5KDOB

Heterotrimeric complex of the 4 alanine insertion variant of the gi alpha1 subunit and the gbeta1-ggamma1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
339
structure length
335
Chain Sequence
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1
publication title A Conserved Hydrophobic Core in G alpha i1 Regulates G Protein Activation and Release from Activated Receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 110
structure length 335
sequence length 339
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5kdoB00
3KRWB 4L9OA 4A0BB 5FQDA 3E0CA 4D6VA 2P9SC 3CFVA 4J8GA 1FWXA 4PNKB 2I0TA 3PXSD 4CI8A 5IGOA 1N6FA 3JAMg 1GP2B 3PSLA 4ES0A 4GGAA 2UZXB 4FA1D 3JZGA 4ERZA 4JT5C 2J55H 5H17A 4JXMA 1JMXB 3C5MA 5TEFA 2Z2NA 2PM9B 2W18A 4A0AA 1TYQC 4J0XA 4ERYA 4GQ2P 5HE3B 3MZKA 2OIZA 2QC5A 2AGWA 3C75H 2CO0C 4XEIC 5TDHB 1SQJA 2IURA 3JRPA 3RSEC 4KFMB 4JSPC 3EI4B 4CY1A 4H5IA 2OVPB 5EARA 4A11B 3NVXA 4Y7RA 2IUPA 3SBRA 1K8KC 3C9CA 4J84A 5EALA 1RI6A 3RRMC 2BBKH 4J77A 2GC4A 2CE9A 4OWRA 5EM2B 2H68A 4K3JB 2Z2PA 3F3FA 1JJUB 3EI1A 3PVWB 2HJBA 3RLMD 4GGDA 5K1CC 5HE0B 2G99A 3OL2A 3VGZA 5GMKn 3OKYA 5FKTA 2AGLA 5HE2B 4ERQA 5EMJB 3DXKC 4OZUA 3NVNA 4CC9A 4JD2C 3V5WB 5HYNB 4O45A 2G9AA 3K27A 2AQ5A 4FWWA 4L3HD 4XYIA 2IUQA 5C2VB 4J78A 5C9ZB 4ZOZA 1GOTB 5H14A 1MG2A 2AH1A 4O9DA 3I8CA 2HJ4A 2Q7QA 5CXBA 5AMSA 3PE7A 4L1QD 4J73A 3UR4A 4A2LA 2GC7A 2EBSA 1OMWB 2OJYA 4E5ZA 4GM8A 4LG9A 3I7NA 3EWEA 3DM0A 4JSXC 4A0AB 3IKOA 3J81g 2YBAA 2BCJB 3I2NA 4FAND 2YNOA 1PBYB 3L4MD 1YFQA 4CI2A 5GXIA 2CO0A 2I0SA 2H13A 3EI2A 3UVNA 1GG2B 5I5MA 4E54A 5FKQA 1OLZA 3I7KA 3AH8B 3ORVD 3OKTA 1L0QA 4R7AB 4XYHA 4N14A 4ZOXA 5I5IA 3BWSA 3SBPA 3SWSD 4JSVC 4GZ8A 3EI1B 2XL3A 1B9XA 3UKRC 3UVMA 3OL2B 4ZN4A 3MKQA 5EAPA 4U7AA 3OKYB 5TEEA 3SBQA 4JSNC 2Z2OA 4J8BA 2H47A 4PBYA 3SFZA 3MKSB 3UKUC 3IJ1A 5EMMB 4GM9A 1N6EA 5KDOB 2AH0A 2HYEA 4PBZA 2B5NA 4ZOVA 4PXWA 5IT9g 4QT8A 4A09A 3NVQA 1MG3A 3PSCB 2P9NC 2B5LA 5AFU3 3JB9L 2QXVA 5CXBB 2AGYA 2OVRB 3PVUB 3I7LA 2H9LA 2O9KA 1A0RB 4E5ZB 3I7HA 2AGZA 3UVOA 4PSWB 4I79A 3GREA 4A2MA 5FLXg 2CN3A 3RN0D 4H5JA 4CZXA 5SXMA 3OKWA 3OTTA 3W15A 4O1QD 3AFCA 2P9UC 4LGNA 4JT6C 3JZNA 2GNQA 3EI2B 5EMLB 4QRJA 5AJAA 4E54B 3AL9A 4K3ID 5EMKB 3EI3A 3N0EA 1PEVA 4O3TB 5FA5B 3L4OD 4Y5RD 1GXRA 1VYHC 4A08A 4CZYA 4MK0B 3IIYA 3UVLA 4GQ1A 4L3GD 1XHMA 5H1MA 3AL8A 3FGBA 3SCYA 1JMZB 5IJ8E 3K26A 3F3PA 5TF2A 4CI1A 5IGQA 1TBGA 4BH6A 1NR0A 3HFQA 4PC0A 4CI3A 2IWKA 4FA4D 2XYIA 5CXCA 2H6KA 1ERJA 2OK6A 2IUVA 2HKRA 2J57G 4ZOYA 2H9MA 3I89A 2HXCA 4G56B 3SJLD 4QL1A 4J81A 3MZLA 2HKMA 1N6DA 3UVKA 2PBIB 4YVDA 3VH0A 4A09B 2YMUA 2I3SA 5FXYA 5CYKA 4GM3A 3BG0A 2OVQB 4EWRA 2CE8A 5K19A 2H9PA 5IC7A 2I3TA 3VA6A 4ESGA 3U4YA 4X61B 3SLED 1MDAH 1SQ9A 3JROA 4D0KA 2OK4A 3ULEC 2TRCB 4A7JA 2PM7B 4BUJC 4X60B 3EU7A 4J87A 4Z8LA 3FRXA 4FB1D 2IAAA 3SMRA 4J79A 2CN2A 3EMHA 3C99A 3EI3B 4GQBB 4IA9A 3V7DB 1JOFA 4BL0A 1U4CA 3CIKB 5GXHA 3IIWA 4AEZA 1PI6A 3MMYA 4IMMA 4CY2A 4A08B 5HE1B 4O3UB 2H3XA 2YB8B 4U1EI 3AL8B 1XIPA 3ZWLB 5IJ7E 4FHLA 4J86A 1SHYB 2MTAH 4A0BA 3PXTD 2YNPA 5I5JA 2H6NA 5CXCB 5B4WA 5A2Qg 1NEXB 5THAA 3KRXB 3EG6A 4LG8A 2AGXA 3B7FA 4UI9R 3SN6B 5JWZA 5FKRA 4PSXB 3IJ0A 4TZ4A 4GGCA 1PGUA 2P9LC 1R5MA 3DSMA 3MXXA 5EAMA 1K32A 4NSXA 5CYKB 2I0RA 5C2WB 1P22A 2PM9A 2PM6B 3ODTA 4QQEA 3I7OA 3DWLC 2YNNA 3I8EA 2B4EA 3RFHA 4CY5A 4X63B 4FA9D 5HQGA 3RFGA 4CZVA 4X3EA 1XKSA 2P9KC 3P4FA 1QNIA 5GSAA 3CFSB 2H6QA 3PXWD 3N0DA 2XU7A 2XL2A 3J80g 3GFCA 3SXTD 3SVWD 3EI4A 2P9IC 3I7PA 1B9YA 2UZYB 3RN1D 4FAVD 2H14A 4A11A 3JPXA 4J0WA 1Q47A 3RMZD 2J56H 2CNXA 4FA5D 3FM0A 2IWFA 3DXMC 4CY3A 3A0FA 4HDJA 5EM2A 1U2VC 5FKSA 1S4UX 3V9FA 2HESX 3BG1A 3IJCA 3JZHA 2P9PC 3F3GA 3SHFA 2B5MA 2H9NA 4J82A 3OW8A 4AOWA 4GMBA
