5KDOB

Heterotrimeric complex of the 4 alanine insertion variant of the gi alpha1 subunit and the gbeta1-ggamma1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
339
structure length
335
Chain Sequence
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1
publication title A Conserved Hydrophobic Core in G alpha i1 Regulates G Protein Activation and Release from Activated Receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 110
structure length 335
sequence length 339
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5kdoB00
1MG3A 3E0CA 3I7LA 4JXMA 4CZYA 3K27A 3CFVA 3EI3B 3JB9L 3MXXA 4JSVC 5GSAA 5TDHB 5HE2B 3B7FA 3UVNA 4J84A 3EI2B 1RI6A 3V9FA 2CNXA 1ERJA 2H6KA 4GMBA 2CN2A 3I7HA 4JT5C 4D6VA 1XKSA 5AJAA 4GQBB 2HXCA 5EM2B 1JMXB 2PBIB 4J87A 4E5ZA 2H13A 4CZXA 5C2VB 4LGNA 4GGAA 4PNKB 2MTAH 3ORVD 3AFCA 5JWZA 3EI3A 4FA5D 4FA4D 2IUQA 4A11B 4D0KA 5A2Qg 2OK6A 2B4EA 4O3TB 5GXIA 3BG1A 4QT8A 3PXTD 3JAMg 3P4FA 3EI2A 2PM7B 2AGYA 5B4WA 3I7PA 3SBQA 3ODTA 4O3UB 3UVKA 5EM2A 5HE3B 4PSWB 3DXMC 3JZGA 4J73A 2P9KC 3IIWA 3IJ1A 3KRWB 3GREA 2GNQA 5FKQA 1MG2A 3OTTA 5AFU3 4A11A 3SFZA 1TBGA 5H1MA 5FKTA 1GP2B 2H9NA 2H6NA 5EAPA 5HYNB 4J8BA 4XEIC 3JRPA 1OLZA 1GOTB 5HE0B 3MMYA 3I8EA 3U4YA 5FQDA 4AOWA 2YB8B 2OVRB 2QC5A 2Z2NA 3OL2A 3RFHA 2IWKA 5HQGA 5CXBB 3FGBA 2OVQB 3PSLA 2QXVA 3I7OA 4XYIA 1R5MA 2G99A 2XL2A 3I89A 4J78A 4QRJA 4ES0A 3DSMA 4Y7RA 2OIZA 4IMMA 1N6FA 2I0RA 4GGCA 1OMWB 5K19A 3I8CA 3NVXA 3EMHA 4A7JA 4HDJA 3N0DA 4O9DA 5H14A 4OWRA 2AQ5A 4LG8A 5CXBA 4X60B 4CZVA 2IUPA 2AGZA 4A0BB 4A08B 4PXWA 3EG6A 5THAA 4A2MA 5IGOA 2GC4A 3RN0D 4FWWA 5C2WB 3EWEA 3FM0A 2IUVA 4QL1A 2HKRA 2I0TA 4L3GD 5GXHA 5K1CC 2H9PA 4GZ8A 3HFQA 4O45A 3UVLA 3DWLC 2PM6B 2G9AA 3A0FA 1P22A 4MK0B 1SHYB 4FB1D 3SN6B 3PXSD 4A0BA 4A08A 3MKSB 3UVOA 5H17A 2W18A 2HESX 4J0XA 1XHMA 3ULEC 2H6QA 2OJYA 2Z2PA 4JSXC 1S4UX 3C5MA 2I3SA 5I5JA 2BCJB 4L9OA 5FXYA 2H14A 4YVDA 4BUJC 4ZOXA 3OKTA 5EARA 4CY3A 4ERYA 2YMUA 5IC7A 4GQ1A 2H3XA 4PSXB 5GMKn 3OL2B 2HYEA 3SHFA 2AH1A 4CY1A 3NVNA 3CFSB 4J82A 5SXMA 1PI6A 2IURA 2P9IC 2I3TA 3RSEC 4AEZA 4FAVD 2CE8A 3L4MD 2BBKH 3IJ0A 2EBSA 4GGDA 3PXWD 4QQEA 5AMSA 4J77A 2CO0A 4N14A 2Q7QA 1B9XA 5EMJB 1B9YA 2UZYB 2XL3A 5CXCB 2TRCB 2GC7A 5FLXg 4FA1D 4K3ID 1VYHC 5FA5B 2H68A 5CYKB 3W15A 1N6EA 3AL8B 3SVWD 4NSXA 4ZN4A 2H9LA 3SWSD 4CY2A 2I0SA 3I7NA 4J0WA 3IJCA 4U7AA 3UKUC 2P9NC 2J57G 3C9CA 5EALA 4G56B 2PM9B 4CI3A 3I2NA 3AL9A 4ERZA 3MZLA 5EMKB 4FHLA 2OK4A 4JT6C 4OZUA 1SQJA 5CXCA 5TEEA 4Z8LA 5I5MA 3ZWLB 2Z2OA 4E54B 3DXKC 4L3HD 2P9SC 5EMMB 5CYKA 2HJ4A 3AL8A 2CN3A 4CI1A 2AGXA 1NR0A 3PVWB 3UR4A 4FA9D 2B5MA 4LG9A 4ERQA 2IWFA 3VH0A 3OKYB 4CC9A 3AH8B 2PM9A 4FAND 1NEXB 1SQ9A 1MDAH 4U1EI 3SLED 4KFMB 4A0AB 4GM8A 3EI4A 3V5WB 3V7DB 5TEFA 4X63B 5KDOB 3SBPA 3C75H 3FRXA 1Q47A 1JJUB 1N6DA 4XYHA 4JD2C 4UI9R 3UVMA 4E54A 3RFGA 4A09A 3PSCB 5EAMA 4ZOYA 3BWSA 2YNPA 1K32A 1L0QA 1PBYB 3VA6A 1PEVA 4O1QD 1GG2B 4PBYA 1YFQA 3JPXA 2H9MA 3OKYA 3I7KA 4ZOZA 4Y5RD 4L1QD 5FKSA 3CIKB 4A0AA 3OW8A 3EI1B 4JSPC 5EMLB 5I5IA 1PGUA 4GM3A 4J8GA 4ESGA 2J56H 3N0EA 2UZXB 3BG0A 3SCYA 2J55H 3F3FA 2P9UC 4CY5A 4R7AB 4JSNC 4BL0A 1JMZB 3JZNA 3PVUB 3RRMC 2AGLA 3RMZD 4J79A 5HE1B 3EU7A 2HJBA 2AGWA 4H5JA 1U4CA 2YNOA 3PE7A 3JZHA 3RLMD 3EI1A 1TYQC 5IT9g 1A0RB 3GFCA 4BH6A 4A2LA 4J81A 4PBZA 3KRXB 3SMRA 2YBAA 3JROA 1K8KC 3UKRC 2B5LA 4X3EA 3VGZA 4J86A 2CE9A 3SJLD 2XYIA 3IKOA 4K3JB 3C99A 5IGQA 2B5NA 2CO0C 4CI8A 4IA9A 4TZ4A 3NVQA 4EWRA 3SBRA 5FKRA 3EI4B 3MZKA 1XIPA 3J80g 4GM9A 2P9LC 3RN1D 1QNIA 4GQ2P 4PC0A 4H5IA 1FWXA 2HKMA 5C9ZB 5IJ8E 3IIYA 2H47A 3MKQA 4A09B 3SXTD 2IAAA 1JOFA 4I79A 3F3GA 3F3PA 1GXRA 4CI2A 5TF2A 5IJ7E 2XU7A 3L4OD 3J81g 3OKWA 4ZOVA 2O9KA 2OVPB 2AH0A 2P9PC 2YNNA 4X61B 4E5ZB 1U2VC 3K26A 3DM0A
