5KDOB

Heterotrimeric complex of the 4 alanine insertion variant of the gi alpha1 subunit and the gbeta1-ggamma1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
339
structure length
335
Chain Sequence
b'SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1
publication title A Conserved Hydrophobic Core in G alpha i1 Regulates G Protein Activation and Release from Activated Receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 110
structure length 335
sequence length 339
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5kdoB00
4GM9A 1MDAH 2YMUA 3I7PA 4PNKB 4FA4D 3C9CA 3PE7A 4FHLA 4FA1D 4CI2A 3V5WB 4U1EI 4JT6C 1RI6A 5HE0B 2Z2PA 2H14A 5H17A 2CO0A 4PBZA 2HKMA 5FKSA 2MTAH 3V9FA 4FA9D 3UR4A 2CN3A 2XYIA 4L9OA 5A2Qg 4CY3A 3SLED 3HFQA 5HE3B 4IA9A 3RMZD 2CO0C 4QL1A 3JAMg 1PGUA 2CE9A 4QRJA 3E0CA 2OK4A 3KRWB 5TEEA 5GXHA 2I0TA 3SXTD 1JOFA 2AH1A 4A09B 5TDHB 2OVPB 2QC5A 3I8CA 1NEXB 3K26A 3UKRC 3OKWA 3SFZA 2CN2A 3EU7A 3JZHA 2IWKA 2XU7A 3CFSB 4XYHA 3OW8A 4J73A 3I7KA 3AH8B 4ERQA 2P9KC 4A2MA 4PBYA 3SHFA 3ULEC 3EI4A 1TBGA 3EI4B 2B4EA 1XHMA 3PVWB 3V7DB 2OVRB 4A2LA 3EI2B 3I7LA 4CI1A 5I5IA 5IJ8E 4GM3A 4K3ID 4H5IA 5GMKn 3JZGA 4AEZA 2UZYB 5B4WA 4J78A 4ERZA 4A0AA 2IAAA 3UVLA 4G56B 1SQJA 4J8BA 4J82A 5IJ7E 3NVXA 3L4OD 3IJ1A 4E5ZB 4LG9A 5HQGA 4CI3A 2YBAA 3GFCA 3FM0A 2PM7B 2HYEA 3EI3A 3I7OA 4EWRA 3DXMC 3EI3B 4U7AA 3OTTA 4J84A 4J87A 4JSXC 4QT8A 4Y5RD 2P9IC 2J55H 5HYNB 5SXMA 5H14A 3PXSD 4ES0A 3CIKB 5FKTA 5IC7A 3OL2B 4R7AB 1XIPA 3RN0D 1YFQA 5AJAA 3C5MA 3K27A 4IMMA 5C2VB 3AFCA 4A7JA 4J86A 5IGOA 4O3TB 4X61B 1K8KC 3MKSB 2H9NA 1VYHC 4GGAA 2HJBA 2QXVA 4JXMA 3J81g 1L0QA 4JT5C 4OWRA 3AL8B 3MMYA 5FA5B 4BL0A 5FLXg 2OIZA 2UZXB 2AQ5A 2TRCB 2PBIB 4YVDA 3B7FA 4CY2A 2PM9A 5TEFA 5EAMA 3NVQA 2PM9B 2IUPA 4TZ4A 3PXTD 4Z8LA 2B5NA 4A08B 5C9ZB 4L3GD 2HESX 2I0RA 2J57G 1SHYB 5AFU3 5EMJB 2YB8B 1GOTB 2GNQA 4XEIC 5EMKB 3OKTA 3U4YA 3IIYA 5K19A 3JB9L 5CYKA 1K32A 1NR0A 5CYKB 2P9LC 1FWXA 4A09A 4MK0B 3MKQA 3FGBA 2B5MA 5KDOB 1PEVA 1B9XA 5EMMB 2AGLA 2YNPA 3DWLC 3ORVD 3A0FA 4J77A 3IIWA 5GSAA 4PSXB 3DM0A 4H5JA 5TF2A 2GC7A 4X63B 2P9NC 2HKRA 3RRMC 4ZOVA 3MZLA 2OK6A 2H6KA 3RN1D 3UKUC 3RLMD 3EI2A 5CXBB 3SBQA 3IKOA 4NSXA 5GXIA 4J0WA 5FQDA 4K3JB 5FKRA 5CXCB 5I5JA 2H3XA 2O9KA 3C75H 4JSNC 3UVKA 3I2NA 2AGXA 1GP2B 2PM6B 4GQBB 4E5ZA 1U4CA 4ZOYA 5C2WB 4PSWB 4PC0A 2G9AA 3UVMA 2P9SC 3IJCA 2P9PC 3ZWLB 4UI9R 4JSPC 4CC9A 4BH6A 4GM8A 3I89A 2Q7QA 5FKQA 4I79A 1SQ9A 4D6VA 3PVUB 2AH0A 3I8EA 5EARA 1P22A 1GXRA 2W18A 4L3HD 3MZKA 2Z2OA 4J0XA 3FRXA 3OL2A 2IUVA 1S4UX 5IGQA 4O9DA 4N14A 3W15A 2H47A 4CZYA 3UVNA 4KFMB 3EG6A 1JMZB 2HXCA 3RSEC 2H6NA 3KRXB 2I3TA 4O3UB 3NVNA 3SN6B 5FXYA 4X3EA 4HDJA 3EI1B 3AL8A 3SBPA 3F3GA 3SBRA 4BUJC 1N6FA 2J56H 5H1MA 1MG2A 3JRPA 3AL9A 3UVOA 4CY5A 3VGZA 4ZN4A 1OLZA 4AOWA 1GG2B 4A08A 5THAA 2H9MA 2H9LA 1ERJA 1U2VC 5HE1B 3C99A 4FWWA 4J8GA 5K1CC 3EMHA 3SWSD 4J79A 4X60B 1B9YA 1QNIA 1A0RB 2HJ4A 3P4FA 4ZOXA 4JSVC 4ESGA 3EWEA 4GZ8A 1N6EA 5JWZA 3BG0A 2IWFA 3GREA 4ZOZA 2I0SA 4A0BA 4O1QD 4GMBA 4GQ2P 4CY1A 4A0BB 2AGWA 2H68A 4XYIA 3RFHA 1MG3A 3VA6A 4FA5D 2XL2A 5HE2B 2H13A 4QQEA 5EMLB 2OVQB 2CE8A 2G99A 4D0KA 2H6QA 4O45A 5CXBA 3N0EA 2AGYA 3JZNA 4L1QD 2YNNA 1OMWB 3CFVA 5CXCA 3PXWD 3F3PA 4LG8A 2IURA 1PBYB 3DXKC 3MXXA 4GGCA 3N0DA 3PSLA 3F3FA 4CZVA 4CI8A 3J80g 3ODTA 2BBKH 2AGZA 4Y7RA 4E54A 4E54B 2Z2NA 2YNOA 3BG1A 4A0AB 1PI6A 2OJYA 3DSMA 3BWSA 3RFGA 4GGDA 4FAND 3JROA 1XKSA 2EBSA 5IT9g 1JJUB 4J81A 4LGNA 2CNXA 3SVWD 2H9PA 3SCYA 2IUQA 4JD2C 3I7NA 3JPXA 3OKYA 4PXWA 3OKYB 4GQ1A 3EI1A 4A11A 3VH0A 5EALA 4FB1D 1R5MA 4A11B 3I7HA 1TYQC 3SJLD 1JMXB 2B5LA 4CZXA 2P9UC 5I5MA 2GC4A 2BCJB 5AMSA 3IJ0A 4FAVD 5EAPA 1N6DA 3SMRA 5EM2A 2I3SA 4ERYA 3L4MD 5EM2B 2XL3A 3PSCB 4OZUA 1Q47A