chains in the Genus database with same CATH superfamily
3KRWB 4L9OA 2HU7A 4A0BB 5FQDA 3E0CA 1U8CA 4D6VA 3EQ7A 2P9SC 4IRZA 3CFVA 4J8GA 1FWXA 4BCCA 4PNKB 2I0TA 2HU8A 3PXSD 4CI8A 5IGOA 1N6FA 3JAMg 1GP2B 3PSLA 5E6UA 3ZDYA 4ES0A 4GGAA 2UZXB 4FA1D 3JZGA 4ERZA 4JT5C 1L5GA 2J55H 5H17A 4JXMA 1JMXB 3C5MA 5TEFA 2Z2NA 2PM9B 2W18A 4A0AA 4G55A 1TYQC 4DNVA 4J0XA 4ERYA 4GQ2P 5HE3B 3MZKA 2OIZA 2QC5A 2AGWA 4QAMA 3C75H 2CO0C 4XEIC 2VDQA 4O2WA 5FFGA 2VC2A 5TDHB 1M1XA 1SQJA 2IURA 3O4IA 3JRPA 3NIDA 3RSEC 1O6FA 4KFMB 4JSPC 3EI4B 4CY1A 4H5IA 4NENA 2OVPB 5EARA 4A11B 3NVXA 4Y7RA 2IUPA 3SBRA 1K8KC 3C9CA 4J84A 4L1MA 2JKXA 5EALA 1RI6A 3RRMC 2BBKH 4J77A 2GC4A 2CE9A 4OWRA 2VDOA 5EM2B 2H68A 4K3JB 2Z2PA 3V4PA 3V4VA 4AMYA 3F3FA 1JJUB 3EI1A 3GC3B 2HJBA 3PVWB 3RLMD 4GGDA 5K1CC 5HE0B 2G99A 3OL2A 3VGZA 5GMKn 3OKYA 2XE4A 5FKTA 4JHPC 2AGLA 5HE2B 1H2WA 1A12A 4ERQA 5EMJB 4AX4A 3DXKC 4OZUA 3NVNA 4CC9A 4JD2C 3V5WB 5HYNB 4O45A 1C9LA 4NAAA 4Z7NA 2G9AA 3K27A 2AQ5A 4FWWA 4L3HD 4XYIA 2IUQA 1JTDB 3MVDK 5C2VB 4J78A 5C9ZB 4ZOZA 1GOTB 5H14A 1MG2A 2AH1A 2BKLA 5M61A 4O9DA 3I8CA 2HJ4A 2Q7QA 1UOQA 5CXBA 4DNWA 1H2YA 5AMSA 3PE7A 4L1QD 5E6SA 4J73A 1GOHA 3UR4A 4A2LA 1VE6A 2EBSA 2GC7A 1OMWB 2OJYA 4E5ZA 4GM8A 4LG9A 3I7NA 3EWEA 3DM0A 4JSXC 4A0AB 3IKOA 3J81g 2YBAA 2BCJB 1O6GA 3I2NA 4FAND 2YNOA 1PBYB 3L4MD 4BP8A 1YFQA 4CI2A 5GXIA 1TYEA 2CO0A 2I0SA 4NBMA 2H13A 3EI2A 4RE5A 1GG2B 3UVNA 5I5MA 4JHNA 4E54A 3IUJA 5FKQA 1OLZA 3I7KA 3AH8B 3ORVD 4MMXA 3OKTA 1L0QA 3MUNA 4R7AB 4XYHA 3MUOA 4WJKA 5C92A 3K6SA 3VI3A 4N14A 4ZOXA 5HDBA 3NIGA 5I5IA 3BWSA 3SBPA 3SWSD 5E6RA 4JSVC 4GZ8A 3EI1B 2XL3A 1B9XA 3UKRC 3UVMA 3OL2B 2VDKA 4ZN4A 3MKQA 5EAPA 4U7AA 3OKYB 5TEEA 3SBQA 4JSNC 2Z2OA 2VDMA 4J8BA 5M5TA 2H47A 4PBYA 3SFZA 3MKSB 3UKUC 1T2XA 3IJ1A 5EMMB 1E8NA 4GM9A 1N6EA 5KDOB 1BPOA 2AH0A 2HYEA 4PBZA 2B5NA 4ZOVA 4PXWA 2QZPA 3O4HA 5IT9g 4QT8A 4UM8A 4A09A 3NVQA 1MG3A 3PSCB 2P9NC 2B5LA 2WQ8A 1UOOA 5AFU3 3JB9L 2QXVA 5CXBB 2AGYA 2OVRB 3PVUB 3I7LA 2H9LA 4Z7OA 2O9KA 1A0RB 4WK2A 3ZE1A 2XDWA 3EQ9A 3I7HA 4E5ZB 2AGZA 3UVOA 4PSWB 4I79A 3GREA 4A2MA 5FLXg 2CN3A 3RN0D 4H5JA 4CZXA 4MMYA 4MMZA 5SXMA 3OKWA 3OTTA 3W15A 1GOFA 4O1QD 3AFCA 2P9UC 2VZ1A 4RE6A 4LGNA 1C9IA 4JT6C 3JZNA 4AN0A 2GNQA 3EI2B 4BP9A 5EMLB 4QRJA 5AJAA 4E54B 3T3MA 3AL9A 4K3ID 3KCIA 5EMKB 2VDRA 3EI3A 3N0EA 1PEVA 4O3TB 5FA5B 3L4OD 1K3IA 4Y5RD 3ZE2A 1GXRA 1VYHC 4A08A 4CZYA 1H2ZA 4MK0B 4WK0A 3IIYA 4BCBA 3UVLA 4AMZA 1GOGA 4GQ1A 4L3GD 1XHMA 5H1MA 3AL8A 3FGBA 1UTCA 4D9SA 3SCYA 1JMZB 5IJ8E 3K26A 3NIFA 3F3PA 5TF2A 4CI1A 5IGQA 1TBGA 3IUQA 4BH6A 1NR0A 3HFQA 4PC0A 3O4JA 4CI3A 2IWKA 4FA4D 5M5UA 2XYIA 5CXCA 3DDUA 2H6KA 1ERJA 2OK6A 2IUVA 2HKRA 2J57G 2VDLA 4ZOYA 2H9MA 3I89A 2HXCA 2EIDA 4G56B 3SJLD 4QL1A 4J81A 3MZLA 3IJEA 2HKMA 1N6DA 3UVKA 2PBIB 1VE7A 4YVDA 3VH0A 4A09B 2YMUA 2I3SA 5FXYA 5CYKA 4GM3A 4O02A 1VZ2A 3BG0A 2OVQB 4EWRA 2CE8A 1H2XA 5K19A 2H9PA 1E5TA 5IC7A 2EICA 2I3TA 3VA6A 2QR5A 3ZDZA 4ESGA 3U4YA 4X61B 3SLED 1MDAH 1SQ9A 3JROA 5M5VA 2EIEA 4D0KA 3QHYB 2OK4A 3ULEC 2TRCB 4A7JA 2PM7B 4BUJC 1VZ3A 4X60B 3EU7A 4J87A 4Z8LA 