2GC7A

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 94
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc7A00
4R7AB 2B5NA 4CZYA 4UI9R 4GM3A 4XEIC 4G56B 4BH6A 2H6QA 2HXCA 2H47A 5CYKB 3AFCA 4CZVA 4J79A 1RI6A 3F3PA 3N0EA 2IAAA 2I0RA 3ZWLB 2BBKH 3JZGA 4LG9A 5K19A 1JJUB 4FAND 3F3FA 3NVNA 4E54A 1XIPA 4HDJA 3UVKA 4ERZA 4CY5A 4ESGA 2XL2A 4J77A 4PSWB 5EMJB 1P22A 3EI3B 4FA4D 5HE1B 1NR0A 3OKYB 3PXTD 4FB1D 5FKRA 4ZN4A 4J8GA 4JT5C 4X63B 2P9IC 3UVNA 4A11A 4U1EI 3B7FA 3P4FA 4CI8A 2IWKA 3SVWD 2YNPA 1B9YA 4O3UB 3V5WB 3CFSB 5FLXg 3SBPA 3OW8A 1OMWB 2AGLA 3RSEC 1NEXB 5FXYA 4ZOVA 1GP2B 4MK0B 3EI4A 2OIZA 2P9SC 2J55H 3SCYA 2I0TA 4A0BA 2CNXA 5HE2B 3PSLA 2IWFA 2TRCB 5TDHB 2OJYA 3JZNA 4N14A 4NSXA 1OLZA 5I5IA 3UKRC 5AMSA 2EBSA 2OVQB 2P9UC 5AJAA 5HYNB 4A2LA 2YB8B 3JAMg 4D6VA 4AEZA 2UZXB 3W15A 3MZLA 4GGCA 5H17A 4J0XA 3IIYA 4IMMA 4A08A 2MTAH 5EALA 4E5ZA 4IA9A 4A0AB 2HYEA 3PXWD 3U4YA 3SMRA 5GXIA 5JWZA 5B4WA 2I3TA 5FKTA 4J73A 5TEFA 1N6EA 5AFU3 4ZOZA 1JMZB 5GSAA 5TF2A 2H13A 3I7PA 4GGDA 3IKOA 4JD2C 4LG8A 4U7AA 4GGAA 2P9NC 3MKSB 4GQ1A 3I2NA 2XL3A 5CXCA 4CY1A 2OK4A 3DXMC 4BL0A 4CY2A 4FA1D 5EARA 3L4MD 1PGUA 5FKSA 2H6KA 5TEEA 2CE8A 4QL1A 5I5MA 3C9CA 2Z2NA 3AL9A 2PM6B 3L4OD 4O9DA 1Q47A 3EWEA 3SJLD 4A2MA 3I7KA 1PI6A 3A0FA 4I79A 5C9ZB 4O1QD 4JXMA 3NVQA 4PNKB 3J80g 3UVMA 2B5MA 2BCJB 3GFCA 3I8CA 4GQ2P 5FKQA 2XU7A 3SN6B 1ERJA 2IUQA 4ERYA 2W18A 3DWLC 3FRXA 5THAA 2P9LC 5EMMB 3KRWB 4J78A 1GXRA 3C99A 3J81g 2HJBA 1PBYB 1PEVA 3FM0A 2I0SA 4LGNA 3CFVA 4XYHA 4X60B 4L3GD 3GREA 2OK6A 1SQJA 3OL2A 4FWWA 3I89A 3K26A 2UZYB 4CI2A 2IUVA 3SHFA 4H5IA 4CI3A 3VA6A 1TYQC 1SHYB 3OKWA 1MG2A 4J0WA 2HESX 4QRJA 1U4CA 4OZUA 1XKSA 2GC4A 3DXKC 3I7HA 3UKUC 3EI2B 3IJCA 4TZ4A 5I5JA 2G9AA 4ZOYA 5IC7A 3PXSD 4A11B 5HE3B 2OVRB 5IT9g 4A09B 5IJ7E 3N0DA 5CXBB 4BUJC 3AL8A 2Q7QA 3JROA 5A2Qg 1TBGA 2CO0C 5HE0B 2H3XA 1VYHC 3K27A 4H5JA 2GNQA 3JZHA 4L9OA 2HJ4A 2YMUA 3EI4B 2PM7B 5K1CC 5EAMA 3I7NA 4A0BB 2IURA 2G99A 3E0CA 3ULEC 2XYIA 3PVWB 5IGQA 4XYIA 5CYKA 2AGYA 4GMBA 1N6DA 3ODTA 2H9MA 3IIWA 4GM9A 4CC9A 2Z2OA 4O45A 5KDOB 5FA5B 5FQDA 1K8KC 2PM9B 4J82A 4JT6C 1JOFA 1R5MA 4J81A 3IJ0A 4PSXB 3ORVD 4Z8LA 5HQGA 1K32A 3MKQA 3C5MA 1MDAH 1JMXB 3JB9L 4A08B 2J56H 2YNOA 4AOWA 3EG6A 3EI3A 3OKYA 1S4UX 5EM2B 1A0RB 4J84A 4KFMB 4PC0A 3SXTD 2GC7A 3EI1B 4FA5D 2AH0A 3JRPA 2H6NA 2YNNA 2P9PC 4FAVD 3I8EA 3F3GA 3MXXA 4PBYA 2OVPB 3HFQA 4L3HD 4OWRA 3BG0A 3JPXA 3SLED 2Z2PA 5EMKB 5H1MA 5H14A 1U2VC 3SWSD 3RFHA 2HKRA 3PVUB 4Y5RD 3DSMA 4K3ID 2B5LA 2AH1A 3NVXA 5CXCB 3UR4A 3OTTA 1SQ9A 4JSVC 4X61B 4A7JA 3MMYA 2AQ5A 4L1QD 4CZXA 4ES0A 3RFGA 4X3EA 4JSNC 3EI2A 2H9NA 3BWSA 4EWRA 3C75H 1N6FA 2J57G 4QT8A 4E54B 4A09A 5CXBA 3VH0A 3EU7A 2IUPA 2CN2A 3MZKA 2CN3A 3VGZA 3PSCB 4PXWA 4A0AA 5SXMA 2H68A 4Y7RA 3BG1A 3RMZD 2AGXA 2H14A 5IJ8E 4GQBB 3I7OA 3RLMD 4JSPC 2HKMA 4YVDA 1GOTB 3PE7A 4ERQA 3IJ1A 2QXVA 5GMKn 3FGBA 5EMLB 1B9XA 3AH8B 3OL2B 3V7DB 2PM9A 2H9PA 3SBRA 2QC5A 4J86A 5IGOA 5C2VB 4CI1A 4K3JB 3UVLA 3RN0D 4FA9D 1FWXA 5EAPA 1QNIA 3RRMC 3EMHA 4CY3A 2CE9A 4PBZA 2I3SA 4J87A 3KRXB 2P9KC 1YFQA 5EM2A 5C2WB 4FHLA 4JSXC 3DM0A 4QQEA 1XHMA 3EI1A 5GXHA 4GZ8A 1GG2B 3RN1D 4O3TB 1MG3A 3V9FA 2YBAA 3OKTA 4ZOXA 3SBQA 3UVOA 1L0QA 3AL8B 3I7LA 2PBIB 2H9LA 4D0KA 2CO0A 3SFZA 2B4EA 4E5ZB 2AGZA 4GM8A 3CIKB 2O9KA 2AGWA 4J8BA
chains in the Genus database with same CATH superfamily