chains in the Genus database with same CATH superfamily
4AMYA 1MG3A 3E0CA 3I7LA 3ZDZA 4JXMA 3MVDK 4CZYA 1T2XA 3K27A 3CFVA 3EI3B 1UOOA 3JB9L 3MXXA 4JSVC 5GSAA 5TDHB 5HE2B 3B7FA 3UVNA 4J84A 3EI2B 1RI6A 3V9FA 2CNXA 1ERJA 2H6KA 4GMBA 2CN2A 3I7HA 4JT5C 5FFGA 1XKSA 4D6VA 3DDUA 2XE4A 3EQ9A 4WK2A 5AJAA 4GQBB 2HXCA 3IUJA 4UM9A 5EM2B 1JMXB 2PBIB 4J87A 4E5ZA 2H13A 4CZXA 5C2VB 4LGNA 4GGAA 4PNKB 2MTAH 3ORVD 3AFCA 5JWZA 3EI3A 4FA5D 4FA4D 1L5GA 2IUQA 4A11B 4D0KA 3NIGA 5A2Qg 2VC2A 2OK6A 3ZDYA 2VDPA 2B4EA 4O3TB 1O6GA 3BG1A 5GXIA 4QT8A 3PXTD 3JAMg 3P4FA 3EI2A 2PM7B 4AMZA 2AGYA 5B4WA 1I2MB 3I7PA 3T3PA 3OF7A 3SBQA 3ODTA 4O3UB 3UVKA 5EM2A 4DNWA 5HE3B 4PSWB 3T3MA 3DXMC 3JZGA 4J73A 2P9KC 3IIWA 3KCIA 3IJ1A 3KRWB 3GREA 2GNQA 5FKQA 1MG2A 3OTTA 2VZ3A 4BCDA 5AFU3 3NIDA 4A11A 3SFZA 1TBGA 5M5SA 4BCBA 5H1MA 3QHYB 5FKTA 1GP2B 2H9NA 2H6NA 5EAPA 5HYNB 4J8BA 4XEIC 1VE7A 3JRPA 3ZDXA 1OLZA 1GOTB 3IVMA 5HE0B 3MMYA 3I8EA 5M61A 3U4YA 5FQDA 4AOWA 1UOPA 2YB8B 1K3IA 2OVRB 4WJKA 2QC5A 2Z2NA 4NBMA 3OL2A 3RFHA 2IWKA 5HQGA 5CXBB 3FGBA 2OVQB 3PSLA 4MMYA 4NENA 2QXVA 3I7OA 4XYIA 1R5MA 2G99A 2XL2A 3I89A 4J78A 4QRJA 3QI0A 1YR2A 4ES0A 3DSMA 5E6SA 2HU8A 4UM8A 4Y7RA 2OIZA 1QFMA 4IMMA 1N6FA 2I0RA 4GGCA 1OMWB 1JV2A 4Z7OA 5K19A 3I8CA 3NVXA 5M5VA 3EMHA 4A7JA 4HDJA 3N0DA 4O9DA 5H14A 4OWRA 2AQ5A 4LG8A 4RE5A 2HU7A 5CXBA 4X60B 4CZVA 2IUPA 2AGZA 4A0BB 4A08B 4PXWA 3EG6A 1VZ3A 4O02A 1C9IA 5THAA 4A2MA 5IGOA 2GC4A 3RN0D 4FWWA 5C2WB 3EWEA 3FM0A 2IUVA 3EQ8A 4QL1A 2HKRA 3VI4A 2I0TA 4L3GD 5GXHA 5K1CC 2H9PA 4GZ8A 3HFQA 4O45A 2VDKA 3UVLA 3IUMA 3DWLC 2PM6B 2G9AA 3A0FA 1VE6A 1P22A 4MK0B 1SHYB 4FB1D 1TYEA 3SN6B 3PXSD 4A0BA 4A08A 3MKSB 4RE6A 3UVOA 5H17A 2W18A 2HESX 4J0XA 5E6UA 1XHMA 3ULEC 2H6QA 2OJYA 2Z2PA 3O4HA 4JSXC 1S4UX 3C5MA 2I3SA 5I5JA 2BCJB 4L9OA 3K6SA 5FXYA 2H14A 4YVDA 4BUJC 1UTCA 3OKTA 4ZOXA 5EARA 4CY3A 1H2ZA 2YMUA 4ERYA 2VDRA 5IC7A 3ZE1A 4GQ1A 2H3XA 4JHPC 4PSXB 5GMKn 3OL2B 2HYEA 3SHFA 2AH1A 4CY1A 3NVNA 1E8NA 4QAMA 3CFSB 4J82A 5SXMA 2VDQA 1PI6A 1UOQA 2IURA 3FCSA 2EIEA 2P9IC 2HU5A 4NAAA 2I3TA 3RSEC 4AEZA 4FAVD 2CE8A 3L4MD 2BBKH 3IJ0A 3V4PA 2EBSA 3IURA 4Z7QA 4GGDA 3PXWD 4QQEA 4DNVA 5AMSA 4J77A 2EIDA 2CO0A 4N14A 2VZ1A 5FFOA 2Q7QA 4AX4A 1B9XA 5EMJB 1B9YA 2UZYB 4AN1A 2XL3A 5CXCB 2TRCB 4MMZA 4DNUA 4G55A 2BKLA 2GC7A 5FLXg 4FA1D 4NC4A 4K3ID 3O4GA 1VYHC 5FA5B 2H68A 5CYKB 3W15A 1N6EA 3AL8B 3SVWD 4NSXA 4ZN4A 2H9LA 3SWSD 4CY2A 2I0SA 1O6FA 3I7NA 3K72A 4J0WA 3IJCA 4U7AA 5E6RA 3UKUC 2P9NC 2J57G 3C9CA 2WQ8A 5EALA 4G56B 4D9SA 5C86A 4JHNA 3IUNA 2PM9B 4CI3A 3I2NA 3AL9A 4ERZA 3MZLA 5EMKB 3ZE0A 4FHLA 2OK4A 4JT6C 4OZUA 1SQJA 2EICA 2VDOA 5CXCA 5TEEA 4Z8LA 5I5MA 4BP9A 3ZWLB 2Z2OA 4E54B 3DXKC 4L3HD 2P9SC 3IJEA 4WK4A 5EMMB 5CYKA 2HJ4A 3AL8A 2CN3A 4BCCA 4CI1A 4BP8A 2AGXA 1NR0A 3PVWB 3UR4A 1C9LA 4FA9D 3GD1I 2B5MA 1JTDB 4LG9A 4ERQA 2IWFA 3VH0A 3OKYB 3MUNA 3O4IA 3AH8B 4CC9A 2PM9A 4G1MA 4FAND 1NEXB 1SQ9A 1MDAH 4U1EI 3SLED 4KFMB 4A0AB 4GM8A 3EI4A 3V5WB 4O2WA 3V7DB 3VI3A 2VDNA 5TEFA 4X63B 5KDOB 3SBPA 3C75H 3FRXA 1Q47A 1JJUB 1N6DA 4XYHA 5C92A 4JD2C 4UI9R 3UVMA 