2GC7A

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
total genus 94
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc7A00
2MTAH 3IIYA 3HFQA 4U1EI 5C2WB 3NVQA 2TRCB 3SFZA 1PEVA 2P9SC 1S4UX 2GC4A 3SXTD 3AL9A 4O3TB 5C2VB 4X61B 2PBIB 5HE0B 5GMKn 2UZXB 4R7AB 2AGZA 4A2LA 1OMWB 2CO0C 4JSXC 5H17A 2CO0A 2OK4A 1XKSA 1GXRA 4J0XA 3SBPA 4ES0A 4E5ZA 4A0BB 3RRMC 2GC7A 4ERZA 4PBYA 4GM9A 2YNOA 5GXIA 3IJ0A 2W18A 4H5IA 3N0DA 3UKUC 4CZXA 3OL2A 1U4CA 2CN3A 1QNIA 3PSLA 1JOFA 2I3SA 4CI8A 3JZHA 1XIPA 3FRXA 3FGBA 2H6QA 4GM3A 3OKWA 2I0SA 2OK6A 4A0AB 4GGCA 4JSVC 4XYHA 1NEXB 2AGYA 1L0QA 2IUVA 4U7AA 4CZYA 4OWRA 5THAA 1P22A 4PNKB 2XL2A 3CIKB 2H9LA 3MKSB 3NVXA 2B4EA 3DXKC 4JSNC 2OVRB 2P9PC 1JMXB 4Y5RD 4FAND 3MMYA 4K3ID 2CNXA 2AQ5A 4J78A 4GGAA 4XYIA 2CE8A 3JB9L 4L1QD 3UVMA 4PBZA 3RN0D 4NSXA 1VYHC 5I5IA 3BWSA 3RFGA 3J80g 2PM9A 4A08B 3F3GA 1N6FA 2H3XA 2CN2A 2H68A 3I2NA 2Z2OA 5CXCB 3PE7A 5IJ8E 2J56H 3JROA 2J55H 2I3TA 4N14A 3EI1B 4K3JB 3K26A 3JZGA 2H9NA 2I0RA 4BL0A 4CY5A 3IJCA 3RMZD 4L3GD 4A09A 4ZOYA 2PM9B 3F3FA 2XU7A 3EMHA 2J57G 3SBRA 2H14A 3I7OA 2UZYB 5CXBB 4JSPC 3UVLA 2IUQA 3I7LA 3OKYA 4A11A 3ULEC 4GMBA 1PI6A 1MG3A 2YNNA 5B4WA 4J87A 2AGLA 1GP2B 3C5MA 2B5NA 4QL1A 4CI1A 3PXTD 3SMRA 3V9FA 3EI1A 4G56B 2IUPA 4UI9R 2B5MA 5GSAA 4I79A 3MZKA 3RLMD 1B9XA 4J8GA 5KDOB 3N0EA 5IC7A 3JRPA 3DXMC 3GREA 5FKTA 3A0FA 4ZN4A 2HKMA 4X3EA 2OJYA 3ZWLB 3BG1A 5HE2B 4BUJC 3ORVD 4J77A 2OIZA 3VH0A 4E54B 4A7JA 4IMMA 5EMMB 4CI3A 2HKRA 1K8KC 3KRWB 3VA6A 1PGUA 2G9AA 5I5MA 3UVKA 5IGOA 4E5ZB 3EI2A 2IAAA 2IWFA 1ERJA 5C9ZB 2OVPB 4D0KA 2Z2NA 3UKRC 1B9YA 2P9IC 3I8EA 4FHLA 2P9NC 5EAMA 5IJ7E 2XL3A 2CE9A 4O3UB 3L4MD 4OZUA 3I7NA 5TEFA 4E54A 4LGNA 3V5WB 4ZOXA 2IWKA 4O45A 4YVDA 2XYIA 2GNQA 4QQEA 1GG2B 1N6DA 1GOTB 4PC0A 4A0AA 3DM0A 3EI2B 3F3PA 2OVQB 5EALA 3V7DB 1TBGA 1OLZA 5TEEA 2EBSA 3IIWA 3JPXA 5AMSA 3NVNA 3EU7A 3BG0A 4O1QD 2O9KA 4GM8A 5H1MA 4FWWA 2H13A 3OKYB 4A11B 2Z2PA 4TZ4A 5FLXg 4IA9A 3DSMA 4ERQA 1U2VC 3I7PA 2AGWA 4ERYA 4PSWB 3I8CA 3SN6B 2Q7QA 2HESX 4EWRA 3JAMg 3SJLD 2AH0A 4JXMA 3FM0A 4Y7RA 3EI4A 5FXYA 4J84A 3AL8A 3SHFA 3PSCB 3RSEC 4CY2A 2YB8B 3U4YA 4A08A 3C99A 5IGQA 3JZNA 3SCYA 4FA4D 2B5LA 2QXVA 5EAPA 2H9MA 1A0RB 2P9KC 4J79A 3RN1D 3VGZA 3L4OD 5TF2A 3UR4A 3K27A 4PSXB 5K1CC 2PM6B 4PXWA 5FQDA 4A0BA 2PM7B 2H47A 2YBAA 3MXXA 4CC9A 4H5JA 4AEZA 4FA1D 3EI4B 1MDAH 1N6EA 3AL8B 5HQGA 4J86A 4JD2C 4X60B 2AH1A 3EG6A 5CYKA 2HXCA 4LG8A 5CXCA 3UVNA 5EM2B 2HJ4A 4FA9D 5AJAA 4CY1A 1XHMA 1RI6A 3ODTA 4HDJA 3C9CA 4GQ1A 3DWLC 4ZOZA 5FA5B 3P4FA 4J73A 4FB1D 5JWZA 4GQ2P 5I5JA 4ESGA 4ZOVA 4CI2A 4X63B 4J8BA 5EMKB 3B7FA 5IT9g 3CFVA 5CYKB 2H9PA 4GZ8A 4CZVA 5HE3B 2H6KA 3C75H 4FAVD 1SQ9A 3KRXB 5EM2A 2AGXA 2BBKH 2IURA 4D6VA 4Z8LA 5TDHB 3AH8B 4JT5C 3IKOA 2P9LC 4J0WA 2P9UC 1TYQC 5K19A 3J81g 4XEIC 3OKTA 4GGDA 4GQBB 4A09B 1SQJA 2HJBA 4CY3A 4J82A 3OL2B 3AFCA 3SBQA 3EWEA 2BCJB 3E0CA 5H14A 3SVWD 1FWXA 4FA5D 3EI3A 4LG9A 3SLED 3UVOA 3IJ1A 3MZLA 3OTTA 4L9OA 3I89A 4MK0B 2YNPA 3PVWB 1NR0A 1JJUB 4L3HD 5SXMA 4KFMB 4AOWA 3MKQA 2QC5A 5CXBA 3GFCA 3PXWD 1MG2A 1SHYB 4A2MA 4QT8A 1JMZB 4O9DA 2HYEA 4JT6C 3SWSD 3CFSB 5FKRA 3PXSD 2I0TA 1R5MA 3EI3B 4QRJA 4BH6A 3RFHA 5GXHA 2H6NA 1Q47A 5FKQA 5HYNB 5HE1B 1PBYB 5A2Qg 2G99A 5AFU3 3I7HA 3PVUB 5EMJB 4J81A 1K32A 5EARA 5FKSA 2YMUA 5EMLB 1YFQA 3W15A 3I7KA 3OW8A
chains in the Genus database with same CATH superfamily