4Z7OA 4R7AB 2B5NA 4CZYA 4UI9R 3IUMA 4GM3A 4XEIC 4G56B 4BH6A 4AMZA 2H6QA 2HXCA 2H47A 5CYKB 3AFCA 4CZVA 4J79A 1RI6A 3F3PA 2XDWA 3N0EA 2IAAA 2I0RA 4O2WA 3ZWLB 2BBKH 2VC2A 3JZGA 4LG9A 5K19A 1JJUB 4FAND 3F3FA 3NVNA 4E54A 1XIPA 1L5GA 4HDJA 2HU8A 3UVKA 3GD1I 4ERZA 3DDUA 4CY5A 4ESGA 2XL2A 4J77A 4PSWB 3GC3B 5EMJB 2XZGA 1P22A 3EI3B 4FA4D 5HE1B 1NR0A 3OKYB 3PXTD 4FB1D 5FKRA 4ZN4A 4J8GA 4JT5C 4X63B 2P9IC 3UVNA 2VDLA 4A11A 2VDQA 4U1EI 3B7FA 3P4FA 4CI8A 2IWKA 3SVWD 4MMYA 2YNPA 3OF7A 1B9YA 3IULA 4O3UB 3V5WB 3CFSB 5FLXg 3SBPA 3OW8A 1OMWB 2AGLA 3RSEC 1NEXB 5FXYA 4ZOVA 4BCDA 1GP2B 4MK0B 3QHYB 3ZE2A 3EI4A 2OIZA 4D9SA 2P9SC 2J55H 4RE6A 3SCYA 2I0TA 4A0BA 2CNXA 1C9IA 1QFSA 5HE2B 3PSLA 2IWFA 2TRCB 5TDHB 3IUQA 2OJYA 3JZNA 3IVMA 4N14A 1OLZA 4NSXA 4NENA 3KCIA 1VZ2A 5I5IA 4NAAA 3UKRC 5C92A 5AMSA 2VZ1A 2EBSA 1H2YA 2OVQB 2P9UC 5AJAA 5HYNB 4A2LA 2YB8B 3JAMg 4D6VA 4AEZA 4WK2A 2UZXB 4AX4A 3W15A 3MZLA 4GGCA 5H17A 3MVDK 1JV2A 4J0XA 3IIYA 4WK0A 4IMMA 3O4IA 4A08A 2MTAH 5EALA 4E5ZA 4IA9A 4A0AB 2HYEA 3PXWD 3U4YA 3SMRA 1BPOA 4BP8A 5GXIA 5JWZA 5B4WA 2I3TA 5FKTA 4J73A 5TEFA 1N6EA 3K71A 5AFU3 4ZOZA 1I2MB 1JMZB 5GSAA 5TF2A 1UOQA 2H13A 2WQ8A 4Z7QA 3I7PA 4GGDA 3IKOA 1VE6A 3EQ7A 4JD2C 5E6UA 4LG8A 4U7AA 4GGAA 2P9NC 3MKSB 4GQ1A 2QR5A 3I2NA 1TYEA 2XL3A 5CXCA 4CY1A 2OK4A 3DXMC 4BL0A 1H2ZA 4CY2A 4FA1D 5EARA 3L4MD 1PGUA 5FKSA 2H6KA 5TEEA 2CE8A 4QL1A 5I5MA 3C9CA 1K3IA 2Z2NA 3AL9A 2PM6B 3L4OD 4UM8A 4O9DA 3ZDXA 2JKXA 1H2XA 1Q47A 3EWEA 3SJLD 4A2MA 1U8CA 3I7KA 3IJEA 3ZE0A 1PI6A 3A0FA 4I79A 1E8NA 5C9ZB 4O1QD 4JXMA 3V4PA 5M5VA 3NVQA 3QI0A 4PNKB 4WK4A 2VDKA 3J80g 3UVMA 2B5MA 2BCJB 3O4JA 3GFCA 3I8CA 4GQ2P 5FKQA 1GOGA 2XU7A 3SN6B 1ERJA 2IUQA 4ERYA 2W18A 4WJKA 3DWLC 3FRXA 5THAA 1T2XA 2P9LC 3V4VA 3KRWB 4NC4A 5EMMB 4J78A 1GXRA 3C99A 3J81g 2HJBA 4BP9A 1PBYB 1PEVA 3FM0A 2EIBA 2I0SA 4LGNA 3CFVA 4XYHA 4X60B 4L3GD 3GREA 4BCBA 1GOFA 2OK6A 1SQJA 3OL2A 4FWWA 3I89A 4UM9A 3K26A 2UZYB 4CI2A 4BCCA 2IUVA 3SHFA 4H5IA 3IUJA 4CI3A 3VA6A 1TYQC 1SHYB 3OKWA 1MG2A 4J0WA 2HESX 5C86A 3FCSA 2VZ3A 1U4CA 4QRJA 2VDRA 4OZUA 1XKSA 2GC4A 1UOPA 3DXKC 5E6SA 5M5UA 5FFGA 3I7HA 3UKUC 3EI2B 3EQ8A 3IJCA 4TZ4A 5I5JA 3ZDYA 2G9AA 4ZOYA 5IC7A 1UTCA 3PXSD 4A11B 5HE3B 2OVRB 5IT9g 4G55A 4A09B 5IJ7E 3N0DA 5CXBB 4BUJC 3AL8A 2Q7QA 3JROA 5A2Qg 2EIEA 1TBGA 2CO0C 5HE0B 2H3XA 3K27A 1VYHC 4H5JA 2GNQA 3JZHA 4L9OA 2HJ4A 2YMUA 3EI4B 2PM7B 5K1CC 5EAMA 3I7NA 4A0BB 2IURA 2EIDA 2G99A 3E0CA 3ULEC 2XYIA 3PVWB 4L1MA 5IGQA 4XYIA 3K6SA 5CYKA 2VDMA 2AGYA 3IUNA 4GMBA 1N6DA 3O4HA 3ODTA 1E5TA 4NBMA 2H9MA 3IIWA 1YR2A 4GM9A 4CC9A 2Z2OA 4O45A 5KDOB 5FA5B 5FQDA 1K8KC 1JTDB 2PM9B 4J82A 4JT6C 1JOFA 3ZDZA 1R5MA 5HDBA 4J81A 3IJ0A 1E8MA 4PSXB 3ORVD 4Z8LA 2VDNA 5HQGA 1K32A 3MKQA 3C5MA 1MDAH 1JMXB 4O02A 3JB9L 4A08B 2J56H 2YNOA 4AOWA 3EG6A 3EI3A 3OKYA 1H2WA 1S4UX 5EM2B 1A0RB 4J84A 3MUNA 4KFMB 4PC0A 3SXTD 2GC7A 1C9LA 3EI1B 4FA5D 2AH0A 3JRPA 4DNWA 2H6NA 2YNNA 2P9PC 4MMZA 4FAVD 3I8EA 3F3GA 3MXXA 4PBYA 2OVPB 3HFQA 4L3HD 4OWRA 4JHPC 3BG0A 3JPXA 3SLED 2Z2PA 3MUOA 5EMKB 3NIGA 5H1MA 5H14A 4JHNA 1U2VC 3SWSD 3RFHA 4QAMA 2HKRA 3PVUB 5M5TA 4Y5RD 2HU7A 3DSMA 2B5LA 4K3ID 4AN1A 2AH1A 3NVXA 5CXCB 3UR4A 3OTTA 1SQ9A 4AN0A 4JSVC 4X61B 4A7JA 3MMYA 1O6FA 3VI4A 4G1EA 4AMYA 2AQ5A 4L1QD 4CZXA 4ES0A 4IRZA 3RFGA 4X3EA 4JSNC 3EI2A 2H9NA 3BWSA 4EWRA 3C75H 1N6FA 2J57G 4QT8A 4E54B 4A09A 