4E54A 1A12A 3RFGA 3IULA 4A09A 3PSCB 5EAMA 4ZOYA 3BWSA 4Z7NA 2YNPA 1K32A 1L0QA 2XDWA 1PBYB 3VA6A 1PEVA 4O1QD 1GG2B 4PBYA 1YFQA 3JPXA 2H9MA 3OKYA 3I7KA 3GC3B 4ZOZA 4Y5RD 1E8MA 4IRZA 4L1QD 5FKSA 1H2WA 3CIKB 4A0AA 3OW8A 3EI1B 4JSPC 5EMLB 5I5IA 1H2XA 1PGUA 4GM3A 4J8GA 3ZE2A 4ESGA 2J56H 3N0EA 2UZXB 3BG0A 3SCYA 2J55H 1BPOA 3F3FA 2P9UC 4CY5A 2QR5A 4R7AB 4JSNC 4BL0A 5M5UA 1JMZB 3JZNA 3PVUB 3RRMC 2AGLA 3RMZD 4J79A 5HE1B 1GOHA 3EU7A 2HJBA 2XZGA 2AGWA 4H5JA 1U4CA 2YNOA 3PE7A 5M5TA 3V4VA 2EIBA 3JZHA 3RLMD 3EI1A 4AN0A 1TYQC 3NIFA 1VZ2A 5IT9g 4WK0A 1A0RB 3GFCA 3FCUA 4BH6A 2VDLA 3K71A 4A2LA 4J81A 4PBZA 3KRXB 4MMXA 3SMRA 3EQ7A 2YBAA 3JROA 1K8KC 3UKRC 2B5LA 4X3EA 3VGZA 4J86A 2CE9A 3SJLD 2XYIA 3IKOA 3MUOA 4K3JB 3C99A 5IGQA 2B5NA 1M1XA 2CO0C 4CI8A 4IA9A 4TZ4A 3NVQA 4EWRA 3SBRA 5FKRA 2VDMA 3EI4B 3MZKA 1QFSA 1XIPA 3J80g 1GOFA 4G1EA 4GM9A 2P9LC 3RN1D 1QNIA 4GQ2P 4PC0A 1H2YA 4H5IA 1U8CA 1FWXA 2QZPA 1GOGA 2HKMA 5C9ZB 5IJ8E 3IIYA 2H47A 3MKQA 4A09B 2JKXA 3SXTD 2IAAA 1JOFA 4I79A 1E5TA 3O4JA 3F3GA 3F3PA 5M5RA 1GXRA 4CI2A 5TF2A 5IJ7E 3IUQA 2XU7A 4L1MA 3L4OD 3J81g 3OKWA 4ZOVA 2O9KA 2OVPB 2AH0A 2P9PC 2YNNA 4X61B 5HDBA 4E5ZB 1U2VC 3K26A 3DM0A
chains in the Genus database with same CATH topology
1MG3A 3E0CA 3I7LA 4JXMA 4CZYA 3K27A 3CFVA 3EI3B 3JB9L 3MXXA 4JSVC 5GSAA 5TDHB 5HE2B 3B7FA 3UVNA 4J84A 3EI2B 1RI6A 3V9FA 2CNXA 1ERJA 2H6KA 4GMBA 2CN2A 3I7HA 4JT5C 4D6VA 1XKSA 5AJAA 4GQBB 2HXCA 5EM2B 1JMXB 2PBIB 4J87A 4E5ZA 2H13A 4CZXA 5C2VB 4LGNA 4GGAA 4PNKB 2MTAH 3ORVD 3AFCA 5JWZA 3EI3A 4FA5D 4FA4D 2IUQA 4A11B 4D0KA 5A2Qg 2OK6A 2B4EA 4O3TB 5GXIA 3BG1A 4QT8A 3PXTD 3JAMg 3P4FA 3EI2A 2PM7B 2AGYA 5B4WA 3I7PA 3SBQA 3ODTA 4O3UB 3UVKA 5EM2A 5HE3B 4PSWB 3DXMC 3JZGA 4J73A 2P9KC 3IIWA 3IJ1A 3KRWB 3GREA 2GNQA 5FKQA 1MG2A 3OTTA 5AFU3 4A11A 3SFZA 1TBGA 5H1MA 5FKTA 1GP2B 2H9NA 2H6NA 5EAPA 5HYNB 4J8BA 4XEIC 3JRPA 1OLZA 1GOTB 5HE0B 3MMYA 3I8EA 3U4YA 5FQDA 4AOWA 2YB8B 2OVRB 2QC5A 2Z2NA 3OL2A 3RFHA 2IWKA 5HQGA 5CXBB 3FGBA 2OVQB 3PSLA 2QXVA 3I7OA 4XYIA 1R5MA 2G99A 2XL2A 3I89A 4J78A 4QRJA 4ES0A 3DSMA 4Y7RA 2OIZA 4IMMA 1N6FA 2I0RA 4GGCA 1OMWB 5K19A 3I8CA 3NVXA 3EMHA 4A7JA 4HDJA 3N0DA 4O9DA 5H14A 4OWRA 2AQ5A 4LG8A 5CXBA 4X60B 4CZVA 2IUPA 2AGZA 4A0BB 4A08B 4PXWA 3EG6A 5THAA 4A2MA 5IGOA 2GC4A 3RN0D 4FWWA 5C2WB 3EWEA 3FM0A 2IUVA 4QL1A 2HKRA 2I0TA 4L3GD 5GXHA 5K1CC 2H9PA 4GZ8A 3HFQA 4O45A 3UVLA 3DWLC 2PM6B 2G9AA 3A0FA 1P22A 4MK0B 1SHYB 4FB1D 3SN6B 3PXSD 4A0BA 4A08A 3MKSB 3UVOA 5H17A 2W18A 2HESX 4J0XA 1XHMA 3ULEC 2H6QA 2OJYA 2Z2PA 4JSXC 1S4UX 3C5MA 2I3SA 5I5JA 2BCJB 4L9OA 5FXYA 2H14A 4YVDA 4BUJC 4ZOXA 3OKTA 5EARA 4CY3A 4ERYA 2YMUA 5IC7A 4GQ1A 2H3XA 4PSXB 5GMKn 3OL2B 2HYEA 3SHFA 2AH1A 4CY1A 3NVNA 3CFSB 4J82A 5SXMA 1PI6A 2IURA 2P9IC 2I3TA 3RSEC 4AEZA 4FAVD 2CE8A 3L4MD 2BBKH 3IJ0A 2EBSA 4GGDA 3PXWD 4QQEA 5AMSA 4J77A 2CO0A 4N14A 2Q7QA 1B9XA 5EMJB 1B9YA 2UZYB 2XL3A 5CXCB 2TRCB 2GC7A 5FLXg 4FA1D 4K3ID 1VYHC 5FA5B 2H68A 5CYKB 3W15A 1N6EA 3AL8B 3SVWD 4NSXA 4ZN4A 2H9LA 3SWSD 4CY2A 2I0SA 3I7NA 4J0WA 3IJCA 4U7AA 3UKUC 2P9NC 2J57G 3C9CA 5EALA 4G56B 2PM9B 4CI3A 3I2NA 3AL9A 4ERZA 3MZLA 5EMKB 4FHLA 2OK4A 4JT6C 4OZUA 1SQJA 5CXCA 5TEEA 4Z8LA 5I5MA 3ZWLB 2Z2OA 4E54B 3DXKC 4L3HD 2P9SC 5EMMB 5CYKA 2HJ4A 3AL8A 2CN3A 4CI1A 2AGXA 1NR0A 3PVWB 3UR4A 4FA9D 2B5MA 4LG9A 4ERQA 2IWFA 3VH0A 3OKYB 4CC9A 3AH8B 2PM9A 4FAND 1NEXB 1SQ9A 1MDAH 4U1EI 3SLED 4KFMB 4A0AB 4GM8A 3EI4A 