3FRXA 4FB1D 2XZGA 2IAAA 4G1MA 3SMRA 4J79A 2CN2A 3EMHA 3C99A 3EI3B 4GQBB 1QFSA 4IA9A 3V7DB 1JOFA 1UOPA 3ZE0A 4BL0A 3K72A 1U4CA 3CIKB 5GXHA 3IIWA 4AEZA 1PI6A 3MMYA 4IMMA 4CY2A 4A08B 5HE1B 3GD1I 4O3UB 3QI0A 2H3XA 2YB8B 4DNUA 4U1EI 1QFMA 3AL8B 1XIPA 3ZWLB 2VZ3A 5IJ7E 4FHLA 3ZDXA 4J86A 1SHYB 2MTAH 5FFOA 4A0BA 3PXTD 2YNPA 5I5JA 2H6NA 5CXCB 5B4WA 5A2Qg 1NEXB 3IUNA 4UM9A 4G1EA 5THAA 3KRXB 3T3PA 2HU5A 3EG6A 1E8MA 4LG8A 2AGXA 3B7FA 4UI9R 3SN6B 5JWZA 4Z7QA 5FKRA 4PSXB 3IJ0A 4TZ4A 4GGCA 1PGUA 2P9LC 1R5MA 3DSMA 3MXXA 5EAMA 2VDNA 1K32A 4NSXA 5CYKB 2I0RA 5C2WB 1P22A 2PM9A 2PM6B 5M5RA 4AN1A 4BCDA 3ODTA 3IVMA 4QQEA 5M5SA 3I7OA 3DWLC 2YNNA 3I8EA 2B4EA 3RFHA 4CY5A 4X63B 4FA9D 3K71A 3IUMA 5HQGA 3RFGA 4CZVA 4X3EA 1XKSA 2P9KC 4NC4A 3P4FA 1QNIA 5GSAA 3CFSB 2H6QA 4WK4A 3PXWD 3N0DA 2XU7A 2XL2A 3J80g 2VDPA 3GFCA 3SXTD 3FCSA 3SVWD 5C86A 3EI4A 2P9IC 3I7PA 1B9YA 2UZYB 3RN1D 1YR2A 4FAVD 2H14A 3EQ8A 4A11A 3JPXA 4J0WA 1Q47A 3O4GA 3RMZD 2J56H 2CNXA 4FA5D 3FM0A 3IURA 2IWFA 3DXMC 4CY3A 3A0FA 4HDJA 3VI4A 5EM2A 1U2VC 3IULA 5FKSA 1S4UX 3V9FA 2HESX 3BG1A 3JZHA 3IJCA 2P9PC 2EIBA 3FCUA 3OF7A 3F3GA 3SHFA 2B5MA 1JV2A 2H9NA 1I2MB 4J82A 3OW8A 4AOWA 4GMBA
chains in the Genus database with same CATH topology
3KRWB 4L9OA 4A0BB 5FQDA 3E0CA 4D6VA 2P9SC 3CFVA 4J8GA 1FWXA 4PNKB 2I0TA 3PXSD 4CI8A 5IGOA 1N6FA 3JAMg 1GP2B 3PSLA 4ES0A 4GGAA 2UZXB 4FA1D 3JZGA 4ERZA 4JT5C 2J55H 5H17A 4JXMA 1JMXB 3C5MA 5TEFA 2Z2NA 2PM9B 2W18A 4A0AA 1TYQC 4J0XA 4ERYA 4GQ2P 5HE3B 3MZKA 2OIZA 2QC5A 2AGWA 3C75H 2CO0C 4XEIC 5TDHB 1SQJA 2IURA 3JRPA 3RSEC 4KFMB 4JSPC 3EI4B 4CY1A 4H5IA 2OVPB 5EARA 4A11B 3NVXA 4Y7RA 2IUPA 3SBRA 1K8KC 3C9CA 4J84A 5EALA 1RI6A 3RRMC 2BBKH 4J77A 2GC4A 2CE9A 4OWRA 5EM2B 2H68A 4K3JB 2Z2PA 3F3FA 1JJUB 3EI1A 3PVWB 2HJBA 3RLMD 4GGDA 5K1CC 5HE0B 2G99A 3OL2A 3VGZA 5GMKn 3OKYA 5FKTA 2AGLA 5HE2B 4ERQA 5EMJB 3DXKC 4OZUA 3NVNA 4CC9A 4JD2C 3V5WB 5HYNB 4O45A 2G9AA 3K27A 2AQ5A 4FWWA 4L3HD 4XYIA 2IUQA 5C2VB 4J78A 5C9ZB 4ZOZA 1GOTB 5H14A 1MG2A 2AH1A 4O9DA 3I8CA 2HJ4A 2Q7QA 5CXBA 5AMSA 3PE7A 4L1QD 4J73A 3UR4A 4A2LA 2GC7A 2EBSA 1OMWB 2OJYA 4E5ZA 4GM8A 4LG9A 3I7NA 3EWEA 3DM0A 4JSXC 4A0AB 3IKOA 3J81g 2YBAA 2BCJB 3I2NA 4FAND 2YNOA 1PBYB 3L4MD 1YFQA 4CI2A 5GXIA 2CO0A 2I0SA 2H13A 3EI2A 3UVNA 1GG2B 5I5MA 4E54A 5FKQA 1OLZA 3I7KA 3AH8B 3ORVD 3OKTA 1L0QA 4R7AB 4XYHA 4N14A 4ZOXA 5I5IA 3BWSA 3SBPA 3SWSD 4JSVC 4GZ8A 3EI1B 2XL3A 1B9XA 3UKRC 3UVMA 3OL2B 4ZN4A 3MKQA 5EAPA 4U7AA 3OKYB 5TEEA 3SBQA 4JSNC 2Z2OA 4J8BA 2H47A 4PBYA 3SFZA 3MKSB 3UKUC 3IJ1A 5EMMB 4GM9A 1N6EA 5KDOB 2AH0A 2HYEA 4PBZA 2B5NA 4ZOVA 4PXWA 5IT9g 4QT8A 4A09A 3NVQA 1MG3A 3PSCB 2P9NC 2B5LA 5AFU3 3JB9L 2QXVA 5CXBB 2AGYA 2OVRB 3PVUB 3I7LA 2H9LA 2O9KA 1A0RB 4E5ZB 3I7HA 2AGZA 3UVOA 4PSWB 4I79A 3GREA 4A2MA 5FLXg 2CN3A 3RN0D 4H5JA 4CZXA 5SXMA 3OKWA 3OTTA 3W15A 4O1QD 3AFCA 2P9UC 4LGNA 4JT6C 3JZNA 2GNQA 3EI2B 5EMLB 4QRJA 5AJAA 4E54B 3AL9A 4K3ID 5EMKB 3EI3A 3N0EA 1PEVA 4O3TB 5FA5B 3L4OD 4Y5RD 1GXRA 1VYHC 4A08A 4CZYA 4MK0B 3IIYA 3UVLA 4GQ1A 4L3GD 1XHMA 5H1MA 3AL8A 3FGBA 3SCYA 1JMZB 5IJ8E 3K26A 3F3PA 5TF2A 4CI1A 5IGQA 1TBGA 4BH6A 1NR0A 3HFQA 4PC0A 4CI3A 2IWKA 4FA4D 2XYIA 5CXCA 2H6KA 1ERJA 2OK6A 2IUVA 2HKRA 2J57G 4ZOYA 2H9MA 3I89A 2HXCA 4G56B 3SJLD 4QL1A 4J81A 3MZLA 2HKMA 1N6DA 3UVKA 2PBIB 4YVDA 3VH0A 4A09B 2YMUA 2I3SA 5FXYA 5CYKA 4GM3A 3BG0A 2OVQB 4EWRA 2CE8A 5K19A 2H9PA 5IC7A 2I3TA 3VA6A 4ESGA 3U4YA 4X61B 