4Z7QA 2MTAH 3IIYA 3HFQA 4U1EI 3ZDYA 4DNVA 5C2WB 3NVQA 2TRCB 3SFZA 1PEVA 2P9SC 1S4UX 3ZE0A 2GC4A 3SXTD 3AL9A 4O3TB 4G1EA 3ZE2A 5C2VB 4X61B 2PBIB 1A12A 1YR2A 5HE0B 2UZXB 5GMKn 4R7AB 2AGZA 4A2LA 1OMWB 2CO0C 4JSXC 5M5UA 5H17A 2CO0A 2OK4A 1XKSA 1GXRA 4J0XA 3SBPA 4ES0A 4E5ZA 1UOOA 3RRMC 4A0BB 2GC7A 4ERZA 4PBYA 1H2ZA 4GM9A 2YNOA 5GXIA 3IJ0A 2W18A 4H5IA 3N0DA 3UKUC 4CZXA 3OL2A 1U4CA 1H2WA 2CN3A 1GOFA 1QNIA 3PSLA 1JOFA 2I3SA 1JTDB 4CI8A 4AMZA 4WK4A 3JZHA 1XIPA 3FRXA 3FGBA 2H6QA 3VI4A 4GM3A 3OKWA 2I0SA 2VDRA 4O02A 2OK6A 4A0AB 4GGCA 4RE5A 4JSVC 3EQ7A 1NEXB 2AGYA 1L0QA 2IUVA 4XYHA 1H2XA 2VZ3A 4NBMA 4MMXA 1H2YA 4U7AA 4CZYA 4OWRA 5THAA 1P22A 4PNKB 2XL2A 3CIKB 2H9LA 3K6SA 3MKSB 3NVXA 1E5TA 2B4EA 3DXKC 4JSNC 5HDBA 2OVRB 2P9PC 1JMXB 4Y5RD 2XDWA 4FAND 3MMYA 1GOGA 2CNXA 4K3ID 4AN1A 2AQ5A 4J78A 4GGAA 4XYIA 2CE8A 3JB9L 4L1QD 3UVMA 4PBZA 3EQ8A 1QFSA 3RN0D 4BCDA 4AMYA 5FFGA 2HU5A 4NSXA 1VYHC 5I5IA 3IUNA 3BWSA 3RFGA 3J80g 2PM9A 4A08B 4G55A 3IUMA 3F3GA 2VDLA 1N6FA 2BKLA 3IJEA 2H3XA 2CN2A 2H68A 1E8MA 3IUQA 4BP9A 3I2NA 2Z2OA 5CXCB 3PE7A 5IJ8E 1L5GA 2J56H 3JROA 2J55H 4JHPC 2I3TA 4N14A 3EI1B 5E6UA 4K3JB 3K26A 3JZGA 1O6FA 2H9NA 2I0RA 4BL0A 4CY5A 3IJCA 3EQ9A 2EICA 3RMZD 4L3GD 2HU8A 4A09A 4ZOYA 3NIGA 2PM9B 3F3FA 2XU7A 3EMHA 3K71A 2J57G 3SBRA 4AX4A 4BCBA 2H14A 3I7OA 1TYEA 2UZYB 5CXBB 4JSPC 3UVLA 2IUQA 3I7LA 3OKYA 1JV2A 2VDNA 3ULEC 4GMBA 1PI6A 4A11A 1MG3A 1UOQA 2VDOA 2YNNA 5B4WA 4J87A 2AGLA 5C92A 1GP2B 3C5MA 4Z7OA 2B5NA 4QL1A 4CI1A 3PXTD 4NENA 3SMRA 1K3IA 3V9FA 3IULA 3EI1A 4G56B 2IUPA 4UI9R 2B5MA 5GSAA 4I79A 2VDPA 3MZKA 2EIBA 4G1MA 3RLMD 1B9XA 4J8GA 5KDOB 1BPOA 3N0EA 5IC7A 3JRPA 3DXMC 3GREA 5FKTA 3A0FA 4ZN4A 3O4HA 2HKMA 3NIFA 3O4JA 4X3EA 2QZPA 2OJYA 3ZWLB 3BG1A 5HE2B 4BUJC 4RE6A 3ORVD 4WJKA 3ZDZA 4J77A 2OIZA 3VH0A 4E54B 4A7JA 4IMMA 5EMMB 4CI3A 1O6GA 2HKRA 1K8KC 3KRWB 3VA6A 1PGUA 2G9AA 5I5MA 3UVKA 5IGOA 4E5ZB 4UM9A 3EI2A 2IAAA 2IWFA 1ERJA 5C9ZB 2OVPB 4D0KA 2Z2NA 3UKRC 1B9YA 2P9IC 2VZ1A 3T3MA 3I8EA 4NAAA 4FHLA 2P9NC 5EAMA 5IJ7E 2XL3A 2CE9A 4O3UB 3L4MD 4OZUA 5M5VA 3I7NA 5TEFA 4E54A 4LGNA 3V5WB 4ZOXA 2IWKA 4O45A 4YVDA 2XYIA 2GNQA 4QQEA 1GG2B 1N6DA 1QFMA 1GOTB 4PC0A 1M1XA 4A0AA 3DM0A 3EI2B 1VZ2A 3IVMA 3F3PA 2OVQB 5EALA 3V7DB 1TBGA 1OLZA 5TEEA 2EBSA 2VDKA 3IIWA 3JPXA 5AMSA 3NVNA 3EU7A 3BG0A 4O1QD 2O9KA 4GM8A 5H1MA 4FWWA 2H13A 3OKYB 4A11B 2Z2PA 4TZ4A 5FLXg 4IA9A 5FFOA 3DSMA 4ERQA 1U2VC 3I7PA 2AGWA 2VDMA 4ERYA 4PSWB 3I8CA 3SN6B 2Q7QA 2HESX 4EWRA 3JAMg 3SJLD 2AH0A 3KCIA 4JXMA 1VE6A 3FM0A 5C86A 4Y7RA 1UTCA 3EI4A 5FXYA 4J84A 3AL8A 3SHFA 3PSCB 3RSEC 4CY2A 2YB8B 3U4YA 1C9IA 4A08A 4WK0A 1I2MB 3C99A 5IGQA 3JZNA 2XZGA 3SCYA 4FA4D 2B5LA 2QXVA 5EAPA 2H9MA 1A0RB 1E8NA 1T2XA 2P9KC 4J79A 3RN1D 3VGZA 3L4OD 3IUJA 3FCSA 5TF2A 3O4IA 3GC3B 3UR4A 3K27A 4PSXB 5K1CC 4AN0A 4DNUA 2PM6B 3MUOA 4PXWA 5FQDA 4A0BA 2PM7B 2H47A 2YBAA 3MXXA 4DNWA 4CC9A 4H5JA 4AEZA 4FA1D 3EI4B 1MDAH 1N6EA 3AL8B 3K72A 5HQGA 1UOPA 4J86A 4JD2C 4X60B 2AH1A 3EG6A 4JHNA 5CYKA 2HXCA 4LG8A 3IURA 5CXCA 3UVNA 5EM2B 1U8CA 2HJ4A 4FA9D 5AJAA 4L1MA 4CY1A 1XHMA 1RI6A 4BP8A 2EIEA 3ODTA 3OF7A 4HDJA 4D9SA 3C9CA 4GQ1A 3DWLC 4ZOZA 5FA5B 3P4FA 4J73A 4FB1D 5JWZA 4GQ2P 5I5JA 4ESGA 4ZOVA 4CI2A 4X63B 4J8BA 5EMKB 3B7FA 5IT9g 3CFVA 3NIDA 5CYKB 2H9PA 4GZ8A 4CZVA 5HE3B 2H6KA 3C75H 4FAVD 1SQ9A 3KRXB 5EM2A 2AGXA 2BBKH 2IURA 