chains in the Genus database with same CATH superfamily
4GM9A 1MDAH 2YMUA 3I7PA 2XE4A 4PNKB 4FA4D 3C9CA 3PE7A 1VZ3A 4FHLA 4FA1D 4CI2A 3V5WB 1QFSA 4IRZA 4U1EI 3FCSA 4JT6C 1RI6A 5HE0B 2XZGA 2Z2PA 2H14A 5H17A 2CO0A 3K6SA 4PBZA 2HKMA 5FKSA 2MTAH 3V9FA 4FA9D 3UR4A 2CN3A 2XYIA 4L9OA 5A2Qg 4CY3A 3SLED 5M5VA 3HFQA 2HU8A 5M5UA 2VDPA 5HE3B 4IA9A 4DNUA 3RMZD 4MMXA 2CO0C 4QL1A 3JAMg 1PGUA 2CE9A 4QRJA 3E0CA 2OK4A 3KRWB 5TEEA 1U8CA 5GXHA 2I0TA 3SXTD 1JOFA 2AH1A 4A09B 1UOQA 5TDHB 2EIEA 2OVPB 2QC5A 3I8CA 1NEXB 3NIDA 3K26A 3UKRC 3OKWA 3SFZA 2CN2A 3EU7A 3JZHA 2IWKA 2XU7A 3CFSB 4XYHA 4NC4A 3IUMA 3OW8A 4J73A 3I7KA 3OF7A 3AH8B 4ERQA 1UTCA 2P9KC 4A2MA 4PBYA 1O6FA 3SHFA 3ULEC 3EI4A 1TBGA 3O4GA 2WQ8A 3EI4B 2B4EA 1XHMA 3PVWB 3V7DB 2VZ1A 4DNWA 2OVRB 2EIBA 4A2LA 3EI2B 1H2YA 2VDOA 3I7LA 4CI1A 5I5IA 5IJ8E 5M5SA 4GM3A 4K3ID 4WK0A 4Z7OA 1H2WA 4H5IA 3V4PA 5GMKn 3O4HA 3JZGA 4AEZA 2UZYB 5B4WA 4J78A 4ERZA 4A0AA 2IAAA 4RE6A 3UVLA 4G56B 4WK2A 1SQJA 4J8BA 4J82A 5IJ7E 3NVXA 4Z7QA 3L4OD 3IJ1A 5E6RA 4E5ZB 4LG9A 5HQGA 4CI3A 2YBAA 3GFCA 3FM0A 2PM7B 2HYEA 3EI3A 3I7OA 4EWRA 3DXMC 3EI3B 4U7AA 3T3PA 2VDQA 3OTTA 4J84A 4J87A 3IULA 4JSXC 4QT8A 4Y5RD 2P9IC 1UOPA 2J55H 1GOFA 5HYNB 1VE6A 5SXMA 5H14A 1O6GA 3ZDZA 3PXSD 4ES0A 3CIKB 5FKTA 5IC7A 3OL2B 4R7AB 1VZ2A 1XIPA 1H2ZA 3RN0D 1YFQA 3NIGA 5AJAA 4AMYA 3C5MA 3K27A 4IMMA 5C2VB 3AFCA 4A7JA 4J86A 5IGOA 4O3TB 4X61B 1K8KC 3MKSB 2H9NA 1VYHC 4GGAA 2HJBA 2QXVA 4JXMA 3J81g 2VDRA 1L0QA 4JT5C 4OWRA 3AL8B 3MMYA 5FA5B 3ZDXA 4BL0A 5FLXg 2OIZA 2UZXB 3MUOA 4G55A 2AQ5A 2TRCB 2PBIB 4YVDA 3B7FA 4CY2A 2PM9A 1T2XA 5TEFA 5EAMA 3FCUA 3NVQA 2PM9B 2IUPA 4TZ4A 3PXTD 4Z8LA 2B5NA 4A08B 5C9ZB 4L3GD 1H2XA 2HESX 2I0RA 2J57G 1SHYB 4QAMA 4BCDA 5EMJB 2YB8B 1GOTB 5AFU3 5E6SA 2GNQA 4UM8A 4XEIC 5EMKB 3OKTA 3U4YA 3IIYA 4NENA 5K19A 3JB9L 5CYKA 1K32A 1NR0A 5CYKB 2P9LC 1FWXA 4A09A 4G1MA 4MK0B 3MKQA 3FGBA 2B5MA 5KDOB 3MUNA 1E8MA 4BP8A 1PEVA 1B9XA 5EMMB 4WJKA 2AGLA 2YNPA 3DWLC 3ORVD 3A0FA 4JHPC 2QR5A 4J77A 3IIWA 5GSAA 4PSXB 3DM0A 4H5JA 4BP9A 5TF2A 2GC7A 4X63B 2BKLA 2P9NC 3GD1I 2VDNA 2HKRA 3RRMC 1C9LA 4ZOVA 1VE7A 2XDWA 3MZLA 2OK6A 3K72A 3MVDK 2H6KA 3RN1D 3UKUC 3RLMD 3ZE0A 3EI2A 5CXBB 3SBQA 3IKOA 3V4VA 4NSXA 5GXIA 4J0WA 5FQDA 4K3JB 5FKRA 5CXCB 2HU7A 5I5JA 2H3XA 2O9KA 3EQ7A 1GOGA 3C75H 4JSNC 3UVKA 3I2NA 2AGXA 1GP2B 2PM6B 4GQBB 4E5ZA 1U4CA 4ZOYA 5C2WB 3EQ9A 4PSWB 4PC0A 2G9AA 3UVMA 4DNVA 2P9SC 3ZE1A 4BCCA 4O2WA 3VI4A 4WK4A 1M1XA 3IJCA 2P9PC 4MMZA 3ZWLB 4UI9R 4JSPC 4CC9A 4BH6A 4GM8A 3I89A 2Q7QA 5FKQA 3IVMA 1SQ9A 4I79A 3PVUB 2AH0A 3I8EA 3IUJA 5EARA 1P22A 4D6VA 1GXRA 2W18A 4L3HD 3MZKA 2Z2OA 4J0XA 3GC3B 3FRXA 3OL2A 4AN0A 2IUVA 3T3MA 1S4UX 4AMZA 2VZ3A 5IGQA 1UOOA 4O9DA 4N14A 3W15A 2H47A 4CZYA 5C86A 3UVNA 4KFMB 3EG6A 5HDBA 4JHNA 1JMZB 2HXCA 3RSEC 2H6NA 3KRXB 2I3TA 4O3UB 3NVNA 3SN6B 5FXYA 5FFGA 4X3EA 5M61A 4HDJA 3EI1B 2VDMA 3AL8A 3SBPA 3F3GA 4BCBA 3O4IA 3SBRA 1E5TA 4BUJC 1N6FA 2J56H 3O4JA 2EIDA 5H1MA 1MG2A 3JRPA 3AL9A 3UVOA 4CY5A 2VDLA 3VGZA 4ZN4A 1OLZA 4AOWA 1GG2B 4A08A 5E6UA 5THAA 3QI0A 4MMYA 2H9MA 2H9LA 1ERJA 1U2VC 