4G1MA 5CXBA 3VH0A 3EU7A 1O6GA 2IUPA 2CN2A 3MZKA 2CN3A 3VGZA 3PSCB 4PXWA 4A0AA 5E6RA 5SXMA 2H68A 2VDPA 3K72A 4Y7RA 2XE4A 3BG1A 3RMZD 2AGXA 2H14A 4DNVA 5IJ8E 4GQBB 1A12A 1GOHA 3I7OA 3RLMD 4JSPC 2HKMA 4YVDA 1VE7A 1GOTB 3PE7A 4ERQA 3IJ1A 2QXVA 5GMKn 3FGBA 5EMLB 1B9XA 3AH8B 3OL2B 3V7DB 3NIDA 2PM9A 2H9PA 1UOOA 3ZE1A 3SBRA 2QC5A 4J86A 5IGOA 1M1XA 5C2VB 3EQ9A 1VZ3A 4CI1A 4K3JB 3UVLA 3RN0D 3O4GA 4FA9D 1FWXA 5EAPA 1QNIA 3RRMC 3EMHA 3T3MA 4CY3A 2CE9A 4PBZA 2BKLA 3VI3A 2I3SA 4J87A 3KRXB 3NIFA 2P9KC 1YFQA 5EM2A 3FCUA 5C2WB 4FHLA 4JSXC 3DM0A 4QQEA 1XHMA 3EI1A 2QZPA 5GXHA 4GZ8A 1GG2B 3RN1D 5M5SA 4MMXA 4O3TB 4DNUA 3IURA 1MG3A 3V9FA 2YBAA 3OKTA 4ZOXA 3SBQA 3UVOA 1L0QA 2VDOA 2EICA 2HU5A 4Z7NA 3AL8B 5M5RA 3I7LA 2PBIB 2H9LA 4D0KA 3T3PA 2CO0A 3SFZA 2B4EA 5FFOA 4E5ZB 2AGZA 1QFMA 3CIKB 4GM8A 5M61A 2O9KA 2AGWA 4RE5A 4J8BA
chains in the Genus database with same CATH topology
4R7AB 2B5NA 4CZYA 4UI9R 4GM3A 4XEIC 4G56B 4BH6A 2H6QA 2HXCA 2H47A 5CYKB 3AFCA 4CZVA 4J79A 1RI6A 3F3PA 3N0EA 2IAAA 2I0RA 3ZWLB 2BBKH 3JZGA 4LG9A 5K19A 1JJUB 4FAND 3F3FA 3NVNA 4E54A 1XIPA 4HDJA 3UVKA 4ERZA 4CY5A 4ESGA 2XL2A 4J77A 4PSWB 5EMJB 1P22A 3EI3B 4FA4D 5HE1B 1NR0A 3OKYB 3PXTD 4FB1D 5FKRA 4ZN4A 4J8GA 4JT5C 4X63B 2P9IC 3UVNA 4A11A 4U1EI 3B7FA 3P4FA 4CI8A 2IWKA 3SVWD 2YNPA 1B9YA 4O3UB 3V5WB 3CFSB 5FLXg 3SBPA 3OW8A 1OMWB 2AGLA 3RSEC 1NEXB 5FXYA 4ZOVA 1GP2B 4MK0B 3EI4A 2OIZA 2P9SC 2J55H 3SCYA 2I0TA 4A0BA 2CNXA 5HE2B 3PSLA 2IWFA 2TRCB 5TDHB 2OJYA 3JZNA 4N14A 4NSXA 1OLZA 5I5IA 3UKRC 5AMSA 2EBSA 2OVQB 2P9UC 5AJAA 5HYNB 4A2LA 2YB8B 3JAMg 4D6VA 4AEZA 2UZXB 3W15A 3MZLA 4GGCA 5H17A 4J0XA 3IIYA 4IMMA 4A08A 2MTAH 5EALA 4E5ZA 4IA9A 4A0AB 2HYEA 3PXWD 3U4YA 3SMRA 5GXIA 5JWZA 5B4WA 2I3TA 5FKTA 4J73A 5TEFA 1N6EA 5AFU3 4ZOZA 1JMZB 5GSAA 5TF2A 2H13A 3I7PA 4GGDA 3IKOA 4JD2C 4LG8A 4U7AA 4GGAA 2P9NC 3MKSB 4GQ1A 3I2NA 2XL3A 5CXCA 4CY1A 2OK4A 3DXMC 4BL0A 4CY2A 4FA1D 5EARA 3L4MD 1PGUA 5FKSA 2H6KA 5TEEA 2CE8A 4QL1A 5I5MA 3C9CA 2Z2NA 3AL9A 2PM6B 3L4OD 4O9DA 1Q47A 3EWEA 3SJLD 4A2MA 3I7KA 1PI6A 3A0FA 4I79A 5C9ZB 4O1QD 4JXMA 3NVQA 4PNKB 3J80g 3UVMA 2B5MA 2BCJB 3GFCA 3I8CA 4GQ2P 5FKQA 2XU7A 3SN6B 1ERJA 2IUQA 4ERYA 2W18A 3DWLC 3FRXA 5THAA 2P9LC 5EMMB 3KRWB 4J78A 1GXRA 3C99A 3J81g 2HJBA 1PBYB 1PEVA 3FM0A 2I0SA 4LGNA 3CFVA 4XYHA 4X60B 4L3GD 3GREA 2OK6A 1SQJA 3OL2A 4FWWA 3I89A 3K26A 2UZYB 4CI2A 2IUVA 3SHFA 4H5IA 4CI3A 3VA6A 1TYQC 1SHYB 3OKWA 1MG2A 4J0WA 2HESX 4QRJA 1U4CA 4OZUA 1XKSA 2GC4A 3DXKC 3I7HA 3UKUC 3EI2B 3IJCA 4TZ4A 5I5JA 2G9AA 4ZOYA 5IC7A 3PXSD 4A11B 5HE3B 2OVRB 5IT9g 4A09B 5IJ7E 3N0DA 5CXBB 4BUJC 3AL8A 2Q7QA 3JROA 5A2Qg 1TBGA 2CO0C 5HE0B 2H3XA 1VYHC 3K27A 4H5JA 2GNQA 3JZHA 4L9OA 2HJ4A 2YMUA 3EI4B 2PM7B 5K1CC 5EAMA 3I7NA 4A0BB 2IURA 2G99A 3E0CA 3ULEC 2XYIA 3PVWB 5IGQA 4XYIA 5CYKA 2AGYA 4GMBA 1N6DA 3ODTA 2H9MA 3IIWA 4GM9A 4CC9A 2Z2OA 4O45A 5KDOB 5FA5B 5FQDA 1K8KC 2PM9B 4J82A 4JT6C 1JOFA 1R5MA 4J81A 3IJ0A 4PSXB 3ORVD 4Z8LA 5HQGA 1K32A 3MKQA 3C5MA 1MDAH 1JMXB 3JB9L 4A08B 2J56H 2YNOA 4AOWA 3EG6A 3EI3A 3OKYA 1S4UX 5EM2B 1A0RB 4J84A 4KFMB 4PC0A 3SXTD 2GC7A 3EI1B 4FA5D 2AH0A 3JRPA 2H6NA 2YNNA 2P9PC 4FAVD 3I8EA 3F3GA 3MXXA 4PBYA 2OVPB 3HFQA 4L3HD 4OWRA 3BG0A 3JPXA 3SLED 2Z2PA 5EMKB 5H1MA 5H14A 1U2VC 3SWSD 3RFHA 2HKRA 3PVUB 4Y5RD 3DSMA 4K3ID 2B5LA 2AH1A 3NVXA 5CXCB 3UR4A 3OTTA 1SQ9A 4JSVC 4X61B 4A7JA 3MMYA 