3SLED 1MDAH 1SQ9A 3JROA 4D0KA 2OK4A 3ULEC 2TRCB 4A7JA 2PM7B 4BUJC 4X60B 3EU7A 4J87A 4Z8LA 3FRXA 4FB1D 2IAAA 3SMRA 4J79A 2CN2A 3EMHA 3C99A 3EI3B 4GQBB 4IA9A 3V7DB 1JOFA 4BL0A 1U4CA 3CIKB 5GXHA 3IIWA 4AEZA 1PI6A 3MMYA 4IMMA 4CY2A 4A08B 5HE1B 4O3UB 2H3XA 2YB8B 4U1EI 3AL8B 1XIPA 3ZWLB 5IJ7E 4FHLA 4J86A 1SHYB 2MTAH 4A0BA 3PXTD 2YNPA 5I5JA 2H6NA 5CXCB 5B4WA 5A2Qg 1NEXB 5THAA 3KRXB 3EG6A 4LG8A 2AGXA 3B7FA 4UI9R 3SN6B 5JWZA 5FKRA 4PSXB 3IJ0A 4TZ4A 4GGCA 1PGUA 2P9LC 1R5MA 3DSMA 3MXXA 5EAMA 1K32A 4NSXA 5CYKB 2I0RA 5C2WB 1P22A 2PM9A 2PM6B 3ODTA 4QQEA 3I7OA 3DWLC 2YNNA 3I8EA 2B4EA 3RFHA 4CY5A 4X63B 4FA9D 5HQGA 3RFGA 4CZVA 4X3EA 1XKSA 2P9KC 3P4FA 1QNIA 5GSAA 3CFSB 2H6QA 3PXWD 3N0DA 2XU7A 2XL2A 3J80g 3GFCA 3SXTD 3SVWD 3EI4A 2P9IC 3I7PA 1B9YA 2UZYB 3RN1D 4FAVD 2H14A 4A11A 3JPXA 4J0WA 1Q47A 3RMZD 2J56H 2CNXA 4FA5D 3FM0A 2IWFA 3DXMC 4CY3A 3A0FA 4HDJA 5EM2A 1U2VC 5FKSA 1S4UX 3V9FA 2HESX 3BG1A 3IJCA 3JZHA 2P9PC 3F3GA 3SHFA 2B5MA 2H9NA 4J82A 3OW8A 4AOWA 4GMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRW B;  4L9O A;  4A0B B;  5FQD A;  3E0C A;  4D6V A;  2P9S C;  3CFV A;  4J8G A;  1FWX A;  4PNK B;  2I0T A;  3PXS D;  4CI8 A;  5IGO A;  1N6F A;  3JAM g;  1GP2 B;  3PSL A;  4ES0 A;  4GGA A;  2UZX B;  4FA1 D;  3JZG A;  4ERZ A;  4JT5 C;  2J55 H;  5H17 A;  4JXM A;  1JMX B;  3C5M A;  5TEF A;  2Z2N A;  2PM9 B;  2W18 A;  4A0A A;  1TYQ C;  4J0X A;  4ERY A;  4GQ2 P;  5HE3 B;  3MZK A;  2OIZ A;  2QC5 A;  2AGW A;  3C75 H;  2CO0 C;  4XEI C;  5TDH B;  1SQJ A;  2IUR A;  3JRP A;  3RSE C;  4KFM B;  4JSP C;  3EI4 B;  4CY1 A;  4H5I A;  2OVP B;  5EAR A;  4A11 B;  3NVX A;  4Y7R A;  2IUP A;  3SBR A;  1K8K C;  3C9C A;  4J84 A;  5EAL A;  1RI6 A;  3RRM C;  2BBK H;  4J77 A;  2GC4 A;  2CE9 A;  4OWR A;  5EM2 B;  2H68 A;  4K3J B;  2Z2P A;  3F3F A;  1JJU B;  3EI1 A;  3PVW B;  2HJB A;  3RLM D;  4GGD A;  5K1C C;  5HE0 B;  2G99 A;  3OL2 A;  3VGZ A;  5GMK n;  3OKY A;  5FKT A;  2AGL A;  5HE2 B;  4ERQ A;  5EMJ B;  3DXK C;  4OZU A;  3NVN A;  4CC9 A;  4JD2 C;  3V5W B;  5HYN B;  4O45 A;  2G9A A;  3K27 A;  2AQ5 A;  4FWW A;  4L3H D;  4XYI A;  2IUQ A;  5C2V B;  4J78 A;  5C9Z B;  4ZOZ A;  1GOT B;  5H14 A;  1MG2 A;  2AH1 A;  4O9D A;  3I8C A;  2HJ4 A;  2Q7Q A;  5CXB A;  5AMS A;  3PE7 A;  4L1Q D;  4J73 A;  3UR4 A;  4A2L A;  2GC7 A;  2EBS A;  1OMW B;  2OJY A;  4E5Z A;  4GM8 A;  4LG9 A;  3I7N A;  3EWE A;  3DM0 A;  4JSX C;  4A0A B;  3IKO A;  3J81 g;  2YBA A;  2BCJ B;  3I2N A;  4FAN D;  2YNO A;  1PBY B;  3L4M D;  1YFQ A;  4CI2 A;  5GXI A;  2CO0 A;  2I0S A;  2H13 A;  3EI2 A;  3UVN A;  1GG2 B;  5I5M A;  4E54 A;  5FKQ A;  1OLZ A;  3I7K A;  3AH8 B;  3ORV D;  3OKT A;  1L0Q A;  4R7A B;  4XYH A;  4N14 A;  4ZOX A;  5I5I A;  3BWS A;  3SBP A;  3SWS D;  4JSV C;  4GZ8 A;  3EI1 B;  2XL3 A;  1B9X A;  3UKR C;  3UVM A;  3OL2 B;  4ZN4 A;  3MKQ A;  5EAP A;  4U7A A;  3OKY B;  5TEE A;  3SBQ A;  4JSN C;  2Z2O A;  4J8B A;  2H47 A;  4PBY A;  3SFZ A;  3MKS B;  3UKU C;  3IJ1 A;  5EMM B;  4GM9 A;  1N6E A;  5KDO B;  2AH0 A;  2HYE A;  4PBZ A;  2B5N A;  4ZOV A;  4PXW A;  5IT9 g;  4QT8 A;  4A09 A;  3NVQ A;  1MG3 A;  3PSC B;  2P9N C;  2B5L A;  5AFU 3;  3JB9 L;  2QXV A;  5CXB B;  2AGY A;  2OVR B;  3PVU B;  3I7L A;  2H9L A;  2O9K A;  1A0R B;  4E5Z B;  3I7H A;  2AGZ A;  3UVO A;  4PSW B;  4I79 A;  3GRE A;  4A2M A;  5FLX g;  2CN3 A;  3RN0 D;  4H5J A;  4CZX A;  5SXM A;  3OKW