5HE1B 3C99A 4FWWA 4J8GA 5K1CC 3EMHA 3SWSD 5C92A 4J79A 4X60B 1B9YA 4L1MA 1QNIA 1A0RB 2HJ4A 3P4FA 4ZOXA 4JSVC 4ESGA 1C9IA 3EWEA 4GZ8A 4G1EA 1N6EA 5JWZA 4O02A 3BG0A 2IWFA 3GREA 4ZOZA 3ZDYA 2I0SA 4A0BA 5FFOA 4GMBA 4O1QD 4GQ2P 4CY1A 4A0BB 2AGWA 2H68A 4XYIA 3RFHA 1MG3A 3VA6A 4FA5D 2XL2A 5HE2B 5M5RA 1L5GA 2H13A 3DDUA 1A12A 4QQEA 5EMLB 2OVQB 2CE8A 1BPOA 2G99A 4D0KA 2H6QA 4O45A 2VDKA 3KCIA 5CXBA 3IUNA 4D9SA 3N0EA 2AGYA 3JZNA 1I2MB 4AN1A 4L1QD 2YNNA 1OMWB 3CFVA 5CXCA 3PXWD 3EQ8A 3F3PA 4LG8A 2IURA 1PBYB 3DXKC 3MXXA 4GGCA 4NBMA 3N0DA 3PSLA 3F3FA 4CZVA 4CI8A 3J80g 3IURA 3ODTA 1YR2A 2BBKH 3IJEA 2AGZA 4Y7RA 2EICA 4AX4A 4Z7NA 4E54A 4E54B 3NIFA 2HU5A 2Z2NA 2YNOA 3BG1A 4A0AB 1PI6A 4NAAA 3ZE2A 2VC2A 1K3IA 2OJYA 3DSMA 3BWSA 3RFGA 4GGDA 4FAND 3JROA 1XKSA 1TYEA 2EBSA 5IT9g 3IUQA 1JJUB 3VI3A 4J81A 4UM9A 2JKXA 4LGNA 2QZPA 2CNXA 1JTDB 3SVWD 2H9PA 3SCYA 1E8NA 2IUQA 4JD2C 3I7NA 3JPXA 3OKYA 4PXWA 3OKYB 4GQ1A 3EI1A 4A11A 3VH0A 5EALA 4FB1D 1R5MA 4A11B 3I7HA 3K71A 1QFMA 1JV2A 1TYQC 4RE5A 3SJLD 1JMXB 2B5LA 4CZXA 5M5TA 2P9UC 3QHYB 2GC4A 5I5MA 2BCJB 5AMSA 3IJ0A 4FAVD 5EAPA 1N6DA 3SMRA 5EM2A 2I3SA 4ERYA 1GOHA 3L4MD 5EM2B 2XL3A 3PSCB 4OZUA 1Q47A
chains in the Genus database with same CATH topology
4GM9A 1MDAH 2YMUA 3I7PA 4PNKB 4FA4D 3C9CA 3PE7A 4FHLA 4FA1D 4CI2A 3V5WB 4U1EI 4JT6C 1RI6A 5HE0B 2Z2PA 2H14A 5H17A 2CO0A 4PBZA 2HKMA 5FKSA 2MTAH 3V9FA 4FA9D 3UR4A 2CN3A 2XYIA 4L9OA 5A2Qg 4CY3A 3SLED 3HFQA 5HE3B 4IA9A 3RMZD 2CO0C 4QL1A 3JAMg 1PGUA 2CE9A 4QRJA 3E0CA 2OK4A 3KRWB 5TEEA 5GXHA 2I0TA 3SXTD 1JOFA 2AH1A 4A09B 5TDHB 2OVPB 2QC5A 3I8CA 1NEXB 3K26A 3UKRC 3OKWA 3SFZA 2CN2A 3EU7A 3JZHA 2IWKA 2XU7A 3CFSB 4XYHA 3OW8A 4J73A 3I7KA 3AH8B 4ERQA 2P9KC 4A2MA 4PBYA 3SHFA 3ULEC 3EI4A 1TBGA 3EI4B 2B4EA 1XHMA 3PVWB 3V7DB 2OVRB 4A2LA 3EI2B 3I7LA 4CI1A 5I5IA 5IJ8E 4GM3A 4K3ID 4H5IA 5GMKn 3JZGA 4AEZA 2UZYB 5B4WA 4J78A 4ERZA 4A0AA 2IAAA 3UVLA 4G56B 1SQJA 4J8BA 4J82A 5IJ7E 3NVXA 3L4OD 3IJ1A 4E5ZB 4LG9A 5HQGA 4CI3A 2YBAA 3GFCA 3FM0A 2PM7B 2HYEA 3EI3A 3I7OA 4EWRA 3DXMC 3EI3B 4U7AA 3OTTA 4J84A 4J87A 4JSXC 4QT8A 4Y5RD 2P9IC 2J55H 5HYNB 5SXMA 5H14A 3PXSD 4ES0A 3CIKB 5FKTA 5IC7A 3OL2B 4R7AB 1XIPA 3RN0D 1YFQA 5AJAA 3C5MA 3K27A 4IMMA 5C2VB 3AFCA 4A7JA 4J86A 5IGOA 4O3TB 4X61B 1K8KC 3MKSB 2H9NA 1VYHC 4GGAA 2HJBA 2QXVA 4JXMA 3J81g 1L0QA 4JT5C 4OWRA 3AL8B 3MMYA 5FA5B 4BL0A 5FLXg 2OIZA 2UZXB 2AQ5A 2TRCB 2PBIB 4YVDA 3B7FA 4CY2A 2PM9A 5TEFA 5EAMA 3NVQA 2PM9B 2IUPA 4TZ4A 3PXTD 4Z8LA 2B5NA 4A08B 5C9ZB 4L3GD 2HESX 2I0RA 2J57G 1SHYB 5AFU3 5EMJB 2YB8B 1GOTB 2GNQA 4XEIC 5EMKB 3OKTA 3U4YA 3IIYA 5K19A 3JB9L 5CYKA 1K32A 1NR0A 5CYKB 2P9LC 1FWXA 4A09A 4MK0B 3MKQA 3FGBA 2B5MA 5KDOB 1PEVA 1B9XA 5EMMB 2AGLA 2YNPA 3DWLC 3ORVD 3A0FA 4J77A 3IIWA 5GSAA 4PSXB 3DM0A 4H5JA 5TF2A 2GC7A 4X63B 2P9NC 2HKRA 3RRMC 4ZOVA 3MZLA 2OK6A 2H6KA 3RN1D 3UKUC 3RLMD 3EI2A 5CXBB 3SBQA 3IKOA 4NSXA 5GXIA 4J0WA 5FQDA 4K3JB 5FKRA 5CXCB 5I5JA 2H3XA 2O9KA 3C75H 4JSNC 3UVKA 3I2NA 2AGXA 1GP2B 2PM6B 4GQBB 4E5ZA 1U4CA 4ZOYA 5C2WB 4PSWB 4PC0A 2G9AA 3UVMA 2P9SC 3IJCA 2P9PC 3ZWLB 4UI9R 4JSPC 4CC9A 4BH6A 4GM8A 3I89A 2Q7QA 5FKQA 4I79A 1SQ9A 4D6VA 3PVUB 2AH0A 3I8EA 5EARA 1P22A 1GXRA 2W18A 4L3HD 3MZKA 2Z2OA 4J0XA 3FRXA 3OL2A 2IUVA 1S4UX 5IGQA 4O9DA 4N14A 3W15A 2H47A 4CZYA 3UVNA 4KFMB 3EG6A 1JMZB 2HXCA 3RSEC 2H6NA 3KRXB 2I3TA 4O3UB 3NVNA 3SN6B 5FXYA 4X3EA 4HDJA 3EI1B 3AL8A 3SBPA 3F3GA 3SBRA 4BUJC 1N6FA 