4D6VA 4Z8LA 5TDHB 3AH8B 2QR5A 4JT5C 2WQ8A 3IKOA 5M5TA 2P9LC 3FCUA 4J0WA 2P9UC 1TYQC 2JKXA 5K19A 1VZ3A 4XEIC 3J81g 3OKTA 2HU7A 4GGDA 4GQBB 4A09B 3ZDXA 1SQJA 4MMYA 5E6RA 2HJBA 1C9LA 4CY3A 4J82A 3OL2B 3V4PA 1GOHA 2XE4A 3AFCA 3SBQA 3EWEA 2BCJB 3VI3A 3E0CA 5H14A 3GD1I 3SVWD 1FWXA 4FA5D 3QI0A 3EI3A 3DDUA 4LG9A 2VDQA 3SLED 3UVOA 3ZE1A 3IJ1A 4QAMA 3MZLA 3OTTA 4IRZA 4UM8A 3MUNA 4L9OA 3I89A 4MK0B 2YNPA 3PVWB 1NR0A 1JJUB 4L3HD 5M61A 5SXMA 4KFMB 4AOWA 3MKQA 2QC5A 5CXBA 3QHYB 4MMZA 3GFCA 3PXWD 1MG2A 1SHYB 4A2MA 4QT8A 5M5SA 1JMZB 4O9DA 3V4VA 2HYEA 4O2WA 4JT6C 3SWSD 3CFSB 5FKRA 3PXSD 2I0TA 1R5MA 3EI3B 4QRJA 4BH6A 2VC2A 2EIDA 5E6SA 3RFHA 5GXHA 4NC4A 2H6NA 4BCCA 1Q47A 5FKQA 1VE7A 5HYNB 5HE1B 5M5RA 1PBYB 5A2Qg 2G99A 5AFU3 3I7HA 3O4GA 3PVUB 4WK2A 4J81A 5EMJB 4Z7NA 1K32A 5EARA 3MVDK 3T3PA 5FKSA 2YMUA 5EMLB 1YFQA 3W15A 3I7KA 3OW8A
chains in the Genus database with same CATH topology
2MTAH 3IIYA 3HFQA 4U1EI 5C2WB 3NVQA 2TRCB 3SFZA 1PEVA 2P9SC 1S4UX 2GC4A 3SXTD 3AL9A 4O3TB 5C2VB 4X61B 2PBIB 5HE0B 5GMKn 2UZXB 4R7AB 2AGZA 4A2LA 1OMWB 2CO0C 4JSXC 5H17A 2CO0A 2OK4A 1XKSA 1GXRA 4J0XA 3SBPA 4ES0A 4E5ZA 4A0BB 3RRMC 2GC7A 4ERZA 4PBYA 4GM9A 2YNOA 5GXIA 3IJ0A 2W18A 4H5IA 3N0DA 3UKUC 4CZXA 3OL2A 1U4CA 2CN3A 1QNIA 3PSLA 1JOFA 2I3SA 4CI8A 3JZHA 1XIPA 3FRXA 3FGBA 2H6QA 4GM3A 3OKWA 2I0SA 2OK6A 4A0AB 4GGCA 4JSVC 4XYHA 1NEXB 2AGYA 1L0QA 2IUVA 4U7AA 4CZYA 4OWRA 5THAA 1P22A 4PNKB 2XL2A 3CIKB 2H9LA 3MKSB 3NVXA 2B4EA 3DXKC 4JSNC 2OVRB 2P9PC 1JMXB 4Y5RD 4FAND 3MMYA 4K3ID 2CNXA 2AQ5A 4J78A 4GGAA 4XYIA 2CE8A 3JB9L 4L1QD 3UVMA 4PBZA 3RN0D 4NSXA 1VYHC 5I5IA 3BWSA 3RFGA 3J80g 2PM9A 4A08B 3F3GA 1N6FA 2H3XA 2CN2A 2H68A 3I2NA 2Z2OA 5CXCB 3PE7A 5IJ8E 2J56H 3JROA 2J55H 2I3TA 4N14A 3EI1B 4K3JB 3K26A 3JZGA 2H9NA 2I0RA 4BL0A 4CY5A 3IJCA 3RMZD 4L3GD 4A09A 4ZOYA 2PM9B 3F3FA 2XU7A 3EMHA 2J57G 3SBRA 2H14A 3I7OA 2UZYB 5CXBB 4JSPC 3UVLA 2IUQA 3I7LA 3OKYA 4A11A 3ULEC 4GMBA 1PI6A 1MG3A 2YNNA 5B4WA 4J87A 2AGLA 1GP2B 3C5MA 2B5NA 4QL1A 4CI1A 3PXTD 3SMRA 3V9FA 3EI1A 4G56B 2IUPA 4UI9R 2B5MA 5GSAA 4I79A 3MZKA 3RLMD 1B9XA 4J8GA 5KDOB 3N0EA 5IC7A 3JRPA 3DXMC 3GREA 5FKTA 3A0FA 4ZN4A 2HKMA 4X3EA 2OJYA 3ZWLB 3BG1A 5HE2B 4BUJC 3ORVD 4J77A 2OIZA 3VH0A 4E54B 4A7JA 4IMMA 5EMMB 4CI3A 2HKRA 1K8KC 3KRWB 3VA6A 1PGUA 2G9AA 5I5MA 3UVKA 5IGOA 4E5ZB 3EI2A 2IAAA 2IWFA 1ERJA 5C9ZB 2OVPB 4D0KA 2Z2NA 3UKRC 1B9YA 2P9IC 3I8EA 4FHLA 2P9NC 5EAMA 5IJ7E 2XL3A 2CE9A 4O3UB 3L4MD 4OZUA 3I7NA 5TEFA 4E54A 4LGNA 3V5WB 4ZOXA 2IWKA 4O45A 4YVDA 2XYIA 2GNQA 4QQEA 1GG2B 1N6DA 1GOTB 4PC0A 4A0AA 3DM0A 3EI2B 3F3PA 2OVQB 5EALA 3V7DB 1TBGA 1OLZA 5TEEA 2EBSA 3IIWA 3JPXA 5AMSA 3NVNA 3EU7A 3BG0A 4O1QD 2O9KA 4GM8A 5H1MA 4FWWA 2H13A 3OKYB 4A11B 2Z2PA 4TZ4A 5FLXg 4IA9A 3DSMA 4ERQA 1U2VC 3I7PA 2AGWA 4ERYA 4PSWB 3I8CA 3SN6B 2Q7QA 2HESX 4EWRA 3JAMg 3SJLD 2AH0A 4JXMA 3FM0A 4Y7RA 3EI4A 5FXYA 4J84A 3AL8A 3SHFA 3PSCB 3RSEC 4CY2A 2YB8B 3U4YA 4A08A 3C99A 5IGQA 3JZNA 3SCYA 4FA4D 2B5LA 2QXVA 5EAPA 2H9MA 1A0RB 2P9KC 4J79A 3RN1D 3VGZA 3L4OD 5TF2A 3UR4A 3K27A 4PSXB 5K1CC 2PM6B 4PXWA 5FQDA 4A0BA 2PM7B 2H47A 2YBAA 3MXXA 4CC9A 4H5JA 4AEZA 4FA1D 3EI4B 1MDAH 1N6EA 3AL8B 5HQGA 4J86A 4JD2C 4X60B 2AH1A 3EG6A 5CYKA 2HXCA 4LG8A 5CXCA 3UVNA 5EM2B 2HJ4A 4FA9D 5AJAA 4CY1A 1XHMA 1RI6A 3ODTA 4HDJA 3C9CA 4GQ1A 3DWLC 4ZOZA 5FA5B 3P4FA 4J73A 4FB1D 5JWZA 4GQ2P 5I5JA 4ESGA 