2AQ5A 4L1QD 4CZXA 4ES0A 3RFGA 4X3EA 4JSNC 3EI2A 2H9NA 3BWSA 4EWRA 3C75H 1N6FA 2J57G 4QT8A 4E54B 4A09A 5CXBA 3VH0A 3EU7A 2IUPA 2CN2A 3MZKA 2CN3A 3VGZA 3PSCB 4PXWA 4A0AA 5SXMA 2H68A 4Y7RA 3BG1A 3RMZD 2AGXA 2H14A 5IJ8E 4GQBB 3I7OA 3RLMD 4JSPC 2HKMA 4YVDA 1GOTB 3PE7A 4ERQA 3IJ1A 2QXVA 5GMKn 3FGBA 5EMLB 1B9XA 3AH8B 3OL2B 3V7DB 2PM9A 2H9PA 3SBRA 2QC5A 4J86A 5IGOA 5C2VB 4CI1A 4K3JB 3UVLA 3RN0D 4FA9D 1FWXA 5EAPA 1QNIA 3RRMC 3EMHA 4CY3A 2CE9A 4PBZA 2I3SA 4J87A 3KRXB 2P9KC 1YFQA 5EM2A 5C2WB 4FHLA 4JSXC 3DM0A 4QQEA 1XHMA 3EI1A 5GXHA 4GZ8A 1GG2B 3RN1D 4O3TB 1MG3A 3V9FA 2YBAA 3OKTA 4ZOXA 3SBQA 3UVOA 1L0QA 3AL8B 3I7LA 2PBIB 2H9LA 4D0KA 2CO0A 3SFZA 2B4EA 4E5ZB 2AGZA 4GM8A 3CIKB 2O9KA 2AGWA 4J8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7A B;  2B5N A;  4CZY A;  4UI9 R;  4GM3 A;  4XEI C;  4G56 B;  4BH6 A;  2H6Q A;  2HXC A;  2H47 A;  5CYK B;  3AFC A;  4CZV A;  4J79 A;  1RI6 A;  3F3P A;  3N0E A;  2IAA A;  2I0R A;  3ZWL B;  2BBK H;  3JZG A;  4LG9 A;  5K19 A;  1JJU B;  4FAN D;  3F3F A;  3NVN A;  4E54 A;  1XIP A;  4HDJ A;  3UVK A;  4ERZ A;  4CY5 A;  4ESG A;  2XL2 A;  4J77 A;  4PSW B;  5EMJ B;  1P22 A;  3EI3 B;  4FA4 D;  5HE1 B;  1NR0 A;  3OKY B;  3PXT D;  4FB1 D;  5FKR A;  4ZN4 A;  4J8G A;  4JT5 C;  4X63 B;  2P9I C;  3UVN A;  4A11 A;  4U1E I;  3B7F A;  3P4F A;  4CI8 A;  2IWK A;  3SVW D;  2YNP A;  1B9Y A;  4O3U B;  3V5W B;  3CFS B;  5FLX g;  3SBP A;  3OW8 A;  1OMW B;  2AGL A;  3RSE C;  1NEX B;  5FXY A;  4ZOV A;  1GP2 B;  4MK0 B;  3EI4 A;  2OIZ A;  2P9S C;  2J55 H;  3SCY A;  2I0T A;  4A0B A;  2CNX A;  5HE2 B;  3PSL A;  2IWF A;  2TRC B;  5TDH B;  2OJY A;  3JZN A;  4N14 A;  4NSX A;  1OLZ A;  5I5I A;  3UKR C;  5AMS A;  2EBS A;  2OVQ B;  2P9U C;  5AJA A;  5HYN B;  4A2L A;  2YB8 B;  3JAM g;  4D6V A;  4AEZ A;  2UZX B;  3W15 A;  3MZL A;  4GGC A;  5H17 A;  4J0X A;  3IIY A;  4IMM A;  4A08 A;  2MTA H;  5EAL A;  4E5Z A;  4IA9 A;  4A0A B;  2HYE A;  3PXW D;  3U4Y A;  3SMR A;  5GXI A;  5JWZ A;  5B4W A;  2I3T A;  5FKT A;  4J73 A;  5TEF A;  1N6E A;  5AFU 3;  4ZOZ A;  1JMZ B;  5GSA A;  5TF2 A;  2H13 A;  3I7P A;  4GGD A;  3IKO A;  4JD2 C;  4LG8 A;  4U7A A;  4GGA A;  2P9N C;  3MKS B;  4GQ1 A;  3I2N A;  2XL3 A;  5CXC A;  4CY1 A;  2OK4 A;  3DXM C;  4BL0 A;  4CY2 A;  4FA1 D;  5EAR A;  3L4M D;  1PGU A;  5FKS A;  2H6K A;  5TEE A;  2CE8 A;  4QL1 A;  5I5M A;  3C9C A;  2Z2N A;  3AL9 A;  2PM6 B;  3L4O D;  4O9D A;  1Q47 A;  3EWE A;  3SJL D;  4A2M A;  3I7K A;  1PI6 A;  3A0F A;  4I79 A;  5C9Z B;  4O1Q D;  4JXM A;  3NVQ A;  4PNK B;  3J80 g;  3UVM A;  2B5M A;  2BCJ B;  3GFC A;  3I8C A;  4GQ2 P;  5FKQ A;  2XU7 A;  3SN6 B;  1ERJ A;  2IUQ A;  4ERY A;  2W18 A;  3DWL C;  3FRX A;  5THA A;  2P9L C;  5EMM B;  3KRW B;  4J78 A;  1GXR A;  3C99 A;  3J81 g;  2HJB A;  1PBY B;  1PEV A;  3FM0 A;  2I0S A;  4LGN A;  3CFV A;  4XYH A;  4X60 B;  4L3G D;  3GRE A;  2OK6 A;  1SQJ A;  3OL2 A;  4FWW A;  3I89 A;  3K26 A;  2UZY B;  4CI2 A;  2IUV A;  3SHF A;  4H5I A;  4CI3 A;  3VA6 A;  1TYQ C;  1SHY B;  3OKW A;  1MG2 A;  4J0W A;  2HES X;  4QRJ A;  1U4C A;  4OZU A;  1XKS A;  2GC4 A;  3DXK C;  3I7H A;  3UKU C;  3EI2 B;  3IJC A;  4TZ4 A;  5I5J A;  2G9A A;  4ZOY A;  5IC7 A;  3PXS D;  4A11 B;  5HE3 B;  2OVR B;  5IT9 g;  4A09 B;  5IJ7 E;  3N0D A;  5CXB B;  4BUJ C;  3AL8 A;  2Q7Q A;  3JRO A;  5A2Q g;  