2GC7A

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
total genus 94
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc7A00
4BH6A 4QT8A 3VGZA 3UKUC 3UVLA 4QRJA 3EI2A 2UZXB 3PE7A 4A09A 2TRCB 3I7LA 3I7PA 3VA6A 3DXKC 5EMLB 3PSCB 3IKOA 5IJ8E 2YNNA 4UI9R 4NSXA 5GSAA 3IJ1A 4E54B 3KRXB 5IT9g 4J86A 3K26A 5H17A 4X3EA 3J81g 4GGCA 4GM3A 4ESGA 3JPXA 2H47A 5TDHB 2HXCA 4CZVA 5EMKB 4CY1A 3N0EA 2GC4A 2H9LA 4LG9A 2XYIA 1NEXB 2GC7A 3PVUB 5EMJB 4GM8A 1U4CA 2H6NA 4QQEA 4GM9A 4PC0A 3SBQA 5IC7A 1PEVA 1XKSA 1MG3A 2OJYA 3AL8B 3PSLA 2GNQA 4XYHA 5AMSA 4GGAA 2P9SC 3I7HA 3EI4A 2P9IC 4L3HD 2HJ4A 1XIPA 4O1QD 5IJ7E 2G9AA 4G56B 3PXSD 4A0AB 5GMKn 2B4EA 4FAVD 3C99A 1GOTB 1SQ9A 4J0XA 2Z2PA 3SLED 3JZHA 4Z8LA 3UVKA 1U2VC 2CE9A 2J56H 3MZLA 3EG6A 4MK0B 2PM9A 1TYQC 5EM2B 2YNPA 1K32A 2PBIB 5TF2A 1PGUA 4ZN4A 4A11A 1OMWB 4PBYA 3MKSB 4D0KA 5FKRA 5B4WA 3PVWB 4X60B 2OVPB 4Y5RD 5H14A 5CYKA 3PXWD 4KFMB 4FWWA 2QXVA 5FKTA 1JOFA 2H68A 4LG8A 3BG0A 4J8GA 4L1QD 3UKRC 3JZGA 4J8BA 2B5NA 1GG2B 1B9XA 2O9KA 2XU7A 4GQ1A 2XL3A 2AGZA 5GXHA 4A2LA 4CC9A 2J55H 3MXXA 3OL2B 1SQJA 2OIZA 3E0CA 3SBRA 3EI2B 3EI3A 3JRPA 4A09B 4R7AB 2B5LA 2H9MA 4FAND 5KDOB 3OKYA 5C9ZB 3I8CA 3C75H 2QC5A 3DXMC 4O3UB 4HDJA 2H3XA 1N6DA 2AGYA 5FQDA 4H5IA 3I89A 4IMMA 4OZUA 3MKQA 5HQGA 4PSXB 2UZYB 2OK4A 3V9FA 2YBAA 4N14A 4YVDA 3V5WB 4K3JB 4OWRA 3A0FA 1P22A 3DWLC 3I2NA 3RN1D 3SHFA 4CY3A 2YMUA 1RI6A 3KRWB 4L9OA 3SCYA 4GQ2P 4CI3A 5H1MA 3B7FA 5EALA 5HE1B 5HE3B 2H6QA 4E5ZA 4JSVC 3EWEA 4J81A 1MG2A 5HE2B 1N6EA 4X63B 3ZWLB 3RMZD 5CXCA 5HE0B 4J82A 4J87A 2H14A 4Y7RA 5FLXg 4IA9A 1S4UX 2PM6B 3FGBA 3UVMA 3EI4B 4JSXC 4AEZA 5I5IA 2AH0A 4I79A 2I0TA 4U1EI 2I0SA 3MMYA 2Z2NA 4JSPC 2IUVA 3P4FA 4ERYA 4XEIC 5FA5B 4FA5D 2W18A 5FXYA 4CY2A 2PM9B 3L4MD 1JMXB 3ORVD 4D6VA 3EU7A 4A11B 5C2WB 2YNOA 5K19A 4ERZA 4PBZA 3AL9A 4CI2A 1PBYB 4X61B 3JAMg 2H9NA 5IGQA 4FB1D 3NVXA 2Q7QA 5FKSA 5CYKB 4LGNA 3EI1A 4J78A 3JROA 3F3GA 3BWSA 4ZOXA 4CI1A 3AH8B 3GREA 2CO0A 2J57G 2H13A 2OVRB 3I8EA 3RRMC 3VH0A 2MTAH 5TEFA 1ERJA 2P9PC 3CIKB 2AGWA 4A0BA 2G99A 3EMHA 3MZKA 3CFSB 3W15A 5JWZA 4BUJC 4J0WA 2EBSA 2PM7B 3SFZA 3CFVA 3EI3B 4PXWA 1JJUB 3OW8A 4JD2C 5K1CC 3OKYB 3UVOA 4EWRA 4J84A 3DM0A 5EMMB 4PNKB 4FA4D 4A08A 2Z2OA 1GP2B 3I7NA 2AH1A 1N6FA 4QL1A 1FWXA 3NVNA 2I3TA 3FRXA 1L0QA 2P9LC 2AGLA 2IUQA 3ULEC 2IURA 3OKWA 3JB9L 5CXBA 4CI8A 3SVWD 5IGOA 3OL2A 2P9NC 4J77A 5I5JA 3C9CA 3NVQA 1B9YA 3GFCA 1A0RB 3C5MA 4CZYA 2IWKA 2BCJB 4E5ZB 3PXTD 2IUPA 5CXCB 2XL2A 3UVNA 2HYEA 1YFQA 2CN2A 3F3FA 3SWSD 4JT6C 4E54A 1JMZB 4GZ8A 3RFHA 3V7DB 5THAA 3OKTA 3RLMD 4ZOZA 2H6KA 3IIYA 5FKQA 2AGXA 4ERQA 4GMBA 2IAAA 3U4YA 3BG1A 2CO0C 3RFGA 4JSNC 5I5MA 3FM0A 1R5MA 2HJBA 4GQBB 4CZXA 5SXMA 2CNXA 4XYIA 2P9UC 1Q47A 5EAMA 3RSEC 3AL8A 2OK6A 3OTTA 3HFQA 4ZOYA 4O45A 3I7OA 3F3PA 3DSMA 3SBPA 3IIWA 2HKMA 3L4OD 4A0AA 1K8KC 1GXRA 3AFCA 2I3SA 3EI1B 4O9DA 4ES0A 1XHMA 4GGDA 5AFU3 4A2MA 3N0DA 3UR4A 4U7AA 4O3TB 3RN0D 4PSWB 2P9KC 4AOWA 3J80g 4JT5C 2CE8A 2BBKH 5EM2A 1SHYB 4A0BB 4J79A 5HYNB 2OVQB 3SN6B 3SMRA 4J73A 2CN3A 4FA9D 4K3ID 5TEEA 3SXTD 1MDAH 3JZNA 3SJLD 3IJ0A 2HESX 5EAPA 3ODTA 3I7KA 4TZ4A 5A2Qg 4A7JA 1QNIA 2I0RA 4CY5A 2H9PA 4ZOVA 4FA1D 4A08B 2B5MA 5GXIA 4H5JA 3K27A 2YB8B 5AJAA 4BL0A 4FHLA 1PI6A 2IWFA 4L3GD 2AQ5A 5CXBB 1OLZA 2HKRA 3IJCA 1TBGA 4JXMA 5EARA 5C2VB 1NR0A 1VYHC
chains in the Genus database with same CATH superfamily
