2H9LA

Wdr5delta23
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
321
structure length
321
Chain Sequence
SGRENLYFQGTQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, gene regulation
total genus 107
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9lA00
4O9DA 2H14A 2QC5A 3EI4B 3SWSD 4Y7RA 3AL8A 1OLZA 2XYIA 4X60B 4CI2A 4A0BB 5EARA 4CZYA 2CNXA 2XU7A 2AH0A 2YNNA 5HQGA 4E54A 1GOTB 4A2MA 3EI1B 5FQDA 1N6DA 4J8GA 1GXRA 2YNOA 3W15A 3N0DA 1GG2B 4A09B 2I3TA 2P9SC 5FKQA 1PGUA 4XYIA 3KRWB 4A11A 2HXCA 4FB1D 2Z2OA 3L4MD 3SVWD 3VGZA 3C5MA 2H3XA 4NSXA 1MG2A 2TRCB 3EI2A 2BCJB 4X63B 2P9LC 3RMZD 4LG9A 5AMSA 4J86A 3IIWA 2AGLA 4JXMA 5K19A 5IJ7E 2CE8A 4ZOVA 3NVQA 4U1EI 1Q47A 1L0QA 3GFCA 3I8CA 4Y5RD 1JMZB 4BH6A 4PBZA 4A0AA 5TF2A 2UZYB 3CIKB 3UVMA 2Z2NA 3C99A 5CXCA 3EI3A 3IJ1A 5CXBB 3JB9L 4FAND 5TDHB 5C2WB 5HE0B 2CO0A 5C2VB 3I7KA 2AH1A 2IWFA 3DM0A 4CC9A 1SQ9A 4MK0B 5IJ8E 1P22A 1PBYB 5SXMA 4J77A 3OKYA 3SCYA 5H1MA 2H13A 1N6FA 4L3HD 4ESGA 2H47A 3SJLD 4FHLA 4LG8A 2PM9A 4AOWA 3SFZA 3JAMg 4JSVC 4L3GD 1PI6A 4H5IA 2OK4A 1RI6A 3KRXB 3AH8B 2P9UC 2OJYA 5IT9g 4A08A 5EMJB 3IIYA 3I7LA 1S4UX 2GC7A 5CYKB 2AGZA 3SLED 4J73A 1MG3A 2OVPB 5B4WA 3PXSD 4LGNA 2J55H 1TYQC 3JZHA 4BL0A 4ERQA 3EI1A 4I79A 3ODTA 3FRXA 4FWWA 3CFVA 4J79A 5HE3B 3JZGA 1U2VC 5AJAA 3SMRA 4J8BA 2AGYA 4BUJC 2MTAH 4D0KA 3RSEC 4K3JB 3MKQA 2CN2A 3UKRC 4U7AA 4CY1A 4PXWA 4A2LA 3BWSA 4IA9A 4GQ1A 3RN0D 3JROA 2HYEA 5EAPA 4ERZA 3EG6A 5KDOB 3PVWB 3DXKC 2I0SA 4GM9A 4G56B 3JPXA 2Z2PA 3I89A 4CI8A 2CE9A 3ZWLB 3CFSB 2H9NA 2H9MA 2J57G 5I5MA 4GZ8A 2OIZA 4K3ID 2B4EA 5EM2A 1R5MA 3EWEA 2OK6A 4FA4D 4PBYA 5IC7A 5EMMB 1XKSA 4CY5A 3AFCA 2HESX 4OWRA 3MKSB 1PEVA 4GM8A 2G99A 5FA5B 2AQ5A 4O3UB 3I7HA 4JSNC 4E54B 4J82A 4L1QD 3RN1D 4ZOZA 2H9PA 5TEFA 4JSXC 2HKRA 2YBAA 4EWRA 3NVXA 2PM7B 3JRPA 5EALA 3IJCA 4CI1A 3ORVD 3V9FA 2PM6B 4N14A 5FKTA 1SHYB 3EU7A 4GGCA 5HYNB 4PSWB 3PXTD 3UVOA 3C9CA 3PXWD 3DWLC 2H6QA 3A0FA 3VA6A 3EI2B 3UVKA 1U4CA 3OW8A 2BBKH 3OKWA 3PE7A 4ZOXA 2IUVA 3V5WB 3K27A 4J84A 3NVNA 4OZUA 5IGOA 4E5ZB 3F3GA 4R7AB 3MZKA 4J78A 1NR0A 3OTTA 3OL2A 5EMLB 2H6NA 2H68A 4A0AB 3EI4A 4IMMA 2XL2A 3BG1A 2YNPA 5FKRA 2YMUA 2B5NA 4KFMB 4O45A 3UKUC 4A0BA 5CXCB 1B9XA 1VYHC 2P9NC 4FA1D 3EI3B 3OKTA 1XIPA 4JT5C 1JJUB 1A0RB 3J81g 3PVUB 3VH0A 1XHMA 3UVLA 3JZNA 5THAA 3PSCB 4X3EA 4PSXB 5H14A 3MMYA 2CN3A 4GQBB 4FAVD 1ERJA 1FWXA 4CI3A 4A09A 2P9KC 5GSAA 2G9AA 5IGQA 2PM9B 2GC4A 4FA9D 2HJ4A 2IUPA 1JOFA 4HDJA 1N6EA 1GP2B 2UZXB 3SXTD 4CZVA 5GMKn 4O1QD 2J56H 4ZOYA 4QQEA 3B7FA 4A08B 3PSLA 3FGBA 1QNIA 3I2NA 5AFU3 2I3SA 2P9PC 4PNKB 4H5JA 4AEZA 2W18A 5TEEA 5GXHA 3AL9A 4QL1A 1MDAH 3L4OD 4FA5D 2IURA 1NEXB 3V7DB 4Z8LA 3UR4A 4ERYA 1K32A 5C9ZB 5FKSA 3AL8B 5CXBA 5K1CC 4XYHA 4CY2A 3E0CA 2I0TA 3RLMD 4J81A 2OVQB 4GM3A 2P9IC 3BG0A 2HJBA 4O3TB 3FM0A 3EMHA 2AGWA 4GQ2P 5H17A 2I0RA 2HKMA 4QT8A 4A7JA 3SN6B 2AGXA 5A2Qg 3SHFA 1OMWB 1YFQA 4XEIC 4JD2C 2PBIB 5EAMA 3RFGA 3SBQA 3IJ0A 4PC0A 3J80g 1K8KC 2B5MA 4E5ZA 3ULEC 4A11B 5I5JA 2IUQA 2IWKA 4QRJA 5I5IA 3C75H 2EBSA 5FXYA 3K26A 4YVDA 5EM2B 5CYKA 4ES0A 3I7NA 5GXIA 3RRMC 5FLXg 2YB8B 3DSMA 4J0XA 4X61B 3MXXA 2H6KA 4TZ4A 2B5LA 2H9LA 4L9OA 1JMXB 2IAAA 2O9KA 3N0EA 2QXVA 3MZLA 1B9YA 1TBGA 3F3PA 4D6VA 5HE1B 5JWZA 4J0WA 4GMBA 2Q7QA 1SQJA 4CZXA 2XL3A 3U4YA 3I8EA 3P4FA 4JT6C 5EMKB 2GNQA 3SBRA 3I7OA 3SBPA 3OKYB 4CY3A 3GREA 4JSPC 4GGDA 4GGAA 2OVRB 3HFQA 3DXMC 3IKOA 5HE2B 4ZN4A 4J87A 3UVNA 3I7PA 3F3FA 3OL2B 3RFHA 2CO0C 4UI9R
