3P4FA

Structural and biochemical insights into mll1 core complex assembly and regulation.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title Structural and biochemical insights into MLL1 core complex assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3p4fA00
3BG1A 3NVXA 5HE2B 5IGQA 2H3XA 4L9OA 3SFZA 4ERQA 5CXCB 1NEXB 1K8KC 1PI6A 4GQ2P 3A0FA 3I89A 4AOWA 5K1CC 4Z8LA 4PNKB 4GGAA 3OL2B 1SQJA 2YMUA 3EI2A 2UZXB 4J86A 5SXMA 3IJ1A 3MMYA 4AEZA 1PEVA 3UVKA 3MXXA 5EMLB 4J8GA 4A09B 2H13A 2AGLA 3L4OD 3ZWLB 5HYNB 3DXMC 4L3GD 5EMJB 1FWXA 4LG9A 4GQBB 2IAAA 2Q7QA 3SCYA 3UVOA 5EM2A 1L0QA 3OKTA 3PXWD 4J0WA 4KFMB 4FA1D 4J81A 4J8BA 4A11B 3MZKA 4CI3A 3SVWD 2YB8B 2HJ4A 4J82A 4ES0A 4CY3A 5JWZA 4E54B 1K32A 3EI3B 4CY2A 4A0BB 2CO0C 2I0TA 4IMMA 2XU7A 5CXCA 5IGOA 3SN6B 1SHYB 4PSXB 3JPXA 3SBPA 5H14A 4N14A 2B5NA 4K3ID 5HQGA 4ZOVA 3OW8A 1U4CA 3SBRA 2GNQA 3OKYB 3RFGA 5C2WB 2PM9A 4CI1A 4A2MA 2P9KC 4O1QD 2UZYB 1ERJA 5B4WA 4D6VA 4J78A 3L4MD 3CFSB 5A2Qg 4ESGA 3MZLA 5GXHA 2B4EA 4CY1A 3RSEC 2H6QA 3C99A 3EMHA 2OVRB 3K26A 4TZ4A 1OLZA 2Z2NA 1XHMA 3EU7A 3J80g 4CZXA 5HE1B 5EM2B 5TDHB 3W15A 4A11A 4UI9R 4JSPC 3I7LA 3SHFA 5FLXg 3FGBA 5I5JA 2J57G 5FXYA 3EI3A 4ZOZA 5EALA 4A0BA 2GC7A 2TRCB 3MKSB 3DXKC 4PXWA 2G99A 2IWKA 1MG3A 3I7OA 2CE9A 4XYHA 3RMZD 3I2NA 3I7KA 3V9FA 4E5ZB 2PBIB 3AL9A 3JROA 2BCJB 4PC0A 3UKUC 3C5MA 2H9PA 1PBYB 3C75H 3UR4A 3F3FA 3NVNA 3OKYA 2AGWA 2P9PC 5C9ZB 1Q47A 5H17A 3HFQA 3I7NA 4CZVA 3C9CA 3ULEC 2YNPA 4QL1A 5K19A 4GQ1A 5FQDA 2PM9B 3SXTD 1MDAH 2HKRA 3SMRA 1N6FA 4BL0A 1XIPA 2AGYA 4PBZA 3V7DB 2YBAA 3V5WB 5FKQA 4D0KA 5C2VB 2CN2A 2IURA 2QC5A 4FB1D 4A0AB 3PVUB 5EAPA 4A7JA 5EAMA 3UVNA 3I8EA 1SQ9A 1S4UX 3UVLA 3GREA 1N6EA 3AL8B 5THAA 4ERZA 2Z2OA 5TF2A 4EWRA 3JAMg 3F3PA 4O3TB 2IUQA 2XL3A 3KRXB 4H5IA 5GMKn 2AH0A 4E5ZA 2H68A 2CO0A 2HJBA 4IA9A 4X3EA 1TYQC 2H14A 4CY5A 2H6KA 3SWSD 3OKWA 4QQEA 3IKOA 3VA6A 2CNXA 4FA9D 3N0EA 1RI6A 2PM6B 1A0RB 4X61B 1VYHC 1B9YA 4QT8A 3RRMC 5HE3B 2OIZA 5FKRA 4L3HD 3OTTA 2IUVA 4HDJA 4A08A 3BG0A 2O9KA 4X63B 4GGDA 4A0AA 2I3TA 3IIWA 4G56B 4O3UB 2J55H 5AJAA 3UVMA 3RN1D 3PSCB 4Y5RD 5FA5B 3IJ0A 2I0RA 2CN3A 5EMMB 4GM3A 3U4YA 3AL8A 2H6NA 2H9MA 2I0SA 5FKSA 2OJYA 5CXBB 2OVPB 4ZOYA 4PSWB 3I7HA 5I5MA 3GFCA 2H47A 2EBSA 3RLMD 3PSLA 5IJ7E 3EG6A 3PE7A 3RFHA 3K27A 2I3SA 5TEFA 3UKRC 4GM9A 4BUJC 2IWFA 4OZUA 3DM0A 3RN0D 4FA5D 5I5IA 4J87A 3I7PA 5H1MA 4O45A 5IJ8E 4CI2A 1P22A 3EWEA 4XYIA 1U2VC 4ZOXA 1NR0A 4BH6A 3J81g 2B5LA 2H9NA 3JRPA 4FAVD 1JMXB 1XKSA 2AGZA 4ERYA 3FM0A 4R7AB 3VGZA 3SJLD 2XYIA 3NVQA 4A08B 4LGNA 5EARA 4J77A 4QRJA 1GXRA 4GGCA 4LG8A 2PM7B 1R5MA 2P9SC 3FRXA 1MG2A 2YNOA 5FKTA 2P9LC 4JT6C 4U7AA 4FA4D 1GP2B 2H9LA 5CXBA 4I79A 4A2LA 1TBGA 2CE8A 5HE0B 4FHLA 3IJCA 3AH8B 3AFCA 4L1QD 1QNIA 2AQ5A 3EI1B 3CFVA 4H5JA 3PVWB 1GOTB 2P9UC 4JSXC 5GSAA 4U1EI 3EI4A 3PXSD 4J73A 3JZHA 3ODTA 2HXCA 5TEEA 4CZYA 2J56H 1JMZB 3BWSA 4JSVC 5CYKA 5CYKB 1JOFA 4J84A 1YFQA 4MK0B 2MTAH 3IIYA 4Y7RA 2P9NC 2G9AA 3ORVD 5KDOB 2AGXA 4CC9A 4GM8A 1OMWB 3P4FA 3OL2A 3E0CA 2W18A 4JT5C 2AH1A 4GMBA 3EI2B 1N6DA 4OWRA 5AMSA 2GC4A 4A09A 4K3JB 2HKMA 4X60B 1B9XA 3B7FA 4PBYA 2XL2A 2HYEA 5IC7A 3SLED 2OK6A 3N0DA 3MKQA 5EMKB 3JB9L 4J79A 4YVDA 2BBKH 4FAND 3KRWB 4O9DA 3EI1A 3PXTD 2Z2PA 1GG2B 4JD2C 4ZN4A 4FWWA 4JSNC 3VH0A 5AFU3 2IUPA 1JJUB 3JZGA 1PGUA 3CIKB 3DWLC 2HESX 3F3GA 2QXVA 3JZNA 4GZ8A 4JXMA 3EI4B 4J0XA 5IT9g 3DSMA 3I8CA 4E54A 2OVQB 4CI8A 2OK4A 2YNNA 5GXIA 3SBQA 4NSXA 2P9IC 4XEIC 2B5MA