A;  3OTT A;  3W15 A;  4O1Q D;  3AFC A;  2P9U C;  4LGN A;  4JT6 C;  3JZN A;  2GNQ A;  3EI2 B;  5EML B;  4QRJ A;  5AJA A;  4E54 B;  3AL9 A;  4K3I D;  5EMK B;  3EI3 A;  3N0E A;  1PEV A;  4O3T B;  5FA5 B;  3L4O D;  4Y5R D;  1GXR A;  1VYH C;  4A08 A;  4CZY A;  4MK0 B;  3IIY A;  3UVL A;  4GQ1 A;  4L3G D;  1XHM A;  5H1M A;  3AL8 A;  3FGB A;  3SCY A;  1JMZ B;  5IJ8 E;  3K26 A;  3F3P A;  5TF2 A;  4CI1 A;  5IGQ A;  1TBG A;  4BH6 A;  1NR0 A;  3HFQ A;  4PC0 A;  4CI3 A;  2IWK A;  4FA4 D;  2XYI A;  5CXC A;  2H6K A;  1ERJ A;  2OK6 A;  2IUV A;  2HKR A;  2J57 G;  4ZOY A;  2H9M A;  3I89 A;  2HXC A;  4G56 B;  3SJL D;  4QL1 A;  4J81 A;  3MZL A;  2HKM A;  1N6D A;  3UVK A;  2PBI B;  4YVD A;  3VH0 A;  4A09 B;  2YMU A;  2I3S A;  5FXY A;  5CYK A;  4GM3 A;  3BG0 A;  2OVQ B;  4EWR A;  2CE8 A;  5K19 A;  2H9P A;  5IC7 A;  2I3T A;  3VA6 A;  4ESG A;  3U4Y A;  4X61 B;  3SLE D;  1MDA H;  1SQ9 A;  3JRO A;  4D0K A;  2OK4 A;  3ULE C;  2TRC B;  4A7J A;  2PM7 B;  4BUJ C;  4X60 B;  3EU7 A;  4J87 A;  4Z8L A;  3FRX A;  4FB1 D;  2IAA A;  3SMR A;  4J79 A;  2CN2 A;  3EMH A;  3C99 A;  3EI3 B;  4GQB B;  4IA9 A;  3V7D B;  1JOF A;  4BL0 A;  1U4C A;  3CIK B;  5GXH A;  3IIW A;  4AEZ A;  1PI6 A;  3MMY A;  4IMM A;  4CY2 A;  4A08 B;  5HE1 B;  4O3U B;  2H3X A;  2YB8 B;  4U1E I;  3AL8 B;  1XIP A;  3ZWL B;  5IJ7 E;  4FHL A;  4J86 A;  1SHY B;  2MTA H;  4A0B A;  3PXT D;  2YNP A;  5I5J A;  2H6N A;  5CXC B;  5B4W A;  5A2Q g;  1NEX B;  5THA A;  3KRX B;  3EG6 A;  4LG8 A;  2AGX A;  3B7F A;  4UI9 R;  3SN6 B;  5JWZ A;  5FKR A;  4PSX B;  3IJ0 A;  4TZ4 A;  4GGC A;  1PGU A;  2P9L C;  1R5M A;  3DSM A;  3MXX A;  5EAM A;  1K32 A;  4NSX A;  5CYK B;  2I0R A;  5C2W B;  1P22 A;  2PM9 A;  2PM6 B;  3ODT A;  4QQE A;  3I7O A;  3DWL C;  2YNN A;  3I8E A;  2B4E A;  3RFH A;  4CY5 A;  4X63 B;  4FA9 D;  5HQG A;  3RFG A;  4CZV A;  4X3E A;  1XKS A;  2P9K C;  3P4F A;  1QNI A;  5GSA A;  3CFS B;  2H6Q A;  3PXW D;  3N0D A;  2XU7 A;  2XL2 A;  3J80 g;  3GFC A;  3SXT D;  3SVW D;  3EI4 A;  2P9I C;  3I7P A;  1B9Y A;  2UZY B;  3RN1 D;  4FAV D;  2H14 A;  4A11 A;  3JPX A;  4J0W A;  1Q47 A;  3RMZ D;  2J56 H;  2CNX A;  4FA5 D;  3FM0 A;  2IWF A;  3DXM C;  4CY3 A;  3A0F A;  4HDJ A;  5EM2 A;  1U2V C;  5FKS A;  1S4U X;  3V9F A;  2HES X;  3BG1 A;  3IJC A;  3JZH A;  2P9P C;  3F3G A;  3SHF A;  2B5M A;  2H9N A;  4J82 A;  3OW8 A;  4AOW A;  4GMB A; 
#chains in the Genus database with same CATH topology
 3KRW B;  4L9O A;  2HU7 A;  4A0B B;  5FQD A;  3E0C A;  1U8C A;  4D6V A;  3EQ7 A;  2P9S C;  4IRZ A;  3CFV A;  4J8G A;  1FWX A;  4BCC A;  4PNK B;  2I0T A;  2HU8 A;  3PXS D;  4CI8 A;  5IGO A;  1N6F A;  3JAM g;  1GP2 B;  3PSL A;  5E6U A;  3ZDY A;  4ES0 A;  4GGA A;  2UZX B;  4FA1 D;  3JZG A;  4ERZ A;  4JT5 C;  1L5G A;  2J55 H;  5H17 A;  4JXM A;  1JMX B;  3C5M A;  5TEF A;  2Z2N A;  2PM9 B;  2W18 A;  4A0A A;  4G55 A;  1TYQ C;  4DNV A;  4J0X A;  4ERY A;  4GQ2 P;  5HE3 B;  3MZK A;  2OIZ A;  2QC5 A;  2AGW A;  4QAM A;  3C75 H;  2CO0 C;  4XEI C;  2VDQ A;  4O2W A;  5FFG A;  2VC2 A;  5TDH B;  1M1X A;  1SQJ A;  2IUR A;  3O4I A;  3JRP A;  3NID A;  3RSE C;  1O6F A;  4KFM B;  4JSP C;  3EI4 B;  4CY1 A;  4H5I A;  4NEN A;  2OVP B;  5EAR A;  4A11 B;  3NVX A;  4Y7R A;  2IUP A;  3SBR A;  1K8K C;  3C9C A;  4J84 A;  4L1M A;  2JKX A;  5EAL A;  1RI6 A;  3RRM C;  2BBK H;  4J77 A;  2GC4 A;  2CE9 A;  4OWR A;  2VDO