chains in the Genus database with same CATH superfamily
4O9DA 3VI4A 2H14A 2QC5A 3EI4B 3SWSD 4MMXA 3AL8A 4Y7RA 1VE6A 4RE5A 1OLZA 2XYIA 2XZGA 4X60B 4CI2A 4DNWA 4A0BB 5EARA 4CZYA 2CNXA 2XU7A 4MMYA 2AH0A 2YNNA 5HQGA 3VI3A 4E54A 1GOTB 4A2MA 3EI1B 5FQDA 1N6DA 1C9IA 4J8GA 1GXRA 2YNOA 4BCCA 3ZDZA 3W15A 3N0DA 1GG2B 4A09B 2QZPA 1VE7A 2I3TA 2P9SC 5FKQA 1PGUA 3T3PA 4XYIA 3KRWB 4A11A 4Z7QA 2HXCA 4FB1D 4AMZA 2Z2OA 3L4MD 2EICA 3SVWD 3VGZA 3C5MA 2H3XA 4NSXA 1MG2A 3O4JA 2TRCB 4G1EA 3EI2A 2BCJB 4X63B 2P9LC 3RMZD 5E6RA 1I2MB 4LG9A 4BCDA 5AMSA 4J86A 5E6SA 3K71A 3IIWA 2AGLA 4JXMA 1TYEA 4WK4A 2HU7A 5K19A 5IJ7E 2CE8A 3O4GA 4ZOVA 1GOHA 3NVQA 4U1EI 1Q47A 1L0QA 3GFCA 3FCSA 3I8CA 1JMZB 4Y5RD 4BH6A 4PBZA 3DDUA 1H2WA 4A0AA 5TF2A 2UZYB 4G1MA 3ZE0A 3CIKB 3UVMA 2VC2A 2Z2NA 3C99A 5CXCA 3O4IA 3EI3A 3IJ1A 5CXBB 4UM9A 3JB9L 4FAND 5TDHB 5C2WB 1YR2A 1K3IA 5HE0B 3GD1I 2CO0A 5C2VB 3I7KA 2AH1A 2IWFA 3DM0A 4RE6A 5M61A 4CC9A 4IRZA 5M5SA 1SQ9A 4MK0B 5IJ8E 1P22A 1PBYB 1GOFA 5SXMA 4J77A 3OKYA 3SCYA 5H1MA 2H13A 1N6FA 4L3HD 4ESGA 2H47A 1BPOA 3SJLD 4FHLA 4LG8A 2PM9A 4AOWA 3SFZA 3QHYB 3JAMg 4JSVC 4L3GD 1PI6A 4H5IA 3MUNA 2OK4A 5FFOA 1RI6A 3KRXB 3IJEA 3AH8B 2P9UC 5M5UA 2OJYA 5C86A 5IT9g 4A08A 5EMJB 3IIYA 3I7LA 1S4UX 2GC7A 5CYKB 2AGZA 3SLED 4J73A 1MG3A 4JHNA 2OVPB 3NIDA 3PXSD 4LGNA 5B4WA 1H2ZA 1TYQC 2J55H 3JZHA 4BL0A 4ERQA 3EI1A 4I79A 3ODTA 3K6SA 3FRXA 3IVMA 4FWWA 3ZE1A 3CFVA 3NIFA 3MUOA 4J79A 5HE3B 3JZGA 1U2VC 5AJAA 3SMRA 4J8BA 2AGYA 1QFSA 4AN0A 4BUJC 2MTAH 4D0KA 3RSEC 2HU5A 4K3JB 3MKQA 2CN2A 3UKRC 4U7AA 4CY1A 1L5GA 3EQ9A 4PXWA 2VDOA 3BWSA 4A2LA 4IA9A 4GQ1A 3RN0D 3JROA 2HYEA 5EAPA 4ERZA 3EG6A 5KDOB 3PVWB 2VDRA 3DXKC 3NIGA 2I0SA 4GM9A 4G56B 3JPXA 1JV2A 2Z2PA 3I89A 1UOPA 2CE9A 4CI8A 2VDLA 3ZWLB 3CFSB 2H9NA 2H9MA 2J57G 5I5MA 4GZ8A 2OIZA 4K3ID 2B4EA 5EM2A 2XE4A 1R5MA 3EWEA 1E8NA 2OK6A 4NBMA 4FA4D 4PBYA 3V4PA 5IC7A 2WQ8A 5EMMB 1XKSA 4CY5A 3AFCA 2HESX 4OWRA 2VZ3A 3MKSB 2VZ1A 1PEVA 4GM8A 4DNUA 2G99A 5FA5B 2AQ5A 5M5RA 4O3UB 3I7HA 4JSNC 4E54B 4J82A 4L1QD 3RN1D 4ZOZA 2H9PA 5TEFA 3ZE2A 4JSXC 2HKRA 2YBAA 4EWRA 3NVXA 2PM7B 3JRPA 5EALA 3IJCA 4CI1A 4G55A 3ORVD 3V9FA 2PM6B 5M5TA 3IUMA 4N14A 5FKTA 1SHYB 3EU7A 4GGCA 5HYNB 3IUJA 1H2XA 4PSWB 3PXTD 1E5TA 3UVOA 3C9CA 3PXWD 3QI0A 3DWLC 4MMZA 2H6QA 3A0FA 1UOQA 4AMYA 1E8MA 3VA6A 1T2XA 3EI2B 3UVKA 1U4CA 3OW8A 2BBKH 4WJKA 3OKWA 2EIDA 3PE7A 2VDPA 4ZOXA 2IUVA 3V5WB 4L1MA 3K27A 4J84A 3NVNA 4OZUA 5IGOA 4E5ZB 3F3GA 4R7AB 4BP8A 3MZKA 5E6UA 4J78A 3O4HA 1NR0A 3OTTA 4WK0A 3OL2A 2EIBA 5EMLB 2H6NA 4NENA 2H68A 3IUQA 4A0AB 3EI4A 4IMMA 2XL2A 4WK2A 5M5VA 3BG1A 2YNPA 5FKRA 2YMUA 2B5NA 4KFMB 4O45A 3UKUC 4A0BA 5CXCB 1B9XA 1VYHC 2P9NC 4FA1D 3EI3B 3OKTA 4D9SA 1XIPA 3IULA 4JT5C 1JJUB 1A0RB 3J81g 3GC3B 3PVUB 3VH0A 3T3MA 1XHMA 3UVLA 3JZNA 1GOGA 5THAA 3PSCB 2EIEA 4X3EA 4PSXB 3OF7A 5H14A 2QR5A 3MMYA 2CN3A 4GQBB 4FAVD 1ERJA 1FWXA 4CI3A 4A09A 2P9KC 2VDQA 2VDMA 5GSAA 2G9AA 5IGQA 2PM9B 2GC4A 4FA9D 2HJ4A 4AX4A 2IUPA 3MVDK 1JOFA 4Z7NA 4HDJA 1N6EA 1GP2B 2UZXB 3SXTD 4CZVA 5GMKn 4O1QD 2J56H 2JKXA 4ZOYA 4QQEA 3B7FA 4A08B 3PSLA 3FGBA 1QNIA 3I2NA 5AFU3 2I3SA 2P9PC 1UOOA 4PNKB 4H5JA 4AEZA 2W18A 5TEEA 5GXHA 3AL9A 4QL1A 4NAAA 1MDAH 3L4OD 2VDKA 4QAMA 4FA5D 2IURA 1NEXB 3V7DB 4Z8LA 3UR4A 1A12A 1K32A 4ERYA 5C9ZB 4O02A 4UM8A 5FKSA 