2H9LA

Wdr5delta23
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
321
structure length
321
Chain Sequence
SGRENLYFQGTQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, gene regulation
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9lA00
2HKRA 4ES0A 4J8GA 2J56H 1B9XA 4PC0A 2Z2OA 2YMUA 3PXTD 4E5ZA 2CN3A 4J82A 5HYNB 4JT6C 3IJ1A 3FM0A 4CY3A 1GP2B 2G9AA 1GOTB 3SLED 4PBYA 2HYEA 1Q47A 3UKRC 2PM7B 3AL8A 4FWWA 4QRJA 4FAND 5CYKA 4PBZA 3EI4A 5EM2A 4KFMB 4A0BB 4J87A 3GREA 1MDAH 5A2Qg 4A11B 1N6EA 2CO0C 2P9KC 5EM2B 3RN0D 3C5MA 3C75H 1JOFA 2P9PC 4FHLA 5FA5B 2OVQB 1PI6A 4GM8A 3V9FA 3A0FA 2XYIA 4ERZA 3CFSB 3EWEA 3C99A 3MZKA 5TDHB 3RLMD 3JRPA 3ODTA 2XL2A 5EMJB 3PXSD 3VH0A 4BL0A 4CY1A 3SXTD 4A09A 4JD2C 4D0KA 2J55H 2J57G 3I2NA 3SHFA 4A08A 4J77A 5IT9g 1TYQC 4YVDA 4CY2A 1VYHC 2IUVA 3KRXB 5CXCA 4O45A 4J73A 5AJAA 2XL3A 5CXCB 1N6FA 1R5MA 4R7AB 4J81A 3I89A 1P22A 3N0DA 1NR0A 1U2VC 3ZWLB 3I8CA 3KRWB 3CFVA 2GC4A 5FLXg 1JMZB 2CE9A 2OVPB 3VGZA 4CZYA 5HQGA 3SBPA 5K19A 2PM9B 1QNIA 3FRXA 3SJLD 3PXWD 3NVNA 3K27A 5FKQA 4Y7RA 1YFQA 3ORVD 3JZHA 3EMHA 1SQJA 4GQ2P 3SMRA 4U7AA 3MXXA 2OJYA 3I7NA 5SXMA 5EMMB 3MKQA 4FA9D 1SQ9A 5H1MA 4JSXC 2IUQA 2H6QA 5GXIA 4XYHA 4H5JA 2Z2PA 3EG6A 2I0SA 1XHMA 5C9ZB 4UI9R 2H3XA 3SWSD 5I5JA 3SFZA 3I7PA 5EALA 3PVWB 3DSMA 2BCJB 3UVMA 1A0RB 3U4YA 4ZN4A 3V5WB 4E5ZB 2CE8A 2P9IC 2IURA 4JXMA 2QC5A 4GZ8A 4MK0B 2B5LA 1NEXB 3I8EA 3DM0A 3PE7A 5EMKB 2I0TA 2H47A 2AGZA 3I7LA 3AL8B 2IAAA 1XIPA 5CYKB 4GGAA 3EI4B 3OKYA 5EAMA 3JB9L 1K32A 1L0QA 4QT8A 4JT5C 5HE1B 4TZ4A 3DWLC 4X61B 4ZOZA 4FB1D 4D6VA 5TEEA 2TRCB 3EU7A 3E0CA 3OKWA 3OL2A 4O3TB 3SVWD 2CO0A 4FA4D 5AMSA 4FA5D 3K26A 3NVXA 4X3EA 1PBYB 4GQ1A 1K8KC 2OIZA 5K1CC 1B9YA 2P9SC 1GXRA 2I3SA 2OK6A 3IIYA 4L3HD 2AGLA 4A09B 3OW8A 4CZXA 2AH0A 2H9PA 1N6DA 3IKOA 4A08B 2P9UC 3PSCB 2GC7A 1MG2A 4GGCA 2W18A 4U1EI 3RFHA 4FA1D 5FKSA 5FKRA 4QQEA 3SBRA 4E54A 4LGNA 3I7HA 3BWSA 3JPXA 2HESX 4OWRA 2HKMA 4E54B 4QL1A 5CXBA 4CC9A 3GFCA 3I7KA 4AEZA 2P9LC 4Y5RD 4CY5A 2G99A 5HE2B 4J0WA 2H68A 2B5MA 4XYIA 4CI8A 4GGDA 3JAMg 2YNOA 4AOWA 3SBQA 3EI1A 3JZNA 4JSNC 1ERJA 5GXHA 3OKTA 2PBIB 4GM9A 2H13A 3IJCA 3BG0A 4HDJA 3UR4A 4K3JB 2H6KA 4L1QD 4PSXB 5B4WA 3W15A 4A7JA 2H14A 1FWXA 4BH6A 4XEIC 2AGXA 4OZUA 2YBAA 3RN1D 2O9KA 3VA6A 4JSVC 5HE0B 5TEFA 3UVLA 3N0EA 2H6NA 3UVKA 3JROA 3DXKC 3SCYA 4ZOXA 3J81g 2B5NA 4O3UB 1S4UX 2I3TA 4A2MA 2XU7A 3L4OD 3UKUC 3F3PA 4PSWB 2YNPA 5EARA 4GMBA 3MMYA 5HE3B 3SN6B 1GG2B 3BG1A 1SHYB 3IIWA 5GSAA 2PM6B 3L4MD 2H9MA 3I7OA 4J78A 2HJBA 4ZOYA 4CI1A 2Z2NA 2AQ5A 3UVOA 5KDOB 3AFCA 3OKYB 3RRMC 3AH8B 4A0BA 2GNQA 2IWKA 2H9NA 5GMKn 2H9LA 4L3GD 4A11A 4GM3A 4ERYA 3EI3A 3ULEC 3HFQA 1MG3A 5C2VB 1JMXB 2Q7QA 3P4FA 5JWZA 5AFU3 4X63B 3J80g 2AGYA 2UZXB 3OL2B 4IMMA 3EI3B 4FAVD 1XKSA 1RI6A 2YNNA 1U4CA 4O1QD 2B4EA 5I5MA 4J86A 2HXCA 4NSXA 3FGBA 5FQDA 5IGQA 4K3ID 2CN2A 2AH1A 3C9CA 4X60B 4IA9A 4Z8LA 3OTTA 5IGOA 3AL9A 2MTAH 2QXVA 2I0RA 2IUPA 3RSEC 3MKSB 5H14A 4A0AA 4PXWA 1TBGA 3F3FA 5IJ8E 4G56B 3EI2A 4LG8A 4A0AB 3MZLA 2BBKH 2HJ4A 3IJ0A 5IJ7E 4EWRA 5H17A 5CXBB 4JSPC 3PSLA 4H5IA 3DXMC 3EI2B 2EBSA 4J84A 4A2LA 3B7FA 1PGUA 5EAPA 4LG9A 2PM9A 3JZGA 5FXYA 2OK4A 4CI2A 5I5IA 3CIKB 4J0XA 5C2WB 3RFGA 3EI1B 2IWFA 2YB8B 5TF2A 1PEVA 3RMZD 2AGWA 3PVUB 4N14A 4ESGA 5EMLB 4I79A 5FKTA 4GQBB 4L9OA 2CNXA 1JJUB 1OMWB 3F3GA 2P9NC 4CI3A 3V7DB 4BUJC 5THAA 4ERQA 3UVNA 4J8BA 3NVQA 4O9DA 4CZVA 4PNKB 5IC7A 2OVRB 4J79A 4ZOVA 1OLZA 2UZYB