A;  5EM2 B;  2H68 A;  4K3J B;  2Z2P A;  3V4P A;  3V4V A;  4AMY A;  3F3F A;  1JJU B;  3EI1 A;  3GC3 B;  2HJB A;  3PVW B;  3RLM D;  4GGD A;  5K1C C;  5HE0 B;  2G99 A;  3OL2 A;  3VGZ A;  5GMK n;  3OKY A;  2XE4 A;  5FKT A;  4JHP C;  2AGL A;  5HE2 B;  1H2W A;  1A12 A;  4ERQ A;  5EMJ B;  4AX4 A;  3DXK C;  4OZU A;  3NVN A;  4CC9 A;  4JD2 C;  3V5W B;  5HYN B;  4O45 A;  1C9L A;  4NAA A;  4Z7N A;  2G9A A;  3K27 A;  2AQ5 A;  4FWW A;  4L3H D;  4XYI A;  2IUQ A;  1JTD B;  3MVD K;  5C2V B;  4J78 A;  5C9Z B;  4ZOZ A;  1GOT B;  5H14 A;  1MG2 A;  2AH1 A;  2BKL A;  5M61 A;  4O9D A;  3I8C A;  2HJ4 A;  2Q7Q A;  1UOQ A;  5CXB A;  4DNW A;  1H2Y A;  5AMS A;  3PE7 A;  4L1Q D;  5E6S A;  4J73 A;  1GOH A;  3UR4 A;  4A2L A;  1VE6 A;  2EBS A;  2GC7 A;  1OMW B;  2OJY A;  4E5Z A;  4GM8 A;  4LG9 A;  3I7N A;  3EWE A;  3DM0 A;  4JSX C;  4A0A B;  3IKO A;  3J81 g;  2YBA A;  2BCJ B;  1O6G A;  3I2N A;  4FAN D;  2YNO A;  1PBY B;  3L4M D;  4BP8 A;  1YFQ A;  4CI2 A;  5GXI A;  1TYE A;  2CO0 A;  2I0S A;  4NBM A;  2H13 A;  3EI2 A;  4RE5 A;  1GG2 B;  3UVN A;  5I5M A;  4JHN A;  4E54 A;  3IUJ A;  5FKQ A;  1OLZ A;  3I7K A;  3AH8 B;  3ORV D;  4MMX A;  3OKT A;  1L0Q A;  3MUN A;  4R7A B;  4XYH A;  3MUO A;  4WJK A;  5C92 A;  3K6S A;  3VI3 A;  4N14 A;  4ZOX A;  5HDB A;  3NIG A;  5I5I A;  3BWS A;  3SBP A;  3SWS D;  5E6R A;  4JSV C;  4GZ8 A;  3EI1 B;  2XL3 A;  1B9X A;  3UKR C;  3UVM A;  3OL2 B;  2VDK A;  4ZN4 A;  3MKQ A;  5EAP A;  4U7A A;  3OKY B;  5TEE A;  3SBQ A;  4JSN C;  2Z2O A;  2VDM A;  4J8B A;  5M5T A;  2H47 A;  4PBY A;  3SFZ A;  3MKS B;  3UKU C;  1T2X A;  3IJ1 A;  5EMM B;  1E8N A;  4GM9 A;  1N6E A;  5KDO B;  1BPO A;  2AH0 A;  2HYE A;  4PBZ A;  2B5N A;  4ZOV A;  4PXW A;  2QZP A;  3O4H A;  5IT9 g;  4QT8 A;  4UM8 A;  4A09 A;  3NVQ A;  1MG3 A;  3PSC B;  2P9N C;  2B5L A;  2WQ8 A;  1UOO A;  5AFU 3;  3JB9 L;  2QXV A;  5CXB B;  2AGY A;  2OVR B;  3PVU B;  3I7L A;  2H9L A;  4Z7O A;  2O9K A;  1A0R B;  4WK2 A;  3ZE1 A;  2XDW A;  3EQ9 A;  3I7H A;  4E5Z B;  2AGZ A;  3UVO A;  4PSW B;  4I79 A;  3GRE A;  4A2M A;  5FLX g;  2CN3 A;  3RN0 D;  4H5J A;  4CZX A;  4MMY A;  4MMZ A;  5SXM A;  3OKW A;  3OTT A;  3W15 A;  1GOF A;  4O1Q D;  3AFC A;  2P9U C;  2VZ1 A;  4RE6 A;  4LGN A;  1C9I A;  4JT6 C;  3JZN A;  4AN0 A;  2GNQ A;  3EI2 B;  4BP9 A;  5EML B;  4QRJ A;  5AJA A;  4E54 B;  3T3M A;  3AL9 A;  4K3I D;  3KCI A;  5EMK B;  2VDR A;  3EI3 A;  3N0E A;  1PEV A;  4O3T B;  5FA5 B;  3L4O D;  1K3I A;  4Y5R D;  3ZE2 A;  1GXR A;  1VYH C;  4A08 A;  4CZY A;  1H2Z A;  4MK0 B;  4WK0 A;  3IIY A;  4BCB A;  3UVL A;  4AMZ A;  1GOG A;  4GQ1 A;  4L3G D;  1XHM A;  5H1M A;  3AL8 A;  3FGB A;  1UTC A;  4D9S A;  3SCY A;  1JMZ B;  5IJ8 E;  3K26 A;  3NIF A;  3F3P A;  5TF2 A;  4CI1 A;  5IGQ A;  1TBG A;  3IUQ A;  4BH6 A;  1NR0 A;  3HFQ A;  4PC0 A;  3O4J A;  4CI3 A;  2IWK A;  4FA4 D;  5M5U A;  2XYI A;  5CXC A;  3DDU A;  2H6K A;  1ERJ A;  2OK6 A;  2IUV A;  2HKR A;  2J57 G;  2VDL A;  4ZOY A;  2H9M A;  3I89 A;  2HXC A;  2EID A;  4G56 B;  3SJL D;  4QL1 A;  4J81 A;  3MZL A;  3IJE A;  2HKM A;  1N6D A;  3UVK A;  2PBI B;  1VE7 A;  4YVD A;  3VH0 A;  4A09 B;  2YMU A;  2I3S A;  5FXY A;  5CYK A;  4GM3 A;  4O02 A;  1VZ2 A;  3BG0 A;  2OVQ B;  4EWR A;  2CE8 A;  1H2X A;  5K19 A;  2H9P A;  1E5T A;  5IC7 A;  2EIC A;  2I3T A;  3VA6 A;  2QR5 A;  3ZDZ A;  4ESG A;  3U4Y A;  4X61 B;  3SLE D;  1MDA