3AL8B 5CXBA 5K1CC 4XYHA 3ZDXA 4CY2A 3E0CA 2I0TA 3RLMD 4J81A 2OVQB 2XDWA 4GM3A 2P9IC 3BG0A 2HJBA 4O3TB 3FCUA 3FM0A 2HU8A 3EMHA 2AGWA 4GQ2P 5H17A 2I0RA 2HKMA 4QT8A 4A7JA 4DNVA 3SN6B 2AGXA 5A2Qg 3SHFA 1OMWB 1YFQA 4XEIC 4JD2C 2PBIB 5EAMA 3RFGA 3SBQA 2VDNA 1JTDB 3IJ0A 4PC0A 3J80g 1K8KC 2B5MA 4E5ZA 3ULEC 1M1XA 3ZDYA 4A11B 5I5JA 2IUQA 2IWKA 4QRJA 5I5IA 1QFMA 1VZ3A 3C75H 2EBSA 5FXYA 3EQ8A 3K26A 4YVDA 5EM2B 5CYKA 4ES0A 3I7NA 5GXIA 3RRMC 5FLXg 2YB8B 3DSMA 4J0XA 4X61B 3MXXA 2H6KA 4TZ4A 2B5LA 2H9LA 4L9OA 1JMXB 3IURA 3EQ7A 1U8CA 3K72A 2IAAA 2O9KA 3N0EA 2QXVA 4O2WA 5HDBA 4JHPC 3MZLA 1B9YA 1H2YA 1TBGA 3F3PA 4D6VA 5HE1B 5JWZA 4J0WA 4GMBA 5C92A 2Q7QA 1C9LA 1SQJA 4CZXA 4NC4A 2XL3A 3U4YA 3I8EA 3P4FA 1O6GA 4JT6C 5EMKB 2GNQA 4BP9A 3SBRA 5FFGA 3I7OA 3SBPA 4BCBA 3OKYB 4CY3A 3GREA 4JSPC 1UTCA 2BKLA 3V4VA 4Z7OA 4GGDA 4GGAA 1O6FA 2OVRB 3HFQA 3KCIA 3IUNA 3DXMC 3IKOA 5HE2B 4AN1A 4ZN4A 1VZ2A 4J87A 3UVNA 3I7PA 3F3FA 3OL2B 3RFHA 2CO0C 4UI9R
chains in the Genus database with same CATH topology
4O9DA 2H14A 2QC5A 3EI4B 3SWSD 4Y7RA 3AL8A 1OLZA 2XYIA 4X60B 4CI2A 4A0BB 5EARA 4CZYA 2CNXA 2XU7A 2AH0A 2YNNA 5HQGA 4E54A 1GOTB 4A2MA 3EI1B 5FQDA 1N6DA 4J8GA 1GXRA 2YNOA 3W15A 3N0DA 1GG2B 4A09B 2I3TA 2P9SC 5FKQA 1PGUA 4XYIA 3KRWB 4A11A 2HXCA 4FB1D 2Z2OA 3L4MD 3SVWD 3VGZA 3C5MA 2H3XA 4NSXA 1MG2A 2TRCB 3EI2A 2BCJB 4X63B 2P9LC 3RMZD 4LG9A 5AMSA 4J86A 3IIWA 2AGLA 4JXMA 5K19A 5IJ7E 2CE8A 4ZOVA 3NVQA 4U1EI 1Q47A 1L0QA 3GFCA 3I8CA 4Y5RD 1JMZB 4BH6A 4PBZA 4A0AA 5TF2A 2UZYB 3CIKB 3UVMA 2Z2NA 3C99A 5CXCA 3EI3A 3IJ1A 5CXBB 3JB9L 4FAND 5TDHB 5C2WB 5HE0B 2CO0A 5C2VB 3I7KA 2AH1A 2IWFA 3DM0A 4CC9A 1SQ9A 4MK0B 5IJ8E 1P22A 1PBYB 5SXMA 4J77A 3OKYA 3SCYA 5H1MA 2H13A 1N6FA 4L3HD 4ESGA 2H47A 3SJLD 4FHLA 4LG8A 2PM9A 4AOWA 3SFZA 3JAMg 4JSVC 4L3GD 1PI6A 4H5IA 2OK4A 1RI6A 3KRXB 3AH8B 2P9UC 2OJYA 5IT9g 4A08A 5EMJB 3IIYA 3I7LA 1S4UX 2GC7A 5CYKB 2AGZA 3SLED 4J73A 1MG3A 2OVPB 5B4WA 3PXSD 4LGNA 2J55H 1TYQC 3JZHA 4BL0A 4ERQA 3EI1A 4I79A 3ODTA 3FRXA 4FWWA 3CFVA 4J79A 5HE3B 3JZGA 1U2VC 5AJAA 3SMRA 4J8BA 2AGYA 4BUJC 2MTAH 4D0KA 3RSEC 4K3JB 3MKQA 2CN2A 3UKRC 4U7AA 4CY1A 4PXWA 4A2LA 3BWSA 4IA9A 4GQ1A 3RN0D 3JROA 2HYEA 5EAPA 4ERZA 3EG6A 5KDOB 3PVWB 3DXKC 2I0SA 4GM9A 4G56B 3JPXA 2Z2PA 3I89A 4CI8A 2CE9A 3ZWLB 3CFSB 2H9NA 2H9MA 2J57G 5I5MA 4GZ8A 2OIZA 4K3ID 2B4EA 5EM2A 1R5MA 3EWEA 2OK6A 4FA4D 4PBYA 5IC7A 5EMMB 1XKSA 4CY5A 3AFCA 2HESX 4OWRA 3MKSB 1PEVA 4GM8A 2G99A 5FA5B 2AQ5A 4O3UB 3I7HA 4JSNC 4E54B 4J82A 4L1QD 3RN1D 4ZOZA 2H9PA 5TEFA 4JSXC 2HKRA 2YBAA 4EWRA 3NVXA 2PM7B 3JRPA 5EALA 3IJCA 4CI1A 3ORVD 3V9FA 2PM6B 4N14A 5FKTA 1SHYB 3EU7A 4GGCA 5HYNB 4PSWB 3PXTD 3UVOA 3C9CA 3PXWD 3DWLC 2H6QA 3A0FA 3VA6A 3EI2B 3UVKA 1U4CA 3OW8A 2BBKH 3OKWA 3PE7A 4ZOXA 2IUVA 3V5WB 3K27A 4J84A 3NVNA 4OZUA 5IGOA 4E5ZB 3F3GA 4R7AB 3MZKA 4J78A 1NR0A 3OTTA 3OL2A 5EMLB 2H6NA 2H68A 4A0AB 3EI4A 4IMMA 2XL2A 3BG1A 2YNPA 5FKRA 2YMUA 2B5NA 4KFMB 4O45A 3UKUC 4A0BA 5CXCB 1B9XA 1VYHC 2P9NC 4FA1D 3EI3B 3OKTA 1XIPA 4JT5C 1JJUB 1A0RB 3J81g 3PVUB 3VH0A 1XHMA 3UVLA 3JZNA 5THAA 3PSCB 4X3EA 4PSXB 5H14A 3MMYA 2CN3A 4GQBB 4FAVD 1ERJA 1FWXA 4CI3A 4A09A 2P9KC 5GSAA 2G9AA 5IGQA 2PM9B 2GC4A 4FA9D 2HJ4A 2IUPA 1JOFA 4HDJA 1N6EA 1GP2B 2UZXB 3SXTD 4CZVA 5GMKn 4O1QD 2J56H 4ZOYA 4QQEA 3B7FA 4A08B 3PSLA 3FGBA 1QNIA 3I2NA 5AFU3 2I3SA 2P9PC 4PNKB 4H5JA 4AEZA 2W18A 5TEEA 5GXHA 3AL9A 4QL1A 