chains in the Genus database with same CATH superfamily
3BG1A 3NVXA 5HE2B 3DDUA 5IGQA 2H3XA 4L9OA 1A12A 1GOHA 3SFZA 4ERQA 5CXCB 1NEXB 1K8KC 1M1XA 1PI6A 4GQ2P 1QFMA 4L1MA 3A0FA 3I89A 3T3PA 4AOWA 5K1CC 4Z8LA 4PNKB 4GGAA 3OL2B 1SQJA 2YMUA 3EI2A 2UZXB 4J86A 5SXMA 3IJ1A 3MMYA 4AEZA 3FCUA 1PEVA 3UVKA 4BCCA 4O02A 3K71A 1H2YA 3MXXA 2VDMA 5EMLB 4J8GA 4A09B 2H13A 1C9IA 2VDQA 2HU7A 2AGLA 3L4OD 2EIBA 2VZ1A 3ZWLB 3ZE0A 1TYEA 5HYNB 4BCBA 3DXMC 4L3GD 5EMJB 4DNVA 1FWXA 4LG9A 4GQBB 2IAAA 2Q7QA 3SCYA 1L5GA 5EM2A 3UVOA 1L0QA 3OKTA 3PXWD 3O4GA 4J0WA 4KFMB 4FA1D 4J81A 4J8BA 3NIDA 4A11B 5M5TA 3OF7A 3MZKA 4CI3A 3SVWD 2YB8B 2HJ4A 3O4JA 4J82A 4ES0A 4G1EA 4CY3A 5JWZA 4E54B 1K32A 2JKXA 3EI3B 4CY2A 4A0BB 2CO0C 2I0TA 4IMMA 2XU7A 5CXCA 5IGOA 3SN6B 3ZE2A 1SHYB 4PSXB 3JPXA 3SBPA 5H14A 4N14A 2B5NA 4K3ID 5HQGA 4ZOVA 3OW8A 4DNWA 3QHYB 1VZ2A 3ZDZA 4NBMA 1U4CA 3SBRA 2GNQA 3OKYB 3RFGA 5C2WB 2PM9A 4CI1A 3EQ7A 3IUMA 4A2MA 2P9KC 3GD1I 4O1QD 2UZYB 1ERJA 5E6RA 5B4WA 4D6VA 3L4MD 4J78A 3CFSB 5A2Qg 4ESGA 3MZLA 5GXHA 2B4EA 4CY1A 3RSEC 4WJKA 4WK0A 2H6QA 3C99A 3EMHA 2OVRB 1VE6A 3K26A 3IUJA 4TZ4A 1I2MB 1OLZA 2Z2NA 1XHMA 3EU7A 3J80g 4CZXA 3IJEA 5HE1B 5EM2B 2VDLA 5TDHB 4MMYA 1H2XA 4UI9R 3W15A 4JSPC 4A11A 1JTDB 3I7LA 3SHFA 5FLXg 3FGBA 5I5JA 2J57G 5FXYA 3EI3A 4ZOZA 5EALA 4IRZA 4A0BA 2GC7A 2TRCB 3MKSB 3DXKC 4PXWA 2G99A 2IWKA 5M61A 1MG3A 3I7OA 2CE9A 4XYHA 1H2WA 3RMZD 3I2NA 3I7KA 3V9FA 4E5ZB 2PBIB 3AL9A 4Z7OA 3JROA 2BCJB 4G55A 4PC0A 3UKUC 3C5MA 5M5VA 2H9PA 1PBYB 3NIGA 3C75H 1C9LA 3F3FA 3NVNA 4QAMA 3UR4A 3OKYA 3MUOA 2AGWA 5FFOA 2P9PC 5C9ZB 1Q47A 5H17A 3HFQA 3I7NA 3O4IA 4CZVA 3C9CA 3ULEC 2YNPA 4QL1A 5K19A 4GQ1A 5FQDA 2PM9B 2XDWA 2XE4A 3SXTD 1JV2A 2HU8A 4AMZA 4BCDA 1MDAH 2HKRA 3T3MA 1U8CA 3SMRA 1GOGA 1N6FA 4BL0A 1XIPA 5C92A 2AGYA 4O2WA 4PBZA 4MMXA 3V7DB 2YBAA 2XZGA 3V5WB 5FKQA 4AMYA 3MVDK 4D0KA 5C2VB 1O6GA 2CN2A 2IURA 2QC5A 3VI3A 2VC2A 4FB1D 4A0AB 3PVUB 5EAPA 4A7JA 5EAMA 4Z7QA 3UVNA 3I8EA 1SQ9A 1S4UX 3UVLA 4UM8A 3GREA 1N6EA 3AL8B 1GOFA 4MMZA 5THAA 2Z2OA 5TF2A 4ERZA 4EWRA 3JAMg 3F3PA 1UTCA 2EICA 2XL3A 3KRXB 2IUQA 4O3TB 1UOPA 4H5IA 4AN0A 5GMKn 2AH0A 4E5ZA 2H68A 2CO0A 2HJBA 4IA9A 4X3EA 1TYQC 2H14A 4CY5A 4NENA 2H6KA 4WK2A 3SWSD 1YR2A 3OKWA 3K6SA 4QQEA 3QI0A 3IUNA 3IKOA 5C86A 3VA6A 1QFSA 5E6UA 3GC3B 2CNXA 4FA9D 3N0EA 1RI6A 2PM6B 1A0RB 4X61B 4UM9A 1VYHC 1B9YA 4QT8A 1T2XA 3RRMC 5HE3B 2OIZA 5FKRA 4L3HD 3OTTA 4RE5A 5M5RA 2IUVA 1O6FA 4HDJA 4A08A 3BG0A 2O9KA 4X63B 4GGDA 4A0AA 3FCSA 2I3TA 3IIWA 4G56B 4AX4A 4BP8A 4O3UB 2J55H 5AJAA 4WK4A 3UVMA 3RN1D 4D9SA 3PSCB 4Y5RD 5FA5B 3IJ0A 2I0RA 2CN3A 5EMMB 4GM3A 3U4YA 2WQ8A 3AL8A 2H6NA 2H9MA 2I0SA 5FKSA 2OJYA 5CXBB 2OVPB 2QZPA 4ZOYA 2VDNA 4PSWB 3I7HA 5I5MA 3GFCA 2H47A 3NIFA 2EBSA 3RLMD 3PSLA 5IJ7E 5FFGA 3EG6A 3PE7A 3RFHA 3K27A 2VDPA 2I3SA 5TEFA 3UKRC 3IUQA 4GM9A 1E8MA 2BKLA 4BUJC 2IWFA 4OZUA 3DM0A 4Z7NA 2VZ3A 3RN0D 4FA5D 4JHPC 5I5IA 2QR5A 4J87A 3I7PA 5H1MA 4O45A 5IJ8E 4CI2A 1P22A 3EWEA 4XYIA 1U2VC 4ZOXA 1NR0A 4BH6A 3J81g 2B5LA 2H9NA 3JRPA 4FAVD 3VI4A 1JMXB 1XKSA 2AGZA 4ERYA 3FM0A 4R7AB 3VGZA 3SJLD 2HU5A 1E8NA 2XYIA 5M5SA 3NVQA 4A08B 4LGNA 5EARA 4J77A 4QRJA 3ZDYA 1GXRA 4GGCA 4LG8A 2PM7B 1R5MA 2P9SC 2EIDA 1MG2A 3FRXA 5HDBA 2YNOA 5FKTA 2P9LC 4JT6C 4U7AA 4FA4D 3MUNA 1E5TA 1GP2B 2H9LA 5CXBA 4I79A 