4ZOVA 4CI2A 4X63B 4J8BA 5EMKB 3B7FA 5IT9g 3CFVA 5CYKB 2H9PA 4GZ8A 4CZVA 5HE3B 2H6KA 3C75H 4FAVD 1SQ9A 3KRXB 5EM2A 2AGXA 2BBKH 2IURA 4D6VA 4Z8LA 5TDHB 3AH8B 4JT5C 3IKOA 2P9LC 4J0WA 2P9UC 1TYQC 5K19A 3J81g 4XEIC 3OKTA 4GGDA 4GQBB 4A09B 1SQJA 2HJBA 4CY3A 4J82A 3OL2B 3AFCA 3SBQA 3EWEA 2BCJB 3E0CA 5H14A 3SVWD 1FWXA 4FA5D 3EI3A 4LG9A 3SLED 3UVOA 3IJ1A 3MZLA 3OTTA 4L9OA 3I89A 4MK0B 2YNPA 3PVWB 1NR0A 1JJUB 4L3HD 5SXMA 4KFMB 4AOWA 3MKQA 2QC5A 5CXBA 3GFCA 3PXWD 1MG2A 1SHYB 4A2MA 4QT8A 1JMZB 4O9DA 2HYEA 4JT6C 3SWSD 3CFSB 5FKRA 3PXSD 2I0TA 1R5MA 3EI3B 4QRJA 4BH6A 3RFHA 5GXHA 2H6NA 1Q47A 5FKQA 5HYNB 5HE1B 1PBYB 5A2Qg 2G99A 5AFU3 3I7HA 3PVUB 5EMJB 4J81A 1K32A 5EARA 5FKSA 2YMUA 5EMLB 1YFQA 3W15A 3I7KA 3OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTA H;  3IIY A;  3HFQ A;  4U1E I;  5C2W B;  3NVQ A;  2TRC B;  3SFZ A;  1PEV A;  2P9S C;  1S4U X;  2GC4 A;  3SXT D;  3AL9 A;  4O3T B;  5C2V B;  4X61 B;  2PBI B;  5HE0 B;  5GMK n;  2UZX B;  4R7A B;  2AGZ A;  4A2L A;  1OMW B;  2CO0 C;  4JSX C;  5H17 A;  2CO0 A;  2OK4 A;  1XKS A;  1GXR A;  4J0X A;  3SBP A;  4ES0 A;  4E5Z A;  4A0B B;  3RRM C;  2GC7 A;  4ERZ A;  4PBY A;  4GM9 A;  2YNO A;  5GXI A;  3IJ0 A;  2W18 A;  4H5I A;  3N0D A;  3UKU C;  4CZX A;  3OL2 A;  1U4C A;  2CN3 A;  1QNI A;  3PSL A;  1JOF A;  2I3S A;  4CI8 A;  3JZH A;  1XIP A;  3FRX A;  3FGB A;  2H6Q A;  4GM3 A;  3OKW A;  2I0S A;  2OK6 A;  4A0A B;  4GGC A;  4JSV C;  4XYH A;  1NEX B;  2AGY A;  1L0Q A;  2IUV A;  4U7A A;  4CZY A;  4OWR A;  5THA A;  1P22 A;  4PNK B;  2XL2 A;  3CIK B;  2H9L A;  3MKS B;  3NVX A;  2B4E A;  3DXK C;  4JSN C;  2OVR B;  2P9P C;  1JMX B;  4Y5R D;  4FAN D;  3MMY A;  4K3I D;  2CNX A;  2AQ5 A;  4J78 A;  4GGA A;  4XYI A;  2CE8 A;  3JB9 L;  4L1Q D;  3UVM A;  4PBZ A;  3RN0 D;  4NSX A;  1VYH C;  5I5I A;  3BWS A;  3RFG A;  3J80 g;  2PM9 A;  4A08 B;  3F3G A;  1N6F A;  2H3X A;  2CN2 A;  2H68 A;  3I2N A;  2Z2O A;  5CXC B;  3PE7 A;  5IJ8 E;  2J56 H;  3JRO A;  2J55 H;  2I3T A;  4N14 A;  3EI1 B;  4K3J B;  3K26 A;  3JZG A;  2H9N A;  2I0R A;  4BL0 A;  4CY5 A;  3IJC A;  3RMZ D;  4L3G D;  4A09 A;  4ZOY A;  2PM9 B;  3F3F A;  2XU7 A;  3EMH A;  2J57 G;  3SBR A;  2H14 A;  3I7O A;  2UZY B;  5CXB B;  4JSP C;  3UVL A;  2IUQ A;  3I7L A;  3OKY A;  4A11 A;  3ULE C;  4GMB A;  1PI6 A;  1MG3 A;  2YNN A;  5B4W A;  4J87 A;  2AGL A;  1GP2 B;  3C5M A;  2B5N A;  4QL1 A;  4CI1 A;  3PXT D;  3SMR A;  3V9F A;  3EI1 A;  4G56 B;  2IUP A;  4UI9 R;  2B5M A;  5GSA A;  4I79 A;  3MZK A;  3RLM D;  1B9X A;  4J8G A;  5KDO B;  3N0E A;  5IC7 A;  3JRP A;  3DXM C;  3GRE A;  5FKT A;  3A0F A;  4ZN4 A;  2HKM A;  4X3E A;  2OJY A;  3ZWL B;  3BG1 A;  5HE2 B;  4BUJ C;  3ORV D;  4J77 A;  2OIZ A;  3VH0 A;  4E54 B;  4A7J A;  4IMM A;  5EMM B;  4CI3 A;  2HKR A;  1K8K C;  3KRW B;  3VA6 A;  1PGU A;  2G9A A;  5I5M A;  3UVK A;  5IGO A;  4E5Z B;  3EI2 A;  2IAA A;  2IWF A;  1ERJ A;  5C9Z B;  2OVP B;  4D0K A;  2Z2N A;  3UKR C;  1B9Y A;  2P9I C;  3I8E A;  4FHL A;  2P9N C;  5EAM A;  5IJ7 E;  2XL3 A;  2CE9 A;  4O3U B;  3L4M D;  4OZU A;  3I7N A;  5TEF A;  4E54 A;  4LGN A;  3V5W B;  4ZOX A;  2IWK A;  4O45 A;  4YVD A;  2XYI A;  2GNQ A;  4QQE A;  1GG2 B;  1N6D A;  1GOT B;  4PC0 A;  4A0A A;  3DM0 A;  3EI2 B;  3F3P A;  2OVQ B;  5EAL A;  3V7D B;  1TBG A;  1OLZ A;  5TEE A;  2EBS A;  3IIW A;  3JPX