1MDAH 3L4OD 4FA5D 2IURA 1NEXB 3V7DB 4Z8LA 3UR4A 4ERYA 1K32A 5C9ZB 5FKSA 3AL8B 5CXBA 5K1CC 4XYHA 4CY2A 3E0CA 2I0TA 3RLMD 4J81A 2OVQB 4GM3A 2P9IC 3BG0A 2HJBA 4O3TB 3FM0A 3EMHA 2AGWA 4GQ2P 5H17A 2I0RA 2HKMA 4QT8A 4A7JA 3SN6B 2AGXA 5A2Qg 3SHFA 1OMWB 1YFQA 4XEIC 4JD2C 2PBIB 5EAMA 3RFGA 3SBQA 3IJ0A 4PC0A 3J80g 1K8KC 2B5MA 4E5ZA 3ULEC 4A11B 5I5JA 2IUQA 2IWKA 4QRJA 5I5IA 3C75H 2EBSA 5FXYA 3K26A 4YVDA 5EM2B 5CYKA 4ES0A 3I7NA 5GXIA 3RRMC 5FLXg 2YB8B 3DSMA 4J0XA 4X61B 3MXXA 2H6KA 4TZ4A 2B5LA 2H9LA 4L9OA 1JMXB 2IAAA 2O9KA 3N0EA 2QXVA 3MZLA 1B9YA 1TBGA 3F3PA 4D6VA 5HE1B 5JWZA 4J0WA 4GMBA 2Q7QA 1SQJA 4CZXA 2XL3A 3U4YA 3I8EA 3P4FA 4JT6C 5EMKB 2GNQA 3SBRA 3I7OA 3SBPA 3OKYB 4CY3A 3GREA 4JSPC 4GGDA 4GGAA 2OVRB 3HFQA 3DXMC 3IKOA 5HE2B 4ZN4A 4J87A 3UVNA 3I7PA 3F3FA 3OL2B 3RFHA 2CO0C 4UI9R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O9D A;  2H14 A;  2QC5 A;  3EI4 B;  3SWS D;  4Y7R A;  3AL8 A;  1OLZ A;  2XYI A;  4X60 B;  4CI2 A;  4A0B B;  5EAR A;  4CZY A;  2CNX A;  2XU7 A;  2AH0 A;  2YNN A;  5HQG A;  4E54 A;  1GOT B;  4A2M A;  3EI1 B;  5FQD A;  1N6D A;  4J8G A;  1GXR A;  2YNO A;  3W15 A;  3N0D A;  1GG2 B;  4A09 B;  2I3T A;  2P9S C;  5FKQ A;  1PGU A;  4XYI A;  3KRW B;  4A11 A;  2HXC A;  4FB1 D;  2Z2O A;  3L4M D;  3SVW D;  3VGZ A;  3C5M A;  2H3X A;  4NSX A;  1MG2 A;  2TRC B;  3EI2 A;  2BCJ B;  4X63 B;  2P9L C;  3RMZ D;  4LG9 A;  5AMS A;  4J86 A;  3IIW A;  2AGL A;  4JXM A;  5K19 A;  5IJ7 E;  2CE8 A;  4ZOV A;  3NVQ A;  4U1E I;  1Q47 A;  1L0Q A;  3GFC A;  3I8C A;  4Y5R D;  1JMZ B;  4BH6 A;  4PBZ A;  4A0A A;  5TF2 A;  2UZY B;  3CIK B;  3UVM A;  2Z2N A;  3C99 A;  5CXC A;  3EI3 A;  3IJ1 A;  5CXB B;  3JB9 L;  4FAN D;  5TDH B;  5C2W B;  5HE0 B;  2CO0 A;  5C2V B;  3I7K A;  2AH1 A;  2IWF A;  3DM0 A;  4CC9 A;  1SQ9 A;  4MK0 B;  5IJ8 E;  1P22 A;  1PBY B;  5SXM A;  4J77 A;  3OKY A;  3SCY A;  5H1M A;  2H13 A;  1N6F A;  4L3H D;  4ESG A;  2H47 A;  3SJL D;  4FHL A;  4LG8 A;  2PM9 A;  4AOW A;  3SFZ A;  3JAM g;  4JSV C;  4L3G D;  1PI6 A;  4H5I A;  2OK4 A;  1RI6 A;  3KRX B;  3AH8 B;  2P9U C;  2OJY A;  5IT9 g;  4A08 A;  5EMJ B;  3IIY A;  3I7L A;  1S4U X;  2GC7 A;  5CYK B;  2AGZ A;  3SLE D;  4J73 A;  1MG3 A;  2OVP B;  5B4W A;  3PXS D;  4LGN A;  2J55 H;  1TYQ C;  3JZH A;  4BL0 A;  4ERQ A;  3EI1 A;  4I79 A;  3ODT A;  3FRX A;  4FWW A;  3CFV A;  4J79 A;  5HE3 B;  3JZG A;  1U2V C;  5AJA A;  3SMR A;  4J8B A;  2AGY A;  4BUJ C;  2MTA H;  4D0K A;  3RSE C;  4K3J B;  3MKQ A;  2CN2 A;  3UKR C;  4U7A A;  4CY1 A;  4PXW A;  4A2L A;  3BWS A;  4IA9 A;  4GQ1 A;  3RN0 D;  3JRO A;  2HYE A;  5EAP A;  4ERZ A;  3EG6 A;  5KDO B;  3PVW B;  3DXK C;  2I0S A;  4GM9 A;  4G56 B;  3JPX A;  2Z2P A;  3I89 A;  4CI8 A;  2CE9 A;  3ZWL B;  3CFS B;  2H9N A;  2H9M A;  2J57 G;  5I5M A;  4GZ8 A;  2OIZ A;  4K3I D;  2B4E A;  5EM2 A;  1R5M A;  3EWE A;  2OK6 A;  4FA4 D;  4PBY A;  5IC7 A;  5EMM B;  1XKS A;  4CY5 A;  3AFC A;  2HES X;  4OWR A;  3MKS B;  1PEV A;  4GM8 A;  2G99 A;  5FA5 B;  2AQ5 A;  4O3U B;  3I7H A;  4JSN C;  4E54 B;  4J82 A;  4L1Q D;  3RN1 D;  4ZOZ A;  2H9P A;  5TEF A;  4JSX C;  2HKR A;  2YBA A;  4EWR A;  3NVX A;  2PM7 B;  3JRP A;  5EAL A;  3IJC A;  4CI1 A;  3ORV D;  3V9F A;  2PM6 B;  4N14 A;  5FKT A;  1SHY B;  3EU7 A;  4GGC A;  5HYN B;  4PSW B;  3PXT D;  3UVO A;  3C9C A;  3PXW D;  3DWL C;  2H6Q A;  3A0F