4BH6A 4QT8A 3VGZA 4UM8A 3UKUC 1QFMA 3UVLA 4QRJA 3EI2A 2UZXB 3PE7A 4A09A 3ZE2A 2TRCB 3I7LA 3I7PA 3VA6A 4AN1A 3DXKC 5EMLB 3PSCB 3IKOA 5IJ8E 2YNNA 4UI9R 4NSXA 5GSAA 3IJ1A 4E54B 3KRXB 5IT9g 4J86A 3K26A 5H17A 4X3EA 2QZPA 3J81g 4GGCA 4NBMA 4GM3A 2XDWA 4ESGA 3JPXA 4UM9A 2H47A 5TDHB 2HXCA 4CZVA 5EMKB 4CY1A 4G55A 3N0EA 2EIEA 2GC4A 2H9LA 4LG9A 2XYIA 3DDUA 1NEXB 2GC7A 1VE7A 1K3IA 3PVUB 5EMJB 4GM8A 1U4CA 2H6NA 4QQEA 4GM9A 4PC0A 3SBQA 5IC7A 1PEVA 1XKSA 1MG3A 1C9IA 2OJYA 3AL8B 5E6UA 3PSLA 2GNQA 4XYHA 5AMSA 4GGAA 2P9SC 1UTCA 4MMZA 1VZ3A 3I7HA 3EI4A 2P9IC 4L3HD 2EICA 2HJ4A 1XIPA 4O1QD 5IJ7E 2G9AA 4G56B 3PXSD 4A0AB 5C86A 1L5GA 5GMKn 2B4EA 4FAVD 3T3MA 3C99A 1GOTB 1SQ9A 4J0XA 4RE6A 1UOPA 2Z2PA 3SLED 3JZHA 4Z8LA 3UVKA 3ZE1A 1U2VC 1I2MB 2CE9A 2J56H 3MZLA 3MUNA 3EG6A 1O6FA 3MUOA 4MK0B 2PM9A 2VDRA 3OF7A 1TYQC 5EM2B 2YNPA 1K32A 2PBIB 5TF2A 1PGUA 4AMYA 5M61A 4G1MA 4ZN4A 4A11A 1OMWB 4Z7QA 4RE5A 2VDLA 4PBYA 3MKSB 4D0KA 5FKRA 4DNVA 4BCDA 5B4WA 3PVWB 4X60B 4IRZA 2OVPB 4Y5RD 5E6SA 5H14A 3EQ8A 5CYKA 3PXWD 4KFMB 4FWWA 2QXVA 5FKTA 1JOFA 2H68A 4LG8A 3BG0A 3FCUA 4J8GA 4L1QD 3UKRC 3JZGA 4J8BA 2B5NA 1GG2B 3O4HA 1B9XA 2O9KA 2XU7A 4GQ1A 3ZE0A 2XL3A 2AGZA 2VDMA 5GXHA 4A2LA 4G1EA 4CC9A 2J55H 3MXXA 3T3PA 3OL2B 1SQJA 2OIZA 4AMZA 3E0CA 3SBRA 3EI2B 3FCSA 3EI3A 3JRPA 4WK0A 4A09B 4R7AB 1H2ZA 2B5LA 2H9MA 4FAND 5KDOB 3OKYA 5C9ZB 3I8CA 3C75H 2QC5A 3DXMC 4O3UB 3EQ7A 4HDJA 2H3XA 4L1MA 1H2WA 1N6DA 4WK4A 2AGYA 5FQDA 3QHYB 4H5IA 3I89A 4IMMA 4D9SA 4OZUA 3MKQA 5HQGA 4PSXB 2UZYB 2OK4A 3V9FA 2YBAA 4NAAA 4N14A 4YVDA 3V5WB 4K3JB 4OWRA 3A0FA 2VDQA 1P22A 3ZDYA 3DWLC 3I2NA 3RN1D 4QAMA 1VZ2A 3SHFA 4CY3A 5M5RA 4NENA 2YMUA 1RI6A 3KRWB 1YR2A 4L9OA 3SCYA 4GQ2P 4CI3A 5H1MA 3B7FA 5EALA 5HE1B 5HE3B 2H6QA 4E5ZA 4JSVC 3EWEA 4J81A 1MG2A 5HE2B 1N6EA 4X63B 3ZDZA 3ZWLB 3RMZD 5CXCA 5HE0B 4J82A 4J87A 2H14A 4Y7RA 5FLXg 4IA9A 4WK2A 1S4UX 2PM6B 2EIDA 3FGBA 4DNWA 1GOHA 3UVMA 2QR5A 3EI4B 4JSXC 4AEZA 5I5IA 5M5VA 4JHPC 2AH0A 4I79A 2I0TA 4U1EI 2I0SA 3MMYA 2Z2NA 4Z7OA 4JSPC 1VE6A 2XZGA 2VZ3A 1O6GA 2IUVA 3P4FA 4ERYA 4XEIC 5FA5B 4FA5D 2W18A 5FXYA 3K71A 1TYEA 1H2YA 4CY2A 2PM9B 3L4MD 3MVDK 1JMXB 4AX4A 3ORVD 4D6VA 3EU7A 1UOQA 2VDOA 4A11B 4O2WA 5C2WB 3IUNA 2YNOA 3EQ9A 5K19A 4ERZA 1U8CA 4PBZA 3AL9A 4CI2A 1PBYB 4X61B 3JAMg 2H9NA 5IGQA 4BP9A 4FB1D 3NVXA 2JKXA 2Q7QA 5FKSA 5CYKB 4LGNA 3EI1A 4J78A 5C92A 3JROA 3F3GA 3BWSA 4ZOXA 4JHNA 4CI1A 3AH8B 3GREA 3I8EA 1QFSA 2CO0A 2H13A 2J57G 2OVRB 2VZ1A 3RRMC 3VH0A 2MTAH 5TEFA 1ERJA 1M1XA 2P9PC 3CIKB 2AGWA 4A0BA 2G99A 3EMHA 3MZKA 2HU8A 3CFSB 5E6RA 3W15A 5JWZA 1T2XA 4BUJC 4J0WA 2EBSA 2PM7B 3SFZA 3CFVA 3EI3B 3GC3B 1JJUB 4PXWA 3OW8A 4BCCA 4JD2C 4WJKA 3O4GA 5K1CC 3OKYB 3UVOA 4EWRA 4J84A 3DM0A 4MMXA 5HDBA 5EMMB 3ZDXA 3IUJA 4PNKB 4FA4D 4A08A 2Z2OA 1GP2B 3I7NA 5M5UA 3NIDA 2AH1A 1N6FA 3K72A 4Z7NA 4QL1A 1FWXA 3NVNA 2I3TA 1E8MA 3FRXA 1L0QA 5FFOA 2P9LC 2HU5A 2AGLA 2IUQA 3ULEC 2IURA 3OKWA 3JB9L 3V4VA 2XE4A 5CXBA 4CI8A 3SVWD 5IGOA 3OL2A 2P9NC 4J77A 5I5JA 2VDPA 5M5SA 3O4IA 4BCBA 3C9CA 1UOOA 1GOFA 3NVQA 1B9YA 3GFCA 1A0RB 3C5MA 4NC4A 4CZYA 2IWKA 2BCJB 4E5ZB 3VI3A 1E8NA 3PXTD 2IUPA 2WQ8A 4O02A 5CXCB 1E5TA 2XL2A 3UVNA 2HYEA 1YFQA 2CN2A 3F3FA 3SWSD 4JT6C 4E54A 1JMZB 4GZ8A 3RFHA 3V7DB 5THAA 3OKTA 3RLMD 4ZOZA 3V4PA 2H6KA 3IIYA 5FKQA 2AGXA 4ERQA 1JV2A 4GMBA 1H2XA 2IAAA 3U4YA 3BG1A 2CO0C 