2J56H 5H1MA 1MG2A 3JRPA 3AL9A 3UVOA 4CY5A 3VGZA 4ZN4A 1OLZA 4AOWA 1GG2B 4A08A 5THAA 2H9MA 2H9LA 1ERJA 1U2VC 5HE1B 3C99A 4FWWA 4J8GA 5K1CC 3EMHA 3SWSD 4J79A 4X60B 1B9YA 1QNIA 1A0RB 2HJ4A 3P4FA 4ZOXA 4JSVC 4ESGA 3EWEA 4GZ8A 1N6EA 5JWZA 3BG0A 2IWFA 3GREA 4ZOZA 2I0SA 4A0BA 4O1QD 4GMBA 4GQ2P 4CY1A 4A0BB 2AGWA 2H68A 4XYIA 3RFHA 1MG3A 3VA6A 4FA5D 2XL2A 5HE2B 2H13A 4QQEA 5EMLB 2OVQB 2CE8A 2G99A 4D0KA 2H6QA 4O45A 5CXBA 3N0EA 2AGYA 3JZNA 4L1QD 2YNNA 1OMWB 3CFVA 5CXCA 3PXWD 3F3PA 4LG8A 2IURA 1PBYB 3DXKC 3MXXA 4GGCA 3N0DA 3PSLA 3F3FA 4CZVA 4CI8A 3J80g 3ODTA 2BBKH 2AGZA 4Y7RA 4E54A 4E54B 2Z2NA 2YNOA 3BG1A 4A0AB 1PI6A 2OJYA 3DSMA 3BWSA 3RFGA 4GGDA 4FAND 3JROA 1XKSA 2EBSA 5IT9g 1JJUB 4J81A 4LGNA 2CNXA 3SVWD 2H9PA 3SCYA 2IUQA 4JD2C 3I7NA 3JPXA 3OKYA 4PXWA 3OKYB 4GQ1A 3EI1A 4A11A 3VH0A 5EALA 4FB1D 1R5MA 4A11B 3I7HA 1TYQC 3SJLD 1JMXB 2B5LA 4CZXA 2P9UC 5I5MA 2GC4A 2BCJB 5AMSA 3IJ0A 4FAVD 5EAPA 1N6DA 3SMRA 5EM2A 2I3SA 4ERYA 3L4MD 5EM2B 2XL3A 3PSCB 4OZUA 1Q47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GM9 A;  1MDA H;  2YMU A;  3I7P A;  4PNK B;  4FA4 D;  3C9C A;  3PE7 A;  4FHL A;  4FA1 D;  4CI2 A;  3V5W B;  4U1E I;  4JT6 C;  1RI6 A;  5HE0 B;  2Z2P A;  2H14 A;  5H17 A;  2CO0 A;  4PBZ A;  2HKM A;  5FKS A;  2MTA H;  3V9F A;  4FA9 D;  3UR4 A;  2CN3 A;  2XYI A;  4L9O A;  5A2Q g;  4CY3 A;  3SLE D;  3HFQ A;  5HE3 B;  4IA9 A;  3RMZ D;  2CO0 C;  4QL1 A;  3JAM g;  1PGU A;  2CE9 A;  4QRJ A;  3E0C A;  2OK4 A;  3KRW B;  5TEE A;  5GXH A;  2I0T A;  3SXT D;  1JOF A;  2AH1 A;  4A09 B;  5TDH B;  2OVP B;  2QC5 A;  3I8C A;  1NEX B;  3K26 A;  3UKR C;  3OKW A;  3SFZ A;  2CN2 A;  3EU7 A;  3JZH A;  2IWK A;  2XU7 A;  3CFS B;  4XYH A;  3OW8 A;  4J73 A;  3I7K A;  3AH8 B;  4ERQ A;  2P9K C;  4A2M A;  4PBY A;  3SHF A;  3ULE C;  3EI4 A;  1TBG A;  3EI4 B;  2B4E A;  1XHM A;  3PVW B;  3V7D B;  2OVR B;  4A2L A;  3EI2 B;  3I7L A;  4CI1 A;  5I5I A;  5IJ8 E;  4GM3 A;  4K3I D;  4H5I A;  5GMK n;  3JZG A;  4AEZ A;  2UZY B;  5B4W A;  4J78 A;  4ERZ A;  4A0A A;  2IAA A;  3UVL A;  4G56 B;  1SQJ A;  4J8B A;  4J82 A;  5IJ7 E;  3NVX A;  3L4O D;  3IJ1 A;  4E5Z B;  4LG9 A;  5HQG A;  4CI3 A;  2YBA A;  3GFC A;  3FM0 A;  2PM7 B;  2HYE A;  3EI3 A;  3I7O A;  4EWR A;  3DXM C;  3EI3 B;  4U7A A;  3OTT A;  4J84 A;  4J87 A;  4JSX C;  4QT8 A;  4Y5R D;  2P9I C;  2J55 H;  5HYN B;  5SXM A;  5H14 A;  3PXS D;  4ES0 A;  3CIK B;  5FKT A;  5IC7 A;  3OL2 B;  4R7A B;  1XIP A;  3RN0 D;  1YFQ A;  5AJA A;  3C5M A;  3K27 A;  4IMM A;  5C2V B;  3AFC A;  4A7J A;  4J86 A;  5IGO A;  4O3T B;  4X61 B;  1K8K C;  3MKS B;  2H9N A;  1VYH C;  4GGA A;  2HJB A;  2QXV A;  4JXM A;  3J81 g;  1L0Q A;  4JT5 C;  4OWR A;  3AL8 B;  3MMY A;  5FA5 B;  4BL0 A;  5FLX g;  2OIZ A;  2UZX B;  2AQ5 A;  2TRC B;  2PBI B;  4YVD A;  3B7F A;  4CY2 A;  2PM9 A;  5TEF A;  5EAM A;  3NVQ A;  2PM9 B;  2IUP A;  4TZ4 A;  3PXT D;  4Z8L A;  2B5N A;  4A08 B;  5C9Z B;  4L3G D;  2HES X;  2I0R A;  2J57 G;  1SHY B;  5AFU 3;  5EMJ B;  2YB8 B;  1GOT B;  2GNQ A;  4XEI C;  5EMK B;  3OKT A;  3U4Y A;  3IIY A;  5K19 A;  3JB9 L;  5CYK A;  1K32 A;  1NR0 A;  5CYK B;  2P9L C;  1FWX A;  4A09 A;  4MK0 B;  3MKQ A;  3FGB A;  2B5M A;  5KDO B;  1PEV A;  1B9X A;  5EMM B;  2AGL A;  2YNP A;  3DWL C;  3ORV D;  3A0F A;  4J77 A;  3IIW A;  5GSA A;  4PSX B;  3DM0 A;  4H5J A;  5TF2 A;  2GC7 A;  4X63 B;  2P9N C;  2HKR A;  3RRM C;  4ZOV