4A2LA 1TBGA 2CE8A 5HE0B 4FHLA 3IJCA 3AH8B 3AFCA 4L1QD 3K72A 1QNIA 4NAAA 2AQ5A 2VDRA 3EI1B 3CFVA 4H5JA 3PVWB 1GOTB 4BP9A 2P9UC 4JSXC 5GSAA 4U1EI 3IULA 3EI4A 3PXSD 5M5UA 4J73A 3JZHA 3ODTA 2HXCA 5TEEA 4CZYA 3IVMA 2J56H 1JMZB 3BWSA 4JSVC 1UOOA 5CYKA 3EQ9A 5CYKB 4NC4A 1JOFA 3EQ8A 1YFQA 4J84A 4MK0B 2MTAH 3ZDXA 3IIYA 4Y7RA 2P9NC 2G9AA 3O4HA 3ORVD 5KDOB 2AGXA 4DNUA 1VZ3A 4CC9A 4AN1A 4GM8A 4G1MA 2VDOA 1OMWB 2VDKA 3P4FA 3IURA 3OL2A 3E0CA 2W18A 4JT5C 2AH1A 4GMBA 3EI2B 1N6DA 4OWRA 3ZE1A 5AMSA 1VE7A 2GC4A 4A09A 4K3JB 2HKMA 4X60B 1B9XA 3V4VA 3B7FA 1H2ZA 1UOQA 4PBYA 2XL2A 2EIEA 5IC7A 2HYEA 3SLED 1K3IA 2OK6A 3N0DA 3MKQA 5EMKB 3JB9L 4JHNA 4J79A 4YVDA 2BBKH 4RE6A 3KCIA 4FAND 3KRWB 4O9DA 3EI1A 3PXTD 2Z2PA 1GG2B 4JD2C 4ZN4A 1BPOA 4FWWA 4JSNC 3VH0A 5AFU3 2IUPA 1JJUB 5E6SA 3JZGA 1PGUA 3CIKB 3DWLC 2HESX 3F3GA 2QXVA 3JZNA 4GZ8A 4JXMA 3EI4B 4J0XA 5IT9g 3DSMA 3I8CA 4E54A 2OVQB 4CI8A 2OK4A 2YNNA 5GXIA 3V4PA 3SBQA 2P9IC 4NSXA 4XEIC 2B5MA
chains in the Genus database with same CATH topology
3BG1A 3NVXA 5HE2B 5IGQA 2H3XA 4L9OA 3SFZA 4ERQA 5CXCB 1NEXB 1K8KC 1PI6A 4GQ2P 3A0FA 3I89A 4AOWA 5K1CC 4Z8LA 4PNKB 4GGAA 3OL2B 1SQJA 2YMUA 3EI2A 2UZXB 4J86A 5SXMA 3IJ1A 3MMYA 4AEZA 1PEVA 3UVKA 3MXXA 5EMLB 4J8GA 4A09B 2H13A 2AGLA 3L4OD 3ZWLB 5HYNB 3DXMC 4L3GD 5EMJB 1FWXA 4LG9A 4GQBB 2IAAA 2Q7QA 3SCYA 3UVOA 5EM2A 1L0QA 3OKTA 3PXWD 4J0WA 4KFMB 4FA1D 4J81A 4J8BA 4A11B 3MZKA 4CI3A 3SVWD 2YB8B 2HJ4A 4J82A 4ES0A 4CY3A 5JWZA 4E54B 1K32A 3EI3B 4CY2A 4A0BB 2CO0C 2I0TA 4IMMA 2XU7A 5CXCA 5IGOA 3SN6B 1SHYB 4PSXB 3JPXA 3SBPA 5H14A 4N14A 2B5NA 4K3ID 5HQGA 4ZOVA 3OW8A 1U4CA 3SBRA 2GNQA 3OKYB 3RFGA 5C2WB 2PM9A 4CI1A 4A2MA 2P9KC 4O1QD 2UZYB 1ERJA 5B4WA 4D6VA 4J78A 3L4MD 3CFSB 5A2Qg 4ESGA 3MZLA 5GXHA 2B4EA 4CY1A 3RSEC 2H6QA 3C99A 3EMHA 2OVRB 3K26A 4TZ4A 1OLZA 2Z2NA 1XHMA 3EU7A 3J80g 4CZXA 5HE1B 5EM2B 5TDHB 3W15A 4A11A 4UI9R 4JSPC 3I7LA 3SHFA 5FLXg 3FGBA 5I5JA 2J57G 5FXYA 3EI3A 4ZOZA 5EALA 4A0BA 2GC7A 2TRCB 3MKSB 3DXKC 4PXWA 2G99A 2IWKA 1MG3A 3I7OA 2CE9A 4XYHA 3RMZD 3I2NA 3I7KA 3V9FA 4E5ZB 2PBIB 3AL9A 3JROA 2BCJB 4PC0A 3UKUC 3C5MA 2H9PA 1PBYB 3C75H 3UR4A 3F3FA 3NVNA 3OKYA 2AGWA 2P9PC 5C9ZB 1Q47A 5H17A 3HFQA 3I7NA 4CZVA 3C9CA 3ULEC 2YNPA 4QL1A 5K19A 4GQ1A 5FQDA 2PM9B 3SXTD 1MDAH 2HKRA 3SMRA 1N6FA 4BL0A 1XIPA 2AGYA 4PBZA 3V7DB 2YBAA 3V5WB 5FKQA 4D0KA 5C2VB 2CN2A 2IURA 2QC5A 4FB1D 4A0AB 3PVUB 5EAPA 4A7JA 5EAMA 3UVNA 3I8EA 1SQ9A 1S4UX 3UVLA 3GREA 1N6EA 3AL8B 5THAA 4ERZA 2Z2OA 5TF2A 4EWRA 3JAMg 3F3PA 4O3TB 2IUQA 2XL3A 3KRXB 4H5IA 5GMKn 2AH0A 4E5ZA 2H68A 2CO0A 2HJBA 4IA9A 4X3EA 1TYQC 2H14A 4CY5A 2H6KA 3SWSD 3OKWA 4QQEA 3IKOA 3VA6A 2CNXA 4FA9D 3N0EA 1RI6A 2PM6B 1A0RB 4X61B 1VYHC 1B9YA 4QT8A 3RRMC 5HE3B 2OIZA 5FKRA 4L3HD 3OTTA 2IUVA 4HDJA 4A08A 3BG0A 2O9KA 4X63B 4GGDA 4A0AA 2I3TA 3IIWA 4G56B 4O3UB 2J55H 5AJAA 3UVMA 3RN1D 3PSCB 4Y5RD 5FA5B 3IJ0A 2I0RA 2CN3A 5EMMB 4GM3A 3U4YA 3AL8A 2H6NA 2H9MA 2I0SA 5FKSA 2OJYA 5CXBB 2OVPB 4ZOYA 4PSWB 3I7HA 5I5MA 3GFCA 2H47A 2EBSA 3RLMD 3PSLA 5IJ7E 3EG6A 3PE7A 3RFHA 3K27A 2I3SA 5TEFA 3UKRC 4GM9A 4BUJC 2IWFA 4OZUA 3DM0A 3RN0D 4FA5D 5I5IA 4J87A 3I7PA 5H1MA 4O45A 5IJ8E 4CI2A 1P22A 3EWEA 4XYIA 1U2VC 4ZOXA 1NR0A 4BH6A 3J81g 2B5LA 2H9NA 3JRPA 4FAVD 1JMXB 1XKSA 2AGZA 4ERYA 3FM0A 4R7AB 3VGZA 3SJLD 2XYIA 3NVQA 4A08B 4LGNA 5EARA 4J77A 4QRJA 1GXRA 4GGCA 4LG8A 2PM7B 1R5MA 2P9SC 3FRXA 1MG2A 