chains in the Genus database with same CATH superfamily
2HKRA 4ES0A 4J8GA 2J56H 1B9XA 4PC0A 2Z2OA 3DDUA 2YMUA 3IUQA 2VC2A 3PXTD 4E5ZA 2CN3A 4J82A 5HYNB 4JT6C 3IJ1A 3FM0A 4CY3A 3FCSA 1GP2B 2G9AA 4O2WA 2XE4A 2QZPA 1GOTB 3SLED 1VZ3A 4PBYA 3V4PA 2HYEA 1L5GA 1Q47A 4Z7NA 3UKRC 2PM7B 3AL8A 3T3PA 4FWWA 4QRJA 4FAND 5CYKA 4PBZA 4BCBA 3EI4A 3MUNA 5M5UA 5EM2A 4KFMB 4A0BB 4J87A 3GREA 1MDAH 3NIDA 2XDWA 5A2Qg 4A11B 1N6EA 2CO0C 2P9KC 5EM2B 3RN0D 2VDNA 3C5MA 3O4JA 3C75H 1JOFA 2P9PC 4FHLA 5FA5B 2OVQB 1PI6A 4GM8A 4WK2A 3V9FA 3IURA 3A0FA 2XYIA 4ERZA 3CFSB 3EWEA 3C99A 3MZKA 5TDHB 3RLMD 3JRPA 4BCDA 3ODTA 2XL2A 5EMJB 3PXSD 3VH0A 2VDRA 4BL0A 4CY1A 3K6SA 3EQ7A 3SXTD 4A09A 4JD2C 4D0KA 4DNUA 2J55H 2J57G 1M1XA 3I2NA 3SHFA 4A08A 4J77A 1TYEA 5IT9g 3IUNA 1TYQC 4YVDA 4CY2A 1VYHC 1VZ2A 2IUVA 3KRXB 2VDOA 5CXCA 4O45A 4J73A 5AJAA 2XL3A 4MMXA 3IVMA 1UOOA 3IULA 5CXCB 2VDKA 4BP9A 1N6FA 5M5SA 4QAMA 1R5MA 4R7AB 4J81A 3I89A 1P22A 3N0DA 1NR0A 1U2VC 3ZWLB 3I8CA 3KRWB 3CFVA 2GC4A 5FLXg 1JMZB 1UOQA 2CE9A 4IRZA 2OVPB 1H2YA 3VGZA 3VI3A 1UTCA 4CZYA 3VI4A 5HQGA 3SBPA 5K19A 2PM9B 1BPOA 1QNIA 2BKLA 3FRXA 4AMYA 3SJLD 1JTDB 3PXWD 3NVNA 3K27A 5FKQA 5FFGA 4NBMA 4Y7RA 1YFQA 1E8MA 3ORVD 3JZHA 3EMHA 1SQJA 2HU7A 1E8NA 1GOGA 4GQ2P 3SMRA 4U7AA 4UM9A 3MXXA 2OJYA 3I7NA 5SXMA 5EMMB 3MKQA 4FA9D 1SQ9A 5H1MA 4JSXC 4Z7QA 2IUQA 2H6QA 5GXIA 4XYHA 4H5JA 3ZDZA 5M5VA 2Z2PA 3EG6A 2I0SA 1XHMA 5C9ZB 4UI9R 2H3XA 4WK4A 3SWSD 4D9SA 2VDMA 5I5JA 3SFZA 3I7PA 5EALA 3PVWB 3GD1I 1VE6A 1YR2A 3DSMA 2BCJB 3UVMA 1A0RB 3U4YA 4ZN4A 1GOHA 5E6RA 3V5WB 4E5ZB 4JHPC 2CE8A 2P9IC 2IURA 4JXMA 2QC5A 4GZ8A 4MK0B 2B5LA 1O6GA 1NEXB 3I8EA 3DM0A 3O4GA 3PE7A 5EMKB 2I0TA 3O4HA 4NC4A 2H47A 2AGZA 2VDQA 3I7LA 3AL8B 2IAAA 1XIPA 5CYKB 1O6FA 3EI4B 3OKYA 4GGAA 5EAMA 3JB9L 1K32A 1L0QA 4QT8A 4JT5C 5HE1B 3ZDXA 4TZ4A 5C86A 3DWLC 4X61B 3IUMA 4ZOZA 4FB1D 4D6VA 5TEEA 5FFOA 4AN0A 2TRCB 3EU7A 3E0CA 3OKWA 3OL2A 4O3TB 3SVWD 2CO0A 3QI0A 4FA4D 1C9LA 5AMSA 4FA5D 3K26A 3NVXA 4X3EA 1PBYB 4GQ1A 1K8KC 2OIZA 5K1CC 1B9YA 2P9SC 1GXRA 2I3SA 1QFSA 2OK6A 3IIYA 4NAAA 4L3HD 2AGLA 1JV2A 4A09B 3OW8A 4CZXA 2AH0A 2H9PA 1N6DA 3IKOA 4MMYA 4A08B 2P9UC 3PSCB 2GC7A 1MG2A 4GGCA 2W18A 4U1EI 3RFHA 4FA1D 5FKSA 5FKRA 3T3MA 4QQEA 3SBRA 4E54A 1QFMA 4LGNA 3I7HA 3BWSA 4UM8A 3JPXA 2HESX 4OWRA 2HKMA 4E54B 4QL1A 5CXBA 4CC9A 3GFCA 3I7KA 2XZGA 4AEZA 2P9LC 4Y5RD 4CY5A 2G99A 3ZE2A 5HE2B 3MVDK 4J0WA 2H68A 2B5MA 4XYIA 4CI8A 4GGDA 5E6UA 3JAMg 2VDPA 2YNOA 4AOWA 3SBQA 3EI1A 3JZNA 3FCUA 4JSNC 1ERJA 5GXHA 3OKTA 2PBIB 1VE7A 1A12A 4JHNA 4GM9A 2HU5A 2H13A 3IJCA 3BG0A 3V4VA 4HDJA 5HDBA 3ZE0A 3UR4A 4K3JB 2H6KA 4L1QD 4PSXB 5B4WA 3W15A 4A7JA 4G1EA 4AX4A 2H14A 1FWXA 4BH6A 5M5RA 4XEIC 2AGXA 4OZUA 2YBAA 3RN1D 2O9KA 3EQ9A 4JSVC 3VA6A 5HE0B 4BP8A 5TEFA 3UVLA 3N0EA 2H6NA 3UVKA 3JROA 3DXKC 3SCYA 4ZOXA 3J81g 2B5NA 4O3UB 5M5TA 4RE6A 1S4UX 2I3TA 4A2MA 3K72A 2XU7A 3ZE1A 3L4OD 3UKUC 4AMZA 3F3PA 1I2MB 4PSWB 2YNPA 1H2XA 4G55A 5EARA 5M61A 4L1MA 4GMBA 3MMYA 5HE3B 3SN6B 1GG2B 3BG1A 1SHYB 3IIWA 5GSAA 2PM6B 4RE5A 3L4MD 2H9MA 3I7OA 4J78A 3ZDYA 2HJBA 4ZOYA 4CI1A 4AN1A 2Z2NA 2AQ5A 3UVOA 5KDOB 3AFCA 3OKYB 3RRMC 3AH8B 4A0BA 2GNQA 2IWKA 2H9NA 1K3IA 5GMKn 2H9LA 4L3GD 4A11A 4GM3A 4ERYA 3NIGA 5C92A 3EI3A 3ULEC 3HFQA 1MG3A 5C2VB 1JMXB 2Q7QA 3P4FA 5JWZA 5AFU3 4X63B 3O4IA 3J80g 