A;  3MZL A;  2OK6 A;  2H6K A;  3RN1 D;  3UKU C;  3RLM D;  3EI2 A;  5CXB B;  3SBQ A;  3IKO A;  4NSX A;  5GXI A;  4J0W A;  5FQD A;  4K3J B;  5FKR A;  5CXC B;  5I5J A;  2H3X A;  2O9K A;  3C75 H;  4JSN C;  3UVK A;  3I2N A;  2AGX A;  1GP2 B;  2PM6 B;  4GQB B;  4E5Z A;  1U4C A;  4ZOY A;  5C2W B;  4PSW B;  4PC0 A;  2G9A A;  3UVM A;  2P9S C;  3IJC A;  2P9P C;  3ZWL B;  4UI9 R;  4JSP C;  4CC9 A;  4BH6 A;  4GM8 A;  3I89 A;  2Q7Q A;  5FKQ A;  4I79 A;  1SQ9 A;  4D6V A;  3PVU B;  2AH0 A;  3I8E A;  5EAR A;  1P22 A;  1GXR A;  2W18 A;  4L3H D;  3MZK A;  2Z2O A;  4J0X A;  3FRX A;  3OL2 A;  2IUV A;  1S4U X;  5IGQ A;  4O9D A;  4N14 A;  3W15 A;  2H47 A;  4CZY A;  3UVN A;  4KFM B;  3EG6 A;  1JMZ B;  2HXC A;  3RSE C;  2H6N A;  3KRX B;  2I3T A;  4O3U B;  3NVN A;  3SN6 B;  5FXY A;  4X3E A;  4HDJ A;  3EI1 B;  3AL8 A;  3SBP A;  3F3G A;  3SBR A;  4BUJ C;  1N6F A;  2J56 H;  5H1M A;  1MG2 A;  3JRP A;  3AL9 A;  3UVO A;  4CY5 A;  3VGZ A;  4ZN4 A;  1OLZ A;  4AOW A;  1GG2 B;  4A08 A;  5THA A;  2H9M A;  2H9L A;  1ERJ A;  1U2V C;  5HE1 B;  3C99 A;  4FWW A;  4J8G A;  5K1C C;  3EMH A;  3SWS D;  4J79 A;  4X60 B;  1B9Y A;  1QNI A;  1A0R B;  2HJ4 A;  3P4F A;  4ZOX A;  4JSV C;  4ESG A;  3EWE A;  4GZ8 A;  1N6E A;  5JWZ A;  3BG0 A;  2IWF A;  3GRE A;  4ZOZ A;  2I0S A;  4A0B A;  4O1Q D;  4GMB A;  4GQ2 P;  4CY1 A;  4A0B B;  2AGW A;  2H68 A;  4XYI A;  3RFH A;  1MG3 A;  3VA6 A;  4FA5 D;  2XL2 A;  5HE2 B;  2H13 A;  4QQE A;  5EML B;  2OVQ B;  2CE8 A;  2G99 A;  4D0K A;  2H6Q A;  4O45 A;  5CXB A;  3N0E A;  2AGY A;  3JZN A;  4L1Q D;  2YNN A;  1OMW B;  3CFV A;  5CXC A;  3PXW D;  3F3P A;  4LG8 A;  2IUR A;  1PBY B;  3DXK C;  3MXX A;  4GGC A;  3N0D A;  3PSL A;  3F3F A;  4CZV A;  4CI8 A;  3J80 g;  3ODT A;  2BBK H;  2AGZ A;  4Y7R A;  4E54 A;  4E54 B;  2Z2N A;  2YNO A;  3BG1 A;  4A0A B;  1PI6 A;  2OJY A;  3DSM A;  3BWS A;  3RFG A;  4GGD A;  4FAN D;  3JRO A;  1XKS A;  2EBS A;  5IT9 g;  1JJU B;  4J81 A;  4LGN A;  2CNX A;  3SVW D;  2H9P A;  3SCY A;  2IUQ A;  4JD2 C;  3I7N A;  3JPX A;  3OKY A;  4PXW A;  3OKY B;  4GQ1 A;  3EI1 A;  4A11 A;  3VH0 A;  5EAL A;  4FB1 D;  1R5M A;  4A11 B;  3I7H A;  1TYQ C;  3SJL D;  1JMX B;  2B5L A;  4CZX A;  2P9U C;  5I5M A;  2GC4 A;  2BCJ B;  5AMS A;  3IJ0 A;  4FAV D;  5EAP A;  1N6D A;  3SMR A;  5EM2 A;  2I3S A;  4ERY A;  3L4M D;  5EM2 B;  2XL3 A;  3PSC B;  4OZU A;  1Q47 A; 
#chains in the Genus database with same CATH topology
 4GM9 A;  1MDA H;  2YMU A;  3I7P A;  2XE4 A;  4PNK B;  4FA4 D;  3C9C A;  3PE7 A;  1VZ3 A;  4FHL A;  4FA1 D;  4CI2 A;  3V5W B;  1QFS A;  4IRZ A;  4U1E I;  3FCS A;  4JT6 C;  1RI6 A;  5HE0 B;  2XZG A;  2Z2P A;  2H14 A;  5H17 A;  2CO0 A;  3K6S A;  4PBZ A;  2HKM A;  5FKS A;  2MTA H;  3V9F A;  4FA9 D;  3UR4 A;  2CN3 A;  2XYI A;  4L9O A;  5A2Q g;  4CY3 A;  3SLE D;  5M5V A;  3HFQ A;  2HU8 A;  5M5U A;  2VDP A;  5HE3 B;  4IA9 A;  4DNU A;  3RMZ D;  4MMX A;  2CO0 C;  4QL1 A;  3JAM g;  1PGU A;  2CE9 A;  4QRJ A;  3E0C A;  2OK4 A;  3KRW B;  5TEE A;  1U8C A;  5GXH A;  2I0T A;  3SXT D;  1JOF A;  2AH1 A;  4A09 B;  1UOQ A;  5TDH B;  2EIE A;  2OVP B;  2QC5 A;  3I8C A;  1NEX B;  3NID A;  3K26 A;  3UKR C;  3OKW A;  3SFZ A;  2CN2 A;  3EU7 A;  3JZH A;  2IWK A;  2XU7 A;  3CFS B;  4XYH A;  4NC4 A;  3IUM A;  3OW8 A;  4J73 A;  3I7K A;  3OF7 A;  3AH8 B;  4ERQ A;  1UTC A;  2P9K C;  4A2M A;  4PBY A;  1O6F A;  3SHF