2YNOA 5FKTA 2P9LC 4JT6C 4U7AA 4FA4D 1GP2B 2H9LA 5CXBA 4I79A 4A2LA 1TBGA 2CE8A 5HE0B 4FHLA 3IJCA 3AH8B 3AFCA 4L1QD 1QNIA 2AQ5A 3EI1B 3CFVA 4H5JA 3PVWB 1GOTB 2P9UC 4JSXC 5GSAA 4U1EI 3EI4A 3PXSD 4J73A 3JZHA 3ODTA 2HXCA 5TEEA 4CZYA 2J56H 1JMZB 3BWSA 4JSVC 5CYKA 5CYKB 1JOFA 4J84A 1YFQA 4MK0B 2MTAH 3IIYA 4Y7RA 2P9NC 2G9AA 3ORVD 5KDOB 2AGXA 4CC9A 4GM8A 1OMWB 3P4FA 3OL2A 3E0CA 2W18A 4JT5C 2AH1A 4GMBA 3EI2B 1N6DA 4OWRA 5AMSA 2GC4A 4A09A 4K3JB 2HKMA 4X60B 1B9XA 3B7FA 4PBYA 2XL2A 2HYEA 5IC7A 3SLED 2OK6A 3N0DA 3MKQA 5EMKB 3JB9L 4J79A 4YVDA 2BBKH 4FAND 3KRWB 4O9DA 3EI1A 3PXTD 2Z2PA 1GG2B 4JD2C 4ZN4A 4FWWA 4JSNC 3VH0A 5AFU3 2IUPA 1JJUB 3JZGA 1PGUA 3CIKB 3DWLC 2HESX 3F3GA 2QXVA 3JZNA 4GZ8A 4JXMA 3EI4B 4J0XA 5IT9g 3DSMA 3I8CA 4E54A 2OVQB 4CI8A 2OK4A 2YNNA 5GXIA 3SBQA 4NSXA 2P9IC 4XEIC 2B5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG1 A;  3NVX A;  5HE2 B;  5IGQ A;  2H3X A;  4L9O A;  3SFZ A;  4ERQ A;  5CXC B;  1NEX B;  1K8K C;  1PI6 A;  4GQ2 P;  3A0F A;  3I89 A;  4AOW A;  5K1C C;  4Z8L A;  4PNK B;  4GGA A;  3OL2 B;  1SQJ A;  2YMU A;  3EI2 A;  2UZX B;  4J86 A;  5SXM A;  3IJ1 A;  3MMY A;  4AEZ A;  1PEV A;  3UVK A;  3MXX A;  5EML B;  4J8G A;  4A09 B;  2H13 A;  2AGL A;  3L4O D;  3ZWL B;  5HYN B;  3DXM C;  4L3G D;  5EMJ B;  1FWX A;  4LG9 A;  4GQB B;  2IAA A;  2Q7Q A;  3SCY A;  3UVO A;  5EM2 A;  1L0Q A;  3OKT A;  3PXW D;  4J0W A;  4KFM B;  4FA1 D;  4J81 A;  4J8B A;  4A11 B;  3MZK A;  4CI3 A;  3SVW D;  2YB8 B;  2HJ4 A;  4J82 A;  4ES0 A;  4CY3 A;  5JWZ A;  4E54 B;  1K32 A;  3EI3 B;  4CY2 A;  4A0B B;  2CO0 C;  2I0T A;  4IMM A;  2XU7 A;  5CXC A;  5IGO A;  3SN6 B;  1SHY B;  4PSX B;  3JPX A;  3SBP A;  5H14 A;  4N14 A;  2B5N A;  4K3I D;  5HQG A;  4ZOV A;  3OW8 A;  1U4C A;  3SBR A;  2GNQ A;  3OKY B;  3RFG A;  5C2W B;  2PM9 A;  4CI1 A;  4A2M A;  2P9K C;  4O1Q D;  2UZY B;  1ERJ A;  5B4W A;  4D6V A;  4J78 A;  3L4M D;  3CFS B;  5A2Q g;  4ESG A;  3MZL A;  5GXH A;  2B4E A;  4CY1 A;  3RSE C;  2H6Q A;  3C99 A;  3EMH A;  2OVR B;  3K26 A;  4TZ4 A;  1OLZ A;  2Z2N A;  1XHM A;  3EU7 A;  3J80 g;  4CZX A;  5HE1 B;  5EM2 B;  5TDH B;  3W15 A;  4A11 A;  4UI9 R;  4JSP C;  3I7L A;  3SHF A;  5FLX g;  3FGB A;  5I5J A;  2J57 G;  5FXY A;  3EI3 A;  4ZOZ A;  5EAL A;  4A0B A;  2GC7 A;  2TRC B;  3MKS B;  3DXK C;  4PXW A;  2G99 A;  2IWK A;  1MG3 A;  3I7O A;  2CE9 A;  4XYH A;  3RMZ D;  3I2N A;  3I7K A;  3V9F A;  4E5Z B;  2PBI B;  3AL9 A;  3JRO A;  2BCJ B;  4PC0 A;  3UKU C;  3C5M A;  2H9P A;  1PBY B;  3C75 H;  3UR4 A;  3F3F A;  3NVN A;  3OKY A;  2AGW A;  2P9P C;  5C9Z B;  1Q47 A;  5H17 A;  3HFQ A;  3I7N A;  4CZV A;  3C9C A;  3ULE C;  2YNP A;  4QL1 A;  5K19 A;  4GQ1 A;  5FQD A;  2PM9 B;  3SXT D;  1MDA H;  2HKR A;  3SMR A;  1N6F A;  4BL0 A;  1XIP A;  2AGY A;  4PBZ A;  3V7D B;  2YBA A;  3V5W B;  5FKQ A;  4D0K A;  5C2V B;  2CN2 A;  2IUR A;  2QC5 A;  4FB1 D;  4A0A B;  3PVU B;  5EAP A;  4A7J A;  5EAM A;  3UVN A;  3I8E A;  1SQ9 A;  1S4U X;  3UVL A;  3GRE A;  1N6E A;  3AL8 B;  5THA A;  4ERZ A;  2Z2O A;  5TF2 A;  4EWR A;  3JAM g;  3F3P A;  4O3T B;  2IUQ A;  2XL3 A;  3KRX B;  4H5I A;  5GMK n;  2AH0 A;  4E5Z A;  2H68 A;  2CO0 A;  2HJB A;  4IA9 A;  4X3E A;  1TYQ C;  2H14 A;  4CY5 A;  2H6K A;  3SWS D;  3OKW A;  4QQE A;  3IKO A;  3VA6 A;  2CNX A;  4FA9 D;  3N0E A;  1RI6 A;  2PM6 B;  1A0R B;  4X61 B;  1VYH