A;  3VA6 A;  3EI2 B;  3UVK A;  1U4C A;  3OW8 A;  2BBK H;  3OKW A;  3PE7 A;  4ZOX A;  2IUV A;  3V5W B;  3K27 A;  4J84 A;  3NVN A;  4OZU A;  5IGO A;  4E5Z B;  3F3G A;  4R7A B;  3MZK A;  4J78 A;  1NR0 A;  3OTT A;  3OL2 A;  5EML B;  2H6N A;  2H68 A;  4A0A B;  3EI4 A;  4IMM A;  2XL2 A;  3BG1 A;  2YNP A;  5FKR A;  2YMU A;  2B5N A;  4KFM B;  4O45 A;  3UKU C;  4A0B A;  5CXC B;  1B9X A;  1VYH C;  2P9N C;  4FA1 D;  3EI3 B;  3OKT A;  1XIP A;  4JT5 C;  1JJU B;  1A0R B;  3J81 g;  3PVU B;  3VH0 A;  1XHM A;  3UVL A;  3JZN A;  5THA A;  3PSC B;  4X3E A;  4PSX B;  5H14 A;  3MMY A;  2CN3 A;  4GQB B;  4FAV D;  1ERJ A;  1FWX A;  4CI3 A;  4A09 A;  2P9K C;  5GSA A;  2G9A A;  5IGQ A;  2PM9 B;  2GC4 A;  4FA9 D;  2HJ4 A;  2IUP A;  1JOF A;  4HDJ A;  1N6E A;  1GP2 B;  2UZX B;  3SXT D;  4CZV A;  5GMK n;  4O1Q D;  2J56 H;  4ZOY A;  4QQE A;  3B7F A;  4A08 B;  3PSL A;  3FGB A;  1QNI A;  3I2N A;  5AFU 3;  2I3S A;  2P9P C;  4PNK B;  4H5J A;  4AEZ A;  2W18 A;  5TEE A;  5GXH A;  3AL9 A;  4QL1 A;  1MDA H;  3L4O D;  4FA5 D;  2IUR A;  1NEX B;  3V7D B;  4Z8L A;  3UR4 A;  4ERY A;  1K32 A;  5C9Z B;  5FKS A;  3AL8 B;  5CXB A;  5K1C C;  4XYH A;  4CY2 A;  3E0C A;  2I0T A;  3RLM D;  4J81 A;  2OVQ B;  4GM3 A;  2P9I C;  3BG0 A;  2HJB A;  4O3T B;  3FM0 A;  3EMH A;  2AGW A;  4GQ2 P;  5H17 A;  2I0R A;  2HKM A;  4QT8 A;  4A7J A;  3SN6 B;  2AGX A;  5A2Q g;  3SHF A;  1OMW B;  1YFQ A;  4XEI C;  4JD2 C;  2PBI B;  5EAM A;  3RFG A;  3SBQ A;  3IJ0 A;  4PC0 A;  3J80 g;  1K8K C;  2B5M A;  4E5Z A;  3ULE C;  4A11 B;  5I5J A;  2IUQ A;  2IWK A;  4QRJ A;  5I5I A;  3C75 H;  2EBS A;  5FXY A;  3K26 A;  4YVD A;  5EM2 B;  5CYK A;  4ES0 A;  3I7N A;  5GXI A;  3RRM C;  5FLX g;  2YB8 B;  3DSM A;  4J0X A;  4X61 B;  3MXX A;  2H6K A;  4TZ4 A;  2B5L A;  2H9L A;  4L9O A;  1JMX B;  2IAA A;  2O9K A;  3N0E A;  2QXV A;  3MZL A;  1B9Y A;  1TBG A;  3F3P A;  4D6V A;  5HE1 B;  5JWZ A;  4J0W A;  4GMB A;  2Q7Q A;  1SQJ A;  4CZX A;  2XL3 A;  3U4Y A;  3I8E A;  3P4F A;  4JT6 C;  5EMK B;  2GNQ A;  3SBR A;  3I7O A;  3SBP A;  3OKY B;  4CY3 A;  3GRE A;  4JSP C;  4GGD A;  4GGA A;  2OVR B;  3HFQ A;  3DXM C;  3IKO A;  5HE2 B;  4ZN4 A;  4J87 A;  3UVN A;  3I7P A;  3F3F A;  3OL2 B;  3RFH A;  2CO0 C;  4UI9 R; 
#chains in the Genus database with same CATH topology
 4O9D A;  3VI4 A;  2H14 A;  2QC5 A;  3EI4 B;  3SWS D;  4MMX A;  3AL8 A;  4Y7R A;  1VE6 A;  4RE5 A;  1OLZ A;  2XYI A;  2XZG A;  4X60 B;  4CI2 A;  4DNW A;  4A0B B;  5EAR A;  4CZY A;  2CNX A;  2XU7 A;  4MMY A;  2AH0 A;  2YNN A;  5HQG A;  3VI3 A;  4E54 A;  1GOT B;  4A2M A;  3EI1 B;  5FQD A;  1N6D A;  1C9I A;  4J8G A;  1GXR A;  2YNO A;  4BCC A;  3ZDZ A;  3W15 A;  3N0D A;  1GG2 B;  4A09 B;  2QZP A;  1VE7 A;  2I3T A;  2P9S C;  5FKQ A;  1PGU A;  3T3P A;  4XYI A;  3KRW B;  4A11 A;  4Z7Q A;  2HXC A;  4FB1 D;  4AMZ A;  2Z2O A;  3L4M D;  2EIC A;  3SVW D;  3VGZ A;  3C5M A;  2H3X A;  4NSX A;  1MG2 A;  3O4J A;  2TRC B;  4G1E A;  3EI2 A;  2BCJ B;  4X63 B;  2P9L C;  3RMZ D;  5E6R A;  1I2M B;  4LG9 A;  4BCD A;  5AMS A;  4J86 A;  5E6S A;  3K71 A;  3IIW A;  2AGL A;  4JXM A;  1TYE A;  4WK4 A;  2HU7 A;  5K19 A;  5IJ7 E;  2CE8 A;  3O4G A;  4ZOV A;  1GOH A;  3NVQ A;  4U1E I;  1Q47 A;  1L0Q A;  3GFC A;  3FCS A;  3I8C A;  1JMZ B;  4Y5R D;  4BH6 A;  4PBZ A;  3DDU A;  1H2W A;  4A0A A;  5TF2 A;  2UZY B;  4G1M A;  