4G1MA 3MUOA 2AGYA 2UZXB 3OL2B 4IMMA 3EI3B 4FAVD 5E6SA 1XKSA 1RI6A 2YNNA 2EIEA 3IUJA 1U4CA 4O1QD 2B4EA 5I5MA 2VDLA 4J86A 4DNWA 2HXCA 1U8CA 4NSXA 3OF7A 3FGBA 5FQDA 2EIBA 5IGQA 4K3ID 2AH1A 2CN2A 3C9CA 4X60B 2VZ3A 4IA9A 2EIDA 3OTTA 4Z8LA 3AL9A 5IGOA 2MTAH 2QXVA 2I0RA 2IUPA 3RSEC 3MKSB 5H14A 3KCIA 4A0AA 2JKXA 4PXWA 1TBGA 3F3FA 5IJ8E 4O02A 4G56B 3EI2A 4LG8A 4A0AB 3MZLA 2BBKH 2HJ4A 3IJ0A 5IJ7E 4EWRA 5H17A 5CXBB 1H2WA 4JSPC 3GC3B 3PSLA 3K71A 4H5IA 3DXMC 3EI2B 2EBSA 4J84A 4A2LA 3B7FA 1PGUA 5EAPA 2VZ1A 4LG9A 2PM9A 3JZGA 2HU8A 2OK4A 5FXYA 4WK0A 4CI2A 2WQ8A 3EQ8A 4Z7OA 5I5IA 3CIKB 3NIFA 4J0XA 1E5TA 5C2WB 3RFGA 3EI1B 2IWFA 2YB8B 5TF2A 1T2XA 2QR5A 1PEVA 1UOPA 3RMZD 1GOFA 4WJKA 2AGWA 3PVUB 4N14A 4ESGA 5EMLB 4I79A 4DNVA 5FKTA 4GQBB 4L9OA 2CNXA 1H2ZA 1JJUB 1OMWB 2EICA 2P9NC 3F3GA 4CI3A 1C9IA 3V7DB 4BUJC 5THAA 4ERQA 4NENA 3UVNA 4J8BA 3NVQA 4O9DA 4CZVA 4PNKB 3QHYB 4MMZA 5IC7A 2OVRB 4J79A 4BCCA 3IJEA 4ZOVA 1OLZA 2UZYB
chains in the Genus database with same CATH topology
2HKRA 4ES0A 4J8GA 2J56H 1B9XA 4PC0A 2Z2OA 2YMUA 3PXTD 4E5ZA 2CN3A 4J82A 5HYNB 4JT6C 3IJ1A 3FM0A 4CY3A 1GP2B 2G9AA 1GOTB 3SLED 4PBYA 2HYEA 1Q47A 3UKRC 2PM7B 3AL8A 4FWWA 4QRJA 4FAND 5CYKA 4PBZA 3EI4A 5EM2A 4KFMB 4A0BB 4J87A 3GREA 1MDAH 5A2Qg 4A11B 1N6EA 2CO0C 2P9KC 5EM2B 3RN0D 3C5MA 3C75H 1JOFA 2P9PC 4FHLA 5FA5B 2OVQB 1PI6A 4GM8A 3V9FA 3A0FA 2XYIA 4ERZA 3CFSB 3EWEA 3C99A 3MZKA 5TDHB 3RLMD 3JRPA 3ODTA 2XL2A 5EMJB 3PXSD 3VH0A 4BL0A 4CY1A 3SXTD 4A09A 4JD2C 4D0KA 2J55H 2J57G 3I2NA 3SHFA 4A08A 4J77A 5IT9g 1TYQC 4YVDA 4CY2A 1VYHC 2IUVA 3KRXB 5CXCA 4O45A 4J73A 5AJAA 2XL3A 5CXCB 1N6FA 1R5MA 4R7AB 4J81A 3I89A 1P22A 3N0DA 1NR0A 1U2VC 3ZWLB 3I8CA 3KRWB 3CFVA 2GC4A 5FLXg 1JMZB 2CE9A 2OVPB 3VGZA 4CZYA 5HQGA 3SBPA 5K19A 2PM9B 1QNIA 3FRXA 3SJLD 3PXWD 3NVNA 3K27A 5FKQA 4Y7RA 1YFQA 3ORVD 3JZHA 3EMHA 1SQJA 4GQ2P 3SMRA 4U7AA 3MXXA 2OJYA 3I7NA 5SXMA 5EMMB 3MKQA 4FA9D 1SQ9A 5H1MA 4JSXC 2IUQA 2H6QA 5GXIA 4XYHA 4H5JA 2Z2PA 3EG6A 2I0SA 1XHMA 5C9ZB 4UI9R 2H3XA 3SWSD 5I5JA 3SFZA 3I7PA 5EALA 3PVWB 3DSMA 2BCJB 3UVMA 1A0RB 3U4YA 4ZN4A 3V5WB 4E5ZB 2CE8A 2P9IC 2IURA 4JXMA 2QC5A 4GZ8A 4MK0B 2B5LA 1NEXB 3I8EA 3DM0A 3PE7A 5EMKB 2I0TA 2H47A 2AGZA 3I7LA 3AL8B 2IAAA 1XIPA 5CYKB 4GGAA 3EI4B 3OKYA 5EAMA 3JB9L 1K32A 1L0QA 4QT8A 4JT5C 5HE1B 4TZ4A 3DWLC 4X61B 4ZOZA 4FB1D 4D6VA 5TEEA 2TRCB 3EU7A 3E0CA 3OKWA 3OL2A 4O3TB 3SVWD 2CO0A 4FA4D 5AMSA 4FA5D 3K26A 3NVXA 4X3EA 1PBYB 4GQ1A 1K8KC 2OIZA 5K1CC 1B9YA 2P9SC 1GXRA 2I3SA 2OK6A 3IIYA 4L3HD 2AGLA 4A09B 3OW8A 4CZXA 2AH0A 2H9PA 1N6DA 3IKOA 4A08B 2P9UC 3PSCB 2GC7A 1MG2A 4GGCA 2W18A 4U1EI 3RFHA 4FA1D 5FKSA 5FKRA 4QQEA 3SBRA 4E54A 4LGNA 3I7HA 3BWSA 3JPXA 2HESX 4OWRA 2HKMA 4E54B 4QL1A 5CXBA 4CC9A 3GFCA 3I7KA 4AEZA 2P9LC 4Y5RD 4CY5A 2G99A 5HE2B 4J0WA 2H68A 2B5MA 4XYIA 4CI8A 4GGDA 3JAMg 2YNOA 4AOWA 3SBQA 3EI1A 3JZNA 4JSNC 1ERJA 5GXHA 3OKTA 2PBIB 4GM9A 2H13A 3IJCA 3BG0A 4HDJA 3UR4A 4K3JB 2H6KA 4L1QD 4PSXB 5B4WA 3W15A 4A7JA 2H14A 1FWXA 4BH6A 4XEIC 2AGXA 4OZUA 2YBAA 3RN1D 2O9KA 3VA6A 4JSVC 5HE0B 5TEFA 3UVLA 3N0EA 2H6NA 3UVKA 3JROA 3DXKC 3SCYA 4ZOXA 3J81g 2B5NA 4O3UB 1S4UX 2I3TA 4A2MA 2XU7A 3L4OD 3UKUC 3F3PA 4PSWB 2YNPA 5EARA 4GMBA 3MMYA 5HE3B 3SN6B 1GG2B 3BG1A 1SHYB 3IIWA 5GSAA 2PM6B 3L4MD 2H9MA 3I7OA 4J78A 2HJBA 4ZOYA 4CI1A 2Z2NA 2AQ5A 3UVOA 5KDOB 3AFCA 3OKYB 3RRMC 3AH8B 4A0BA 2GNQA 2IWKA 2H9NA 5GMKn 