3V5WB 3V7DB 5TEFA 4X63B 5KDOB 3SBPA 3C75H 3FRXA 1Q47A 1JJUB 1N6DA 4XYHA 4JD2C 4UI9R 3UVMA 4E54A 3RFGA 4A09A 3PSCB 5EAMA 4ZOYA 3BWSA 2YNPA 1K32A 1L0QA 1PBYB 3VA6A 1PEVA 4O1QD 1GG2B 4PBYA 1YFQA 3JPXA 2H9MA 3OKYA 3I7KA 4ZOZA 4Y5RD 4L1QD 5FKSA 3CIKB 4A0AA 3OW8A 3EI1B 4JSPC 5EMLB 5I5IA 1PGUA 4GM3A 4J8GA 4ESGA 2J56H 3N0EA 2UZXB 3BG0A 3SCYA 2J55H 3F3FA 2P9UC 4CY5A 4R7AB 4JSNC 4BL0A 1JMZB 3JZNA 3PVUB 3RRMC 2AGLA 3RMZD 4J79A 5HE1B 3EU7A 2HJBA 2AGWA 4H5JA 1U4CA 2YNOA 3PE7A 3JZHA 3RLMD 3EI1A 1TYQC 5IT9g 1A0RB 3GFCA 4BH6A 4A2LA 4J81A 4PBZA 3KRXB 3SMRA 2YBAA 3JROA 1K8KC 3UKRC 2B5LA 4X3EA 3VGZA 4J86A 2CE9A 3SJLD 2XYIA 3IKOA 4K3JB 3C99A 5IGQA 2B5NA 2CO0C 4CI8A 4IA9A 4TZ4A 3NVQA 4EWRA 3SBRA 5FKRA 3EI4B 3MZKA 1XIPA 3J80g 4GM9A 2P9LC 3RN1D 1QNIA 4GQ2P 4PC0A 4H5IA 1FWXA 2HKMA 5C9ZB 5IJ8E 3IIYA 2H47A 3MKQA 4A09B 3SXTD 2IAAA 1JOFA 4I79A 3F3GA 3F3PA 1GXRA 4CI2A 5TF2A 5IJ7E 2XU7A 3L4OD 3J81g 3OKWA 4ZOVA 2O9KA 2OVPB 2AH0A 2P9PC 2YNNA 4X61B 4E5ZB 1U2VC 3K26A 3DM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG3 A;  3E0C A;  3I7L A;  4JXM A;  4CZY A;  3K27 A;  3CFV A;  3EI3 B;  3JB9 L;  3MXX A;  4JSV C;  5GSA A;  5TDH B;  5HE2 B;  3B7F A;  3UVN A;  4J84 A;  3EI2 B;  1RI6 A;  3V9F A;  2CNX A;  1ERJ A;  2H6K A;  4GMB A;  2CN2 A;  3I7H A;  4JT5 C;  4D6V A;  1XKS A;  5AJA A;  4GQB B;  2HXC A;  5EM2 B;  1JMX B;  2PBI B;  4J87 A;  4E5Z A;  2H13 A;  4CZX A;  5C2V B;  4LGN A;  4GGA A;  4PNK B;  2MTA H;  3ORV D;  3AFC A;  5JWZ A;  3EI3 A;  4FA5 D;  4FA4 D;  2IUQ A;  4A11 B;  4D0K A;  5A2Q g;  2OK6 A;  2B4E A;  4O3T B;  5GXI A;  3BG1 A;  4QT8 A;  3PXT D;  3JAM g;  3P4F A;  3EI2 A;  2PM7 B;  2AGY A;  5B4W A;  3I7P A;  3SBQ A;  3ODT A;  4O3U B;  3UVK A;  5EM2 A;  5HE3 B;  4PSW B;  3DXM C;  3JZG A;  4J73 A;  2P9K C;  3IIW A;  3IJ1 A;  3KRW B;  3GRE A;  2GNQ A;  5FKQ A;  1MG2 A;  3OTT A;  5AFU 3;  4A11 A;  3SFZ A;  1TBG A;  5H1M A;  5FKT A;  1GP2 B;  2H9N A;  2H6N A;  5EAP A;  5HYN B;  4J8B A;  4XEI C;  3JRP A;  1OLZ A;  1GOT B;  5HE0 B;  3MMY A;  3I8E A;  3U4Y A;  5FQD A;  4AOW A;  2YB8 B;  2OVR B;  2QC5 A;  2Z2N A;  3OL2 A;  3RFH A;  2IWK A;  5HQG A;  5CXB B;  3FGB A;  2OVQ B;  3PSL A;  2QXV A;  3I7O A;  4XYI A;  1R5M A;  2G99 A;  2XL2 A;  3I89 A;  4J78 A;  4QRJ A;  4ES0 A;  3DSM A;  4Y7R A;  2OIZ A;  4IMM A;  1N6F A;  2I0R A;  4GGC A;  1OMW B;  5K19 A;  3I8C A;  3NVX A;  3EMH A;  4A7J A;  4HDJ A;  3N0D A;  4O9D A;  5H14 A;  4OWR A;  2AQ5 A;  4LG8 A;  5CXB A;  4X60 B;  4CZV A;  2IUP A;  2AGZ A;  4A0B B;  4A08 B;  4PXW A;  3EG6 A;  5THA A;  4A2M A;  5IGO A;  2GC4 A;  3RN0 D;  4FWW A;  5C2W B;  3EWE A;  3FM0 A;  2IUV A;  4QL1 A;  2HKR A;  2I0T A;  4L3G D;  5GXH A;  5K1C C;  2H9P A;  4GZ8 A;  3HFQ A;  4O45 A;  3UVL A;  3DWL C;  2PM6 B;  2G9A A;  3A0F A;  1P22 A;  4MK0 B;  1SHY B;  4FB1 D;  3SN6 B;  3PXS D;  4A0B A;  4A08 A;  3MKS B;  3UVO A;  5H17 A;  2W18 A;  2HES X;  4J0X A;  1XHM A;  3ULE C;  2H6Q A;  2OJY A;  2Z2P A;  4JSX C;  1S4U X;  3C5M A;  2I3S A;  5I5J A;  2BCJ B;  4L9O A;  5FXY A;  2H14 A;  4YVD A;  4BUJ C;  4ZOX A;  3OKT A;  5EAR A;  4CY3 A;  4ERY A;  2YMU A;  5IC7 A;  4GQ1 A;  2H3X A;  4PSX B;  5GMK n;  3OL2 B;  2HYE A;  3SHF A;  2AH1 A;  4CY1 A;  3NVN A;  3CFS B;  4J82 A;  5SXM A;  1PI6 A;  2IUR A;  2P9I C;  2I3T A;  3RSE C;  4AEZ A;  4FAV D;  2CE8 A;  3L4M D;  2BBK H;  3IJ0 A;  2EBS A;  4GGD