I A;  1PBY B;  1PEV A;  1MDA H;  4G56 B;  4CY2 A;  3UVL A;  5GSA A;  2OJY A;  4O9D A;  4O3U B;  3E0C A;  5EML B;  3OKY B;  5GXI A;  3RLM D;  4Y5R D;  4ZOV A;  2J56 H;  3MXX A;  2IUV A;  2CE9 A;  3NVN A;  4U1E I;  2J55 H;  3AFC A;  3OTT A;  2W18 A;  2BBK H;  4KFM B;  1NEX B;  5KDO B;  4PNK B;  2B4E A;  4FA4 D;  4J79 A;  4BL0 A;  4X63 B;  3IIW A;  4A08 B;  3ZWL B;  2P9N C;  5SXM A;  5GXH A;  1U4C A;  5IJ8 E;  3PSL A;  4PC0 A;  4XYH A;  5K1C C;  4QRJ A;  3L4M D;  2H9L A;  1FWX A;  4ZOY A;  4PXW A;  3SXT D;  2IUQ A;  3I7K A;  3SVW D;  5HE2 B;  4FA9 D;  2OVP B;  4GQB B;  3IJ0 A;  4CZY A;  4CI8 A;  5HQG A;  4A11 A;  4CY3 A;  5TEF A;  3VA6 A;  3JB9 L;  3DSM A;  3EI1 A;  5THA A;  4EWR A;  4A11 B;  3GFC A;  4NSX A;  4J82 A;  4PBZ A;  4L9O A;  2CE8 A;  3PSC B;  3VGZ A;  2Q7Q A;  4J84 A;  5TF2 A;  3UVK A;  3SBP A;  2IWF A;  4D0K A;  2AGW A;  1SHY B;  2G9A A;  4FWW A;  4L1Q D;  5FXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...