2H9LA 4L3GD 4A11A 4GM3A 4ERYA 3EI3A 3ULEC 3HFQA 1MG3A 5C2VB 1JMXB 2Q7QA 3P4FA 5JWZA 5AFU3 4X63B 3J80g 2AGYA 2UZXB 3OL2B 4IMMA 3EI3B 4FAVD 1XKSA 1RI6A 2YNNA 1U4CA 4O1QD 2B4EA 5I5MA 4J86A 2HXCA 4NSXA 3FGBA 5FQDA 5IGQA 4K3ID 2CN2A 2AH1A 3C9CA 4X60B 4IA9A 4Z8LA 3OTTA 5IGOA 3AL9A 2MTAH 2QXVA 2I0RA 2IUPA 3RSEC 3MKSB 5H14A 4A0AA 4PXWA 1TBGA 3F3FA 5IJ8E 4G56B 3EI2A 4LG8A 4A0AB 3MZLA 2BBKH 2HJ4A 3IJ0A 5IJ7E 4EWRA 5H17A 5CXBB 4JSPC 3PSLA 4H5IA 3DXMC 3EI2B 2EBSA 4J84A 4A2LA 3B7FA 1PGUA 5EAPA 4LG9A 2PM9A 3JZGA 5FXYA 2OK4A 4CI2A 5I5IA 3CIKB 4J0XA 5C2WB 3RFGA 3EI1B 2IWFA 2YB8B 5TF2A 1PEVA 3RMZD 2AGWA 3PVUB 4N14A 4ESGA 5EMLB 4I79A 5FKTA 4GQBB 4L9OA 2CNXA 1JJUB 1OMWB 3F3GA 2P9NC 4CI3A 3V7DB 4BUJC 5THAA 4ERQA 3UVNA 4J8BA 3NVQA 4O9DA 4CZVA 4PNKB 5IC7A 2OVRB 4J79A 4ZOVA 1OLZA 2UZYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKR A;  4ES0 A;  4J8G A;  2J56 H;  1B9X A;  4PC0 A;  2Z2O A;  2YMU A;  3PXT D;  4E5Z A;  2CN3 A;  4J82 A;  5HYN B;  4JT6 C;  3IJ1 A;  3FM0 A;  4CY3 A;  1GP2 B;  2G9A A;  1GOT B;  3SLE D;  4PBY A;  2HYE A;  1Q47 A;  3UKR C;  2PM7 B;  3AL8 A;  4FWW A;  4QRJ A;  4FAN D;  5CYK A;  4PBZ A;  3EI4 A;  5EM2 A;  4KFM B;  4A0B B;  4J87 A;  3GRE A;  1MDA H;  5A2Q g;  4A11 B;  1N6E A;  2CO0 C;  2P9K C;  5EM2 B;  3RN0 D;  3C5M A;  3C75 H;  1JOF A;  2P9P C;  4FHL A;  5FA5 B;  2OVQ B;  1PI6 A;  4GM8 A;  3V9F A;  3A0F A;  2XYI A;  4ERZ A;  3CFS B;  3EWE A;  3C99 A;  3MZK A;  5TDH B;  3RLM D;  3JRP A;  3ODT A;  2XL2 A;  5EMJ B;  3PXS D;  3VH0 A;  4BL0 A;  4CY1 A;  3SXT D;  4A09 A;  4JD2 C;  4D0K A;  2J55 H;  2J57 G;  3I2N A;  3SHF A;  4A08 A;  4J77 A;  5IT9 g;  1TYQ C;  4YVD A;  4CY2 A;  1VYH C;  2IUV A;  3KRX B;  5CXC A;  4O45 A;  4J73 A;  5AJA A;  2XL3 A;  5CXC B;  1N6F A;  1R5M A;  4R7A B;  4J81 A;  3I89 A;  1P22 A;  3N0D A;  1NR0 A;  1U2V C;  3ZWL B;  3I8C A;  3KRW B;  3CFV A;  2GC4 A;  5FLX g;  1JMZ B;  2CE9 A;  2OVP B;  3VGZ A;  4CZY A;  5HQG A;  3SBP A;  5K19 A;  2PM9 B;  1QNI A;  3FRX A;  3SJL D;  3PXW D;  3NVN A;  3K27 A;  5FKQ A;  4Y7R A;  1YFQ A;  3ORV D;  3JZH A;  3EMH A;  1SQJ A;  4GQ2 P;  3SMR A;  4U7A A;  3MXX A;  2OJY A;  3I7N A;  5SXM A;  5EMM B;  3MKQ A;  4FA9 D;  1SQ9 A;  5H1M A;  4JSX C;  2IUQ A;  2H6Q A;  5GXI A;  4XYH A;  4H5J A;  2Z2P A;  3EG6 A;  2I0S A;  1XHM A;  5C9Z B;  4UI9 R;  2H3X A;  3SWS D;  5I5J A;  3SFZ A;  3I7P A;  5EAL A;  3PVW B;  3DSM A;  2BCJ B;  3UVM A;  1A0R B;  3U4Y A;  4ZN4 A;  3V5W B;  4E5Z B;  2CE8 A;  2P9I C;  2IUR A;  4JXM A;  2QC5 A;  4GZ8 A;  4MK0 B;  2B5L A;  1NEX B;  3I8E A;  3DM0 A;  3PE7 A;  5EMK B;  2I0T A;  2H47 A;  2AGZ A;  3I7L A;  3AL8 B;  2IAA A;  1XIP A;  5CYK B;  4GGA A;  3EI4 B;  3OKY A;  5EAM A;  3JB9 L;  1K32 A;  1L0Q A;  4QT8 A;  4JT5 C;  5HE1 B;  4TZ4 A;  3DWL C;  4X61 B;  4ZOZ A;  4FB1 D;  4D6V A;  5TEE A;  2TRC B;  3EU7 A;  3E0C A;  3OKW A;  3OL2 A;  4O3T B;  3SVW D;  2CO0 A;  4FA4 D;  5AMS A;  4FA5 D;  3K26 A;  3NVX A;  4X3E A;  1PBY B;  4GQ1 A;  1K8K C;  2OIZ A;  5K1C C;  1B9Y A;  2P9S C;  1GXR A;  2I3S A;  2OK6 A;  3IIY A;  4L3H D;  2AGL A;  4A09 B;  3OW8 A;  4CZX A;  2AH0 A;  2H9P A;  1N6D A;  3IKO A;  4A08 B;  2P9U C;  3PSC B;  2GC7 A;  1MG2 A;  4GGC A;  2W18 A;  4U1E I;  3RFH A;  4FA1 D;  5FKS A;  5FKR A;  4QQE A;  3SBR A;  4E54 A;  4LGN A;  3I7H A;  3BWS A;  3JPX A;  2HES