3ZE0 A;  3CIK B;  3UVM A;  2VC2 A;  2Z2N A;  3C99 A;  5CXC A;  3O4I A;  3EI3 A;  3IJ1 A;  5CXB B;  4UM9 A;  3JB9 L;  4FAN D;  5TDH B;  5C2W B;  1YR2 A;  1K3I A;  5HE0 B;  3GD1 I;  2CO0 A;  5C2V B;  3I7K A;  2AH1 A;  2IWF A;  3DM0 A;  4RE6 A;  5M61 A;  4CC9 A;  4IRZ A;  5M5S A;  1SQ9 A;  4MK0 B;  5IJ8 E;  1P22 A;  1PBY B;  1GOF A;  5SXM A;  4J77 A;  3OKY A;  3SCY A;  5H1M A;  2H13 A;  1N6F A;  4L3H D;  4ESG A;  2H47 A;  1BPO A;  3SJL D;  4FHL A;  4LG8 A;  2PM9 A;  4AOW A;  3SFZ A;  3QHY B;  3JAM g;  4JSV C;  4L3G D;  1PI6 A;  4H5I A;  3MUN A;  2OK4 A;  5FFO A;  1RI6 A;  3KRX B;  3IJE A;  3AH8 B;  2P9U C;  5M5U A;  2OJY A;  5C86 A;  5IT9 g;  4A08 A;  5EMJ B;  3IIY A;  3I7L A;  1S4U X;  2GC7 A;  5CYK B;  2AGZ A;  3SLE D;  4J73 A;  1MG3 A;  4JHN A;  2OVP B;  3NID A;  3PXS D;  4LGN A;  5B4W A;  1H2Z A;  1TYQ C;  2J55 H;  3JZH A;  4BL0 A;  4ERQ A;  3EI1 A;  4I79 A;  3ODT A;  3K6S A;  3FRX A;  3IVM A;  4FWW A;  3ZE1 A;  3CFV A;  3NIF A;  3MUO A;  4J79 A;  5HE3 B;  3JZG A;  1U2V C;  5AJA A;  3SMR A;  4J8B A;  2AGY A;  1QFS A;  4AN0 A;  4BUJ C;  2MTA H;  4D0K A;  3RSE C;  2HU5 A;  4K3J B;  3MKQ A;  2CN2 A;  3UKR C;  4U7A A;  4CY1 A;  1L5G A;  3EQ9 A;  4PXW A;  2VDO A;  3BWS A;  4A2L A;  4IA9 A;  4GQ1 A;  3RN0 D;  3JRO A;  2HYE A;  5EAP A;  4ERZ A;  3EG6 A;  5KDO B;  3PVW B;  2VDR A;  3DXK C;  3NIG A;  2I0S A;  4GM9 A;  4G56 B;  3JPX A;  1JV2 A;  2Z2P A;  3I89 A;  1UOP A;  2CE9 A;  4CI8 A;  2VDL A;  3ZWL B;  3CFS B;  2H9N A;  2H9M A;  2J57 G;  5I5M A;  4GZ8 A;  2OIZ A;  4K3I D;  2B4E A;  5EM2 A;  2XE4 A;  1R5M A;  3EWE A;  1E8N A;  2OK6 A;  4NBM A;  4FA4 D;  4PBY A;  3V4P A;  5IC7 A;  2WQ8 A;  5EMM B;  1XKS A;  4CY5 A;  3AFC A;  2HES X;  4OWR A;  2VZ3 A;  3MKS B;  2VZ1 A;  1PEV A;  4GM8 A;  4DNU A;  2G99 A;  5FA5 B;  2AQ5 A;  5M5R A;  4O3U B;  3I7H A;  4JSN C;  4E54 B;  4J82 A;  4L1Q D;  3RN1 D;  4ZOZ A;  2H9P A;  5TEF A;  3ZE2 A;  4JSX C;  2HKR A;  2YBA A;  4EWR A;  3NVX A;  2PM7 B;  3JRP A;  5EAL A;  3IJC A;  4CI1 A;  4G55 A;  3ORV D;  3V9F A;  2PM6 B;  5M5T A;  3IUM A;  4N14 A;  5FKT A;  1SHY B;  3EU7 A;  4GGC A;  5HYN B;  3IUJ A;  1H2X A;  4PSW B;  3PXT D;  1E5T A;  3UVO A;  3C9C A;  3PXW D;  3QI0 A;  3DWL C;  4MMZ A;  2H6Q A;  3A0F A;  1UOQ A;  4AMY A;  1E8M A;  3VA6 A;  1T2X A;  3EI2 B;  3UVK A;  1U4C A;  3OW8 A;  2BBK H;  4WJK A;  3OKW A;  2EID A;  3PE7 A;  2VDP A;  4ZOX A;  2IUV A;  3V5W B;  4L1M A;  3K27 A;  4J84 A;  3NVN A;  4OZU A;  5IGO A;  4E5Z B;  3F3G A;  4R7A B;  4BP8 A;  3MZK A;  5E6U A;  4J78 A;  3O4H A;  1NR0 A;  3OTT A;  4WK0 A;  3OL2 A;  2EIB A;  5EML B;  2H6N A;  4NEN A;  2H68 A;  3IUQ A;  4A0A B;  3EI4 A;  4IMM A;  2XL2 A;  4WK2 A;  5M5V A;  3BG1 A;  2YNP A;  5FKR A;  2YMU A;  2B5N A;  4KFM B;  4O45 A;  3UKU C;  4A0B A;  5CXC B;  1B9X A;  1VYH C;  2P9N C;  4FA1 D;  3EI3 B;  3OKT A;  4D9S A;  1XIP A;  3IUL A;  4JT5 C;  1JJU B;  1A0R B;  3J81 g;  3GC3 B;  3PVU B;  3VH0 A;  3T3M A;  1XHM A;  3UVL A;  3JZN A;  1GOG A;  5THA A;  3PSC B;  2EIE A;  4X3E A;  4PSX B;  3OF7 A;  5H14 A;  2QR5 A;  3MMY A;  2CN3 A;  4GQB B;  4FAV D;  1ERJ A;  1FWX A;  4CI3 A;  4A09 A;  2P9K C;  2VDQ A;  2VDM A;  5GSA A;  2G9A A;  5IGQ A;  2PM9 B;  2GC4 A;  4FA9 D;  2HJ4 A;  4AX4 A;  2IUP A;  3MVD K;  1JOF A;  4Z7N A;  4HDJ A;  1N6E A;  1GP2 B;  2UZX B;  