A;  5AMS A;  3NVN A;  3EU7 A;  3BG0 A;  4O1Q D;  2O9K A;  4GM8 A;  5H1M A;  4FWW A;  2H13 A;  3OKY B;  4A11 B;  2Z2P A;  4TZ4 A;  5FLX g;  4IA9 A;  3DSM A;  4ERQ A;  1U2V C;  3I7P A;  2AGW A;  4ERY A;  4PSW B;  3I8C A;  3SN6 B;  2Q7Q A;  2HES X;  4EWR A;  3JAM g;  3SJL D;  2AH0 A;  4JXM A;  3FM0 A;  4Y7R A;  3EI4 A;  5FXY A;  4J84 A;  3AL8 A;  3SHF A;  3PSC B;  3RSE C;  4CY2 A;  2YB8 B;  3U4Y A;  4A08 A;  3C99 A;  5IGQ A;  3JZN A;  3SCY A;  4FA4 D;  2B5L A;  2QXV A;  5EAP A;  2H9M A;  1A0R B;  2P9K C;  4J79 A;  3RN1 D;  3VGZ A;  3L4O D;  5TF2 A;  3UR4 A;  3K27 A;  4PSX B;  5K1C C;  2PM6 B;  4PXW A;  5FQD A;  4A0B A;  2PM7 B;  2H47 A;  2YBA A;  3MXX A;  4CC9 A;  4H5J A;  4AEZ A;  4FA1 D;  3EI4 B;  1MDA H;  1N6E A;  3AL8 B;  5HQG A;  4J86 A;  4JD2 C;  4X60 B;  2AH1 A;  3EG6 A;  5CYK A;  2HXC A;  4LG8 A;  5CXC A;  3UVN A;  5EM2 B;  2HJ4 A;  4FA9 D;  5AJA A;  4CY1 A;  1XHM A;  1RI6 A;  3ODT A;  4HDJ A;  3C9C A;  4GQ1 A;  3DWL C;  4ZOZ A;  5FA5 B;  3P4F A;  4J73 A;  4FB1 D;  5JWZ A;  4GQ2 P;  5I5J A;  4ESG A;  4ZOV A;  4CI2 A;  4X63 B;  4J8B A;  5EMK B;  3B7F A;  5IT9 g;  3CFV A;  5CYK B;  2H9P A;  4GZ8 A;  4CZV A;  5HE3 B;  2H6K A;  3C75 H;  4FAV D;  1SQ9 A;  3KRX B;  5EM2 A;  2AGX A;  2BBK H;  2IUR A;  4D6V A;  4Z8L A;  5TDH B;  3AH8 B;  4JT5 C;  3IKO A;  2P9L C;  4J0W A;  2P9U C;  1TYQ C;  5K19 A;  3J81 g;  4XEI C;  3OKT A;  4GGD A;  4GQB B;  4A09 B;  1SQJ A;  2HJB A;  4CY3 A;  4J82 A;  3OL2 B;  3AFC A;  3SBQ A;  3EWE A;  2BCJ B;  3E0C A;  5H14 A;  3SVW D;  1FWX A;  4FA5 D;  3EI3 A;  4LG9 A;  3SLE D;  3UVO A;  3IJ1 A;  3MZL A;  3OTT A;  4L9O A;  3I89 A;  4MK0 B;  2YNP A;  3PVW B;  1NR0 A;  1JJU B;  4L3H D;  5SXM A;  4KFM B;  4AOW A;  3MKQ A;  2QC5 A;  5CXB A;  3GFC A;  3PXW D;  1MG2 A;  1SHY B;  4A2M A;  4QT8 A;  1JMZ B;  4O9D A;  2HYE A;  4JT6 C;  3SWS D;  3CFS B;  5FKR A;  3PXS D;  2I0T A;  1R5M A;  3EI3 B;  4QRJ A;  4BH6 A;  3RFH A;  5GXH A;  2H6N A;  1Q47 A;  5FKQ A;  5HYN B;  5HE1 B;  1PBY B;  5A2Q g;  2G99 A;  5AFU 3;  3I7H A;  3PVU B;  5EMJ B;  4J81 A;  1K32 A;  5EAR A;  5FKS A;  2YMU A;  5EML B;  1YFQ A;  3W15 A;  3I7K A;  3OW8 A; 
#chains in the Genus database with same CATH topology
 4Z7Q A;  2MTA H;  3IIY A;  3HFQ A;  4U1E I;  3ZDY A;  4DNV A;  5C2W B;  3NVQ A;  2TRC B;  3SFZ A;  1PEV A;  2P9S C;  1S4U X;  3ZE0 A;  2GC4 A;  3SXT D;  3AL9 A;  4O3T B;  4G1E A;  3ZE2 A;  5C2V B;  4X61 B;  2PBI B;  1A12 A;  1YR2 A;  5HE0 B;  2UZX B;  5GMK n;  4R7A B;  2AGZ A;  4A2L A;  1OMW B;  2CO0 C;  4JSX C;  5M5U A;  5H17 A;  2CO0 A;  2OK4 A;  1XKS A;  1GXR A;  4J0X A;  3SBP A;  4ES0 A;  4E5Z A;  1UOO A;  3RRM C;  4A0B B;  2GC7 A;  4ERZ A;  4PBY A;  1H2Z A;  4GM9 A;  2YNO A;  5GXI A;  3IJ0 A;  2W18 A;  4H5I A;  3N0D A;  3UKU C;  4CZX A;  3OL2 A;  1U4C A;  1H2W A;  2CN3 A;  1GOF A;  1QNI A;  3PSL A;  1JOF A;  2I3S A;  1JTD B;  4CI8 A;  4AMZ A;  4WK4 A;  3JZH A;  1XIP A;  3FRX A;  3FGB A;  2H6Q A;  3VI4 A;  4GM3 A;  3OKW A;  2I0S A;  2VDR A;  4O02 A;  2OK6 A;  4A0A B;  4GGC A;  4RE5 A;  4JSV C;  3EQ7 A;  1NEX B;  2AGY A;  1L0Q A;  2IUV A;  4XYH A;  1H2X A;  2VZ3 A;  4NBM A;  4MMX A;  1H2Y A;  4U7A A;  4CZY A;  4OWR A;  5THA A;  1P22 A;  4PNK B;  2XL2 A;  3CIK B;  2H9L A;  3K6S A;  3MKS B;  3NVX A;  1E5T A;  2B4E A;  3DXK C;  4JSN