1TBG A;  2CO0 C;  5HE0 B;  2H3X A;  1VYH C;  3K27 A;  4H5J A;  2GNQ A;  3JZH A;  4L9O A;  2HJ4 A;  2YMU A;  3EI4 B;  2PM7 B;  5K1C C;  5EAM A;  3I7N A;  4A0B B;  2IUR A;  2G99 A;  3E0C A;  3ULE C;  2XYI A;  3PVW B;  5IGQ A;  4XYI A;  5CYK A;  2AGY A;  4GMB A;  1N6D A;  3ODT A;  2H9M A;  3IIW A;  4GM9 A;  4CC9 A;  2Z2O A;  4O45 A;  5KDO B;  5FA5 B;  5FQD A;  1K8K C;  2PM9 B;  4J82 A;  4JT6 C;  1JOF A;  1R5M A;  4J81 A;  3IJ0 A;  4PSX B;  3ORV D;  4Z8L A;  5HQG A;  1K32 A;  3MKQ A;  3C5M A;  1MDA H;  1JMX B;  3JB9 L;  4A08 B;  2J56 H;  2YNO A;  4AOW A;  3EG6 A;  3EI3 A;  3OKY A;  1S4U X;  5EM2 B;  1A0R B;  4J84 A;  4KFM B;  4PC0 A;  3SXT D;  2GC7 A;  3EI1 B;  4FA5 D;  2AH0 A;  3JRP A;  2H6N A;  2YNN A;  2P9P C;  4FAV D;  3I8E A;  3F3G A;  3MXX A;  4PBY A;  2OVP B;  3HFQ A;  4L3H D;  4OWR A;  3BG0 A;  3JPX A;  3SLE D;  2Z2P A;  5EMK B;  5H1M A;  5H14 A;  1U2V C;  3SWS D;  3RFH A;  2HKR A;  3PVU B;  4Y5R D;  3DSM A;  4K3I D;  2B5L A;  2AH1 A;  3NVX A;  5CXC B;  3UR4 A;  3OTT A;  1SQ9 A;  4JSV C;  4X61 B;  4A7J A;  3MMY A;  2AQ5 A;  4L1Q D;  4CZX A;  4ES0 A;  3RFG A;  4X3E A;  4JSN C;  3EI2 A;  2H9N A;  3BWS A;  4EWR A;  3C75 H;  1N6F A;  2J57 G;  4QT8 A;  4E54 B;  4A09 A;  5CXB A;  3VH0 A;  3EU7 A;  2IUP A;  2CN2 A;  3MZK A;  2CN3 A;  3VGZ A;  3PSC B;  4PXW A;  4A0A A;  5SXM A;  2H68 A;  4Y7R A;  3BG1 A;  3RMZ D;  2AGX A;  2H14 A;  5IJ8 E;  4GQB B;  3I7O A;  3RLM D;  4JSP C;  2HKM A;  4YVD A;  1GOT B;  3PE7 A;  4ERQ A;  3IJ1 A;  2QXV A;  5GMK n;  3FGB A;  5EML B;  1B9X A;  3AH8 B;  3OL2 B;  3V7D B;  2PM9 A;  2H9P A;  3SBR A;  2QC5 A;  4J86 A;  5IGO A;  5C2V B;  4CI1 A;  4K3J B;  3UVL A;  3RN0 D;  4FA9 D;  1FWX A;  5EAP A;  1QNI A;  3RRM C;  3EMH A;  4CY3 A;  2CE9 A;  4PBZ A;  2I3S A;  4J87 A;  3KRX B;  2P9K C;  1YFQ A;  5EM2 A;  5C2W B;  4FHL A;  4JSX C;  3DM0 A;  4QQE A;  1XHM A;  3EI1 A;  5GXH A;  4GZ8 A;  1GG2 B;  3RN1 D;  4O3T B;  1MG3 A;  3V9F A;  2YBA A;  3OKT A;  4ZOX A;  3SBQ A;  3UVO A;  1L0Q A;  3AL8 B;  3I7L A;  2PBI B;  2H9L A;  4D0K A;  2CO0 A;  3SFZ A;  2B4E A;  4E5Z B;  2AGZ A;  4GM8 A;  3CIK B;  2O9K A;  2AGW A;  4J8B A; 
#chains in the Genus database with same CATH topology
 4Z7O A;  4R7A B;  2B5N A;  4CZY A;  4UI9 R;  3IUM A;  4GM3 A;  4XEI C;  4G56 B;  4BH6 A;  4AMZ A;  2H6Q A;  2HXC A;  2H47 A;  5CYK B;  3AFC A;  4CZV A;  4J79 A;  1RI6 A;  3F3P A;  2XDW A;  3N0E A;  2IAA A;  2I0R A;  4O2W A;  3ZWL B;  2BBK H;  2VC2 A;  3JZG A;  4LG9 A;  5K19 A;  1JJU B;  4FAN D;  3F3F A;  3NVN A;  4E54 A;  1XIP A;  1L5G A;  4HDJ A;  2HU8 A;  3UVK A;  3GD1 I;  4ERZ A;  3DDU A;  4CY5 A;  4ESG A;  2XL2 A;  4J77 A;  4PSW B;  3GC3 B;  5EMJ B;  2XZG A;  1P22 A;  3EI3 B;  4FA4 D;  5HE1 B;  1NR0 A;  3OKY B;  3PXT D;  4FB1 D;  5FKR A;  4ZN4 A;  4J8G A;  4JT5 C;  4X63 B;  2P9I C;  3UVN A;  2VDL A;  4A11 A;  2VDQ A;  4U1E I;  3B7F A;  3P4F A;  4CI8 A;  2IWK A;  3SVW D;  4MMY A;  2YNP A;  3OF7 A;  1B9Y A;  3IUL A;  4O3U B;  3V5W B;  3CFS B;  5FLX g;  3SBP A;  3OW8 A;  1OMW B;  2AGL A;  3RSE C;  1NEX B;  5FXY A;  4ZOV A;  4BCD A;  1GP2 B;  4MK0 B;  3QHY B;  3ZE2 A;  3EI4 A;  2OIZ A;  4D9S A;  2P9S C;  2J55 H;  4RE6 A;  3SCY A;  2I0T A;  4A0B A;  2CNX A;  1C9I A;  1QFS A;  5HE2 B;  3PSL A;  2IWF A;  2TRC B;  5TDH B;  3IUQ A;  2OJY A;  