4MMYA 3RFGA 3KCIA 4JSNC 5I5MA 2VDNA 3FM0A 1R5MA 2HJBA 3NIGA 4GQBB 4CZXA 5SXMA 2CNXA 4XYIA 1GOGA 5M5TA 2P9UC 1Q47A 5EAMA 3RSEC 3AL8A 2OK6A 2VDKA 2EIBA 3OTTA 4DNUA 3HFQA 4BP8A 1A12A 4O45A 4ZOYA 3I7OA 3F3PA 3DSMA 3SBPA 3IIWA 2HKMA 3L4OD 4A0AA 1K8KC 1GXRA 3IVMA 3AFCA 2I3SA 3GD1I 3EI1B 4O9DA 4ES0A 1XHMA 4GGDA 2HU7A 5AFU3 3K6SA 1JTDB 4A2MA 3N0DA 3UR4A 3IULA 4U7AA 4O3TB 3RN0D 4PSWB 2P9KC 4AOWA 3J80g 4JT5C 2CE8A 2BBKH 3QI0A 1SHYB 3O4JA 5EM2A 5FFGA 4AN0A 4A0BB 2BKLA 4J79A 5HYNB 2OVQB 3SN6B 3SMRA 4J73A 3NIFA 2CN3A 3IURA 4FA9D 4K3ID 5TEEA 3SXTD 1MDAH 3JZNA 3SJLD 3IJ0A 2HESX 5EAPA 3ODTA 3I7KA 4TZ4A 1BPOA 5A2Qg 3IUQA 2VC2A 1C9LA 4A7JA 1QNIA 2I0RA 4CY5A 2H9PA 3VI4A 4ZOVA 4FA1D 4A08B 2B5MA 3IUMA 4H5JA 5GXIA 3K27A 2YB8B 5AJAA 4BL0A 4FHLA 1PI6A 2IWFA 4L3GD 2AQ5A 5CXBB 1OLZA 2HKRA 3IJEA 3IJCA 1TBGA 4JXMA 5EARA 5C2VB 1NR0A 1VYHC
chains in the Genus database with same CATH topology
4BH6A 4QT8A 3VGZA 3UKUC 3UVLA 4QRJA 3EI2A 2UZXB 3PE7A 4A09A 2TRCB 3I7LA 3I7PA 3VA6A 3DXKC 5EMLB 3PSCB 3IKOA 5IJ8E 2YNNA 4UI9R 4NSXA 5GSAA 3IJ1A 4E54B 3KRXB 5IT9g 4J86A 3K26A 5H17A 4X3EA 3J81g 4GGCA 4GM3A 4ESGA 3JPXA 2H47A 5TDHB 2HXCA 4CZVA 5EMKB 4CY1A 3N0EA 2GC4A 2H9LA 4LG9A 2XYIA 1NEXB 2GC7A 3PVUB 5EMJB 4GM8A 1U4CA 2H6NA 4QQEA 4GM9A 4PC0A 3SBQA 5IC7A 1PEVA 1XKSA 1MG3A 2OJYA 3AL8B 3PSLA 2GNQA 4XYHA 5AMSA 4GGAA 2P9SC 3I7HA 3EI4A 2P9IC 4L3HD 2HJ4A 1XIPA 4O1QD 5IJ7E 2G9AA 4G56B 3PXSD 4A0AB 5GMKn 2B4EA 4FAVD 3C99A 1GOTB 1SQ9A 4J0XA 2Z2PA 3SLED 3JZHA 4Z8LA 3UVKA 1U2VC 2CE9A 2J56H 3MZLA 3EG6A 4MK0B 2PM9A 1TYQC 5EM2B 2YNPA 1K32A 2PBIB 5TF2A 1PGUA 4ZN4A 4A11A 1OMWB 4PBYA 3MKSB 4D0KA 5FKRA 5B4WA 3PVWB 4X60B 2OVPB 4Y5RD 5H14A 5CYKA 3PXWD 4KFMB 4FWWA 2QXVA 5FKTA 1JOFA 2H68A 4LG8A 3BG0A 4J8GA 4L1QD 3UKRC 3JZGA 4J8BA 2B5NA 1GG2B 1B9XA 2O9KA 2XU7A 4GQ1A 2XL3A 2AGZA 5GXHA 4A2LA 4CC9A 2J55H 3MXXA 3OL2B 1SQJA 2OIZA 3E0CA 3SBRA 3EI2B 3EI3A 3JRPA 4A09B 4R7AB 2B5LA 2H9MA 4FAND 5KDOB 3OKYA 5C9ZB 3I8CA 3C75H 2QC5A 3DXMC 4O3UB 4HDJA 2H3XA 1N6DA 2AGYA 5FQDA 4H5IA 3I89A 4IMMA 4OZUA 3MKQA 5HQGA 4PSXB 2UZYB 2OK4A 3V9FA 2YBAA 4N14A 4YVDA 3V5WB 4K3JB 4OWRA 3A0FA 1P22A 3DWLC 3I2NA 3RN1D 3SHFA 4CY3A 2YMUA 1RI6A 3KRWB 4L9OA 3SCYA 4GQ2P 4CI3A 5H1MA 3B7FA 5EALA 5HE1B 5HE3B 2H6QA 4E5ZA 4JSVC 3EWEA 4J81A 1MG2A 5HE2B 1N6EA 4X63B 3ZWLB 3RMZD 5CXCA 5HE0B 4J82A 4J87A 2H14A 4Y7RA 5FLXg 4IA9A 1S4UX 2PM6B 3FGBA 3UVMA 3EI4B 4JSXC 4AEZA 5I5IA 2AH0A 4I79A 2I0TA 4U1EI 2I0SA 3MMYA 2Z2NA 4JSPC 2IUVA 3P4FA 4ERYA 4XEIC 5FA5B 4FA5D 2W18A 5FXYA 4CY2A 2PM9B 3L4MD 1JMXB 3ORVD 4D6VA 3EU7A 4A11B 5C2WB 2YNOA 5K19A 4ERZA 4PBZA 3AL9A 4CI2A 1PBYB 4X61B 3JAMg 2H9NA 5IGQA 4FB1D 3NVXA 2Q7QA 5FKSA 5CYKB 4LGNA 3EI1A 4J78A 3JROA 3F3GA 3BWSA 4ZOXA 4CI1A 3AH8B 3GREA 2CO0A 2J57G 2H13A 2OVRB 3I8EA 3RRMC 3VH0A 2MTAH 5TEFA 1ERJA 2P9PC 3CIKB 2AGWA 4A0BA 2G99A 3EMHA 3MZKA 3CFSB 3W15A 5JWZA 4BUJC 4J0WA 2EBSA 2PM7B 3SFZA 3CFVA 3EI3B 4PXWA 1JJUB 3OW8A 4JD2C 5K1CC 3OKYB 3UVOA 4EWRA 4J84A 3DM0A 5EMMB 4PNKB 4FA4D 4A08A 2Z2OA 1GP2B 3I7NA 2AH1A 1N6FA 4QL1A 1FWXA 3NVNA 2I3TA 3FRXA 1L0QA 2P9LC 2AGLA 2IUQA 3ULEC 2IURA 3OKWA 3JB9L 5CXBA 4CI8A 3SVWD 5IGOA 3OL2A 2P9NC 4J77A 5I5JA 3C9CA 3NVQA 1B9YA 3GFCA 1A0RB 3C5MA 4CZYA 2IWKA 2BCJB 4E5ZB 3PXTD 2IUPA 5CXCB 2XL2A 3UVNA 2HYEA 1YFQA 2CN2A 3F3FA 3SWSD 4JT6C 4E54A 1JMZB 4GZ8A 3RFHA 3V7DB 5THAA 3OKTA 3RLMD 4ZOZA 