C;  5HDB A;  2OVR B;  2P9P C;  1JMX B;  4Y5R D;  2XDW A;  4FAN D;  3MMY A;  1GOG A;  2CNX A;  4K3I D;  4AN1 A;  2AQ5 A;  4J78 A;  4GGA A;  4XYI A;  2CE8 A;  3JB9 L;  4L1Q D;  3UVM A;  4PBZ A;  3EQ8 A;  1QFS A;  3RN0 D;  4BCD A;  4AMY A;  5FFG A;  2HU5 A;  4NSX A;  1VYH C;  5I5I A;  3IUN A;  3BWS A;  3RFG A;  3J80 g;  2PM9 A;  4A08 B;  4G55 A;  3IUM A;  3F3G A;  2VDL A;  1N6F A;  2BKL A;  3IJE A;  2H3X A;  2CN2 A;  2H68 A;  1E8M A;  3IUQ A;  4BP9 A;  3I2N A;  2Z2O A;  5CXC B;  3PE7 A;  5IJ8 E;  1L5G A;  2J56 H;  3JRO A;  2J55 H;  4JHP C;  2I3T A;  4N14 A;  3EI1 B;  5E6U A;  4K3J B;  3K26 A;  3JZG A;  1O6F A;  2H9N A;  2I0R A;  4BL0 A;  4CY5 A;  3IJC A;  3EQ9 A;  2EIC A;  3RMZ D;  4L3G D;  2HU8 A;  4A09 A;  4ZOY A;  3NIG A;  2PM9 B;  3F3F A;  2XU7 A;  3EMH A;  3K71 A;  2J57 G;  3SBR A;  4AX4 A;  4BCB A;  2H14 A;  3I7O A;  1TYE A;  2UZY B;  5CXB B;  4JSP C;  3UVL A;  2IUQ A;  3I7L A;  3OKY A;  1JV2 A;  2VDN A;  3ULE C;  4GMB A;  1PI6 A;  4A11 A;  1MG3 A;  1UOQ A;  2VDO A;  2YNN A;  5B4W A;  4J87 A;  2AGL A;  5C92 A;  1GP2 B;  3C5M A;  4Z7O A;  2B5N A;  4QL1 A;  4CI1 A;  3PXT D;  4NEN A;  3SMR A;  1K3I A;  3V9F A;  3IUL A;  3EI1 A;  4G56 B;  2IUP A;  4UI9 R;  2B5M A;  5GSA A;  4I79 A;  2VDP A;  3MZK A;  2EIB A;  4G1M A;  3RLM D;  1B9X A;  4J8G A;  5KDO B;  1BPO A;  3N0E A;  5IC7 A;  3JRP A;  3DXM C;  3GRE A;  5FKT A;  3A0F A;  4ZN4 A;  3O4H A;  2HKM A;  3NIF A;  3O4J A;  4X3E A;  2QZP A;  2OJY A;  3ZWL B;  3BG1 A;  5HE2 B;  4BUJ C;  4RE6 A;  3ORV D;  4WJK A;  3ZDZ A;  4J77 A;  2OIZ A;  3VH0 A;  4E54 B;  4A7J A;  4IMM A;  5EMM B;  4CI3 A;  1O6G A;  2HKR A;  1K8K C;  3KRW B;  3VA6 A;  1PGU A;  2G9A A;  5I5M A;  3UVK A;  5IGO A;  4E5Z B;  4UM9 A;  3EI2 A;  2IAA A;  2IWF A;  1ERJ A;  5C9Z B;  2OVP B;  4D0K A;  2Z2N A;  3UKR C;  1B9Y A;  2P9I C;  2VZ1 A;  3T3M A;  3I8E A;  4NAA A;  4FHL A;  2P9N C;  5EAM A;  5IJ7 E;  2XL3 A;  2CE9 A;  4O3U B;  3L4M D;  4OZU A;  5M5V A;  3I7N A;  5TEF A;  4E54 A;  4LGN A;  3V5W B;  4ZOX A;  2IWK A;  4O45 A;  4YVD A;  2XYI A;  2GNQ A;  4QQE A;  1GG2 B;  1N6D A;  1QFM A;  1GOT B;  4PC0 A;  1M1X A;  4A0A A;  3DM0 A;  3EI2 B;  1VZ2 A;  3IVM A;  3F3P A;  2OVQ B;  5EAL A;  3V7D B;  1TBG A;  1OLZ A;  5TEE A;  2EBS A;  2VDK A;  3IIW A;  3JPX A;  5AMS A;  3NVN A;  3EU7 A;  3BG0 A;  4O1Q D;  2O9K A;  4GM8 A;  5H1M A;  4FWW A;  2H13 A;  3OKY B;  4A11 B;  2Z2P A;  4TZ4 A;  5FLX g;  4IA9 A;  5FFO A;  3DSM A;  4ERQ A;  1U2V C;  3I7P A;  2AGW A;  2VDM A;  4ERY A;  4PSW B;  3I8C A;  3SN6 B;  2Q7Q A;  2HES X;  4EWR A;  3JAM g;  3SJL D;  2AH0 A;  3KCI A;  4JXM A;  1VE6 A;  3FM0 A;  5C86 A;  4Y7R A;  1UTC A;  3EI4 A;  5FXY A;  4J84 A;  3AL8 A;  3SHF A;  3PSC B;  3RSE C;  4CY2 A;  2YB8 B;  3U4Y A;  1C9I A;  4A08 A;  4WK0 A;  1I2M B;  3C99 A;  5IGQ A;  3JZN A;  2XZG A;  3SCY A;  4FA4 D;  2B5L A;  2QXV A;  5EAP A;  2H9M A;  1A0R B;  1E8N A;  1T2X A;  2P9K C;  4J79 A;  3RN1 D;  3VGZ A;  3L4O D;  3IUJ A;  3FCS A;  5TF2 A;  3O4I A;  3GC3 B;  3UR4 A;  3K27 A;  4PSX B;  5K1C C;  4AN0 A;  4DNU A;  2PM6 B;  3MUO A;  4PXW A;  5FQD A;  4A0B A;  2PM7 B;  2H47 A;  2YBA A;  3MXX A;  4DNW A;  4CC9 A;  4H5J A;  4AEZ A;  4FA1 D;  3EI4 B;  1MDA H;  1N6E A;  3AL8 B;  3K72 A;  5HQG A;  1UOP A;  4J86 A;  4JD2 C;  4X60 B;  2AH1 A;  3EG6 A;  