X;  4OWR A;  2HKM A;  4E54 B;  4QL1 A;  5CXB A;  4CC9 A;  3GFC A;  3I7K A;  4AEZ A;  2P9L C;  4Y5R D;  4CY5 A;  2G99 A;  5HE2 B;  4J0W A;  2H68 A;  2B5M A;  4XYI A;  4CI8 A;  4GGD A;  3JAM g;  2YNO A;  4AOW A;  3SBQ A;  3EI1 A;  3JZN A;  4JSN C;  1ERJ A;  5GXH A;  3OKT A;  2PBI B;  4GM9 A;  2H13 A;  3IJC A;  3BG0 A;  4HDJ A;  3UR4 A;  4K3J B;  2H6K A;  4L1Q D;  4PSX B;  5B4W A;  3W15 A;  4A7J A;  2H14 A;  1FWX A;  4BH6 A;  4XEI C;  2AGX A;  4OZU A;  2YBA A;  3RN1 D;  2O9K A;  3VA6 A;  4JSV C;  5HE0 B;  5TEF A;  3UVL A;  3N0E A;  2H6N A;  3UVK A;  3JRO A;  3DXK C;  3SCY A;  4ZOX A;  3J81 g;  2B5N A;  4O3U B;  1S4U X;  2I3T A;  4A2M A;  2XU7 A;  3L4O D;  3UKU C;  3F3P A;  4PSW B;  2YNP A;  5EAR A;  4GMB A;  3MMY A;  5HE3 B;  3SN6 B;  1GG2 B;  3BG1 A;  1SHY B;  3IIW A;  5GSA A;  2PM6 B;  3L4M D;  2H9M A;  3I7O A;  4J78 A;  2HJB A;  4ZOY A;  4CI1 A;  2Z2N A;  2AQ5 A;  3UVO A;  5KDO B;  3AFC A;  3OKY B;  3RRM C;  3AH8 B;  4A0B A;  2GNQ A;  2IWK A;  2H9N A;  5GMK n;  2H9L A;  4L3G D;  4A11 A;  4GM3 A;  4ERY A;  3EI3 A;  3ULE C;  3HFQ A;  1MG3 A;  5C2V B;  1JMX B;  2Q7Q A;  3P4F A;  5JWZ A;  5AFU 3;  4X63 B;  3J80 g;  2AGY A;  2UZX B;  3OL2 B;  4IMM A;  3EI3 B;  4FAV D;  1XKS A;  1RI6 A;  2YNN A;  1U4C A;  4O1Q D;  2B4E A;  5I5M A;  4J86 A;  2HXC A;  4NSX A;  3FGB A;  5FQD A;  5IGQ A;  4K3I D;  2CN2 A;  2AH1 A;  3C9C A;  4X60 B;  4IA9 A;  4Z8L A;  3OTT A;  5IGO A;  3AL9 A;  2MTA H;  2QXV A;  2I0R A;  2IUP A;  3RSE C;  3MKS B;  5H14 A;  4A0A A;  4PXW A;  1TBG A;  3F3F A;  5IJ8 E;  4G56 B;  3EI2 A;  4LG8 A;  4A0A B;  3MZL A;  2BBK H;  2HJ4 A;  3IJ0 A;  5IJ7 E;  4EWR A;  5H17 A;  5CXB B;  4JSP C;  3PSL A;  4H5I A;  3DXM C;  3EI2 B;  2EBS A;  4J84 A;  4A2L A;  3B7F A;  1PGU A;  5EAP A;  4LG9 A;  2PM9 A;  3JZG A;  5FXY A;  2OK4 A;  4CI2 A;  5I5I A;  3CIK B;  4J0X A;  5C2W B;  3RFG A;  3EI1 B;  2IWF A;  2YB8 B;  5TF2 A;  1PEV A;  3RMZ D;  2AGW A;  3PVU B;  4N14 A;  4ESG A;  5EML B;  4I79 A;  5FKT A;  4GQB B;  4L9O A;  2CNX A;  1JJU B;  1OMW B;  3F3G A;  2P9N C;  4CI3 A;  3V7D B;  4BUJ C;  5THA A;  4ERQ A;  3UVN A;  4J8B A;  3NVQ A;  4O9D A;  4CZV A;  4PNK B;  5IC7 A;  2OVR B;  4J79 A;  4ZOV A;  1OLZ A;  2UZY B; 
#chains in the Genus database with same CATH topology
 2HKR A;  4ES0 A;  4J8G A;  2J56 H;  1B9X A;  4PC0 A;  2Z2O A;  3DDU A;  2YMU A;  3IUQ A;  2VC2 A;  3PXT D;  4E5Z A;  2CN3 A;  4J82 A;  5HYN B;  4JT6 C;  3IJ1 A;  3FM0 A;  4CY3 A;  3FCS A;  1GP2 B;  2G9A A;  4O2W A;  2XE4 A;  2QZP A;  1GOT B;  3SLE D;  1VZ3 A;  4PBY A;  3V4P A;  2HYE A;  1L5G A;  1Q47 A;  4Z7N A;  3UKR C;  2PM7 B;  3AL8 A;  3T3P A;  4FWW A;  4QRJ A;  4FAN D;  5CYK A;  4PBZ A;  4BCB A;  3EI4 A;  3MUN A;  5M5U A;  5EM2 A;  4KFM B;  4A0B B;  4J87 A;  3GRE A;  1MDA H;  3NID A;  2XDW A;  5A2Q g;  4A11 B;  1N6E A;  2CO0 C;  2P9K C;  5EM2 B;  3RN0 D;  2VDN A;  3C5M A;  3O4J A;  3C75 H;  1JOF A;  2P9P C;  4FHL A;  5FA5 B;  2OVQ B;  1PI6 A;  4GM8 A;  4WK2 A;  3V9F A;  3IUR A;  3A0F A;  2XYI A;  4ERZ A;  3CFS B;  3EWE A;  3C99 A;  3MZK A;  5TDH B;  3RLM D;  3JRP A;  4BCD A;  3ODT A;  2XL2 A;  5EMJ B;  3PXS D;  3VH0 A;  2VDR A;  4BL0 A;  4CY1 A;  3K6S A;  3EQ7 A;  3SXT D;  4A09 A;  4JD2 C;  4D0K A;  4DNU A;  2J55 H;  2J57 G;  1M1X A;  3I2N A;  3SHF A;  4A08 A;  4J77 A;  1TYE A;  5IT9 