A;  3PXW D;  4QQE A;  5AMS A;  4J77 A;  2CO0 A;  4N14 A;  2Q7Q A;  1B9X A;  5EMJ B;  1B9Y A;  2UZY B;  2XL3 A;  5CXC B;  2TRC B;  2GC7 A;  5FLX g;  4FA1 D;  4K3I D;  1VYH C;  5FA5 B;  2H68 A;  5CYK B;  3W15 A;  1N6E A;  3AL8 B;  3SVW D;  4NSX A;  4ZN4 A;  2H9L A;  3SWS D;  4CY2 A;  2I0S A;  3I7N A;  4J0W A;  3IJC A;  4U7A A;  3UKU C;  2P9N C;  2J57 G;  3C9C A;  5EAL A;  4G56 B;  2PM9 B;  4CI3 A;  3I2N A;  3AL9 A;  4ERZ A;  3MZL A;  5EMK B;  4FHL A;  2OK4 A;  4JT6 C;  4OZU A;  1SQJ A;  5CXC A;  5TEE A;  4Z8L A;  5I5M A;  3ZWL B;  2Z2O A;  4E54 B;  3DXK C;  4L3H D;  2P9S C;  5EMM B;  5CYK A;  2HJ4 A;  3AL8 A;  2CN3 A;  4CI1 A;  2AGX A;  1NR0 A;  3PVW B;  3UR4 A;  4FA9 D;  2B5M A;  4LG9 A;  4ERQ A;  2IWF A;  3VH0 A;  3OKY B;  4CC9 A;  3AH8 B;  2PM9 A;  4FAN D;  1NEX B;  1SQ9 A;  1MDA H;  4U1E I;  3SLE D;  4KFM B;  4A0A B;  4GM8 A;  3EI4 A;  3V5W B;  3V7D B;  5TEF A;  4X63 B;  5KDO B;  3SBP A;  3C75 H;  3FRX A;  1Q47 A;  1JJU B;  1N6D A;  4XYH A;  4JD2 C;  4UI9 R;  3UVM A;  4E54 A;  3RFG A;  4A09 A;  3PSC B;  5EAM A;  4ZOY A;  3BWS A;  2YNP A;  1K32 A;  1L0Q A;  1PBY B;  3VA6 A;  1PEV A;  4O1Q D;  1GG2 B;  4PBY A;  1YFQ A;  3JPX A;  2H9M A;  3OKY A;  3I7K A;  4ZOZ A;  4Y5R D;  4L1Q D;  5FKS A;  3CIK B;  4A0A A;  3OW8 A;  3EI1 B;  4JSP C;  5EML B;  5I5I A;  1PGU A;  4GM3 A;  4J8G A;  4ESG A;  2J56 H;  3N0E A;  2UZX B;  3BG0 A;  3SCY A;  2J55 H;  3F3F A;  2P9U C;  4CY5 A;  4R7A B;  4JSN C;  4BL0 A;  1JMZ B;  3JZN A;  3PVU B;  3RRM C;  2AGL A;  3RMZ D;  4J79 A;  5HE1 B;  3EU7 A;  2HJB A;  2AGW A;  4H5J A;  1U4C A;  2YNO A;  3PE7 A;  3JZH A;  3RLM D;  3EI1 A;  1TYQ C;  5IT9 g;  1A0R B;  3GFC A;  4BH6 A;  4A2L A;  4J81 A;  4PBZ A;  3KRX B;  3SMR A;  2YBA A;  3JRO A;  1K8K C;  3UKR C;  2B5L A;  4X3E A;  3VGZ A;  4J86 A;  2CE9 A;  3SJL D;  2XYI A;  3IKO A;  4K3J B;  3C99 A;  5IGQ A;  2B5N A;  2CO0 C;  4CI8 A;  4IA9 A;  4TZ4 A;  3NVQ A;  4EWR A;  3SBR A;  5FKR A;  3EI4 B;  3MZK A;  1XIP A;  3J80 g;  4GM9 A;  2P9L C;  3RN1 D;  1QNI A;  4GQ2 P;  4PC0 A;  4H5I A;  1FWX A;  2HKM A;  5C9Z B;  5IJ8 E;  3IIY A;  2H47 A;  3MKQ A;  4A09 B;  3SXT D;  2IAA A;  1JOF A;  4I79 A;  3F3G A;  3F3P A;  1GXR A;  4CI2 A;  5TF2 A;  5IJ7 E;  2XU7 A;  3L4O D;  3J81 g;  3OKW A;  4ZOV A;  2O9K A;  2OVP B;  2AH0 A;  2P9P C;  2YNN A;  4X61 B;  4E5Z B;  1U2V C;  3K26 A;  3DM0 A; 
#chains in the Genus database with same CATH topology
 4AMY A;  1MG3 A;  3E0C A;  3I7L A;  3ZDZ A;  4JXM A;  3MVD K;  4CZY A;  1T2X A;  3K27 A;  3CFV A;  3EI3 B;  1UOO A;  3JB9 L;  3MXX A;  4JSV C;  5GSA A;  5TDH B;  5HE2 B;  3B7F A;  3UVN A;  4J84 A;  3EI2 B;  1RI6 A;  3V9F A;  2CNX A;  1ERJ A;  2H6K A;  4GMB A;  2CN2 A;  3I7H A;  4JT5 C;  5FFG A;  1XKS A;  4D6V A;  3DDU A;  2XE4 A;  3EQ9 A;  4WK2 A;  5AJA A;  4GQB B;  2HXC A;  3IUJ A;  4UM9 A;  5EM2 B;  1JMX B;  2PBI B;  4J87 A;  4E5Z A;  2H13 A;  4CZX A;  5C2V B;  4LGN A;  4GGA A;  4PNK B;  2MTA H;  3ORV D;  3AFC A;  5JWZ A;  3EI3 A;  4FA5 D;  4FA4 D;  1L5G A;  2IUQ A;  4A11 B;  4D0K A;  3NIG A;  5A2Q g;  2VC2 A;  2OK6 A;  3ZDY A;  2VDP A;  2B4E A;  4O3T B;  1O6G A;  3BG1 A;  5GXI A;  4QT8 A;  3PXT D;  3JAM g;  3P4F A;  3EI2 A;  2PM7 B;  4AMZ A;  2AGY A;  5B4W A;  1I2M B;  3I7P A;  3T3P A;  3OF7 A;  3SBQ A;  3ODT A;  4O3U B;  3UVK A;  5EM2 A;  4DNW A;  5HE3 B;  4PSW B;  3T3M A;  3DXM