A;  3ULE C;  3EI4 A;  1TBG A;  3O4G A;  2WQ8 A;  3EI4 B;  2B4E A;  1XHM A;  3PVW B;  3V7D B;  2VZ1 A;  4DNW A;  2OVR B;  2EIB A;  4A2L A;  3EI2 B;  1H2Y A;  2VDO A;  3I7L A;  4CI1 A;  5I5I A;  5IJ8 E;  5M5S A;  4GM3 A;  4K3I D;  4WK0 A;  4Z7O A;  1H2W A;  4H5I A;  3V4P A;  5GMK n;  3O4H A;  3JZG A;  4AEZ A;  2UZY B;  5B4W A;  4J78 A;  4ERZ A;  4A0A A;  2IAA A;  4RE6 A;  3UVL A;  4G56 B;  4WK2 A;  1SQJ A;  4J8B A;  4J82 A;  5IJ7 E;  3NVX A;  4Z7Q A;  3L4O D;  3IJ1 A;  5E6R A;  4E5Z B;  4LG9 A;  5HQG A;  4CI3 A;  2YBA A;  3GFC A;  3FM0 A;  2PM7 B;  2HYE A;  3EI3 A;  3I7O A;  4EWR A;  3DXM C;  3EI3 B;  4U7A A;  3T3P A;  2VDQ A;  3OTT A;  4J84 A;  4J87 A;  3IUL A;  4JSX C;  4QT8 A;  4Y5R D;  2P9I C;  1UOP A;  2J55 H;  1GOF A;  5HYN B;  1VE6 A;  5SXM A;  5H14 A;  1O6G A;  3ZDZ A;  3PXS D;  4ES0 A;  3CIK B;  5FKT A;  5IC7 A;  3OL2 B;  4R7A B;  1VZ2 A;  1XIP A;  1H2Z A;  3RN0 D;  1YFQ A;  3NIG A;  5AJA A;  4AMY A;  3C5M A;  3K27 A;  4IMM A;  5C2V B;  3AFC A;  4A7J A;  4J86 A;  5IGO A;  4O3T B;  4X61 B;  1K8K C;  3MKS B;  2H9N A;  1VYH C;  4GGA A;  2HJB A;  2QXV A;  4JXM A;  3J81 g;  2VDR A;  1L0Q A;  4JT5 C;  4OWR A;  3AL8 B;  3MMY A;  5FA5 B;  3ZDX A;  4BL0 A;  5FLX g;  2OIZ A;  2UZX B;  3MUO A;  4G55 A;  2AQ5 A;  2TRC B;  2PBI B;  4YVD A;  3B7F A;  4CY2 A;  2PM9 A;  1T2X A;  5TEF A;  5EAM A;  3FCU A;  3NVQ A;  2PM9 B;  2IUP A;  4TZ4 A;  3PXT D;  4Z8L A;  2B5N A;  4A08 B;  5C9Z B;  4L3G D;  1H2X A;  2HES X;  2I0R A;  2J57 G;  1SHY B;  4QAM A;  4BCD A;  5EMJ B;  2YB8 B;  1GOT B;  5AFU 3;  5E6S A;  2GNQ A;  4UM8 A;  4XEI C;  5EMK B;  3OKT A;  3U4Y A;  3IIY A;  4NEN A;  5K19 A;  3JB9 L;  5CYK A;  1K32 A;  1NR0 A;  5CYK B;  2P9L C;  1FWX A;  4A09 A;  4G1M A;  4MK0 B;  3MKQ A;  3FGB A;  2B5M A;  5KDO B;  3MUN A;  1E8M A;  4BP8 A;  1PEV A;  1B9X A;  5EMM B;  4WJK A;  2AGL A;  2YNP A;  3DWL C;  3ORV D;  3A0F A;  4JHP C;  2QR5 A;  4J77 A;  3IIW A;  5GSA A;  4PSX B;  3DM0 A;  4H5J A;  4BP9 A;  5TF2 A;  2GC7 A;  4X63 B;  2BKL A;  2P9N C;  3GD1 I;  2VDN A;  2HKR A;  3RRM C;  1C9L A;  4ZOV A;  1VE7 A;  2XDW A;  3MZL A;  2OK6 A;  3K72 A;  3MVD K;  2H6K A;  3RN1 D;  3UKU C;  3RLM D;  3ZE0 A;  3EI2 A;  5CXB B;  3SBQ A;  3IKO A;  3V4V A;  4NSX A;  5GXI A;  4J0W A;  5FQD A;  4K3J B;  5FKR A;  5CXC B;  2HU7 A;  5I5J A;  2H3X A;  2O9K A;  3EQ7 A;  1GOG A;  3C75 H;  4JSN C;  3UVK A;  3I2N A;  2AGX A;  1GP2 B;  2PM6 B;  4GQB B;  4E5Z A;  1U4C A;  4ZOY A;  5C2W B;  3EQ9 A;  4PSW B;  4PC0 A;  2G9A A;  3UVM A;  4DNV A;  2P9S C;  3ZE1 A;  4BCC A;  4O2W A;  3VI4 A;  4WK4 A;  1M1X A;  3IJC A;  2P9P C;  4MMZ A;  3ZWL B;  4UI9 R;  4JSP C;  4CC9 A;  4BH6 A;  4GM8 A;  3I89 A;  2Q7Q A;  5FKQ A;  3IVM A;  1SQ9 A;  4I79 A;  3PVU B;  2AH0 A;  3I8E A;  3IUJ A;  5EAR A;  1P22 A;  4D6V A;  1GXR A;  2W18 A;  4L3H D;  3MZK A;  2Z2O A;  4J0X A;  3GC3 B;  3FRX A;  3OL2 A;  4AN0 A;  2IUV A;  3T3M A;  1S4U X;  4AMZ A;  2VZ3 A;  5IGQ A;  1UOO A;  4O9D A;  4N14 A;  3W15 A;  2H47 A;  4CZY A;  5C86 A;  3UVN A;  4KFM B;  3EG6 A;  5HDB A;  4JHN A;  1JMZ B;  2HXC A;  3RSE C;  2H6N A;  3KRX B;  2I3T A;  4O3U B;  3NVN A;  3SN6 B;  5FXY A;  5FFG A;  4X3E A;  5M61 A;  4HDJ A;  3EI1 B;  2VDM A;  3AL8 A;  3SBP A;  3F3G A;  4BCB A;  3O4I A;  3SBR A;  1E5T A;  4BUJ C;  1N6F A;  2J56 H;  3O4J A;  2EID A;  5H1M A;  1MG2 A;  3JRP A;  3AL9 