2H6KA 3IIYA 5FKQA 2AGXA 4ERQA 4GMBA 2IAAA 3U4YA 3BG1A 2CO0C 3RFGA 4JSNC 5I5MA 3FM0A 1R5MA 2HJBA 4GQBB 4CZXA 5SXMA 2CNXA 4XYIA 2P9UC 1Q47A 5EAMA 3RSEC 3AL8A 2OK6A 3OTTA 3HFQA 4ZOYA 4O45A 3I7OA 3F3PA 3DSMA 3SBPA 3IIWA 2HKMA 3L4OD 4A0AA 1K8KC 1GXRA 3AFCA 2I3SA 3EI1B 4O9DA 4ES0A 1XHMA 4GGDA 5AFU3 4A2MA 3N0DA 3UR4A 4U7AA 4O3TB 3RN0D 4PSWB 2P9KC 4AOWA 3J80g 4JT5C 2CE8A 2BBKH 5EM2A 1SHYB 4A0BB 4J79A 5HYNB 2OVQB 3SN6B 3SMRA 4J73A 2CN3A 4FA9D 4K3ID 5TEEA 3SXTD 1MDAH 3JZNA 3SJLD 3IJ0A 2HESX 5EAPA 3ODTA 3I7KA 4TZ4A 5A2Qg 4A7JA 1QNIA 2I0RA 4CY5A 2H9PA 4ZOVA 4FA1D 4A08B 2B5MA 5GXIA 4H5JA 3K27A 2YB8B 5AJAA 4BL0A 4FHLA 1PI6A 2IWFA 4L3GD 2AQ5A 5CXBB 1OLZA 2HKRA 3IJCA 1TBGA 4JXMA 5EARA 5C2VB 1NR0A 1VYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BH6 A;  4QT8 A;  3VGZ A;  3UKU C;  3UVL A;  4QRJ A;  3EI2 A;  2UZX B;  3PE7 A;  4A09 A;  2TRC B;  3I7L A;  3I7P A;  3VA6 A;  3DXK C;  5EML B;  3PSC B;  3IKO A;  5IJ8 E;  2YNN A;  4UI9 R;  4NSX A;  5GSA A;  3IJ1 A;  4E54 B;  3KRX B;  5IT9 g;  4J86 A;  3K26 A;  5H17 A;  4X3E A;  3J81 g;  4GGC A;  4GM3 A;  4ESG A;  3JPX A;  2H47 A;  5TDH B;  2HXC A;  4CZV A;  5EMK B;  4CY1 A;  3N0E A;  2GC4 A;  2H9L A;  4LG9 A;  2XYI A;  1NEX B;  2GC7 A;  3PVU B;  5EMJ B;  4GM8 A;  1U4C A;  2H6N A;  4QQE A;  4GM9 A;  4PC0 A;  3SBQ A;  5IC7 A;  1PEV A;  1XKS A;  1MG3 A;  2OJY A;  3AL8 B;  3PSL A;  2GNQ A;  4XYH A;  5AMS A;  4GGA A;  2P9S C;  3I7H A;  3EI4 A;  2P9I C;  4L3H D;  2HJ4 A;  1XIP A;  4O1Q D;  5IJ7 E;  2G9A A;  4G56 B;  3PXS D;  4A0A B;  5GMK n;  2B4E A;  4FAV D;  3C99 A;  1GOT B;  1SQ9 A;  4J0X A;  2Z2P A;  3SLE D;  3JZH A;  4Z8L A;  3UVK A;  1U2V C;  2CE9 A;  2J56 H;  3MZL A;  3EG6 A;  4MK0 B;  2PM9 A;  1TYQ C;  5EM2 B;  2YNP A;  1K32 A;  2PBI B;  5TF2 A;  1PGU A;  4ZN4 A;  4A11 A;  1OMW B;  4PBY A;  3MKS B;  4D0K A;  5FKR A;  5B4W A;  3PVW B;  4X60 B;  2OVP B;  4Y5R D;  5H14 A;  5CYK A;  3PXW D;  4KFM B;  4FWW A;  2QXV A;  5FKT A;  1JOF A;  2H68 A;  4LG8 A;  3BG0 A;  4J8G A;  4L1Q D;  3UKR C;  3JZG A;  4J8B A;  2B5N A;  1GG2 B;  1B9X A;  2O9K A;  2XU7 A;  4GQ1 A;  2XL3 A;  2AGZ A;  5GXH A;  4A2L A;  4CC9 A;  2J55 H;  3MXX A;  3OL2 B;  1SQJ A;  2OIZ A;  3E0C A;  3SBR A;  3EI2 B;  3EI3 A;  3JRP A;  4A09 B;  4R7A B;  2B5L A;  2H9M A;  4FAN D;  5KDO B;  3OKY A;  5C9Z B;  3I8C A;  3C75 H;  2QC5 A;  3DXM C;  4O3U B;  4HDJ A;  2H3X A;  1N6D A;  2AGY A;  5FQD A;  4H5I A;  3I89 A;  4IMM A;  4OZU A;  3MKQ A;  5HQG A;  4PSX B;  2UZY B;  2OK4 A;  3V9F A;  2YBA A;  4N14 A;  4YVD A;  3V5W B;  4K3J B;  4OWR A;  3A0F A;  1P22 A;  3DWL C;  3I2N A;  3RN1 D;  3SHF A;  4CY3 A;  2YMU A;  1RI6 A;  3KRW B;  4L9O A;  3SCY A;  4GQ2 P;  4CI3 A;  5H1M A;  3B7F A;  5EAL A;  5HE1 B;  5HE3 B;  2H6Q A;  4E5Z A;  4JSV C;  3EWE A;  4J81 A;  1MG2 A;  5HE2 B;  1N6E A;  4X63 B;  3ZWL B;  3RMZ D;  5CXC A;  5HE0 B;  4J82 A;  4J87 A;  2H14 A;  4Y7R A;  5FLX g;  4IA9 A;  1S4U X;  2PM6 B;  3FGB A;  3UVM A;  3EI4 B;  4JSX C;  4AEZ A;  5I5I A;  2AH0 A;  4I79 A;  2I0T A;  4U1E I;  2I0S A;  3MMY A;  2Z2N A;  4JSP C;  2IUV A;  3P4F A;  4ERY A;  4XEI C;  5FA5 B;  4FA5 D;  2W18 A;  5FXY A;  4CY2 A;  2PM9 B;  3L4M D;  1JMX B;  3ORV D;  4D6V A;  3EU7 A;  4A11 B;  5C2W B;  2YNO A;  5K19 A;  4ERZ A;  4PBZ A;  3AL9 A;  4CI2 A;  1PBY B;  4X61 B;  