C;  1B9Y A;  4QT8 A;  3RRM C;  5HE3 B;  2OIZ A;  5FKR A;  4L3H D;  3OTT A;  2IUV A;  4HDJ A;  4A08 A;  3BG0 A;  2O9K A;  4X63 B;  4GGD A;  4A0A A;  2I3T A;  3IIW A;  4G56 B;  4O3U B;  2J55 H;  5AJA A;  3UVM A;  3RN1 D;  3PSC B;  4Y5R D;  5FA5 B;  3IJ0 A;  2I0R A;  2CN3 A;  5EMM B;  4GM3 A;  3U4Y A;  3AL8 A;  2H6N A;  2H9M A;  2I0S A;  5FKS A;  2OJY A;  5CXB B;  2OVP B;  4ZOY A;  4PSW B;  3I7H A;  5I5M A;  3GFC A;  2H47 A;  2EBS A;  3RLM D;  3PSL A;  5IJ7 E;  3EG6 A;  3PE7 A;  3RFH A;  3K27 A;  2I3S A;  5TEF A;  3UKR C;  4GM9 A;  4BUJ C;  2IWF A;  4OZU A;  3DM0 A;  3RN0 D;  4FA5 D;  5I5I A;  4J87 A;  3I7P A;  5H1M A;  4O45 A;  5IJ8 E;  4CI2 A;  1P22 A;  3EWE A;  4XYI A;  1U2V C;  4ZOX A;  1NR0 A;  4BH6 A;  3J81 g;  2B5L A;  2H9N A;  3JRP A;  4FAV D;  1JMX B;  1XKS A;  2AGZ A;  4ERY A;  3FM0 A;  4R7A B;  3VGZ A;  3SJL D;  2XYI A;  3NVQ A;  4A08 B;  4LGN A;  5EAR A;  4J77 A;  4QRJ A;  1GXR A;  4GGC A;  4LG8 A;  2PM7 B;  1R5M A;  2P9S C;  3FRX A;  1MG2 A;  2YNO A;  5FKT A;  2P9L C;  4JT6 C;  4U7A A;  4FA4 D;  1GP2 B;  2H9L A;  5CXB A;  4I79 A;  4A2L A;  1TBG A;  2CE8 A;  5HE0 B;  4FHL A;  3IJC A;  3AH8 B;  3AFC A;  4L1Q D;  1QNI A;  2AQ5 A;  3EI1 B;  3CFV A;  4H5J A;  3PVW B;  1GOT B;  2P9U C;  4JSX C;  5GSA A;  4U1E I;  3EI4 A;  3PXS D;  4J73 A;  3JZH A;  3ODT A;  2HXC A;  5TEE A;  4CZY A;  2J56 H;  1JMZ B;  3BWS A;  4JSV C;  5CYK A;  5CYK B;  1JOF A;  4J84 A;  1YFQ A;  4MK0 B;  2MTA H;  3IIY A;  4Y7R A;  2P9N C;  2G9A A;  3ORV D;  5KDO B;  2AGX A;  4CC9 A;  4GM8 A;  1OMW B;  3P4F A;  3OL2 A;  3E0C A;  2W18 A;  4JT5 C;  2AH1 A;  4GMB A;  3EI2 B;  1N6D A;  4OWR A;  5AMS A;  2GC4 A;  4A09 A;  4K3J B;  2HKM A;  4X60 B;  1B9X A;  3B7F A;  4PBY A;  2XL2 A;  2HYE A;  5IC7 A;  3SLE D;  2OK6 A;  3N0D A;  3MKQ A;  5EMK B;  3JB9 L;  4J79 A;  4YVD A;  2BBK H;  4FAN D;  3KRW B;  4O9D A;  3EI1 A;  3PXT D;  2Z2P A;  1GG2 B;  4JD2 C;  4ZN4 A;  4FWW A;  4JSN C;  3VH0 A;  5AFU 3;  2IUP A;  1JJU B;  3JZG A;  1PGU A;  3CIK B;  3DWL C;  2HES X;  3F3G A;  2QXV A;  3JZN A;  4GZ8 A;  4JXM A;  3EI4 B;  4J0X A;  5IT9 g;  3DSM A;  3I8C A;  4E54 A;  2OVQ B;  4CI8 A;  2OK4 A;  2YNN A;  5GXI A;  3SBQ A;  4NSX A;  2P9I C;  4XEI C;  2B5M A; 
#chains in the Genus database with same CATH topology
 3BG1 A;  3NVX A;  5HE2 B;  3DDU A;  5IGQ A;  2H3X A;  4L9O A;  1A12 A;  1GOH A;  3SFZ A;  4ERQ A;  5CXC B;  1NEX B;  1K8K C;  1M1X A;  1PI6 A;  4GQ2 P;  1QFM A;  4L1M A;  3A0F A;  3I89 A;  3T3P A;  4AOW A;  5K1C C;  4Z8L A;  4PNK B;  4GGA A;  3OL2 B;  1SQJ A;  2YMU A;  3EI2 A;  2UZX B;  4J86 A;  5SXM A;  3IJ1 A;  3MMY A;  4AEZ A;  3FCU A;  1PEV A;  3UVK A;  4BCC A;  4O02 A;  3K71 A;  1H2Y A;  3MXX A;  2VDM A;  5EML B;  4J8G A;  4A09 B;  2H13 A;  1C9I A;  2VDQ A;  2HU7 A;  2AGL A;  3L4O D;  2EIB A;  2VZ1 A;  3ZWL B;  3ZE0 A;  1TYE A;  5HYN B;  4BCB A;  3DXM C;  4L3G D;  5EMJ B;  4DNV A;  1FWX A;  4LG9 A;  4GQB B;  2IAA A;  2Q7Q A;  3SCY A;  1L5G A;  5EM2 A;  3UVO A;  1L0Q A;  3OKT A;  3PXW D;  3O4G A;  4J0W A;  4KFM B;  4FA1 D;  4J81 A;  4J8B A;  3NID A;  4A11 B;  5M5T A;  3OF7 A;  3MZK A;  4CI3 A;  3SVW D;  2YB8 B;  2HJ4 A;  3O4J A;  4J82 A;  4ES0 A;  4G1E A;  4CY3 A;  5JWZ A;  4E54 B;  1K32 A;  2JKX A;  3EI3 B;  4CY2 A;  4A0B B;  2CO0 C;  2I0T A;  4IMM A;  2XU7 A;  5CXC A;  5IGO A;  