g;  3IUN A;  1TYQ C;  4YVD A;  4CY2 A;  1VYH C;  1VZ2 A;  2IUV A;  3KRX B;  2VDO A;  5CXC A;  4O45 A;  4J73 A;  5AJA A;  2XL3 A;  4MMX A;  3IVM A;  1UOO A;  3IUL A;  5CXC B;  2VDK A;  4BP9 A;  1N6F A;  5M5S A;  4QAM A;  1R5M A;  4R7A B;  4J81 A;  3I89 A;  1P22 A;  3N0D A;  1NR0 A;  1U2V C;  3ZWL B;  3I8C A;  3KRW B;  3CFV A;  2GC4 A;  5FLX g;  1JMZ B;  1UOQ A;  2CE9 A;  4IRZ A;  2OVP B;  1H2Y A;  3VGZ A;  3VI3 A;  1UTC A;  4CZY A;  3VI4 A;  5HQG A;  3SBP A;  5K19 A;  2PM9 B;  1BPO A;  1QNI A;  2BKL A;  3FRX A;  4AMY A;  3SJL D;  1JTD B;  3PXW D;  3NVN A;  3K27 A;  5FKQ A;  5FFG A;  4NBM A;  4Y7R A;  1YFQ A;  1E8M A;  3ORV D;  3JZH A;  3EMH A;  1SQJ A;  2HU7 A;  1E8N A;  1GOG A;  4GQ2 P;  3SMR A;  4U7A A;  4UM9 A;  3MXX A;  2OJY A;  3I7N A;  5SXM A;  5EMM B;  3MKQ A;  4FA9 D;  1SQ9 A;  5H1M A;  4JSX C;  4Z7Q A;  2IUQ A;  2H6Q A;  5GXI A;  4XYH A;  4H5J A;  3ZDZ A;  5M5V A;  2Z2P A;  3EG6 A;  2I0S A;  1XHM A;  5C9Z B;  4UI9 R;  2H3X A;  4WK4 A;  3SWS D;  4D9S A;  2VDM A;  5I5J A;  3SFZ A;  3I7P A;  5EAL A;  3PVW B;  3GD1 I;  1VE6 A;  1YR2 A;  3DSM A;  2BCJ B;  3UVM A;  1A0R B;  3U4Y A;  4ZN4 A;  1GOH A;  5E6R A;  3V5W B;  4E5Z B;  4JHP C;  2CE8 A;  2P9I C;  2IUR A;  4JXM A;  2QC5 A;  4GZ8 A;  4MK0 B;  2B5L A;  1O6G A;  1NEX B;  3I8E A;  3DM0 A;  3O4G A;  3PE7 A;  5EMK B;  2I0T A;  3O4H A;  4NC4 A;  2H47 A;  2AGZ A;  2VDQ A;  3I7L A;  3AL8 B;  2IAA A;  1XIP A;  5CYK B;  1O6F A;  3EI4 B;  3OKY A;  4GGA A;  5EAM A;  3JB9 L;  1K32 A;  1L0Q A;  4QT8 A;  4JT5 C;  5HE1 B;  3ZDX A;  4TZ4 A;  5C86 A;  3DWL C;  4X61 B;  3IUM A;  4ZOZ A;  4FB1 D;  4D6V A;  5TEE A;  5FFO A;  4AN0 A;  2TRC B;  3EU7 A;  3E0C A;  3OKW A;  3OL2 A;  4O3T B;  3SVW D;  2CO0 A;  3QI0 A;  4FA4 D;  1C9L A;  5AMS A;  4FA5 D;  3K26 A;  3NVX A;  4X3E A;  1PBY B;  4GQ1 A;  1K8K C;  2OIZ A;  5K1C C;  1B9Y A;  2P9S C;  1GXR A;  2I3S A;  1QFS A;  2OK6 A;  3IIY A;  4NAA A;  4L3H D;  2AGL A;  1JV2 A;  4A09 B;  3OW8 A;  4CZX A;  2AH0 A;  2H9P A;  1N6D A;  3IKO A;  4MMY A;  4A08 B;  2P9U C;  3PSC B;  2GC7 A;  1MG2 A;  4GGC A;  2W18 A;  4U1E I;  3RFH A;  4FA1 D;  5FKS A;  5FKR A;  3T3M A;  4QQE A;  3SBR A;  4E54 A;  1QFM A;  4LGN A;  3I7H A;  3BWS A;  4UM8 A;  3JPX A;  2HES X;  4OWR A;  2HKM A;  4E54 B;  4QL1 A;  5CXB A;  4CC9 A;  3GFC A;  3I7K A;  2XZG A;  4AEZ A;  2P9L C;  4Y5R D;  4CY5 A;  2G99 A;  3ZE2 A;  5HE2 B;  3MVD K;  4J0W A;  2H68 A;  2B5M A;  4XYI A;  4CI8 A;  4GGD A;  5E6U A;  3JAM g;  2VDP A;  2YNO A;  4AOW A;  3SBQ A;  3EI1 A;  3JZN A;  3FCU A;  4JSN C;  1ERJ A;  5GXH A;  3OKT A;  2PBI B;  1VE7 A;  1A12 A;  4JHN A;  4GM9 A;  2HU5 A;  2H13 A;  3IJC A;  3BG0 A;  3V4V A;  4HDJ A;  5HDB A;  3ZE0 A;  3UR4 A;  4K3J B;  2H6K A;  4L1Q D;  4PSX B;  5B4W A;  3W15 A;  4A7J A;  4G1E A;  4AX4 A;  2H14 A;  1FWX A;  4BH6 A;  5M5R A;  4XEI C;  2AGX A;  4OZU A;  2YBA A;  3RN1 D;  2O9K A;  3EQ9 A;  4JSV C;  3VA6 A;  5HE0 B;  4BP8 A;  5TEF A;  3UVL A;  3N0E A;  2H6N A;  3UVK A;  3JRO A;  3DXK C;  3SCY A;  4ZOX A;  3J81 g;  2B5N A;  4O3U B;  5M5T A;  4RE6 A;  1S4U X;  2I3T A;  4A2M A;  3K72 A;  2XU7 A;  3ZE1 A;  3L4O D;  3UKU C;  4AMZ A;  3F3P A;  1I2M B;  4PSW B;  2YNP A;  1H2X A;  4G55 A;  5EAR A;  5M61 A;  4L1M A;  4GMB A;  3MMY A;  5HE3 B;  3SN6 B;  1GG2 B;  3BG1 A;  1SHY B;  3IIW A;  5GSA