A;  3UVO A;  4CY5 A;  2VDL A;  3VGZ A;  4ZN4 A;  1OLZ A;  4AOW A;  1GG2 B;  4A08 A;  5E6U A;  5THA A;  3QI0 A;  4MMY A;  2H9M A;  2H9L A;  1ERJ A;  1U2V C;  5HE1 B;  3C99 A;  4FWW A;  4J8G A;  5K1C C;  3EMH A;  3SWS D;  5C92 A;  4J79 A;  4X60 B;  1B9Y A;  4L1M A;  1QNI A;  1A0R B;  2HJ4 A;  3P4F A;  4ZOX A;  4JSV C;  4ESG A;  1C9I A;  3EWE A;  4GZ8 A;  4G1E A;  1N6E A;  5JWZ A;  4O02 A;  3BG0 A;  2IWF A;  3GRE A;  4ZOZ A;  3ZDY A;  2I0S A;  4A0B A;  5FFO A;  4GMB A;  4O1Q D;  4GQ2 P;  4CY1 A;  4A0B B;  2AGW A;  2H68 A;  4XYI A;  3RFH A;  1MG3 A;  3VA6 A;  4FA5 D;  2XL2 A;  5HE2 B;  5M5R A;  1L5G A;  2H13 A;  3DDU A;  1A12 A;  4QQE A;  5EML B;  2OVQ B;  2CE8 A;  1BPO A;  2G99 A;  4D0K A;  2H6Q A;  4O45 A;  2VDK A;  3KCI A;  5CXB A;  3IUN A;  4D9S A;  3N0E A;  2AGY A;  3JZN A;  1I2M B;  4AN1 A;  4L1Q D;  2YNN A;  1OMW B;  3CFV A;  5CXC A;  3PXW D;  3EQ8 A;  3F3P A;  4LG8 A;  2IUR A;  1PBY B;  3DXK C;  3MXX A;  4GGC A;  4NBM A;  3N0D A;  3PSL A;  3F3F A;  4CZV A;  4CI8 A;  3J80 g;  3IUR A;  3ODT A;  1YR2 A;  2BBK H;  3IJE A;  2AGZ A;  4Y7R A;  2EIC A;  4AX4 A;  4Z7N A;  4E54 A;  4E54 B;  3NIF A;  2HU5 A;  2Z2N A;  2YNO A;  3BG1 A;  4A0A B;  1PI6 A;  4NAA A;  3ZE2 A;  2VC2 A;  1K3I A;  2OJY A;  3DSM A;  3BWS A;  3RFG A;  4GGD A;  4FAN D;  3JRO A;  1XKS A;  1TYE A;  2EBS A;  5IT9 g;  3IUQ A;  1JJU B;  3VI3 A;  4J81 A;  4UM9 A;  2JKX A;  4LGN A;  2QZP A;  2CNX A;  1JTD B;  3SVW D;  2H9P A;  3SCY A;  1E8N A;  2IUQ A;  4JD2 C;  3I7N A;  3JPX A;  3OKY A;  4PXW A;  3OKY B;  4GQ1 A;  3EI1 A;  4A11 A;  3VH0 A;  5EAL A;  4FB1 D;  1R5M A;  4A11 B;  3I7H A;  3K71 A;  1QFM A;  1JV2 A;  1TYQ C;  4RE5 A;  3SJL D;  1JMX B;  2B5L A;  4CZX A;  5M5T A;  2P9U C;  3QHY B;  2GC4 A;  5I5M A;  2BCJ B;  5AMS A;  3IJ0 A;  4FAV D;  5EAP A;  1N6D A;  3SMR A;  5EM2 A;  2I3S A;  4ERY A;  1GOH A;  3L4M D;  5EM2 B;  2XL3 A;  3PSC B;  4OZU A;  1Q47 A; 
#chains in the Genus database with same CATH homology
 4GM9 A;  1MDA H;  2YMU A;  3I7P A;  4PNK B;  4FA4 D;  3C9C A;  3PE7 A;  4FHL A;  4FA1 D;  4CI2 A;  3V5W B;  4U1E I;  4JT6 C;  1RI6 A;  5HE0 B;  2Z2P A;  2H14 A;  5H17 A;  2CO0 A;  4PBZ A;  2HKM A;  5FKS A;  2MTA H;  3V9F A;  4FA9 D;  3UR4 A;  2CN3 A;  2XYI A;  4L9O A;  5A2Q g;  4CY3 A;  3SLE D;  3HFQ A;  5HE3 B;  4IA9 A;  3RMZ D;  2CO0 C;  4QL1 A;  3JAM g;  1PGU A;  2CE9 A;  4QRJ A;  3E0C A;  2OK4 A;  3KRW B;  5TEE A;  5GXH A;  2I0T A;  3SXT D;  1JOF A;  2AH1 A;  4A09 B;  5TDH B;  2OVP B;  2QC5 A;  3I8C A;  1NEX B;  3K26 A;  3UKR C;  3OKW A;  3SFZ A;  2CN2 A;  3EU7 A;  3JZH A;  2IWK A;  2XU7 A;  3CFS B;  4XYH A;  3OW8 A;  4J73 A;  3I7K A;  3AH8 B;  4ERQ A;  2P9K C;  4A2M A;  4PBY A;  3SHF A;  3ULE C;  3EI4 A;  1TBG A;  3EI4 B;  2B4E A;  1XHM A;  3PVW B;  3V7D B;  2OVR B;  4A2L A;  3EI2 B;  3I7L A;  4CI1 A;  5I5I A;  5IJ8 E;  4GM3 A;  4K3I D;  4H5I A;  5GMK n;  3JZG A;  4AEZ A;  2UZY B;  5B4W A;  4J78 A;  4ERZ A;  4A0A A;  2IAA A;  3UVL A;  4G56 B;  1SQJ A;  4J8B A;  4J82 A;  5IJ7 E;  3NVX A;  3L4O D;  3IJ1 A;  4E5Z B;  4LG9 A;  5HQG A;  4CI3 A;  2YBA A;  3GFC A;  3FM0 A;  2PM7 B;  2HYE A;  3EI3 A;  3I7O A;  4EWR A;  3DXM C;  3EI3 B;  4U7A A;  3OTT A;  4J84 A;  4J87 A;  4JSX C;  4QT8 A;  4Y5R D;  2P9I C;  2J55 H;  5HYN B;  5SXM A;  5H14 A;  3PXS D;  4ES0 A;  3CIK B;  5FKT A;  5IC7 A;  3OL2 B;  4R7A B;  1XIP