3SN6 B;  3ZE2 A;  1SHY B;  4PSX B;  3JPX A;  3SBP A;  5H14 A;  4N14 A;  2B5N A;  4K3I D;  5HQG A;  4ZOV A;  3OW8 A;  4DNW A;  3QHY B;  1VZ2 A;  3ZDZ A;  4NBM A;  1U4C A;  3SBR A;  2GNQ A;  3OKY B;  3RFG A;  5C2W B;  2PM9 A;  4CI1 A;  3EQ7 A;  3IUM A;  4A2M A;  2P9K C;  3GD1 I;  4O1Q D;  2UZY B;  1ERJ A;  5E6R A;  5B4W A;  4D6V A;  3L4M D;  4J78 A;  3CFS B;  5A2Q g;  4ESG A;  3MZL A;  5GXH A;  2B4E A;  4CY1 A;  3RSE C;  4WJK A;  4WK0 A;  2H6Q A;  3C99 A;  3EMH A;  2OVR B;  1VE6 A;  3K26 A;  3IUJ A;  4TZ4 A;  1I2M B;  1OLZ A;  2Z2N A;  1XHM A;  3EU7 A;  3J80 g;  4CZX A;  3IJE A;  5HE1 B;  5EM2 B;  2VDL A;  5TDH B;  4MMY A;  1H2X A;  4UI9 R;  3W15 A;  4JSP C;  4A11 A;  1JTD B;  3I7L A;  3SHF A;  5FLX g;  3FGB A;  5I5J A;  2J57 G;  5FXY A;  3EI3 A;  4ZOZ A;  5EAL A;  4IRZ A;  4A0B A;  2GC7 A;  2TRC B;  3MKS B;  3DXK C;  4PXW A;  2G99 A;  2IWK A;  5M61 A;  1MG3 A;  3I7O A;  2CE9 A;  4XYH A;  1H2W A;  3RMZ D;  3I2N A;  3I7K A;  3V9F A;  4E5Z B;  2PBI B;  3AL9 A;  4Z7O A;  3JRO A;  2BCJ B;  4G55 A;  4PC0 A;  3UKU C;  3C5M A;  5M5V A;  2H9P A;  1PBY B;  3NIG A;  3C75 H;  1C9L A;  3F3F A;  3NVN A;  4QAM A;  3UR4 A;  3OKY A;  3MUO A;  2AGW A;  5FFO A;  2P9P C;  5C9Z B;  1Q47 A;  5H17 A;  3HFQ A;  3I7N A;  3O4I A;  4CZV A;  3C9C A;  3ULE C;  2YNP A;  4QL1 A;  5K19 A;  4GQ1 A;  5FQD A;  2PM9 B;  2XDW A;  2XE4 A;  3SXT D;  1JV2 A;  2HU8 A;  4AMZ A;  4BCD A;  1MDA H;  2HKR A;  3T3M A;  1U8C A;  3SMR A;  1GOG A;  1N6F A;  4BL0 A;  1XIP A;  5C92 A;  2AGY A;  4O2W A;  4PBZ A;  4MMX A;  3V7D B;  2YBA A;  2XZG A;  3V5W B;  5FKQ A;  4AMY A;  3MVD K;  4D0K A;  5C2V B;  1O6G A;  2CN2 A;  2IUR A;  2QC5 A;  3VI3 A;  2VC2 A;  4FB1 D;  4A0A B;  3PVU B;  5EAP A;  4A7J A;  5EAM A;  4Z7Q A;  3UVN A;  3I8E A;  1SQ9 A;  1S4U X;  3UVL A;  4UM8 A;  3GRE A;  1N6E A;  3AL8 B;  1GOF A;  4MMZ A;  5THA A;  2Z2O A;  5TF2 A;  4ERZ A;  4EWR A;  3JAM g;  3F3P A;  1UTC A;  2EIC A;  2XL3 A;  3KRX B;  2IUQ A;  4O3T B;  1UOP A;  4H5I A;  4AN0 A;  5GMK n;  2AH0 A;  4E5Z A;  2H68 A;  2CO0 A;  2HJB A;  4IA9 A;  4X3E A;  1TYQ C;  2H14 A;  4CY5 A;  4NEN A;  2H6K A;  4WK2 A;  3SWS D;  1YR2 A;  3OKW A;  3K6S A;  4QQE A;  3QI0 A;  3IUN A;  3IKO A;  5C86 A;  3VA6 A;  1QFS A;  5E6U A;  3GC3 B;  2CNX A;  4FA9 D;  3N0E A;  1RI6 A;  2PM6 B;  1A0R B;  4X61 B;  4UM9 A;  1VYH C;  1B9Y A;  4QT8 A;  1T2X A;  3RRM C;  5HE3 B;  2OIZ A;  5FKR A;  4L3H D;  3OTT A;  4RE5 A;  5M5R A;  2IUV A;  1O6F A;  4HDJ A;  4A08 A;  3BG0 A;  2O9K A;  4X63 B;  4GGD A;  4A0A A;  3FCS A;  2I3T A;  3IIW A;  4G56 B;  4AX4 A;  4BP8 A;  4O3U B;  2J55 H;  5AJA A;  4WK4 A;  3UVM A;  3RN1 D;  4D9S A;  3PSC B;  4Y5R D;  5FA5 B;  3IJ0 A;  2I0R A;  2CN3 A;  5EMM B;  4GM3 A;  3U4Y A;  2WQ8 A;  3AL8 A;  2H6N A;  2H9M A;  2I0S A;  5FKS A;  2OJY A;  5CXB B;  2OVP B;  2QZP A;  4ZOY A;  2VDN A;  4PSW B;  3I7H A;  5I5M A;  3GFC A;  2H47 A;  3NIF A;  2EBS A;  3RLM D;  3PSL A;  5IJ7 E;  5FFG A;  3EG6 A;  3PE7 A;  3RFH A;  3K27 A;  2VDP A;  2I3S A;  5TEF A;  3UKR C;  3IUQ A;  4GM9 A;  1E8M A;  2BKL A;  4BUJ C;  2IWF A;  4OZU A;  3DM0 A;  4Z7N A;  2VZ3 A;  3RN0 D;  4FA5 D;  4JHP C;  5I5I A;  2QR5 A;  4J87 A;  3I7P A;  5H1M A;  4O45 A;  5IJ8 E;  4CI2 A;  1P22 A;  3EWE A;  4XYI A;  1U2V C;  4ZOX A;  1NR0 A;  4BH6 A;  3J81 g;  2B5L A;  2H9N A;  