H;  1SQ9 A;  3JRO A;  5M5V A;  2EIE A;  4D0K A;  3QHY B;  2OK4 A;  3ULE C;  2TRC B;  4A7J A;  2PM7 B;  4BUJ C;  1VZ3 A;  4X60 B;  3EU7 A;  4J87 A;  4Z8L A;  3FRX A;  4FB1 D;  2XZG A;  2IAA A;  4G1M A;  3SMR A;  4J79 A;  2CN2 A;  3EMH A;  3C99 A;  3EI3 B;  4GQB B;  1QFS A;  4IA9 A;  3V7D B;  1JOF A;  1UOP A;  3ZE0 A;  4BL0 A;  3K72 A;  1U4C A;  3CIK B;  5GXH A;  3IIW A;  4AEZ A;  1PI6 A;  3MMY A;  4IMM A;  4CY2 A;  4A08 B;  5HE1 B;  3GD1 I;  4O3U B;  3QI0 A;  2H3X A;  2YB8 B;  4DNU A;  4U1E I;  1QFM A;  3AL8 B;  1XIP A;  3ZWL B;  2VZ3 A;  5IJ7 E;  4FHL A;  3ZDX A;  4J86 A;  1SHY B;  2MTA H;  5FFO A;  4A0B A;  3PXT D;  2YNP A;  5I5J A;  2H6N A;  5CXC B;  5B4W A;  5A2Q g;  1NEX B;  3IUN A;  4UM9 A;  4G1E A;  5THA A;  3KRX B;  3T3P A;  2HU5 A;  3EG6 A;  1E8M A;  4LG8 A;  2AGX A;  3B7F A;  4UI9 R;  3SN6 B;  5JWZ A;  4Z7Q A;  5FKR A;  4PSX B;  3IJ0 A;  4TZ4 A;  4GGC A;  1PGU A;  2P9L C;  1R5M A;  3DSM A;  3MXX A;  5EAM A;  2VDN A;  1K32 A;  4NSX A;  5CYK B;  2I0R A;  5C2W B;  1P22 A;  2PM9 A;  2PM6 B;  5M5R A;  4AN1 A;  4BCD A;  3ODT A;  3IVM A;  4QQE A;  5M5S A;  3I7O A;  3DWL C;  2YNN A;  3I8E A;  2B4E A;  3RFH A;  4CY5 A;  4X63 B;  4FA9 D;  3K71 A;  3IUM A;  5HQG A;  3RFG A;  4CZV A;  4X3E A;  1XKS A;  2P9K C;  4NC4 A;  3P4F A;  1QNI A;  5GSA A;  3CFS B;  2H6Q A;  4WK4 A;  3PXW D;  3N0D A;  2XU7 A;  2XL2 A;  3J80 g;  2VDP A;  3GFC A;  3SXT D;  3FCS A;  3SVW D;  5C86 A;  3EI4 A;  2P9I C;  3I7P A;  1B9Y A;  2UZY B;  3RN1 D;  1YR2 A;  4FAV D;  2H14 A;  3EQ8 A;  4A11 A;  3JPX A;  4J0W A;  1Q47 A;  3O4G A;  3RMZ D;  2J56 H;  2CNX A;  4FA5 D;  3FM0 A;  3IUR A;  2IWF A;  3DXM C;  4CY3 A;  3A0F A;  4HDJ A;  3VI4 A;  5EM2 A;  1U2V C;  3IUL A;  5FKS A;  1S4U X;  3V9F A;  2HES X;  3BG1 A;  3JZH A;  3IJC A;  2P9P C;  2EIB A;  3FCU A;  3OF7 A;  3F3G A;  3SHF A;  2B5M A;  1JV2 A;  2H9N A;  1I2M B;  4J82 A;  3OW8 A;  4AOW A;  4GMB A; 
#chains in the Genus database with same CATH homology
 3KRW B;  4L9O A;  4A0B B;  5FQD A;  3E0C A;  4D6V A;  2P9S C;  3CFV A;  4J8G A;  1FWX A;  4PNK B;  2I0T A;  3PXS D;  4CI8 A;  5IGO A;  1N6F A;  3JAM g;  1GP2 B;  3PSL A;  4ES0 A;  4GGA A;  2UZX B;  4FA1 D;  3JZG A;  4ERZ A;  4JT5 C;  2J55 H;  5H17 A;  4JXM A;  1JMX B;  3C5M A;  5TEF A;  2Z2N A;  2PM9 B;  2W18 A;  4A0A A;  1TYQ C;  4J0X A;  4ERY A;  4GQ2 P;  5HE3 B;  3MZK A;  2OIZ A;  2QC5 A;  2AGW A;  3C75 H;  2CO0 C;  4XEI C;  5TDH B;  1SQJ A;  2IUR A;  3JRP A;  3RSE C;  4KFM B;  4JSP C;  3EI4 B;  4CY1 A;  4H5I A;  2OVP B;  5EAR A;  4A11 B;  3NVX A;  4Y7R A;  2IUP A;  3SBR A;  1K8K C;  3C9C A;  4J84 A;  5EAL A;  1RI6 A;  3RRM C;  2BBK H;  4J77 A;  2GC4 A;  2CE9 A;  4OWR A;  5EM2 B;  2H68 A;  4K3J B;  2Z2P A;  3F3F A;  1JJU B;  3EI1 A;  3PVW B;  2HJB A;  3RLM D;  4GGD A;  5K1C C;  5HE0 B;  2G99 A;  3OL2 A;  3VGZ A;  5GMK n;  3OKY A;  5FKT A;  2AGL A;  5HE2 B;  4ERQ A;  5EMJ B;  3DXK C;  4OZU A;  3NVN A;  4CC9 A;  4JD2 C;  3V5W B;  5HYN B;  4O45 A;  2G9A A;  3K27 A;  2AQ5 A;  4FWW A;  4L3H D;  4XYI A;  2IUQ A;  5C2V B;  4J78 A;  5C9Z B;  4ZOZ A;  1GOT B;  5H14 A;  1MG2 A;  2AH1 A;  4O9D A;  3I8C A;  2HJ4 A;  2Q7Q A;  5CXB A;  5AMS A;  3PE7 A;  4L1Q D;  4J73 A;  3UR4 A;  4A2L A;  2GC7 A;  2EBS A;  1OMW B;  2OJY A;  4E5Z A;  4GM8 A;  4LG9 A;  3I7N A;  3EWE A;  3DM0 A;  4JSX C;  4A0A B;  3IKO A;  3J81 g;  2YBA