3JAM g;  2H9N A;  5IGQ A;  4FB1 D;  3NVX A;  2Q7Q A;  5FKS A;  5CYK B;  4LGN A;  3EI1 A;  4J78 A;  3JRO A;  3F3G A;  3BWS A;  4ZOX A;  4CI1 A;  3AH8 B;  3GRE A;  2CO0 A;  2J57 G;  2H13 A;  2OVR B;  3I8E A;  3RRM C;  3VH0 A;  2MTA H;  5TEF A;  1ERJ A;  2P9P C;  3CIK B;  2AGW A;  4A0B A;  2G99 A;  3EMH A;  3MZK A;  3CFS B;  3W15 A;  5JWZ A;  4BUJ C;  4J0W A;  2EBS A;  2PM7 B;  3SFZ A;  3CFV A;  3EI3 B;  4PXW A;  1JJU B;  3OW8 A;  4JD2 C;  5K1C C;  3OKY B;  3UVO A;  4EWR A;  4J84 A;  3DM0 A;  5EMM B;  4PNK B;  4FA4 D;  4A08 A;  2Z2O A;  1GP2 B;  3I7N A;  2AH1 A;  1N6F A;  4QL1 A;  1FWX A;  3NVN A;  2I3T A;  3FRX A;  1L0Q A;  2P9L C;  2AGL A;  2IUQ A;  3ULE C;  2IUR A;  3OKW A;  3JB9 L;  5CXB A;  4CI8 A;  3SVW D;  5IGO A;  3OL2 A;  2P9N C;  4J77 A;  5I5J A;  3C9C A;  3NVQ A;  1B9Y A;  3GFC A;  1A0R B;  3C5M A;  4CZY A;  2IWK A;  2BCJ B;  4E5Z B;  3PXT D;  2IUP A;  5CXC B;  2XL2 A;  3UVN A;  2HYE A;  1YFQ A;  2CN2 A;  3F3F A;  3SWS D;  4JT6 C;  4E54 A;  1JMZ B;  4GZ8 A;  3RFH A;  3V7D B;  5THA A;  3OKT A;  3RLM D;  4ZOZ A;  2H6K A;  3IIY A;  5FKQ A;  2AGX A;  4ERQ A;  4GMB A;  2IAA A;  3U4Y A;  3BG1 A;  2CO0 C;  3RFG A;  4JSN C;  5I5M A;  3FM0 A;  1R5M A;  2HJB A;  4GQB B;  4CZX A;  5SXM A;  2CNX A;  4XYI A;  2P9U C;  1Q47 A;  5EAM A;  3RSE C;  3AL8 A;  2OK6 A;  3OTT A;  3HFQ A;  4ZOY A;  4O45 A;  3I7O A;  3F3P A;  3DSM A;  3SBP A;  3IIW A;  2HKM A;  3L4O D;  4A0A A;  1K8K C;  1GXR A;  3AFC A;  2I3S A;  3EI1 B;  4O9D A;  4ES0 A;  1XHM A;  4GGD A;  5AFU 3;  4A2M A;  3N0D A;  3UR4 A;  4U7A A;  4O3T B;  3RN0 D;  4PSW B;  2P9K C;  4AOW A;  3J80 g;  4JT5 C;  2CE8 A;  2BBK H;  5EM2 A;  1SHY B;  4A0B B;  4J79 A;  5HYN B;  2OVQ B;  3SN6 B;  3SMR A;  4J73 A;  2CN3 A;  4FA9 D;  4K3I D;  5TEE A;  3SXT D;  1MDA H;  3JZN A;  3SJL D;  3IJ0 A;  2HES X;  5EAP A;  3ODT A;  3I7K A;  4TZ4 A;  5A2Q g;  4A7J A;  1QNI A;  2I0R A;  4CY5 A;  2H9P A;  4ZOV A;  4FA1 D;  4A08 B;  2B5M A;  5GXI A;  4H5J A;  3K27 A;  2YB8 B;  5AJA A;  4BL0 A;  4FHL A;  1PI6 A;  2IWF A;  4L3G D;  2AQ5 A;  5CXB B;  1OLZ A;  2HKR A;  3IJC A;  1TBG A;  4JXM A;  5EAR A;  5C2V B;  1NR0 A;  1VYH C; 
#chains in the Genus database with same CATH topology
 4BH6 A;  4QT8 A;  3VGZ A;  4UM8 A;  3UKU C;  1QFM A;  3UVL A;  4QRJ A;  3EI2 A;  2UZX B;  3PE7 A;  4A09 A;  3ZE2 A;  2TRC B;  3I7L A;  3I7P A;  3VA6 A;  4AN1 A;  3DXK C;  5EML B;  3PSC B;  3IKO A;  5IJ8 E;  2YNN A;  4UI9 R;  4NSX A;  5GSA A;  3IJ1 A;  4E54 B;  3KRX B;  5IT9 g;  4J86 A;  3K26 A;  5H17 A;  4X3E A;  2QZP A;  3J81 g;  4GGC A;  4NBM A;  4GM3 A;  2XDW A;  4ESG A;  3JPX A;  4UM9 A;  2H47 A;  5TDH B;  2HXC A;  4CZV A;  5EMK B;  4CY1 A;  4G55 A;  3N0E A;  2EIE A;  2GC4 A;  2H9L A;  4LG9 A;  2XYI A;  3DDU A;  1NEX B;  2GC7 A;  1VE7 A;  1K3I A;  3PVU B;  5EMJ B;  4GM8 A;  1U4C A;  2H6N A;  4QQE A;  4GM9 A;  4PC0 A;  3SBQ A;  5IC7 A;  1PEV A;  1XKS A;  1MG3 A;  1C9I A;  2OJY A;  3AL8 B;  5E6U A;  3PSL A;  2GNQ A;  4XYH A;  5AMS A;  4GGA A;  2P9S C;  1UTC A;  4MMZ A;  1VZ3 A;  3I7H A;  3EI4 A;  2P9I C;  4L3H D;  2EIC A;  2HJ4 A;  1XIP A;  4O1Q D;  5IJ7 E;  2G9A A;  4G56 B;  3PXS D;  4A0A B;  5C86 A;  1L5G A;  5GMK n;  2B4E A;  4FAV D;  3T3M A;  3C99 A;  1GOT B;  1SQ9 A;  4J0X A;  4RE6 A;  1UOP A;  2Z2P A;  3SLE D;  3JZH A;  4Z8L