C;  3JZG A;  4J73 A;  2P9K C;  3IIW A;  3KCI A;  3IJ1 A;  3KRW B;  3GRE A;  2GNQ A;  5FKQ A;  1MG2 A;  3OTT A;  2VZ3 A;  4BCD A;  5AFU 3;  3NID A;  4A11 A;  3SFZ A;  1TBG A;  5M5S A;  4BCB A;  5H1M A;  3QHY B;  5FKT A;  1GP2 B;  2H9N A;  2H6N A;  5EAP A;  5HYN B;  4J8B A;  4XEI C;  1VE7 A;  3JRP A;  3ZDX A;  1OLZ A;  1GOT B;  3IVM A;  5HE0 B;  3MMY A;  3I8E A;  5M61 A;  3U4Y A;  5FQD A;  4AOW A;  1UOP A;  2YB8 B;  1K3I A;  2OVR B;  4WJK A;  2QC5 A;  2Z2N A;  4NBM A;  3OL2 A;  3RFH A;  2IWK A;  5HQG A;  5CXB B;  3FGB A;  2OVQ B;  3PSL A;  4MMY A;  4NEN A;  2QXV A;  3I7O A;  4XYI A;  1R5M A;  2G99 A;  2XL2 A;  3I89 A;  4J78 A;  4QRJ A;  3QI0 A;  1YR2 A;  4ES0 A;  3DSM A;  5E6S A;  2HU8 A;  4UM8 A;  4Y7R A;  2OIZ A;  1QFM A;  4IMM A;  1N6F A;  2I0R A;  4GGC A;  1OMW B;  1JV2 A;  4Z7O A;  5K19 A;  3I8C A;  3NVX A;  5M5V A;  3EMH A;  4A7J A;  4HDJ A;  3N0D A;  4O9D A;  5H14 A;  4OWR A;  2AQ5 A;  4LG8 A;  4RE5 A;  2HU7 A;  5CXB A;  4X60 B;  4CZV A;  2IUP A;  2AGZ A;  4A0B B;  4A08 B;  4PXW A;  3EG6 A;  1VZ3 A;  4O02 A;  1C9I A;  5THA A;  4A2M A;  5IGO A;  2GC4 A;  3RN0 D;  4FWW A;  5C2W B;  3EWE A;  3FM0 A;  2IUV A;  3EQ8 A;  4QL1 A;  2HKR A;  3VI4 A;  2I0T A;  4L3G D;  5GXH A;  5K1C C;  2H9P A;  4GZ8 A;  3HFQ A;  4O45 A;  2VDK A;  3UVL A;  3IUM A;  3DWL C;  2PM6 B;  2G9A A;  3A0F A;  1VE6 A;  1P22 A;  4MK0 B;  1SHY B;  4FB1 D;  1TYE A;  3SN6 B;  3PXS D;  4A0B A;  4A08 A;  3MKS B;  4RE6 A;  3UVO A;  5H17 A;  2W18 A;  2HES X;  4J0X A;  5E6U A;  1XHM A;  3ULE C;  2H6Q A;  2OJY A;  2Z2P A;  3O4H A;  4JSX C;  1S4U X;  3C5M A;  2I3S A;  5I5J A;  2BCJ B;  4L9O A;  3K6S A;  5FXY A;  2H14 A;  4YVD A;  4BUJ C;  1UTC A;  3OKT A;  4ZOX A;  5EAR A;  4CY3 A;  1H2Z A;  2YMU A;  4ERY A;  2VDR A;  5IC7 A;  3ZE1 A;  4GQ1 A;  2H3X A;  4JHP C;  4PSX B;  5GMK n;  3OL2 B;  2HYE A;  3SHF A;  2AH1 A;  4CY1 A;  3NVN A;  1E8N A;  4QAM A;  3CFS B;  4J82 A;  5SXM A;  2VDQ A;  1PI6 A;  1UOQ A;  2IUR A;  3FCS A;  2EIE A;  2P9I C;  2HU5 A;  4NAA A;  2I3T A;  3RSE C;  4AEZ A;  4FAV D;  2CE8 A;  3L4M D;  2BBK H;  3IJ0 A;  3V4P A;  2EBS A;  3IUR A;  4Z7Q A;  4GGD A;  3PXW D;  4QQE A;  4DNV A;  5AMS A;  4J77 A;  2EID A;  2CO0 A;  4N14 A;  2VZ1 A;  5FFO A;  2Q7Q A;  4AX4 A;  1B9X A;  5EMJ B;  1B9Y A;  2UZY B;  4AN1 A;  2XL3 A;  5CXC B;  2TRC B;  4MMZ A;  4DNU A;  4G55 A;  2BKL A;  2GC7 A;  5FLX g;  4FA1 D;  4NC4 A;  4K3I D;  3O4G A;  1VYH C;  5FA5 B;  2H68 A;  5CYK B;  3W15 A;  1N6E A;  3AL8 B;  3SVW D;  4NSX A;  4ZN4 A;  2H9L A;  3SWS D;  4CY2 A;  2I0S A;  1O6F A;  3I7N A;  3K72 A;  4J0W A;  3IJC A;  4U7A A;  5E6R A;  3UKU C;  2P9N C;  2J57 G;  3C9C A;  2WQ8 A;  5EAL A;  4G56 B;  4D9S A;  5C86 A;  4JHN A;  3IUN A;  2PM9 B;  4CI3 A;  3I2N A;  3AL9 A;  4ERZ A;  3MZL A;  5EMK B;  3ZE0 A;  4FHL A;  2OK4 A;  4JT6 C;  4OZU A;  1SQJ A;  2EIC A;  2VDO A;  5CXC A;  5TEE A;  4Z8L A;  5I5M A;  4BP9 A;  3ZWL B;  2Z2O A;  4E54 B;  3DXK C;  4L3H D;  2P9S C;  3IJE A;  4WK4 A;  5EMM B;  5CYK A;  2HJ4 A;  3AL8 A;  2CN3 A;  4BCC A;  4CI1 A;  4BP8 A;  2AGX A;  1NR0 A;  3PVW B;  3UR4 A;  1C9L A;  4FA9 D;  3GD1 I;  2B5M A;  1JTD B;  4LG9 A;  4ERQ A;  2IWF A;  3VH0 A;  3OKY B;  3MUN A;  3O4I A;  3AH8 B;  4CC9 A;  2PM9 A;  4G1M A;  4FAN D;  1NEX B;  1SQ9 A;  1MDA H;  4U1E I;  3SLE D;  4KFM B;  4A0A B;  4GM8 A;  3EI4 A;  3V5W B;  4O2W