A;  2PM6 B;  4RE5 A;  3L4M D;  2H9M A;  3I7O A;  4J78 A;  3ZDY A;  2HJB A;  4ZOY A;  4CI1 A;  4AN1 A;  2Z2N A;  2AQ5 A;  3UVO A;  5KDO B;  3AFC A;  3OKY B;  3RRM C;  3AH8 B;  4A0B A;  2GNQ A;  2IWK A;  2H9N A;  1K3I A;  5GMK n;  2H9L A;  4L3G D;  4A11 A;  4GM3 A;  4ERY A;  3NIG A;  5C92 A;  3EI3 A;  3ULE C;  3HFQ A;  1MG3 A;  5C2V B;  1JMX B;  2Q7Q A;  3P4F A;  5JWZ A;  5AFU 3;  4X63 B;  3O4I A;  3J80 g;  4G1M A;  3MUO A;  2AGY A;  2UZX B;  3OL2 B;  4IMM A;  3EI3 B;  4FAV D;  5E6S A;  1XKS A;  1RI6 A;  2YNN A;  2EIE A;  3IUJ A;  1U4C A;  4O1Q D;  2B4E A;  5I5M A;  2VDL A;  4J86 A;  4DNW A;  2HXC A;  1U8C A;  4NSX A;  3OF7 A;  3FGB A;  5FQD A;  2EIB A;  5IGQ A;  4K3I D;  2AH1 A;  2CN2 A;  3C9C A;  4X60 B;  2VZ3 A;  4IA9 A;  2EID A;  3OTT A;  4Z8L A;  3AL9 A;  5IGO A;  2MTA H;  2QXV A;  2I0R A;  2IUP A;  3RSE C;  3MKS B;  5H14 A;  3KCI A;  4A0A A;  2JKX A;  4PXW A;  1TBG A;  3F3F A;  5IJ8 E;  4O02 A;  4G56 B;  3EI2 A;  4LG8 A;  4A0A B;  3MZL A;  2BBK H;  2HJ4 A;  3IJ0 A;  5IJ7 E;  4EWR A;  5H17 A;  5CXB B;  1H2W A;  4JSP C;  3GC3 B;  3PSL A;  3K71 A;  4H5I A;  3DXM C;  3EI2 B;  2EBS A;  4J84 A;  4A2L A;  3B7F A;  1PGU A;  5EAP A;  2VZ1 A;  4LG9 A;  2PM9 A;  3JZG A;  2HU8 A;  2OK4 A;  5FXY A;  4WK0 A;  4CI2 A;  2WQ8 A;  3EQ8 A;  4Z7O A;  5I5I A;  3CIK B;  3NIF A;  4J0X A;  1E5T A;  5C2W B;  3RFG A;  3EI1 B;  2IWF A;  2YB8 B;  5TF2 A;  1T2X A;  2QR5 A;  1PEV A;  1UOP A;  3RMZ D;  1GOF A;  4WJK A;  2AGW A;  3PVU B;  4N14 A;  4ESG A;  5EML B;  4I79 A;  4DNV A;  5FKT A;  4GQB B;  4L9O A;  2CNX A;  1H2Z A;  1JJU B;  1OMW B;  2EIC A;  2P9N C;  3F3G A;  4CI3 A;  1C9I A;  3V7D B;  4BUJ C;  5THA A;  4ERQ A;  4NEN A;  3UVN A;  4J8B A;  3NVQ A;  4O9D A;  4CZV A;  4PNK B;  3QHY B;  4MMZ A;  5IC7 A;  2OVR B;  4J79 A;  4BCC A;  3IJE A;  4ZOV A;  1OLZ A;  2UZY B; 
#chains in the Genus database with same CATH homology
 2HKR A;  4ES0 A;  4J8G A;  2J56 H;  1B9X A;  4PC0 A;  2Z2O A;  2YMU A;  3PXT D;  4E5Z A;  2CN3 A;  4J82 A;  5HYN B;  4JT6 C;  3IJ1 A;  3FM0 A;  4CY3 A;  1GP2 B;  2G9A A;  1GOT B;  3SLE D;  4PBY A;  2HYE A;  1Q47 A;  3UKR C;  2PM7 B;  3AL8 A;  4FWW A;  4QRJ A;  4FAN D;  5CYK A;  4PBZ A;  3EI4 A;  5EM2 A;  4KFM B;  4A0B B;  4J87 A;  3GRE A;  1MDA H;  5A2Q g;  4A11 B;  1N6E A;  2CO0 C;  2P9K C;  5EM2 B;  3RN0 D;  3C5M A;  3C75 H;  1JOF A;  2P9P C;  4FHL A;  5FA5 B;  2OVQ B;  1PI6 A;  4GM8 A;  3V9F A;  3A0F A;  2XYI A;  4ERZ A;  3CFS B;  3EWE A;  3C99 A;  3MZK A;  5TDH B;  3RLM D;  3JRP A;  3ODT A;  2XL2 A;  5EMJ B;  3PXS D;  3VH0 A;  4BL0 A;  4CY1 A;  3SXT D;  4A09 A;  4JD2 C;  4D0K A;  2J55 H;  2J57 G;  3I2N A;  3SHF A;  4A08 A;  4J77 A;  5IT9 g;  1TYQ C;  4YVD A;  4CY2 A;  1VYH C;  2IUV A;  3KRX B;  5CXC A;  4O45 A;  4J73 A;  5AJA A;  2XL3 A;  5CXC B;  1N6F A;  1R5M A;  4R7A B;  4J81 A;  3I89 A;  1P22 A;  3N0D A;  1NR0 A;  1U2V C;  3ZWL B;  3I8C A;  3KRW B;  3CFV A;  2GC4 A;  5FLX g;  1JMZ B;  2CE9 A;  2OVP B;  3VGZ A;  4CZY A;  5HQG A;  3SBP A;  5K19 A;  2PM9 B;  1QNI A;  3FRX A;  3SJL D;  3PXW D;  3NVN A;  3K27 A;  5FKQ A;  4Y7R A;  1YFQ A;  3ORV D;  3JZH A;  3EMH A;  1SQJ A;  4GQ2 P;  3SMR A;  4U7A A;  3MXX A;  2OJY A;  3I7N A;  5SXM A;  5EMM B;  3MKQ A;  4FA9 D;  1SQ9 A;  5H1M A;  4JSX C;  2IUQ A;  2H6Q A;  5GXI A;  4XYH A;  4H5J A;  2Z2P