A;  3UVK A;  3ZE1 A;  1U2V C;  1I2M B;  2CE9 A;  2J56 H;  3MZL A;  3MUN A;  3EG6 A;  1O6F A;  3MUO A;  4MK0 B;  2PM9 A;  2VDR A;  3OF7 A;  1TYQ C;  5EM2 B;  2YNP A;  1K32 A;  2PBI B;  5TF2 A;  1PGU A;  4AMY A;  5M61 A;  4G1M A;  4ZN4 A;  4A11 A;  1OMW B;  4Z7Q A;  4RE5 A;  2VDL A;  4PBY A;  3MKS B;  4D0K A;  5FKR A;  4DNV A;  4BCD A;  5B4W A;  3PVW B;  4X60 B;  4IRZ A;  2OVP B;  4Y5R D;  5E6S A;  5H14 A;  3EQ8 A;  5CYK A;  3PXW D;  4KFM B;  4FWW A;  2QXV A;  5FKT A;  1JOF A;  2H68 A;  4LG8 A;  3BG0 A;  3FCU A;  4J8G A;  4L1Q D;  3UKR C;  3JZG A;  4J8B A;  2B5N A;  1GG2 B;  3O4H A;  1B9X A;  2O9K A;  2XU7 A;  4GQ1 A;  3ZE0 A;  2XL3 A;  2AGZ A;  2VDM A;  5GXH A;  4A2L A;  4G1E A;  4CC9 A;  2J55 H;  3MXX A;  3T3P A;  3OL2 B;  1SQJ A;  2OIZ A;  4AMZ A;  3E0C A;  3SBR A;  3EI2 B;  3FCS A;  3EI3 A;  3JRP A;  4WK0 A;  4A09 B;  4R7A B;  1H2Z A;  2B5L A;  2H9M A;  4FAN D;  5KDO B;  3OKY A;  5C9Z B;  3I8C A;  3C75 H;  2QC5 A;  3DXM C;  4O3U B;  3EQ7 A;  4HDJ A;  2H3X A;  4L1M A;  1H2W A;  1N6D A;  4WK4 A;  2AGY A;  5FQD A;  3QHY B;  4H5I A;  3I89 A;  4IMM A;  4D9S A;  4OZU A;  3MKQ A;  5HQG A;  4PSX B;  2UZY B;  2OK4 A;  3V9F A;  2YBA A;  4NAA A;  4N14 A;  4YVD A;  3V5W B;  4K3J B;  4OWR A;  3A0F A;  2VDQ A;  1P22 A;  3ZDY A;  3DWL C;  3I2N A;  3RN1 D;  4QAM A;  1VZ2 A;  3SHF A;  4CY3 A;  5M5R A;  4NEN A;  2YMU A;  1RI6 A;  3KRW B;  1YR2 A;  4L9O A;  3SCY A;  4GQ2 P;  4CI3 A;  5H1M A;  3B7F A;  5EAL A;  5HE1 B;  5HE3 B;  2H6Q A;  4E5Z A;  4JSV C;  3EWE A;  4J81 A;  1MG2 A;  5HE2 B;  1N6E A;  4X63 B;  3ZDZ A;  3ZWL B;  3RMZ D;  5CXC A;  5HE0 B;  4J82 A;  4J87 A;  2H14 A;  4Y7R A;  5FLX g;  4IA9 A;  4WK2 A;  1S4U X;  2PM6 B;  2EID A;  3FGB A;  4DNW A;  1GOH A;  3UVM A;  2QR5 A;  3EI4 B;  4JSX C;  4AEZ A;  5I5I A;  5M5V A;  4JHP C;  2AH0 A;  4I79 A;  2I0T A;  4U1E I;  2I0S A;  3MMY A;  2Z2N A;  4Z7O A;  4JSP C;  1VE6 A;  2XZG A;  2VZ3 A;  1O6G A;  2IUV A;  3P4F A;  4ERY A;  4XEI C;  5FA5 B;  4FA5 D;  2W18 A;  5FXY A;  3K71 A;  1TYE A;  1H2Y A;  4CY2 A;  2PM9 B;  3L4M D;  3MVD K;  1JMX B;  4AX4 A;  3ORV D;  4D6V A;  3EU7 A;  1UOQ A;  2VDO A;  4A11 B;  4O2W A;  5C2W B;  3IUN A;  2YNO A;  3EQ9 A;  5K19 A;  4ERZ A;  1U8C A;  4PBZ A;  3AL9 A;  4CI2 A;  1PBY B;  4X61 B;  3JAM g;  2H9N A;  5IGQ A;  4BP9 A;  4FB1 D;  3NVX A;  2JKX A;  2Q7Q A;  5FKS A;  5CYK B;  4LGN A;  3EI1 A;  4J78 A;  5C92 A;  3JRO A;  3F3G A;  3BWS A;  4ZOX A;  4JHN A;  4CI1 A;  3AH8 B;  3GRE A;  3I8E A;  1QFS A;  2CO0 A;  2H13 A;  2J57 G;  2OVR B;  2VZ1 A;  3RRM C;  3VH0 A;  2MTA H;  5TEF A;  1ERJ A;  1M1X A;  2P9P C;  3CIK B;  2AGW A;  4A0B A;  2G99 A;  3EMH A;  3MZK A;  2HU8 A;  3CFS B;  5E6R A;  3W15 A;  5JWZ A;  1T2X A;  4BUJ C;  4J0W A;  2EBS A;  2PM7 B;  3SFZ A;  3CFV A;  3EI3 B;  3GC3 B;  1JJU B;  4PXW A;  3OW8 A;  4BCC A;  4JD2 C;  4WJK A;  3O4G A;  5K1C C;  3OKY B;  3UVO A;  4EWR A;  4J84 A;  3DM0 A;  4MMX A;  5HDB A;  5EMM B;  3ZDX A;  3IUJ A;  4PNK B;  4FA4 D;  4A08 A;  2Z2O A;  1GP2 B;  3I7N A;  5M5U A;  3NID A;  2AH1 A;  1N6F A;  3K72 A;  4Z7N A;  4QL1 A;  1FWX A;  3NVN A;  2I3T A;  1E8M A;  3FRX A;  1L0Q A;  5FFO A;  2P9L C;  2HU5 A;  2AGL A;  2IUQ A;  3ULE C;  2IUR A;  3OKW A;  3JB9 L;  3V4V A;  2XE4 A;  5CXB A;  4CI8 A;  3SVW D;  5IGO A;  3OL2 A;  2P9N C;  