3SXT D;  4CZV A;  5GMK n;  4O1Q D;  2J56 H;  2JKX A;  4ZOY A;  4QQE A;  3B7F A;  4A08 B;  3PSL A;  3FGB A;  1QNI A;  3I2N A;  5AFU 3;  2I3S A;  2P9P C;  1UOO A;  4PNK B;  4H5J A;  4AEZ A;  2W18 A;  5TEE A;  5GXH A;  3AL9 A;  4QL1 A;  4NAA A;  1MDA H;  3L4O D;  2VDK A;  4QAM A;  4FA5 D;  2IUR A;  1NEX B;  3V7D B;  4Z8L A;  3UR4 A;  1A12 A;  1K32 A;  4ERY A;  5C9Z B;  4O02 A;  4UM8 A;  5FKS A;  3AL8 B;  5CXB A;  5K1C C;  4XYH A;  3ZDX A;  4CY2 A;  3E0C A;  2I0T A;  3RLM D;  4J81 A;  2OVQ B;  2XDW A;  4GM3 A;  2P9I C;  3BG0 A;  2HJB A;  4O3T B;  3FCU A;  3FM0 A;  2HU8 A;  3EMH A;  2AGW A;  4GQ2 P;  5H17 A;  2I0R A;  2HKM A;  4QT8 A;  4A7J A;  4DNV A;  3SN6 B;  2AGX A;  5A2Q g;  3SHF A;  1OMW B;  1YFQ A;  4XEI C;  4JD2 C;  2PBI B;  5EAM A;  3RFG A;  3SBQ A;  2VDN A;  1JTD B;  3IJ0 A;  4PC0 A;  3J80 g;  1K8K C;  2B5M A;  4E5Z A;  3ULE C;  1M1X A;  3ZDY A;  4A11 B;  5I5J A;  2IUQ A;  2IWK A;  4QRJ A;  5I5I A;  1QFM A;  1VZ3 A;  3C75 H;  2EBS A;  5FXY A;  3EQ8 A;  3K26 A;  4YVD A;  5EM2 B;  5CYK A;  4ES0 A;  3I7N A;  5GXI A;  3RRM C;  5FLX g;  2YB8 B;  3DSM A;  4J0X A;  4X61 B;  3MXX A;  2H6K A;  4TZ4 A;  2B5L A;  2H9L A;  4L9O A;  1JMX B;  3IUR A;  3EQ7 A;  1U8C A;  3K72 A;  2IAA A;  2O9K A;  3N0E A;  2QXV A;  4O2W A;  5HDB A;  4JHP C;  3MZL A;  1B9Y A;  1H2Y A;  1TBG A;  3F3P A;  4D6V A;  5HE1 B;  5JWZ A;  4J0W A;  4GMB A;  5C92 A;  2Q7Q A;  1C9L A;  1SQJ A;  4CZX A;  4NC4 A;  2XL3 A;  3U4Y A;  3I8E A;  3P4F A;  1O6G A;  4JT6 C;  5EMK B;  2GNQ A;  4BP9 A;  3SBR A;  5FFG A;  3I7O A;  3SBP A;  4BCB A;  3OKY B;  4CY3 A;  3GRE A;  4JSP C;  1UTC A;  2BKL A;  3V4V A;  4Z7O A;  4GGD A;  4GGA A;  1O6F A;  2OVR B;  3HFQ A;  3KCI A;  3IUN A;  3DXM C;  3IKO A;  5HE2 B;  4AN1 A;  4ZN4 A;  1VZ2 A;  4J87 A;  3UVN A;  3I7P A;  3F3F A;  3OL2 B;  3RFH A;  2CO0 C;  4UI9 R; 
#chains in the Genus database with same CATH homology
 4O9D A;  2H14 A;  2QC5 A;  3EI4 B;  3SWS D;  4Y7R A;  3AL8 A;  1OLZ A;  2XYI A;  4X60 B;  4CI2 A;  4A0B B;  5EAR A;  4CZY A;  2CNX A;  2XU7 A;  2AH0 A;  2YNN A;  5HQG A;  4E54 A;  1GOT B;  4A2M A;  3EI1 B;  5FQD A;  1N6D A;  4J8G A;  1GXR A;  2YNO A;  3W15 A;  3N0D A;  1GG2 B;  4A09 B;  2I3T A;  2P9S C;  5FKQ A;  1PGU A;  4XYI A;  3KRW B;  4A11 A;  2HXC A;  4FB1 D;  2Z2O A;  3L4M D;  3SVW D;  3VGZ A;  3C5M A;  2H3X A;  4NSX A;  1MG2 A;  2TRC B;  3EI2 A;  2BCJ B;  4X63 B;  2P9L C;  3RMZ D;  4LG9 A;  5AMS A;  4J86 A;  3IIW A;  2AGL A;  4JXM A;  5K19 A;  5IJ7 E;  2CE8 A;  4ZOV A;  3NVQ A;  4U1E I;  1Q47 A;  1L0Q A;  3GFC A;  3I8C A;  4Y5R D;  1JMZ B;  4BH6 A;  4PBZ A;  4A0A A;  5TF2 A;  2UZY B;  3CIK B;  3UVM A;  2Z2N A;  3C99 A;  5CXC A;  3EI3 A;  3IJ1 A;  5CXB B;  3JB9 L;  4FAN D;  5TDH B;  5C2W B;  5HE0 B;  2CO0 A;  5C2V B;  3I7K A;  2AH1 A;  2IWF A;  3DM0 A;  4CC9 A;  1SQ9 A;  4MK0 B;  5IJ8 E;  1P22 A;  1PBY B;  5SXM A;  4J77 A;  3OKY A;  3SCY A;  5H1M A;  2H13 A;  1N6F A;  4L3H D;  4ESG A;  2H47 A;  3SJL D;  4FHL A;  4LG8 A;  2PM9 A;  4AOW A;  3SFZ A;  3JAM g;  4JSV C;  4L3G D;  1PI6 A;  4H5I A;  2OK4 A;  1RI6 A;  3KRX B;  3AH8 B;  2P9U C;  2OJY A;  5IT9 g;  4A08 A;  5EMJ B;  3IIY A;  3I7L A;  1S4U X;  2GC7 A;  5CYK B;  2AGZ A;  3SLE D;  4J73 A;  1MG3 A;  2OVP B;  5B4W A;  3PXS D;  4LGN A;  2J55 H;  1TYQ C;  3JZH A;  4BL0 A;  4ERQ A;  3EI1 