A;  3EG6 A;  2I0S A;  1XHM A;  5C9Z B;  4UI9 R;  2H3X A;  3SWS D;  5I5J A;  3SFZ A;  3I7P A;  5EAL A;  3PVW B;  3DSM A;  2BCJ B;  3UVM A;  1A0R B;  3U4Y A;  4ZN4 A;  3V5W B;  4E5Z B;  2CE8 A;  2P9I C;  2IUR A;  4JXM A;  2QC5 A;  4GZ8 A;  4MK0 B;  2B5L A;  1NEX B;  3I8E A;  3DM0 A;  3PE7 A;  5EMK B;  2I0T A;  2H47 A;  2AGZ A;  3I7L A;  3AL8 B;  2IAA A;  1XIP A;  5CYK B;  4GGA A;  3EI4 B;  3OKY A;  5EAM A;  3JB9 L;  1K32 A;  1L0Q A;  4QT8 A;  4JT5 C;  5HE1 B;  4TZ4 A;  3DWL C;  4X61 B;  4ZOZ A;  4FB1 D;  4D6V A;  5TEE A;  2TRC B;  3EU7 A;  3E0C A;  3OKW A;  3OL2 A;  4O3T B;  3SVW D;  2CO0 A;  4FA4 D;  5AMS A;  4FA5 D;  3K26 A;  3NVX A;  4X3E A;  1PBY B;  4GQ1 A;  1K8K C;  2OIZ A;  5K1C C;  1B9Y A;  2P9S C;  1GXR A;  2I3S A;  2OK6 A;  3IIY A;  4L3H D;  2AGL A;  4A09 B;  3OW8 A;  4CZX A;  2AH0 A;  2H9P A;  1N6D A;  3IKO A;  4A08 B;  2P9U C;  3PSC B;  2GC7 A;  1MG2 A;  4GGC A;  2W18 A;  4U1E I;  3RFH A;  4FA1 D;  5FKS A;  5FKR A;  4QQE A;  3SBR A;  4E54 A;  4LGN A;  3I7H A;  3BWS A;  3JPX A;  2HES X;  4OWR A;  2HKM A;  4E54 B;  4QL1 A;  5CXB A;  4CC9 A;  3GFC A;  3I7K A;  4AEZ A;  2P9L C;  4Y5R D;  4CY5 A;  2G99 A;  5HE2 B;  4J0W A;  2H68 A;  2B5M A;  4XYI A;  4CI8 A;  4GGD A;  3JAM g;  2YNO A;  4AOW A;  3SBQ A;  3EI1 A;  3JZN A;  4JSN C;  1ERJ A;  5GXH A;  3OKT A;  2PBI B;  4GM9 A;  2H13 A;  3IJC A;  3BG0 A;  4HDJ A;  3UR4 A;  4K3J B;  2H6K A;  4L1Q D;  4PSX B;  5B4W A;  3W15 A;  4A7J A;  2H14 A;  1FWX A;  4BH6 A;  4XEI C;  2AGX A;  4OZU A;  2YBA A;  3RN1 D;  2O9K A;  3VA6 A;  4JSV C;  5HE0 B;  5TEF A;  3UVL A;  3N0E A;  2H6N A;  3UVK A;  3JRO A;  3DXK C;  3SCY A;  4ZOX A;  3J81 g;  2B5N A;  4O3U B;  1S4U X;  2I3T A;  4A2M A;  2XU7 A;  3L4O D;  3UKU C;  3F3P A;  4PSW B;  2YNP A;  5EAR A;  4GMB A;  3MMY A;  5HE3 B;  3SN6 B;  1GG2 B;  3BG1 A;  1SHY B;  3IIW A;  5GSA A;  2PM6 B;  3L4M D;  2H9M A;  3I7O A;  4J78 A;  2HJB A;  4ZOY A;  4CI1 A;  2Z2N A;  2AQ5 A;  3UVO A;  5KDO B;  3AFC A;  3OKY B;  3RRM C;  3AH8 B;  4A0B A;  2GNQ A;  2IWK A;  2H9N A;  5GMK n;  2H9L A;  4L3G D;  4A11 A;  4GM3 A;  4ERY A;  3EI3 A;  3ULE C;  3HFQ A;  1MG3 A;  5C2V B;  1JMX B;  2Q7Q A;  3P4F A;  5JWZ A;  5AFU 3;  4X63 B;  3J80 g;  2AGY A;  2UZX B;  3OL2 B;  4IMM A;  3EI3 B;  4FAV D;  1XKS A;  1RI6 A;  2YNN A;  1U4C A;  4O1Q D;  2B4E A;  5I5M A;  4J86 A;  2HXC A;  4NSX A;  3FGB A;  5FQD A;  5IGQ A;  4K3I D;  2CN2 A;  2AH1 A;  3C9C A;  4X60 B;  4IA9 A;  4Z8L A;  3OTT A;  5IGO A;  3AL9 A;  2MTA H;  2QXV A;  2I0R A;  2IUP A;  3RSE C;  3MKS B;  5H14 A;  4A0A A;  4PXW A;  1TBG A;  3F3F A;  5IJ8 E;  4G56 B;  3EI2 A;  4LG8 A;  4A0A B;  3MZL A;  2BBK H;  2HJ4 A;  3IJ0 A;  5IJ7 E;  4EWR A;  5H17 A;  5CXB B;  4JSP C;  3PSL A;  4H5I A;  3DXM C;  3EI2 B;  2EBS A;  4J84 A;  4A2L A;  3B7F A;  1PGU A;  5EAP A;  4LG9 A;  2PM9 A;  3JZG A;  5FXY A;  2OK4 A;  4CI2 A;  5I5I A;  3CIK B;  4J0X A;  5C2W B;  3RFG A;  3EI1 B;  2IWF A;  2YB8 B;  5TF2 A;  1PEV A;  3RMZ D;  2AGW A;  3PVU B;  4N14 A;  4ESG A;  5EML B;  4I79 A;  5FKT A;  4GQB B;  4L9O A;  2CNX A;  1JJU B;  1OMW B;  3F3G A;  2P9N C;  4CI3 A;  3V7D B;  4BUJ C;  5THA A;  4ERQ A;  3UVN A;  4J8B A;  3NVQ A;  4O9D A;  4CZV A;  4PNK B;  5IC7 A;  2OVR B;  4J79 A;  4ZOV A;  1OLZ A;  2UZY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...