3JZN A;  3IVM A;  4N14 A;  1OLZ A;  4NSX A;  4NEN A;  3KCI A;  1VZ2 A;  5I5I A;  4NAA A;  3UKR C;  5C92 A;  5AMS A;  2VZ1 A;  2EBS A;  1H2Y A;  2OVQ B;  2P9U C;  5AJA A;  5HYN B;  4A2L A;  2YB8 B;  3JAM g;  4D6V A;  4AEZ A;  4WK2 A;  2UZX B;  4AX4 A;  3W15 A;  3MZL A;  4GGC A;  5H17 A;  3MVD K;  1JV2 A;  4J0X A;  3IIY A;  4WK0 A;  4IMM A;  3O4I A;  4A08 A;  2MTA H;  5EAL A;  4E5Z A;  4IA9 A;  4A0A B;  2HYE A;  3PXW D;  3U4Y A;  3SMR A;  1BPO A;  4BP8 A;  5GXI A;  5JWZ A;  5B4W A;  2I3T A;  5FKT A;  4J73 A;  5TEF A;  1N6E A;  3K71 A;  5AFU 3;  4ZOZ A;  1I2M B;  1JMZ B;  5GSA A;  5TF2 A;  1UOQ A;  2H13 A;  2WQ8 A;  4Z7Q A;  3I7P A;  4GGD A;  3IKO A;  1VE6 A;  3EQ7 A;  4JD2 C;  5E6U A;  4LG8 A;  4U7A A;  4GGA A;  2P9N C;  3MKS B;  4GQ1 A;  2QR5 A;  3I2N A;  1TYE A;  2XL3 A;  5CXC A;  4CY1 A;  2OK4 A;  3DXM C;  4BL0 A;  1H2Z A;  4CY2 A;  4FA1 D;  5EAR A;  3L4M D;  1PGU A;  5FKS A;  2H6K A;  5TEE A;  2CE8 A;  4QL1 A;  5I5M A;  3C9C A;  1K3I A;  2Z2N A;  3AL9 A;  2PM6 B;  3L4O D;  4UM8 A;  4O9D A;  3ZDX A;  2JKX A;  1H2X A;  1Q47 A;  3EWE A;  3SJL D;  4A2M A;  1U8C A;  3I7K A;  3IJE A;  3ZE0 A;  1PI6 A;  3A0F A;  4I79 A;  1E8N A;  5C9Z B;  4O1Q D;  4JXM A;  3V4P A;  5M5V A;  3NVQ A;  3QI0 A;  4PNK B;  4WK4 A;  2VDK A;  3J80 g;  3UVM A;  2B5M A;  2BCJ B;  3O4J A;  3GFC A;  3I8C A;  4GQ2 P;  5FKQ A;  1GOG A;  2XU7 A;  3SN6 B;  1ERJ A;  2IUQ A;  4ERY A;  2W18 A;  4WJK A;  3DWL C;  3FRX A;  5THA A;  1T2X A;  2P9L C;  3V4V A;  3KRW B;  4NC4 A;  5EMM B;  4J78 A;  1GXR A;  3C99 A;  3J81 g;  2HJB A;  4BP9 A;  1PBY B;  1PEV A;  3FM0 A;  2EIB A;  2I0S A;  4LGN A;  3CFV A;  4XYH A;  4X60 B;  4L3G D;  3GRE A;  4BCB A;  1GOF A;  2OK6 A;  1SQJ A;  3OL2 A;  4FWW A;  3I89 A;  4UM9 A;  3K26 A;  2UZY B;  4CI2 A;  4BCC A;  2IUV A;  3SHF A;  4H5I A;  3IUJ A;  4CI3 A;  3VA6 A;  1TYQ C;  1SHY B;  3OKW A;  1MG2 A;  4J0W A;  2HES X;  5C86 A;  3FCS A;  2VZ3 A;  1U4C A;  4QRJ A;  2VDR A;  4OZU A;  1XKS A;  2GC4 A;  1UOP A;  3DXK C;  5E6S A;  5M5U A;  5FFG A;  3I7H A;  3UKU C;  3EI2 B;  3EQ8 A;  3IJC A;  4TZ4 A;  5I5J A;  3ZDY A;  2G9A A;  4ZOY A;  5IC7 A;  1UTC A;  3PXS D;  4A11 B;  5HE3 B;  2OVR B;  5IT9 g;  4G55 A;  4A09 B;  5IJ7 E;  3N0D A;  5CXB B;  4BUJ C;  3AL8 A;  2Q7Q A;  3JRO A;  5A2Q g;  2EIE A;  1TBG A;  2CO0 C;  5HE0 B;  2H3X A;  3K27 A;  1VYH C;  4H5J A;  2GNQ A;  3JZH A;  4L9O A;  2HJ4 A;  2YMU A;  3EI4 B;  2PM7 B;  5K1C C;  5EAM A;  3I7N A;  4A0B B;  2IUR A;  2EID A;  2G99 A;  3E0C A;  3ULE C;  2XYI A;  3PVW B;  4L1M A;  5IGQ A;  4XYI A;  3K6S A;  5CYK A;  2VDM A;  2AGY A;  3IUN A;  4GMB A;  1N6D A;  3O4H A;  3ODT A;  1E5T A;  4NBM A;  2H9M A;  3IIW A;  1YR2 A;  4GM9 A;  4CC9 A;  2Z2O A;  4O45 A;  5KDO B;  5FA5 B;  5FQD A;  1K8K C;  1JTD B;  2PM9 B;  4J82 A;  4JT6 C;  1JOF A;  3ZDZ A;  1R5M A;  5HDB A;  4J81 A;  3IJ0 A;  1E8M A;  4PSX B;  3ORV D;  4Z8L A;  2VDN A;  5HQG A;  1K32 A;  3MKQ A;  3C5M A;  1MDA H;  1JMX B;  4O02 A;  3JB9 L;  4A08 B;  2J56 H;  2YNO A;  4AOW A;  3EG6 A;  3EI3 A;  3OKY A;  1H2W A;  1S4U X;  5EM2 B;  1A0R B;  4J84 A;  3MUN A;  4KFM B;  4PC0 A;  3SXT D;  2GC7 A;  1C9L A;  3EI1 B;  4FA5 D;  2AH0 A;  3JRP A;  4DNW A;  2H6N A;  2YNN A;  2P9P C;  4MMZ A;  4FAV D;  3I8E A;  3F3G A;  3MXX A;  4PBY A;  2OVP B;  3HFQ A;  