4J77 A;  5I5J A;  2VDP A;  5M5S A;  3O4I A;  4BCB A;  3C9C A;  1UOO A;  1GOF A;  3NVQ A;  1B9Y A;  3GFC A;  1A0R B;  3C5M A;  4NC4 A;  4CZY A;  2IWK A;  2BCJ B;  4E5Z B;  3VI3 A;  1E8N A;  3PXT D;  2IUP A;  2WQ8 A;  4O02 A;  5CXC B;  1E5T A;  2XL2 A;  3UVN A;  2HYE A;  1YFQ A;  2CN2 A;  3F3F A;  3SWS D;  4JT6 C;  4E54 A;  1JMZ B;  4GZ8 A;  3RFH A;  3V7D B;  5THA A;  3OKT A;  3RLM D;  4ZOZ A;  3V4P A;  2H6K A;  3IIY A;  5FKQ A;  2AGX A;  4ERQ A;  1JV2 A;  4GMB A;  1H2X A;  2IAA A;  3U4Y A;  3BG1 A;  2CO0 C;  4MMY A;  3RFG A;  3KCI A;  4JSN C;  5I5M A;  2VDN A;  3FM0 A;  1R5M A;  2HJB A;  3NIG A;  4GQB B;  4CZX A;  5SXM A;  2CNX A;  4XYI A;  1GOG A;  5M5T A;  2P9U C;  1Q47 A;  5EAM A;  3RSE C;  3AL8 A;  2OK6 A;  2VDK A;  2EIB A;  3OTT A;  4DNU A;  3HFQ A;  4BP8 A;  1A12 A;  4O45 A;  4ZOY A;  3I7O A;  3F3P A;  3DSM A;  3SBP A;  3IIW A;  2HKM A;  3L4O D;  4A0A A;  1K8K C;  1GXR A;  3IVM A;  3AFC A;  2I3S A;  3GD1 I;  3EI1 B;  4O9D A;  4ES0 A;  1XHM A;  4GGD A;  2HU7 A;  5AFU 3;  3K6S A;  1JTD B;  4A2M A;  3N0D A;  3UR4 A;  3IUL A;  4U7A A;  4O3T B;  3RN0 D;  4PSW B;  2P9K C;  4AOW A;  3J80 g;  4JT5 C;  2CE8 A;  2BBK H;  3QI0 A;  1SHY B;  3O4J A;  5EM2 A;  5FFG A;  4AN0 A;  4A0B B;  2BKL A;  4J79 A;  5HYN B;  2OVQ B;  3SN6 B;  3SMR A;  4J73 A;  3NIF A;  2CN3 A;  3IUR A;  4FA9 D;  4K3I D;  5TEE A;  3SXT D;  1MDA H;  3JZN A;  3SJL D;  3IJ0 A;  2HES X;  5EAP A;  3ODT A;  3I7K A;  4TZ4 A;  1BPO A;  5A2Q g;  3IUQ A;  2VC2 A;  1C9L A;  4A7J A;  1QNI A;  2I0R A;  4CY5 A;  2H9P A;  3VI4 A;  4ZOV A;  4FA1 D;  4A08 B;  2B5M A;  3IUM A;  4H5J A;  5GXI A;  3K27 A;  2YB8 B;  5AJA A;  4BL0 A;  4FHL A;  1PI6 A;  2IWF A;  4L3G D;  2AQ5 A;  5CXB B;  1OLZ A;  2HKR A;  3IJE A;  3IJC A;  1TBG A;  4JXM A;  5EAR A;  5C2V B;  1NR0 A;  1VYH C; 
#chains in the Genus database with same CATH homology
 4BH6 A;  4QT8 A;  3VGZ A;  3UKU C;  3UVL A;  4QRJ A;  3EI2 A;  2UZX B;  3PE7 A;  4A09 A;  2TRC B;  3I7L A;  3I7P A;  3VA6 A;  3DXK C;  5EML B;  3PSC B;  3IKO A;  5IJ8 E;  2YNN A;  4UI9 R;  4NSX A;  5GSA A;  3IJ1 A;  4E54 B;  3KRX B;  5IT9 g;  4J86 A;  3K26 A;  5H17 A;  4X3E A;  3J81 g;  4GGC A;  4GM3 A;  4ESG A;  3JPX A;  2H47 A;  5TDH B;  2HXC A;  4CZV A;  5EMK B;  4CY1 A;  3N0E A;  2GC4 A;  2H9L A;  4LG9 A;  2XYI A;  1NEX B;  2GC7 A;  3PVU B;  5EMJ B;  4GM8 A;  1U4C A;  2H6N A;  4QQE A;  4GM9 A;  4PC0 A;  3SBQ A;  5IC7 A;  1PEV A;  1XKS A;  1MG3 A;  2OJY A;  3AL8 B;  3PSL A;  2GNQ A;  4XYH A;  5AMS A;  4GGA A;  2P9S C;  3I7H A;  3EI4 A;  2P9I C;  4L3H D;  2HJ4 A;  1XIP A;  4O1Q D;  5IJ7 E;  2G9A A;  4G56 B;  3PXS D;  4A0A B;  5GMK n;  2B4E A;  4FAV D;  3C99 A;  1GOT B;  1SQ9 A;  4J0X A;  2Z2P A;  3SLE D;  3JZH A;  4Z8L A;  3UVK A;  1U2V C;  2CE9 A;  2J56 H;  3MZL A;  3EG6 A;  4MK0 B;  2PM9 A;  1TYQ C;  5EM2 B;  2YNP A;  1K32 A;  2PBI B;  5TF2 A;  1PGU A;  4ZN4 A;  4A11 A;  1OMW B;  4PBY A;  3MKS B;  4D0K A;  5FKR A;  5B4W A;  3PVW B;  4X60 B;  2OVP B;  4Y5R D;  5H14 A;  5CYK A;  3PXW D;  4KFM B;  4FWW A;  2QXV A;  5FKT A;  1JOF A;  2H68 A;  4LG8 A;  3BG0 A;  4J8G A;  4L1Q D;  3UKR C;  3JZG A;  4J8B A;  2B5N A;  1GG2 B;  1B9X A;  2O9K A;  2XU7 A;  4GQ1 A;  2XL3 A;  2AGZ A;  5GXH A;  4A2L A;  4CC9 A;  2J55 H;  3MXX A;  3OL2 B;  1SQJ A;  2OIZ A;  3E0C A;  