4JHN A;  5CYK A;  2HXC A;  4LG8 A;  3IUR A;  5CXC A;  3UVN A;  5EM2 B;  1U8C A;  2HJ4 A;  4FA9 D;  5AJA A;  4L1M A;  4CY1 A;  1XHM A;  1RI6 A;  4BP8 A;  2EIE A;  3ODT A;  3OF7 A;  4HDJ A;  4D9S A;  3C9C A;  4GQ1 A;  3DWL C;  4ZOZ A;  5FA5 B;  3P4F A;  4J73 A;  4FB1 D;  5JWZ A;  4GQ2 P;  5I5J A;  4ESG A;  4ZOV A;  4CI2 A;  4X63 B;  4J8B A;  5EMK B;  3B7F A;  5IT9 g;  3CFV A;  3NID A;  5CYK B;  2H9P A;  4GZ8 A;  4CZV A;  5HE3 B;  2H6K A;  3C75 H;  4FAV D;  1SQ9 A;  3KRX B;  5EM2 A;  2AGX A;  2BBK H;  2IUR A;  4D6V A;  4Z8L A;  5TDH B;  3AH8 B;  2QR5 A;  4JT5 C;  2WQ8 A;  3IKO A;  5M5T A;  2P9L C;  3FCU A;  4J0W A;  2P9U C;  1TYQ C;  2JKX A;  5K19 A;  1VZ3 A;  4XEI C;  3J81 g;  3OKT A;  2HU7 A;  4GGD A;  4GQB B;  4A09 B;  3ZDX A;  1SQJ A;  4MMY A;  5E6R A;  2HJB A;  1C9L A;  4CY3 A;  4J82 A;  3OL2 B;  3V4P A;  1GOH A;  2XE4 A;  3AFC A;  3SBQ A;  3EWE A;  2BCJ B;  3VI3 A;  3E0C A;  5H14 A;  3GD1 I;  3SVW D;  1FWX A;  4FA5 D;  3QI0 A;  3EI3 A;  3DDU A;  4LG9 A;  2VDQ A;  3SLE D;  3UVO A;  3ZE1 A;  3IJ1 A;  4QAM A;  3MZL A;  3OTT A;  4IRZ A;  4UM8 A;  3MUN A;  4L9O A;  3I89 A;  4MK0 B;  2YNP A;  3PVW B;  1NR0 A;  1JJU B;  4L3H D;  5M61 A;  5SXM A;  4KFM B;  4AOW A;  3MKQ A;  2QC5 A;  5CXB A;  3QHY B;  4MMZ A;  3GFC A;  3PXW D;  1MG2 A;  1SHY B;  4A2M A;  4QT8 A;  5M5S A;  1JMZ B;  4O9D A;  3V4V A;  2HYE A;  4O2W A;  4JT6 C;  3SWS D;  3CFS B;  5FKR A;  3PXS D;  2I0T A;  1R5M A;  3EI3 B;  4QRJ A;  4BH6 A;  2VC2 A;  2EID A;  5E6S A;  3RFH A;  5GXH A;  4NC4 A;  2H6N A;  4BCC A;  1Q47 A;  5FKQ A;  1VE7 A;  5HYN B;  5HE1 B;  5M5R A;  1PBY B;  5A2Q g;  2G99 A;  5AFU 3;  3I7H A;  3O4G A;  3PVU B;  4WK2 A;  4J81 A;  5EMJ B;  4Z7N A;  1K32 A;  5EAR A;  3MVD K;  3T3P A;  5FKS A;  2YMU A;  5EML B;  1YFQ A;  3W15 A;  3I7K A;  3OW8 A; 
#chains in the Genus database with same CATH homology
 2MTA H;  3IIY A;  3HFQ A;  4U1E I;  5C2W B;  3NVQ A;  2TRC B;  3SFZ A;  1PEV A;  2P9S C;  1S4U X;  2GC4 A;  3SXT D;  3AL9 A;  4O3T B;  5C2V B;  4X61 B;  2PBI B;  5HE0 B;  5GMK n;  2UZX B;  4R7A B;  2AGZ A;  4A2L A;  1OMW B;  2CO0 C;  4JSX C;  5H17 A;  2CO0 A;  2OK4 A;  1XKS A;  1GXR A;  4J0X A;  3SBP A;  4ES0 A;  4E5Z A;  4A0B B;  3RRM C;  2GC7 A;  4ERZ A;  4PBY A;  4GM9 A;  2YNO A;  5GXI A;  3IJ0 A;  2W18 A;  4H5I A;  3N0D A;  3UKU C;  4CZX A;  3OL2 A;  1U4C A;  2CN3 A;  1QNI A;  3PSL A;  1JOF A;  2I3S A;  4CI8 A;  3JZH A;  1XIP A;  3FRX A;  3FGB A;  2H6Q A;  4GM3 A;  3OKW A;  2I0S A;  2OK6 A;  4A0A B;  4GGC A;  4JSV C;  4XYH A;  1NEX B;  2AGY A;  1L0Q A;  2IUV A;  4U7A A;  4CZY A;  4OWR A;  5THA A;  1P22 A;  4PNK B;  2XL2 A;  3CIK B;  2H9L A;  3MKS B;  3NVX A;  2B4E A;  3DXK C;  4JSN C;  2OVR B;  2P9P C;  1JMX B;  4Y5R D;  4FAN D;  3MMY A;  4K3I D;  2CNX A;  2AQ5 A;  4J78 A;  4GGA A;  4XYI A;  2CE8 A;  3JB9 L;  4L1Q D;  3UVM A;  4PBZ A;  3RN0 D;  4NSX A;  1VYH C;  5I5I A;  3BWS A;  3RFG A;  3J80 g;  2PM9 A;  4A08 B;  3F3G A;  1N6F A;  2H3X A;  2CN2 A;  2H68 A;  3I2N A;  2Z2O A;  5CXC B;  3PE7 A;  5IJ8 E;  2J56 H;  3JRO A;  2J55 H;  2I3T A;  4N14 A;  3EI1 B;  4K3J B;  3K26 A;  3JZG A;  2H9N A;  2I0R A;  4BL0 A;  4CY5 A;  3IJC A;  3RMZ D;  4L3G D;  4A09 A;  4ZOY A;  2PM9 B;  3F3F A;  2XU7 A;  3EMH A;  2J57 G;  3SBR A;  2H14 A;  3I7O A;  2UZY B;  5CXB B;  