A;  3V7D B;  3VI3 A;  2VDN A;  5TEF A;  4X63 B;  5KDO B;  3SBP A;  3C75 H;  3FRX A;  1Q47 A;  1JJU B;  1N6D A;  4XYH A;  5C92 A;  4JD2 C;  4UI9 R;  3UVM A;  4E54 A;  1A12 A;  3RFG A;  3IUL A;  4A09 A;  3PSC B;  5EAM A;  4ZOY A;  3BWS A;  4Z7N A;  2YNP A;  1K32 A;  1L0Q A;  2XDW A;  1PBY B;  3VA6 A;  1PEV A;  4O1Q D;  1GG2 B;  4PBY A;  1YFQ A;  3JPX A;  2H9M A;  3OKY A;  3I7K A;  3GC3 B;  4ZOZ A;  4Y5R D;  1E8M A;  4IRZ A;  4L1Q D;  5FKS A;  1H2W A;  3CIK B;  4A0A A;  3OW8 A;  3EI1 B;  4JSP C;  5EML B;  5I5I A;  1H2X A;  1PGU A;  4GM3 A;  4J8G A;  3ZE2 A;  4ESG A;  2J56 H;  3N0E A;  2UZX B;  3BG0 A;  3SCY A;  2J55 H;  1BPO A;  3F3F A;  2P9U C;  4CY5 A;  2QR5 A;  4R7A B;  4JSN C;  4BL0 A;  5M5U A;  1JMZ B;  3JZN A;  3PVU B;  3RRM C;  2AGL A;  3RMZ D;  4J79 A;  5HE1 B;  1GOH A;  3EU7 A;  2HJB A;  2XZG A;  2AGW A;  4H5J A;  1U4C A;  2YNO A;  3PE7 A;  5M5T A;  3V4V A;  2EIB A;  3JZH A;  3RLM D;  3EI1 A;  4AN0 A;  1TYQ C;  3NIF A;  1VZ2 A;  5IT9 g;  4WK0 A;  1A0R B;  3GFC A;  3FCU A;  4BH6 A;  2VDL A;  3K71 A;  4A2L A;  4J81 A;  4PBZ A;  3KRX B;  4MMX A;  3SMR A;  3EQ7 A;  2YBA A;  3JRO A;  1K8K C;  3UKR C;  2B5L A;  4X3E A;  3VGZ A;  4J86 A;  2CE9 A;  3SJL D;  2XYI A;  3IKO A;  3MUO A;  4K3J B;  3C99 A;  5IGQ A;  2B5N A;  1M1X A;  2CO0 C;  4CI8 A;  4IA9 A;  4TZ4 A;  3NVQ A;  4EWR A;  3SBR A;  5FKR A;  2VDM A;  3EI4 B;  3MZK A;  1QFS A;  1XIP A;  3J80 g;  1GOF A;  4G1E A;  4GM9 A;  2P9L C;  3RN1 D;  1QNI A;  4GQ2 P;  4PC0 A;  1H2Y A;  4H5I A;  1U8C A;  1FWX A;  2QZP A;  1GOG A;  2HKM A;  5C9Z B;  5IJ8 E;  3IIY A;  2H47 A;  3MKQ A;  4A09 B;  2JKX A;  3SXT D;  2IAA A;  1JOF A;  4I79 A;  1E5T A;  3O4J A;  3F3G A;  3F3P A;  5M5R A;  1GXR A;  4CI2 A;  5TF2 A;  5IJ7 E;  3IUQ A;  2XU7 A;  4L1M A;  3L4O D;  3J81 g;  3OKW A;  4ZOV A;  2O9K A;  2OVP B;  2AH0 A;  2P9P C;  2YNN A;  4X61 B;  5HDB A;  4E5Z B;  1U2V C;  3K26 A;  3DM0 A; 
#chains in the Genus database with same CATH homology
 1MG3 A;  3E0C A;  3I7L A;  4JXM A;  4CZY A;  3K27 A;  3CFV A;  3EI3 B;  3JB9 L;  3MXX A;  4JSV C;  5GSA A;  5TDH B;  5HE2 B;  3B7F A;  3UVN A;  4J84 A;  3EI2 B;  1RI6 A;  3V9F A;  2CNX A;  1ERJ A;  2H6K A;  4GMB A;  2CN2 A;  3I7H A;  4JT5 C;  4D6V A;  1XKS A;  5AJA A;  4GQB B;  2HXC A;  5EM2 B;  1JMX B;  2PBI B;  4J87 A;  4E5Z A;  2H13 A;  4CZX A;  5C2V B;  4LGN A;  4GGA A;  4PNK B;  2MTA H;  3ORV D;  3AFC A;  5JWZ A;  3EI3 A;  4FA5 D;  4FA4 D;  2IUQ A;  4A11 B;  4D0K A;  5A2Q g;  2OK6 A;  2B4E A;  4O3T B;  5GXI A;  3BG1 A;  4QT8 A;  3PXT D;  3JAM g;  3P4F A;  3EI2 A;  2PM7 B;  2AGY A;  5B4W A;  3I7P A;  3SBQ A;  3ODT A;  4O3U B;  3UVK A;  5EM2 A;  5HE3 B;  4PSW B;  3DXM C;  3JZG A;  4J73 A;  2P9K C;  3IIW A;  3IJ1 A;  3KRW B;  3GRE A;  2GNQ A;  5FKQ A;  1MG2 A;  3OTT A;  5AFU 3;  4A11 A;  3SFZ A;  1TBG A;  5H1M A;  5FKT A;  1GP2 B;  2H9N A;  2H6N A;  5EAP A;  5HYN B;  4J8B A;  4XEI C;  3JRP A;  1OLZ A;  1GOT B;  5HE0 B;  3MMY A;  3I8E A;  3U4Y A;  5FQD A;  4AOW A;  2YB8 B;  2OVR B;  2QC5 A;  2Z2N A;  3OL2 A;  3RFH A;  2IWK A;  5HQG A;  5CXB B;  3FGB A;  2OVQ B;  3PSL A;  2QXV A;  3I7O A;  4XYI A;  1R5M A;  2G99 A;  2XL2 A;  3I89 A;  4J78 A;  4QRJ A;  4ES0 A;  3DSM A;  4Y7R A;  2OIZ A;  4IMM A;  1N6F A;  2I0R A;  4GGC A;  1OMW B;  5K19 A;  3I8C A;  3NVX A;  3EMH A;  4A7J A;  4HDJ A;  3N0D A;  4O9D A;  5H14 