A;  2BCJ B;  3I2N A;  4FAN D;  2YNO A;  1PBY B;  3L4M D;  1YFQ A;  4CI2 A;  5GXI A;  2CO0 A;  2I0S A;  2H13 A;  3EI2 A;  3UVN A;  1GG2 B;  5I5M A;  4E54 A;  5FKQ A;  1OLZ A;  3I7K A;  3AH8 B;  3ORV D;  3OKT A;  1L0Q A;  4R7A B;  4XYH A;  4N14 A;  4ZOX A;  5I5I A;  3BWS A;  3SBP A;  3SWS D;  4JSV C;  4GZ8 A;  3EI1 B;  2XL3 A;  1B9X A;  3UKR C;  3UVM A;  3OL2 B;  4ZN4 A;  3MKQ A;  5EAP A;  4U7A A;  3OKY B;  5TEE A;  3SBQ A;  4JSN C;  2Z2O A;  4J8B A;  2H47 A;  4PBY A;  3SFZ A;  3MKS B;  3UKU C;  3IJ1 A;  5EMM B;  4GM9 A;  1N6E A;  5KDO B;  2AH0 A;  2HYE A;  4PBZ A;  2B5N A;  4ZOV A;  4PXW A;  5IT9 g;  4QT8 A;  4A09 A;  3NVQ A;  1MG3 A;  3PSC B;  2P9N C;  2B5L A;  5AFU 3;  3JB9 L;  2QXV A;  5CXB B;  2AGY A;  2OVR B;  3PVU B;  3I7L A;  2H9L A;  2O9K A;  1A0R B;  4E5Z B;  3I7H A;  2AGZ A;  3UVO A;  4PSW B;  4I79 A;  3GRE A;  4A2M A;  5FLX g;  2CN3 A;  3RN0 D;  4H5J A;  4CZX A;  5SXM A;  3OKW A;  3OTT A;  3W15 A;  4O1Q D;  3AFC A;  2P9U C;  4LGN A;  4JT6 C;  3JZN A;  2GNQ A;  3EI2 B;  5EML B;  4QRJ A;  5AJA A;  4E54 B;  3AL9 A;  4K3I D;  5EMK B;  3EI3 A;  3N0E A;  1PEV A;  4O3T B;  5FA5 B;  3L4O D;  4Y5R D;  1GXR A;  1VYH C;  4A08 A;  4CZY A;  4MK0 B;  3IIY A;  3UVL A;  4GQ1 A;  4L3G D;  1XHM A;  5H1M A;  3AL8 A;  3FGB A;  3SCY A;  1JMZ B;  5IJ8 E;  3K26 A;  3F3P A;  5TF2 A;  4CI1 A;  5IGQ A;  1TBG A;  4BH6 A;  1NR0 A;  3HFQ A;  4PC0 A;  4CI3 A;  2IWK A;  4FA4 D;  2XYI A;  5CXC A;  2H6K A;  1ERJ A;  2OK6 A;  2IUV A;  2HKR A;  2J57 G;  4ZOY A;  2H9M A;  3I89 A;  2HXC A;  4G56 B;  3SJL D;  4QL1 A;  4J81 A;  3MZL A;  2HKM A;  1N6D A;  3UVK A;  2PBI B;  4YVD A;  3VH0 A;  4A09 B;  2YMU A;  2I3S A;  5FXY A;  5CYK A;  4GM3 A;  3BG0 A;  2OVQ B;  4EWR A;  2CE8 A;  5K19 A;  2H9P A;  5IC7 A;  2I3T A;  3VA6 A;  4ESG A;  3U4Y A;  4X61 B;  3SLE D;  1MDA H;  1SQ9 A;  3JRO A;  4D0K A;  2OK4 A;  3ULE C;  2TRC B;  4A7J A;  2PM7 B;  4BUJ C;  4X60 B;  3EU7 A;  4J87 A;  4Z8L A;  3FRX A;  4FB1 D;  2IAA A;  3SMR A;  4J79 A;  2CN2 A;  3EMH A;  3C99 A;  3EI3 B;  4GQB B;  4IA9 A;  3V7D B;  1JOF A;  4BL0 A;  1U4C A;  3CIK B;  5GXH A;  3IIW A;  4AEZ A;  1PI6 A;  3MMY A;  4IMM A;  4CY2 A;  4A08 B;  5HE1 B;  4O3U B;  2H3X A;  2YB8 B;  4U1E I;  3AL8 B;  1XIP A;  3ZWL B;  5IJ7 E;  4FHL A;  4J86 A;  1SHY B;  2MTA H;  4A0B A;  3PXT D;  2YNP A;  5I5J A;  2H6N A;  5CXC B;  5B4W A;  5A2Q g;  1NEX B;  5THA A;  3KRX B;  3EG6 A;  4LG8 A;  2AGX A;  3B7F A;  4UI9 R;  3SN6 B;  5JWZ A;  5FKR A;  4PSX B;  3IJ0 A;  4TZ4 A;  4GGC A;  1PGU A;  2P9L C;  1R5M A;  3DSM A;  3MXX A;  5EAM A;  1K32 A;  4NSX A;  5CYK B;  2I0R A;  5C2W B;  1P22 A;  2PM9 A;  2PM6 B;  3ODT A;  4QQE A;  3I7O A;  3DWL C;  2YNN A;  3I8E A;  2B4E A;  3RFH A;  4CY5 A;  4X63 B;  4FA9 D;  5HQG A;  3RFG A;  4CZV A;  4X3E A;  1XKS A;  2P9K C;  3P4F A;  1QNI A;  5GSA A;  3CFS B;  2H6Q A;  3PXW D;  3N0D A;  2XU7 A;  2XL2 A;  3J80 g;  3GFC A;  3SXT D;  3SVW D;  3EI4 A;  2P9I C;  3I7P A;  1B9Y A;  2UZY B;  3RN1 D;  4FAV D;  2H14 A;  4A11 A;  3JPX A;  4J0W A;  1Q47 A;  3RMZ D;  2J56 H;  2CNX A;  4FA5 D;  3FM0 A;  2IWF A;  3DXM C;  4CY3 A;  3A0F A;  4HDJ A;  5EM2 A;  1U2V C;  5FKS A;  1S4U X;  3V9F A;  2HES X;  3BG1 A;  3IJC A;  3JZH A;  2P9P C;  3F3G A;  3SHF A;  2B5M A;  2H9N A;  4J82 A;  3OW8 A;  4AOW A;  4GMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...