4JSP C;  3UVL A;  2IUQ A;  3I7L A;  3OKY A;  4A11 A;  3ULE C;  4GMB A;  1PI6 A;  1MG3 A;  2YNN A;  5B4W A;  4J87 A;  2AGL A;  1GP2 B;  3C5M A;  2B5N A;  4QL1 A;  4CI1 A;  3PXT D;  3SMR A;  3V9F A;  3EI1 A;  4G56 B;  2IUP A;  4UI9 R;  2B5M A;  5GSA A;  4I79 A;  3MZK A;  3RLM D;  1B9X A;  4J8G A;  5KDO B;  3N0E A;  5IC7 A;  3JRP A;  3DXM C;  3GRE A;  5FKT A;  3A0F A;  4ZN4 A;  2HKM A;  4X3E A;  2OJY A;  3ZWL B;  3BG1 A;  5HE2 B;  4BUJ C;  3ORV D;  4J77 A;  2OIZ A;  3VH0 A;  4E54 B;  4A7J A;  4IMM A;  5EMM B;  4CI3 A;  2HKR A;  1K8K C;  3KRW B;  3VA6 A;  1PGU A;  2G9A A;  5I5M A;  3UVK A;  5IGO A;  4E5Z B;  3EI2 A;  2IAA A;  2IWF A;  1ERJ A;  5C9Z B;  2OVP B;  4D0K A;  2Z2N A;  3UKR C;  1B9Y A;  2P9I C;  3I8E A;  4FHL A;  2P9N C;  5EAM A;  5IJ7 E;  2XL3 A;  2CE9 A;  4O3U B;  3L4M D;  4OZU A;  3I7N A;  5TEF A;  4E54 A;  4LGN A;  3V5W B;  4ZOX A;  2IWK A;  4O45 A;  4YVD A;  2XYI A;  2GNQ A;  4QQE A;  1GG2 B;  1N6D A;  1GOT B;  4PC0 A;  4A0A A;  3DM0 A;  3EI2 B;  3F3P A;  2OVQ B;  5EAL A;  3V7D B;  1TBG A;  1OLZ A;  5TEE A;  2EBS A;  3IIW A;  3JPX A;  5AMS A;  3NVN A;  3EU7 A;  3BG0 A;  4O1Q D;  2O9K A;  4GM8 A;  5H1M A;  4FWW A;  2H13 A;  3OKY B;  4A11 B;  2Z2P A;  4TZ4 A;  5FLX g;  4IA9 A;  3DSM A;  4ERQ A;  1U2V C;  3I7P A;  2AGW A;  4ERY A;  4PSW B;  3I8C A;  3SN6 B;  2Q7Q A;  2HES X;  4EWR A;  3JAM g;  3SJL D;  2AH0 A;  4JXM A;  3FM0 A;  4Y7R A;  3EI4 A;  5FXY A;  4J84 A;  3AL8 A;  3SHF A;  3PSC B;  3RSE C;  4CY2 A;  2YB8 B;  3U4Y A;  4A08 A;  3C99 A;  5IGQ A;  3JZN A;  3SCY A;  4FA4 D;  2B5L A;  2QXV A;  5EAP A;  2H9M A;  1A0R B;  2P9K C;  4J79 A;  3RN1 D;  3VGZ A;  3L4O D;  5TF2 A;  3UR4 A;  3K27 A;  4PSX B;  5K1C C;  2PM6 B;  4PXW A;  5FQD A;  4A0B A;  2PM7 B;  2H47 A;  2YBA A;  3MXX A;  4CC9 A;  4H5J A;  4AEZ A;  4FA1 D;  3EI4 B;  1MDA H;  1N6E A;  3AL8 B;  5HQG A;  4J86 A;  4JD2 C;  4X60 B;  2AH1 A;  3EG6 A;  5CYK A;  2HXC A;  4LG8 A;  5CXC A;  3UVN A;  5EM2 B;  2HJ4 A;  4FA9 D;  5AJA A;  4CY1 A;  1XHM A;  1RI6 A;  3ODT A;  4HDJ A;  3C9C A;  4GQ1 A;  3DWL C;  4ZOZ A;  5FA5 B;  3P4F A;  4J73 A;  4FB1 D;  5JWZ A;  4GQ2 P;  5I5J A;  4ESG A;  4ZOV A;  4CI2 A;  4X63 B;  4J8B A;  5EMK B;  3B7F A;  5IT9 g;  3CFV A;  5CYK B;  2H9P A;  4GZ8 A;  4CZV A;  5HE3 B;  2H6K A;  3C75 H;  4FAV D;  1SQ9 A;  3KRX B;  5EM2 A;  2AGX A;  2BBK H;  2IUR A;  4D6V A;  4Z8L A;  5TDH B;  3AH8 B;  4JT5 C;  3IKO A;  2P9L C;  4J0W A;  2P9U C;  1TYQ C;  5K19 A;  3J81 g;  4XEI C;  3OKT A;  4GGD A;  4GQB B;  4A09 B;  1SQJ A;  2HJB A;  4CY3 A;  4J82 A;  3OL2 B;  3AFC A;  3SBQ A;  3EWE A;  2BCJ B;  3E0C A;  5H14 A;  3SVW D;  1FWX A;  4FA5 D;  3EI3 A;  4LG9 A;  3SLE D;  3UVO A;  3IJ1 A;  3MZL A;  3OTT A;  4L9O A;  3I89 A;  4MK0 B;  2YNP A;  3PVW B;  1NR0 A;  1JJU B;  4L3H D;  5SXM A;  4KFM B;  4AOW A;  3MKQ A;  2QC5 A;  5CXB A;  3GFC A;  3PXW D;  1MG2 A;  1SHY B;  4A2M A;  4QT8 A;  1JMZ B;  4O9D A;  2HYE A;  4JT6 C;  3SWS D;  3CFS B;  5FKR A;  3PXS D;  2I0T A;  1R5M A;  3EI3 B;  4QRJ A;  4BH6 A;  3RFH A;  5GXH A;  2H6N A;  1Q47 A;  5FKQ A;  5HYN B;  5HE1 B;  1PBY B;  5A2Q g;  2G99 A;  5AFU 3;  3I7H A;  3PVU B;  5EMJ B;  4J81 A;  1K32 A;  5EAR A;  5FKS A;  2YMU A;  5EML B;  1YFQ A;  3W15 A;  3I7K A;  3OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...