A;  4OWR A;  2AQ5 A;  4LG8 A;  5CXB A;  4X60 B;  4CZV A;  2IUP A;  2AGZ A;  4A0B B;  4A08 B;  4PXW A;  3EG6 A;  5THA A;  4A2M A;  5IGO A;  2GC4 A;  3RN0 D;  4FWW A;  5C2W B;  3EWE A;  3FM0 A;  2IUV A;  4QL1 A;  2HKR A;  2I0T A;  4L3G D;  5GXH A;  5K1C C;  2H9P A;  4GZ8 A;  3HFQ A;  4O45 A;  3UVL A;  3DWL C;  2PM6 B;  2G9A A;  3A0F A;  1P22 A;  4MK0 B;  1SHY B;  4FB1 D;  3SN6 B;  3PXS D;  4A0B A;  4A08 A;  3MKS B;  3UVO A;  5H17 A;  2W18 A;  2HES X;  4J0X A;  1XHM A;  3ULE C;  2H6Q A;  2OJY A;  2Z2P A;  4JSX C;  1S4U X;  3C5M A;  2I3S A;  5I5J A;  2BCJ B;  4L9O A;  5FXY A;  2H14 A;  4YVD A;  4BUJ C;  4ZOX A;  3OKT A;  5EAR A;  4CY3 A;  4ERY A;  2YMU A;  5IC7 A;  4GQ1 A;  2H3X A;  4PSX B;  5GMK n;  3OL2 B;  2HYE A;  3SHF A;  2AH1 A;  4CY1 A;  3NVN A;  3CFS B;  4J82 A;  5SXM A;  1PI6 A;  2IUR A;  2P9I C;  2I3T A;  3RSE C;  4AEZ A;  4FAV D;  2CE8 A;  3L4M D;  2BBK H;  3IJ0 A;  2EBS A;  4GGD A;  3PXW D;  4QQE A;  5AMS A;  4J77 A;  2CO0 A;  4N14 A;  2Q7Q A;  1B9X A;  5EMJ B;  1B9Y A;  2UZY B;  2XL3 A;  5CXC B;  2TRC B;  2GC7 A;  5FLX g;  4FA1 D;  4K3I D;  1VYH C;  5FA5 B;  2H68 A;  5CYK B;  3W15 A;  1N6E A;  3AL8 B;  3SVW D;  4NSX A;  4ZN4 A;  2H9L A;  3SWS D;  4CY2 A;  2I0S A;  3I7N A;  4J0W A;  3IJC A;  4U7A A;  3UKU C;  2P9N C;  2J57 G;  3C9C A;  5EAL A;  4G56 B;  2PM9 B;  4CI3 A;  3I2N A;  3AL9 A;  4ERZ A;  3MZL A;  5EMK B;  4FHL A;  2OK4 A;  4JT6 C;  4OZU A;  1SQJ A;  5CXC A;  5TEE A;  4Z8L A;  5I5M A;  3ZWL B;  2Z2O A;  4E54 B;  3DXK C;  4L3H D;  2P9S C;  5EMM B;  5CYK A;  2HJ4 A;  3AL8 A;  2CN3 A;  4CI1 A;  2AGX A;  1NR0 A;  3PVW B;  3UR4 A;  4FA9 D;  2B5M A;  4LG9 A;  4ERQ A;  2IWF A;  3VH0 A;  3OKY B;  4CC9 A;  3AH8 B;  2PM9 A;  4FAN D;  1NEX B;  1SQ9 A;  1MDA H;  4U1E I;  3SLE D;  4KFM B;  4A0A B;  4GM8 A;  3EI4 A;  3V5W B;  3V7D B;  5TEF A;  4X63 B;  5KDO B;  3SBP A;  3C75 H;  3FRX A;  1Q47 A;  1JJU B;  1N6D A;  4XYH A;  4JD2 C;  4UI9 R;  3UVM A;  4E54 A;  3RFG A;  4A09 A;  3PSC B;  5EAM A;  4ZOY A;  3BWS A;  2YNP A;  1K32 A;  1L0Q A;  1PBY B;  3VA6 A;  1PEV A;  4O1Q D;  1GG2 B;  4PBY A;  1YFQ A;  3JPX A;  2H9M A;  3OKY A;  3I7K A;  4ZOZ A;  4Y5R D;  4L1Q D;  5FKS A;  3CIK B;  4A0A A;  3OW8 A;  3EI1 B;  4JSP C;  5EML B;  5I5I A;  1PGU A;  4GM3 A;  4J8G A;  4ESG A;  2J56 H;  3N0E A;  2UZX B;  3BG0 A;  3SCY A;  2J55 H;  3F3F A;  2P9U C;  4CY5 A;  4R7A B;  4JSN C;  4BL0 A;  1JMZ B;  3JZN A;  3PVU B;  3RRM C;  2AGL A;  3RMZ D;  4J79 A;  5HE1 B;  3EU7 A;  2HJB A;  2AGW A;  4H5J A;  1U4C A;  2YNO A;  3PE7 A;  3JZH A;  3RLM D;  3EI1 A;  1TYQ C;  5IT9 g;  1A0R B;  3GFC A;  4BH6 A;  4A2L A;  4J81 A;  4PBZ A;  3KRX B;  3SMR A;  2YBA A;  3JRO A;  1K8K C;  3UKR C;  2B5L A;  4X3E A;  3VGZ A;  4J86 A;  2CE9 A;  3SJL D;  2XYI A;  3IKO A;  4K3J B;  3C99 A;  5IGQ A;  2B5N A;  2CO0 C;  4CI8 A;  4IA9 A;  4TZ4 A;  3NVQ A;  4EWR A;  3SBR A;  5FKR A;  3EI4 B;  3MZK A;  1XIP A;  3J80 g;  4GM9 A;  2P9L C;  3RN1 D;  1QNI A;  4GQ2 P;  4PC0 A;  4H5I A;  1FWX A;  2HKM A;  5C9Z B;  5IJ8 E;  3IIY A;  2H47 A;  3MKQ A;  4A09 B;  3SXT D;  2IAA A;  1JOF A;  4I79 A;  3F3G A;  3F3P A;  1GXR A;  4CI2 A;  5TF2 A;  5IJ7 E;  2XU7 A;  3L4O D;  3J81 g;  3OKW A;  4ZOV A;  2O9K A;  2OVP B;  2AH0 A;  2P9P C;  2YNN A;  4X61 B;  4E5Z B;  1U2V C;  3K26 A;  3DM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...