A;  3RN0 D;  1YFQ A;  5AJA A;  3C5M A;  3K27 A;  4IMM A;  5C2V B;  3AFC A;  4A7J A;  4J86 A;  5IGO A;  4O3T B;  4X61 B;  1K8K C;  3MKS B;  2H9N A;  1VYH C;  4GGA A;  2HJB A;  2QXV A;  4JXM A;  3J81 g;  1L0Q A;  4JT5 C;  4OWR A;  3AL8 B;  3MMY A;  5FA5 B;  4BL0 A;  5FLX g;  2OIZ A;  2UZX B;  2AQ5 A;  2TRC B;  2PBI B;  4YVD A;  3B7F A;  4CY2 A;  2PM9 A;  5TEF A;  5EAM A;  3NVQ A;  2PM9 B;  2IUP A;  4TZ4 A;  3PXT D;  4Z8L A;  2B5N A;  4A08 B;  5C9Z B;  4L3G D;  2HES X;  2I0R A;  2J57 G;  1SHY B;  5AFU 3;  5EMJ B;  2YB8 B;  1GOT B;  2GNQ A;  4XEI C;  5EMK B;  3OKT A;  3U4Y A;  3IIY A;  5K19 A;  3JB9 L;  5CYK A;  1K32 A;  1NR0 A;  5CYK B;  2P9L C;  1FWX A;  4A09 A;  4MK0 B;  3MKQ A;  3FGB A;  2B5M A;  5KDO B;  1PEV A;  1B9X A;  5EMM B;  2AGL A;  2YNP A;  3DWL C;  3ORV D;  3A0F A;  4J77 A;  3IIW A;  5GSA A;  4PSX B;  3DM0 A;  4H5J A;  5TF2 A;  2GC7 A;  4X63 B;  2P9N C;  2HKR A;  3RRM C;  4ZOV A;  3MZL A;  2OK6 A;  2H6K A;  3RN1 D;  3UKU C;  3RLM D;  3EI2 A;  5CXB B;  3SBQ A;  3IKO A;  4NSX A;  5GXI A;  4J0W A;  5FQD A;  4K3J B;  5FKR A;  5CXC B;  5I5J A;  2H3X A;  2O9K A;  3C75 H;  4JSN C;  3UVK A;  3I2N A;  2AGX A;  1GP2 B;  2PM6 B;  4GQB B;  4E5Z A;  1U4C A;  4ZOY A;  5C2W B;  4PSW B;  4PC0 A;  2G9A A;  3UVM A;  2P9S C;  3IJC A;  2P9P C;  3ZWL B;  4UI9 R;  4JSP C;  4CC9 A;  4BH6 A;  4GM8 A;  3I89 A;  2Q7Q A;  5FKQ A;  4I79 A;  1SQ9 A;  4D6V A;  3PVU B;  2AH0 A;  3I8E A;  5EAR A;  1P22 A;  1GXR A;  2W18 A;  4L3H D;  3MZK A;  2Z2O A;  4J0X A;  3FRX A;  3OL2 A;  2IUV A;  1S4U X;  5IGQ A;  4O9D A;  4N14 A;  3W15 A;  2H47 A;  4CZY A;  3UVN A;  4KFM B;  3EG6 A;  1JMZ B;  2HXC A;  3RSE C;  2H6N A;  3KRX B;  2I3T A;  4O3U B;  3NVN A;  3SN6 B;  5FXY A;  4X3E A;  4HDJ A;  3EI1 B;  3AL8 A;  3SBP A;  3F3G A;  3SBR A;  4BUJ C;  1N6F A;  2J56 H;  5H1M A;  1MG2 A;  3JRP A;  3AL9 A;  3UVO A;  4CY5 A;  3VGZ A;  4ZN4 A;  1OLZ A;  4AOW A;  1GG2 B;  4A08 A;  5THA A;  2H9M A;  2H9L A;  1ERJ A;  1U2V C;  5HE1 B;  3C99 A;  4FWW A;  4J8G A;  5K1C C;  3EMH A;  3SWS D;  4J79 A;  4X60 B;  1B9Y A;  1QNI A;  1A0R B;  2HJ4 A;  3P4F A;  4ZOX A;  4JSV C;  4ESG A;  3EWE A;  4GZ8 A;  1N6E A;  5JWZ A;  3BG0 A;  2IWF A;  3GRE A;  4ZOZ A;  2I0S A;  4A0B A;  4O1Q D;  4GMB A;  4GQ2 P;  4CY1 A;  4A0B B;  2AGW A;  2H68 A;  4XYI A;  3RFH A;  1MG3 A;  3VA6 A;  4FA5 D;  2XL2 A;  5HE2 B;  2H13 A;  4QQE A;  5EML B;  2OVQ B;  2CE8 A;  2G99 A;  4D0K A;  2H6Q A;  4O45 A;  5CXB A;  3N0E A;  2AGY A;  3JZN A;  4L1Q D;  2YNN A;  1OMW B;  3CFV A;  5CXC A;  3PXW D;  3F3P A;  4LG8 A;  2IUR A;  1PBY B;  3DXK C;  3MXX A;  4GGC A;  3N0D A;  3PSL A;  3F3F A;  4CZV A;  4CI8 A;  3J80 g;  3ODT A;  2BBK H;  2AGZ A;  4Y7R A;  4E54 A;  4E54 B;  2Z2N A;  2YNO A;  3BG1 A;  4A0A B;  1PI6 A;  2OJY A;  3DSM A;  3BWS A;  3RFG A;  4GGD A;  4FAN D;  3JRO A;  1XKS A;  2EBS A;  5IT9 g;  1JJU B;  4J81 A;  4LGN A;  2CNX A;  3SVW D;  2H9P A;  3SCY A;  2IUQ A;  4JD2 C;  3I7N A;  3JPX A;  3OKY A;  4PXW A;  3OKY B;  4GQ1 A;  3EI1 A;  4A11 A;  3VH0 A;  5EAL A;  4FB1 D;  1R5M A;  4A11 B;  3I7H A;  1TYQ C;  3SJL D;  1JMX B;  2B5L A;  4CZX A;  2P9U C;  5I5M A;  2GC4 A;  2BCJ B;  5AMS A;  3IJ0 A;  4FAV D;  5EAP A;  1N6D A;  3SMR A;  5EM2 A;  2I3S A;  4ERY A;  3L4M D;  5EM2 B;  2XL3 A;  3PSC B;  4OZU A;  1Q47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...