3JRP A;  4FAV D;  3VI4 A;  1JMX B;  1XKS A;  2AGZ A;  4ERY A;  3FM0 A;  4R7A B;  3VGZ A;  3SJL D;  2HU5 A;  1E8N A;  2XYI A;  5M5S A;  3NVQ A;  4A08 B;  4LGN A;  5EAR A;  4J77 A;  4QRJ A;  3ZDY A;  1GXR A;  4GGC A;  4LG8 A;  2PM7 B;  1R5M A;  2P9S C;  2EID A;  1MG2 A;  3FRX A;  5HDB A;  2YNO A;  5FKT A;  2P9L C;  4JT6 C;  4U7A A;  4FA4 D;  3MUN A;  1E5T A;  1GP2 B;  2H9L A;  5CXB A;  4I79 A;  4A2L A;  1TBG A;  2CE8 A;  5HE0 B;  4FHL A;  3IJC A;  3AH8 B;  3AFC A;  4L1Q D;  3K72 A;  1QNI A;  4NAA A;  2AQ5 A;  2VDR A;  3EI1 B;  3CFV A;  4H5J A;  3PVW B;  1GOT B;  4BP9 A;  2P9U C;  4JSX C;  5GSA A;  4U1E I;  3IUL A;  3EI4 A;  3PXS D;  5M5U A;  4J73 A;  3JZH A;  3ODT A;  2HXC A;  5TEE A;  4CZY A;  3IVM A;  2J56 H;  1JMZ B;  3BWS A;  4JSV C;  1UOO A;  5CYK A;  3EQ9 A;  5CYK B;  4NC4 A;  1JOF A;  3EQ8 A;  1YFQ A;  4J84 A;  4MK0 B;  2MTA H;  3ZDX A;  3IIY A;  4Y7R A;  2P9N C;  2G9A A;  3O4H A;  3ORV D;  5KDO B;  2AGX A;  4DNU A;  1VZ3 A;  4CC9 A;  4AN1 A;  4GM8 A;  4G1M A;  2VDO A;  1OMW B;  2VDK A;  3P4F A;  3IUR A;  3OL2 A;  3E0C A;  2W18 A;  4JT5 C;  2AH1 A;  4GMB A;  3EI2 B;  1N6D A;  4OWR A;  3ZE1 A;  5AMS A;  1VE7 A;  2GC4 A;  4A09 A;  4K3J B;  2HKM A;  4X60 B;  1B9X A;  3V4V A;  3B7F A;  1H2Z A;  1UOQ A;  4PBY A;  2XL2 A;  2EIE A;  5IC7 A;  2HYE A;  3SLE D;  1K3I A;  2OK6 A;  3N0D A;  3MKQ A;  5EMK B;  3JB9 L;  4JHN A;  4J79 A;  4YVD A;  2BBK H;  4RE6 A;  3KCI A;  4FAN D;  3KRW B;  4O9D A;  3EI1 A;  3PXT D;  2Z2P A;  1GG2 B;  4JD2 C;  4ZN4 A;  1BPO A;  4FWW A;  4JSN C;  3VH0 A;  5AFU 3;  2IUP A;  1JJU B;  5E6S A;  3JZG A;  1PGU A;  3CIK B;  3DWL C;  2HES X;  3F3G A;  2QXV A;  3JZN A;  4GZ8 A;  4JXM A;  3EI4 B;  4J0X A;  5IT9 g;  3DSM A;  3I8C A;  4E54 A;  2OVQ B;  4CI8 A;  2OK4 A;  2YNN A;  5GXI A;  3V4P A;  3SBQ A;  2P9I C;  4NSX A;  4XEI C;  2B5M A; 
#chains in the Genus database with same CATH homology
 3BG1 A;  3NVX A;  5HE2 B;  5IGQ A;  2H3X A;  4L9O A;  3SFZ A;  4ERQ A;  5CXC B;  1NEX B;  1K8K C;  1PI6 A;  4GQ2 P;  3A0F A;  3I89 A;  4AOW A;  5K1C C;  4Z8L A;  4PNK B;  4GGA A;  3OL2 B;  1SQJ A;  2YMU A;  3EI2 A;  2UZX B;  4J86 A;  5SXM A;  3IJ1 A;  3MMY A;  4AEZ A;  1PEV A;  3UVK A;  3MXX A;  5EML B;  4J8G A;  4A09 B;  2H13 A;  2AGL A;  3L4O D;  3ZWL B;  5HYN B;  3DXM C;  4L3G D;  5EMJ B;  1FWX A;  4LG9 A;  4GQB B;  2IAA A;  2Q7Q A;  3SCY A;  3UVO A;  5EM2 A;  1L0Q A;  3OKT A;  3PXW D;  4J0W A;  4KFM B;  4FA1 D;  4J81 A;  4J8B A;  4A11 B;  3MZK A;  4CI3 A;  3SVW D;  2YB8 B;  2HJ4 A;  4J82 A;  4ES0 A;  4CY3 A;  5JWZ A;  4E54 B;  1K32 A;  3EI3 B;  4CY2 A;  4A0B B;  2CO0 C;  2I0T A;  4IMM A;  2XU7 A;  5CXC A;  5IGO A;  3SN6 B;  1SHY B;  4PSX B;  3JPX A;  3SBP A;  5H14 A;  4N14 A;  2B5N A;  4K3I D;  5HQG A;  4ZOV A;  3OW8 A;  1U4C A;  3SBR A;  2GNQ A;  3OKY B;  3RFG A;  5C2W B;  2PM9 A;  4CI1 A;  4A2M A;  2P9K C;  4O1Q D;  2UZY B;  1ERJ A;  5B4W A;  4D6V A;  4J78 A;  3L4M D;  3CFS B;  5A2Q g;  4ESG A;  3MZL A;  5GXH A;  2B4E A;  4CY1 A;  3RSE C;  2H6Q A;  3C99 A;  3EMH A;  2OVR B;  3K26 A;  4TZ4 A;  1OLZ A;  2Z2N A;  1XHM A;  3EU7 A;  3J80 g;  4CZX A;  5HE1 B;  5EM2 B;  5TDH B;  3W15 A;  4A11 A;  4UI9 R;  4JSP C;  3I7L A;  3SHF A;  5FLX g;  3FGB A;  5I5J A;  2J57 G;  5FXY A;  3EI3 A;  4ZOZ A;  5EAL A;  4A0B A;  2GC7 A;  2TRC B;  3MKS B;  3DXK