A;  4I79 A;  3ODT A;  3FRX A;  4FWW A;  3CFV A;  4J79 A;  5HE3 B;  3JZG A;  1U2V C;  5AJA A;  3SMR A;  4J8B A;  2AGY A;  4BUJ C;  2MTA H;  4D0K A;  3RSE C;  4K3J B;  3MKQ A;  2CN2 A;  3UKR C;  4U7A A;  4CY1 A;  4PXW A;  4A2L A;  3BWS A;  4IA9 A;  4GQ1 A;  3RN0 D;  3JRO A;  2HYE A;  5EAP A;  4ERZ A;  3EG6 A;  5KDO B;  3PVW B;  3DXK C;  2I0S A;  4GM9 A;  4G56 B;  3JPX A;  2Z2P A;  3I89 A;  4CI8 A;  2CE9 A;  3ZWL B;  3CFS B;  2H9N A;  2H9M A;  2J57 G;  5I5M A;  4GZ8 A;  2OIZ A;  4K3I D;  2B4E A;  5EM2 A;  1R5M A;  3EWE A;  2OK6 A;  4FA4 D;  4PBY A;  5IC7 A;  5EMM B;  1XKS A;  4CY5 A;  3AFC A;  2HES X;  4OWR A;  3MKS B;  1PEV A;  4GM8 A;  2G99 A;  5FA5 B;  2AQ5 A;  4O3U B;  3I7H A;  4JSN C;  4E54 B;  4J82 A;  4L1Q D;  3RN1 D;  4ZOZ A;  2H9P A;  5TEF A;  4JSX C;  2HKR A;  2YBA A;  4EWR A;  3NVX A;  2PM7 B;  3JRP A;  5EAL A;  3IJC A;  4CI1 A;  3ORV D;  3V9F A;  2PM6 B;  4N14 A;  5FKT A;  1SHY B;  3EU7 A;  4GGC A;  5HYN B;  4PSW B;  3PXT D;  3UVO A;  3C9C A;  3PXW D;  3DWL C;  2H6Q A;  3A0F A;  3VA6 A;  3EI2 B;  3UVK A;  1U4C A;  3OW8 A;  2BBK H;  3OKW A;  3PE7 A;  4ZOX A;  2IUV A;  3V5W B;  3K27 A;  4J84 A;  3NVN A;  4OZU A;  5IGO A;  4E5Z B;  3F3G A;  4R7A B;  3MZK A;  4J78 A;  1NR0 A;  3OTT A;  3OL2 A;  5EML B;  2H6N A;  2H68 A;  4A0A B;  3EI4 A;  4IMM A;  2XL2 A;  3BG1 A;  2YNP A;  5FKR A;  2YMU A;  2B5N A;  4KFM B;  4O45 A;  3UKU C;  4A0B A;  5CXC B;  1B9X A;  1VYH C;  2P9N C;  4FA1 D;  3EI3 B;  3OKT A;  1XIP A;  4JT5 C;  1JJU B;  1A0R B;  3J81 g;  3PVU B;  3VH0 A;  1XHM A;  3UVL A;  3JZN A;  5THA A;  3PSC B;  4X3E A;  4PSX B;  5H14 A;  3MMY A;  2CN3 A;  4GQB B;  4FAV D;  1ERJ A;  1FWX A;  4CI3 A;  4A09 A;  2P9K C;  5GSA A;  2G9A A;  5IGQ A;  2PM9 B;  2GC4 A;  4FA9 D;  2HJ4 A;  2IUP A;  1JOF A;  4HDJ A;  1N6E A;  1GP2 B;  2UZX B;  3SXT D;  4CZV A;  5GMK n;  4O1Q D;  2J56 H;  4ZOY A;  4QQE A;  3B7F A;  4A08 B;  3PSL A;  3FGB A;  1QNI A;  3I2N A;  5AFU 3;  2I3S A;  2P9P C;  4PNK B;  4H5J A;  4AEZ A;  2W18 A;  5TEE A;  5GXH A;  3AL9 A;  4QL1 A;  1MDA H;  3L4O D;  4FA5 D;  2IUR A;  1NEX B;  3V7D B;  4Z8L A;  3UR4 A;  4ERY A;  1K32 A;  5C9Z B;  5FKS A;  3AL8 B;  5CXB A;  5K1C C;  4XYH A;  4CY2 A;  3E0C A;  2I0T A;  3RLM D;  4J81 A;  2OVQ B;  4GM3 A;  2P9I C;  3BG0 A;  2HJB A;  4O3T B;  3FM0 A;  3EMH A;  2AGW A;  4GQ2 P;  5H17 A;  2I0R A;  2HKM A;  4QT8 A;  4A7J A;  3SN6 B;  2AGX A;  5A2Q g;  3SHF A;  1OMW B;  1YFQ A;  4XEI C;  4JD2 C;  2PBI B;  5EAM A;  3RFG A;  3SBQ A;  3IJ0 A;  4PC0 A;  3J80 g;  1K8K C;  2B5M A;  4E5Z A;  3ULE C;  4A11 B;  5I5J A;  2IUQ A;  2IWK A;  4QRJ A;  5I5I A;  3C75 H;  2EBS A;  5FXY A;  3K26 A;  4YVD A;  5EM2 B;  5CYK A;  4ES0 A;  3I7N A;  5GXI A;  3RRM C;  5FLX g;  2YB8 B;  3DSM A;  4J0X A;  4X61 B;  3MXX A;  2H6K A;  4TZ4 A;  2B5L A;  2H9L A;  4L9O A;  1JMX B;  2IAA A;  2O9K A;  3N0E A;  2QXV A;  3MZL A;  1B9Y A;  1TBG A;  3F3P A;  4D6V A;  5HE1 B;  5JWZ A;  4J0W A;  4GMB A;  2Q7Q A;  1SQJ A;  4CZX A;  2XL3 A;  3U4Y A;  3I8E A;  3P4F A;  4JT6 C;  5EMK B;  2GNQ A;  3SBR A;  3I7O A;  3SBP A;  3OKY B;  4CY3 A;  3GRE A;  4JSP C;  4GGD A;  4GGA A;  2OVR B;  3HFQ A;  3DXM C;  3IKO A;  5HE2 B;  4ZN4 A;  4J87 A;  3UVN A;  3I7P A;  3F3F A;  3OL2 B;  3RFH A;  2CO0 C;  4UI9 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...