3SBR A;  3EI2 B;  3EI3 A;  3JRP A;  4A09 B;  4R7A B;  2B5L A;  2H9M A;  4FAN D;  5KDO B;  3OKY A;  5C9Z B;  3I8C A;  3C75 H;  2QC5 A;  3DXM C;  4O3U B;  4HDJ A;  2H3X A;  1N6D A;  2AGY A;  5FQD A;  4H5I A;  3I89 A;  4IMM A;  4OZU A;  3MKQ A;  5HQG A;  4PSX B;  2UZY B;  2OK4 A;  3V9F A;  2YBA A;  4N14 A;  4YVD A;  3V5W B;  4K3J B;  4OWR A;  3A0F A;  1P22 A;  3DWL C;  3I2N A;  3RN1 D;  3SHF A;  4CY3 A;  2YMU A;  1RI6 A;  3KRW B;  4L9O A;  3SCY A;  4GQ2 P;  4CI3 A;  5H1M A;  3B7F A;  5EAL A;  5HE1 B;  5HE3 B;  2H6Q A;  4E5Z A;  4JSV C;  3EWE A;  4J81 A;  1MG2 A;  5HE2 B;  1N6E A;  4X63 B;  3ZWL B;  3RMZ D;  5CXC A;  5HE0 B;  4J82 A;  4J87 A;  2H14 A;  4Y7R A;  5FLX g;  4IA9 A;  1S4U X;  2PM6 B;  3FGB A;  3UVM A;  3EI4 B;  4JSX C;  4AEZ A;  5I5I A;  2AH0 A;  4I79 A;  2I0T A;  4U1E I;  2I0S A;  3MMY A;  2Z2N A;  4JSP C;  2IUV A;  3P4F A;  4ERY A;  4XEI C;  5FA5 B;  4FA5 D;  2W18 A;  5FXY A;  4CY2 A;  2PM9 B;  3L4M D;  1JMX B;  3ORV D;  4D6V A;  3EU7 A;  4A11 B;  5C2W B;  2YNO A;  5K19 A;  4ERZ A;  4PBZ A;  3AL9 A;  4CI2 A;  1PBY B;  4X61 B;  3JAM g;  2H9N A;  5IGQ A;  4FB1 D;  3NVX A;  2Q7Q A;  5FKS A;  5CYK B;  4LGN A;  3EI1 A;  4J78 A;  3JRO A;  3F3G A;  3BWS A;  4ZOX A;  4CI1 A;  3AH8 B;  3GRE A;  2CO0 A;  2J57 G;  2H13 A;  2OVR B;  3I8E A;  3RRM C;  3VH0 A;  2MTA H;  5TEF A;  1ERJ A;  2P9P C;  3CIK B;  2AGW A;  4A0B A;  2G99 A;  3EMH A;  3MZK A;  3CFS B;  3W15 A;  5JWZ A;  4BUJ C;  4J0W A;  2EBS A;  2PM7 B;  3SFZ A;  3CFV A;  3EI3 B;  4PXW A;  1JJU B;  3OW8 A;  4JD2 C;  5K1C C;  3OKY B;  3UVO A;  4EWR A;  4J84 A;  3DM0 A;  5EMM B;  4PNK B;  4FA4 D;  4A08 A;  2Z2O A;  1GP2 B;  3I7N A;  2AH1 A;  1N6F A;  4QL1 A;  1FWX A;  3NVN A;  2I3T A;  3FRX A;  1L0Q A;  2P9L C;  2AGL A;  2IUQ A;  3ULE C;  2IUR A;  3OKW A;  3JB9 L;  5CXB A;  4CI8 A;  3SVW D;  5IGO A;  3OL2 A;  2P9N C;  4J77 A;  5I5J A;  3C9C A;  3NVQ A;  1B9Y A;  3GFC A;  1A0R B;  3C5M A;  4CZY A;  2IWK A;  2BCJ B;  4E5Z B;  3PXT D;  2IUP A;  5CXC B;  2XL2 A;  3UVN A;  2HYE A;  1YFQ A;  2CN2 A;  3F3F A;  3SWS D;  4JT6 C;  4E54 A;  1JMZ B;  4GZ8 A;  3RFH A;  3V7D B;  5THA A;  3OKT A;  3RLM D;  4ZOZ A;  2H6K A;  3IIY A;  5FKQ A;  2AGX A;  4ERQ A;  4GMB A;  2IAA A;  3U4Y A;  3BG1 A;  2CO0 C;  3RFG A;  4JSN C;  5I5M A;  3FM0 A;  1R5M A;  2HJB A;  4GQB B;  4CZX A;  5SXM A;  2CNX A;  4XYI A;  2P9U C;  1Q47 A;  5EAM A;  3RSE C;  3AL8 A;  2OK6 A;  3OTT A;  3HFQ A;  4ZOY A;  4O45 A;  3I7O A;  3F3P A;  3DSM A;  3SBP A;  3IIW A;  2HKM A;  3L4O D;  4A0A A;  1K8K C;  1GXR A;  3AFC A;  2I3S A;  3EI1 B;  4O9D A;  4ES0 A;  1XHM A;  4GGD A;  5AFU 3;  4A2M A;  3N0D A;  3UR4 A;  4U7A A;  4O3T B;  3RN0 D;  4PSW B;  2P9K C;  4AOW A;  3J80 g;  4JT5 C;  2CE8 A;  2BBK H;  5EM2 A;  1SHY B;  4A0B B;  4J79 A;  5HYN B;  2OVQ B;  3SN6 B;  3SMR A;  4J73 A;  2CN3 A;  4FA9 D;  4K3I D;  5TEE A;  3SXT D;  1MDA H;  3JZN A;  3SJL D;  3IJ0 A;  2HES X;  5EAP A;  3ODT A;  3I7K A;  4TZ4 A;  5A2Q g;  4A7J A;  1QNI A;  2I0R A;  4CY5 A;  2H9P A;  4ZOV A;  4FA1 D;  4A08 B;  2B5M A;  5GXI A;  4H5J A;  3K27 A;  2YB8 B;  5AJA A;  4BL0 A;  4FHL A;  1PI6 A;  2IWF A;  4L3G D;  2AQ5 A;  5CXB B;  1OLZ A;  2HKR A;  3IJC A;  1TBG A;  4JXM A;  5EAR A;  5C2V B;  1NR0 A;  1VYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...