4L3H D;  4OWR A;  4JHP C;  3BG0 A;  3JPX A;  3SLE D;  2Z2P A;  3MUO A;  5EMK B;  3NIG A;  5H1M A;  5H14 A;  4JHN A;  1U2V C;  3SWS D;  3RFH A;  4QAM A;  2HKR A;  3PVU B;  5M5T A;  4Y5R D;  2HU7 A;  3DSM A;  2B5L A;  4K3I D;  4AN1 A;  2AH1 A;  3NVX A;  5CXC B;  3UR4 A;  3OTT A;  1SQ9 A;  4AN0 A;  4JSV C;  4X61 B;  4A7J A;  3MMY A;  1O6F A;  3VI4 A;  4G1E A;  4AMY A;  2AQ5 A;  4L1Q D;  4CZX A;  4ES0 A;  4IRZ A;  3RFG A;  4X3E A;  4JSN C;  3EI2 A;  2H9N A;  3BWS A;  4EWR A;  3C75 H;  1N6F A;  2J57 G;  4QT8 A;  4E54 B;  4A09 A;  4G1M A;  5CXB A;  3VH0 A;  3EU7 A;  1O6G A;  2IUP A;  2CN2 A;  3MZK A;  2CN3 A;  3VGZ A;  3PSC B;  4PXW A;  4A0A A;  5E6R A;  5SXM A;  2H68 A;  2VDP A;  3K72 A;  4Y7R A;  2XE4 A;  3BG1 A;  3RMZ D;  2AGX A;  2H14 A;  4DNV A;  5IJ8 E;  4GQB B;  1A12 A;  1GOH A;  3I7O A;  3RLM D;  4JSP C;  2HKM A;  4YVD A;  1VE7 A;  1GOT B;  3PE7 A;  4ERQ A;  3IJ1 A;  2QXV A;  5GMK n;  3FGB A;  5EML B;  1B9X A;  3AH8 B;  3OL2 B;  3V7D B;  3NID A;  2PM9 A;  2H9P A;  1UOO A;  3ZE1 A;  3SBR A;  2QC5 A;  4J86 A;  5IGO A;  1M1X A;  5C2V B;  3EQ9 A;  1VZ3 A;  4CI1 A;  4K3J B;  3UVL A;  3RN0 D;  3O4G A;  4FA9 D;  1FWX A;  5EAP A;  1QNI A;  3RRM C;  3EMH A;  3T3M A;  4CY3 A;  2CE9 A;  4PBZ A;  2BKL A;  3VI3 A;  2I3S A;  4J87 A;  3KRX B;  3NIF A;  2P9K C;  1YFQ A;  5EM2 A;  3FCU A;  5C2W B;  4FHL A;  4JSX C;  3DM0 A;  4QQE A;  1XHM A;  3EI1 A;  2QZP A;  5GXH A;  4GZ8 A;  1GG2 B;  3RN1 D;  5M5S A;  4MMX A;  4O3T B;  4DNU A;  3IUR A;  1MG3 A;  3V9F A;  2YBA A;  3OKT A;  4ZOX A;  3SBQ A;  3UVO A;  1L0Q A;  2VDO A;  2EIC A;  2HU5 A;  4Z7N A;  3AL8 B;  5M5R A;  3I7L A;  2PBI B;  2H9L A;  4D0K A;  3T3P A;  2CO0 A;  3SFZ A;  2B4E A;  5FFO A;  4E5Z B;  2AGZ A;  1QFM A;  3CIK B;  4GM8 A;  5M61 A;  2O9K A;  2AGW A;  4RE5 A;  4J8B A; 
#chains in the Genus database with same CATH homology
 4R7A B;  2B5N A;  4CZY A;  4UI9 R;  4GM3 A;  4XEI C;  4G56 B;  4BH6 A;  2H6Q A;  2HXC A;  2H47 A;  5CYK B;  3AFC A;  4CZV A;  4J79 A;  1RI6 A;  3F3P A;  3N0E A;  2IAA A;  2I0R A;  3ZWL B;  2BBK H;  3JZG A;  4LG9 A;  5K19 A;  1JJU B;  4FAN D;  3F3F A;  3NVN A;  4E54 A;  1XIP A;  4HDJ A;  3UVK A;  4ERZ A;  4CY5 A;  4ESG A;  2XL2 A;  4J77 A;  4PSW B;  5EMJ B;  1P22 A;  3EI3 B;  4FA4 D;  5HE1 B;  1NR0 A;  3OKY B;  3PXT D;  4FB1 D;  5FKR A;  4ZN4 A;  4J8G A;  4JT5 C;  4X63 B;  2P9I C;  3UVN A;  4A11 A;  4U1E I;  3B7F A;  3P4F A;  4CI8 A;  2IWK A;  3SVW D;  2YNP A;  1B9Y A;  4O3U B;  3V5W B;  3CFS B;  5FLX g;  3SBP A;  3OW8 A;  1OMW B;  2AGL A;  3RSE C;  1NEX B;  5FXY A;  4ZOV A;  1GP2 B;  4MK0 B;  3EI4 A;  2OIZ A;  2P9S C;  2J55 H;  3SCY A;  2I0T A;  4A0B A;  2CNX A;  5HE2 B;  3PSL A;  2IWF A;  2TRC B;  5TDH B;  2OJY A;  3JZN A;  4N14 A;  4NSX A;  1OLZ A;  5I5I A;  3UKR C;  5AMS A;  2EBS A;  2OVQ B;  2P9U C;  5AJA A;  5HYN B;  4A2L A;  2YB8 B;  3JAM g;  4D6V A;  4AEZ A;  2UZX B;  3W15 A;  3MZL A;  4GGC A;  5H17 A;  4J0X A;  3IIY A;  4IMM A;  4A08 A;  2MTA H;  5EAL A;  4E5Z A;  4IA9 A;  4A0A B;  2HYE A;  3PXW D;  3U4Y A;  3SMR A;  5GXI A;  5JWZ A;  5B4W A;  2I3T A;  5FKT A;  4J73 A;  5TEF A;  1N6E A;  5AFU 3;  4ZOZ A;  1JMZ B;  5GSA A;  5TF2 A;  2H13 A;  3I7P A;  4GGD A;  3IKO A;  4JD2 C;  4LG8 A;  4U7A A;  4GGA A;  2P9N C;  3MKS B;  4GQ1 A;  3I2N A;  2XL3 A;  5CXC