C;  4PXW A;  2G99 A;  2IWK A;  1MG3 A;  3I7O A;  2CE9 A;  4XYH A;  3RMZ D;  3I2N A;  3I7K A;  3V9F A;  4E5Z B;  2PBI B;  3AL9 A;  3JRO A;  2BCJ B;  4PC0 A;  3UKU C;  3C5M A;  2H9P A;  1PBY B;  3C75 H;  3UR4 A;  3F3F A;  3NVN A;  3OKY A;  2AGW A;  2P9P C;  5C9Z B;  1Q47 A;  5H17 A;  3HFQ A;  3I7N A;  4CZV A;  3C9C A;  3ULE C;  2YNP A;  4QL1 A;  5K19 A;  4GQ1 A;  5FQD A;  2PM9 B;  3SXT D;  1MDA H;  2HKR A;  3SMR A;  1N6F A;  4BL0 A;  1XIP A;  2AGY A;  4PBZ A;  3V7D B;  2YBA A;  3V5W B;  5FKQ A;  4D0K A;  5C2V B;  2CN2 A;  2IUR A;  2QC5 A;  4FB1 D;  4A0A B;  3PVU B;  5EAP A;  4A7J A;  5EAM A;  3UVN A;  3I8E A;  1SQ9 A;  1S4U X;  3UVL A;  3GRE A;  1N6E A;  3AL8 B;  5THA A;  4ERZ A;  2Z2O A;  5TF2 A;  4EWR A;  3JAM g;  3F3P A;  4O3T B;  2IUQ A;  2XL3 A;  3KRX B;  4H5I A;  5GMK n;  2AH0 A;  4E5Z A;  2H68 A;  2CO0 A;  2HJB A;  4IA9 A;  4X3E A;  1TYQ C;  2H14 A;  4CY5 A;  2H6K A;  3SWS D;  3OKW A;  4QQE A;  3IKO A;  3VA6 A;  2CNX A;  4FA9 D;  3N0E A;  1RI6 A;  2PM6 B;  1A0R B;  4X61 B;  1VYH C;  1B9Y A;  4QT8 A;  3RRM C;  5HE3 B;  2OIZ A;  5FKR A;  4L3H D;  3OTT A;  2IUV A;  4HDJ A;  4A08 A;  3BG0 A;  2O9K A;  4X63 B;  4GGD A;  4A0A A;  2I3T A;  3IIW A;  4G56 B;  4O3U B;  2J55 H;  5AJA A;  3UVM A;  3RN1 D;  3PSC B;  4Y5R D;  5FA5 B;  3IJ0 A;  2I0R A;  2CN3 A;  5EMM B;  4GM3 A;  3U4Y A;  3AL8 A;  2H6N A;  2H9M A;  2I0S A;  5FKS A;  2OJY A;  5CXB B;  2OVP B;  4ZOY A;  4PSW B;  3I7H A;  5I5M A;  3GFC A;  2H47 A;  2EBS A;  3RLM D;  3PSL A;  5IJ7 E;  3EG6 A;  3PE7 A;  3RFH A;  3K27 A;  2I3S A;  5TEF A;  3UKR C;  4GM9 A;  4BUJ C;  2IWF A;  4OZU A;  3DM0 A;  3RN0 D;  4FA5 D;  5I5I A;  4J87 A;  3I7P A;  5H1M A;  4O45 A;  5IJ8 E;  4CI2 A;  1P22 A;  3EWE A;  4XYI A;  1U2V C;  4ZOX A;  1NR0 A;  4BH6 A;  3J81 g;  2B5L A;  2H9N A;  3JRP A;  4FAV D;  1JMX B;  1XKS A;  2AGZ A;  4ERY A;  3FM0 A;  4R7A B;  3VGZ A;  3SJL D;  2XYI A;  3NVQ A;  4A08 B;  4LGN A;  5EAR A;  4J77 A;  4QRJ A;  1GXR A;  4GGC A;  4LG8 A;  2PM7 B;  1R5M A;  2P9S C;  3FRX A;  1MG2 A;  2YNO A;  5FKT A;  2P9L C;  4JT6 C;  4U7A A;  4FA4 D;  1GP2 B;  2H9L A;  5CXB A;  4I79 A;  4A2L A;  1TBG A;  2CE8 A;  5HE0 B;  4FHL A;  3IJC A;  3AH8 B;  3AFC A;  4L1Q D;  1QNI A;  2AQ5 A;  3EI1 B;  3CFV A;  4H5J A;  3PVW B;  1GOT B;  2P9U C;  4JSX C;  5GSA A;  4U1E I;  3EI4 A;  3PXS D;  4J73 A;  3JZH A;  3ODT A;  2HXC A;  5TEE A;  4CZY A;  2J56 H;  1JMZ B;  3BWS A;  4JSV C;  5CYK A;  5CYK B;  1JOF A;  4J84 A;  1YFQ A;  4MK0 B;  2MTA H;  3IIY A;  4Y7R A;  2P9N C;  2G9A A;  3ORV D;  5KDO B;  2AGX A;  4CC9 A;  4GM8 A;  1OMW B;  3P4F A;  3OL2 A;  3E0C A;  2W18 A;  4JT5 C;  2AH1 A;  4GMB A;  3EI2 B;  1N6D A;  4OWR A;  5AMS A;  2GC4 A;  4A09 A;  4K3J B;  2HKM A;  4X60 B;  1B9X A;  3B7F A;  4PBY A;  2XL2 A;  2HYE A;  5IC7 A;  3SLE D;  2OK6 A;  3N0D A;  3MKQ A;  5EMK B;  3JB9 L;  4J79 A;  4YVD A;  2BBK H;  4FAN D;  3KRW B;  4O9D A;  3EI1 A;  3PXT D;  2Z2P A;  1GG2 B;  4JD2 C;  4ZN4 A;  4FWW A;  4JSN C;  3VH0 A;  5AFU 3;  2IUP A;  1JJU B;  3JZG A;  1PGU A;  3CIK B;  3DWL C;  2HES X;  3F3G A;  2QXV A;  3JZN A;  4GZ8 A;  4JXM A;  3EI4 B;  4J0X A;  5IT9 g;  3DSM A;  3I8C A;  4E54 A;  2OVQ B;  4CI8 A;  2OK4 A;  2YNN A;  5GXI A;  3SBQ A;  4NSX A;  2P9I C;  4XEI C;  2B5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...