A;  4CY1 A;  2OK4 A;  3DXM C;  4BL0 A;  4CY2 A;  4FA1 D;  5EAR A;  3L4M D;  1PGU A;  5FKS A;  2H6K A;  5TEE A;  2CE8 A;  4QL1 A;  5I5M A;  3C9C A;  2Z2N A;  3AL9 A;  2PM6 B;  3L4O D;  4O9D A;  1Q47 A;  3EWE A;  3SJL D;  4A2M A;  3I7K A;  1PI6 A;  3A0F A;  4I79 A;  5C9Z B;  4O1Q D;  4JXM A;  3NVQ A;  4PNK B;  3J80 g;  3UVM A;  2B5M A;  2BCJ B;  3GFC A;  3I8C A;  4GQ2 P;  5FKQ A;  2XU7 A;  3SN6 B;  1ERJ A;  2IUQ A;  4ERY A;  2W18 A;  3DWL C;  3FRX A;  5THA A;  2P9L C;  5EMM B;  3KRW B;  4J78 A;  1GXR A;  3C99 A;  3J81 g;  2HJB A;  1PBY B;  1PEV A;  3FM0 A;  2I0S A;  4LGN A;  3CFV A;  4XYH A;  4X60 B;  4L3G D;  3GRE A;  2OK6 A;  1SQJ A;  3OL2 A;  4FWW A;  3I89 A;  3K26 A;  2UZY B;  4CI2 A;  2IUV A;  3SHF A;  4H5I A;  4CI3 A;  3VA6 A;  1TYQ C;  1SHY B;  3OKW A;  1MG2 A;  4J0W A;  2HES X;  4QRJ A;  1U4C A;  4OZU A;  1XKS A;  2GC4 A;  3DXK C;  3I7H A;  3UKU C;  3EI2 B;  3IJC A;  4TZ4 A;  5I5J A;  2G9A A;  4ZOY A;  5IC7 A;  3PXS D;  4A11 B;  5HE3 B;  2OVR B;  5IT9 g;  4A09 B;  5IJ7 E;  3N0D A;  5CXB B;  4BUJ C;  3AL8 A;  2Q7Q A;  3JRO A;  5A2Q g;  1TBG A;  2CO0 C;  5HE0 B;  2H3X A;  1VYH C;  3K27 A;  4H5J A;  2GNQ A;  3JZH A;  4L9O A;  2HJ4 A;  2YMU A;  3EI4 B;  2PM7 B;  5K1C C;  5EAM A;  3I7N A;  4A0B B;  2IUR A;  2G99 A;  3E0C A;  3ULE C;  2XYI A;  3PVW B;  5IGQ A;  4XYI A;  5CYK A;  2AGY A;  4GMB A;  1N6D A;  3ODT A;  2H9M A;  3IIW A;  4GM9 A;  4CC9 A;  2Z2O A;  4O45 A;  5KDO B;  5FA5 B;  5FQD A;  1K8K C;  2PM9 B;  4J82 A;  4JT6 C;  1JOF A;  1R5M A;  4J81 A;  3IJ0 A;  4PSX B;  3ORV D;  4Z8L A;  5HQG A;  1K32 A;  3MKQ A;  3C5M A;  1MDA H;  1JMX B;  3JB9 L;  4A08 B;  2J56 H;  2YNO A;  4AOW A;  3EG6 A;  3EI3 A;  3OKY A;  1S4U X;  5EM2 B;  1A0R B;  4J84 A;  4KFM B;  4PC0 A;  3SXT D;  2GC7 A;  3EI1 B;  4FA5 D;  2AH0 A;  3JRP A;  2H6N A;  2YNN A;  2P9P C;  4FAV D;  3I8E A;  3F3G A;  3MXX A;  4PBY A;  2OVP B;  3HFQ A;  4L3H D;  4OWR A;  3BG0 A;  3JPX A;  3SLE D;  2Z2P A;  5EMK B;  5H1M A;  5H14 A;  1U2V C;  3SWS D;  3RFH A;  2HKR A;  3PVU B;  4Y5R D;  3DSM A;  4K3I D;  2B5L A;  2AH1 A;  3NVX A;  5CXC B;  3UR4 A;  3OTT A;  1SQ9 A;  4JSV C;  4X61 B;  4A7J A;  3MMY A;  2AQ5 A;  4L1Q D;  4CZX A;  4ES0 A;  3RFG A;  4X3E A;  4JSN C;  3EI2 A;  2H9N A;  3BWS A;  4EWR A;  3C75 H;  1N6F A;  2J57 G;  4QT8 A;  4E54 B;  4A09 A;  5CXB A;  3VH0 A;  3EU7 A;  2IUP A;  2CN2 A;  3MZK A;  2CN3 A;  3VGZ A;  3PSC B;  4PXW A;  4A0A A;  5SXM A;  2H68 A;  4Y7R A;  3BG1 A;  3RMZ D;  2AGX A;  2H14 A;  5IJ8 E;  4GQB B;  3I7O A;  3RLM D;  4JSP C;  2HKM A;  4YVD A;  1GOT B;  3PE7 A;  4ERQ A;  3IJ1 A;  2QXV A;  5GMK n;  3FGB A;  5EML B;  1B9X A;  3AH8 B;  3OL2 B;  3V7D B;  2PM9 A;  2H9P A;  3SBR A;  2QC5 A;  4J86 A;  5IGO A;  5C2V B;  4CI1 A;  4K3J B;  3UVL A;  3RN0 D;  4FA9 D;  1FWX A;  5EAP A;  1QNI A;  3RRM C;  3EMH A;  4CY3 A;  2CE9 A;  4PBZ A;  2I3S A;  4J87 A;  3KRX B;  2P9K C;  1YFQ A;  5EM2 A;  5C2W B;  4FHL A;  4JSX C;  3DM0 A;  4QQE A;  1XHM A;  3EI1 A;  5GXH A;  4GZ8 A;  1GG2 B;  3RN1 D;  4O3T B;  1MG3 A;  3V9F A;  2YBA A;  3OKT A;  4ZOX A;  3SBQ A;  3UVO A;  1L0Q A;  3AL8 B;  3I7L A;  2PBI B;  2H9L A;  4D0K A;  2CO0 A;  3SFZ A;  2B4E A;  4E5Z B;  2AGZ A;  4GM8 A;  3CIK B;  2O9K A;  2AGW A;  4J8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...