5I5IA

Shewanella denitrificans nitrous oxide reductase, app form
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
571
structure length
539
Chain Sequence
VHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHMEMRGRMLVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
total genus 170
structure length 539
sequence length 571
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5iA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5iA01
4O3TB 1R5MA 2AQ5A 3C99A 3F3FA 4I79A 4Z8LA 1JZHA 2I85A 3A0FA 3OKTA 2PPDA 4CZVA 3RFHA 2W88A 1IBZA 3X1FA 2H5UA 3AL8A 4AOWA 4A08A 5AMSA 1AG6A 5I6OA 3PXTD 3AG3B 4YVUA 3DM0A 5B4WA 3AG2B 1L9SA 4CI8A 2MRYA 1GY1A 1AAJA 2PBIB 2LLNA 5CXCA 2PP8A 5I28A 2PM9A 4JSNC 4MFHA 2I0RA 3UAAA 4CZXA 3DXKC 4PSWB 2P9NC 3UR4A 2AGZA 2BWIA 2PP7A 4NB7A 1ASQA 1FFTB 3NJMA 1XHMA 4J79A 4CSZA 4XYHA 1ZPUA 1S4UX 1E30A 2CUAA 3BQVA 3U25A 1L9PA 1JZJA 3KW8A 5AFAA 4DP7X 1GOTB 1ASOA 1NINA 3BG0A 5HE2B 2PPEA 2XXFA 1J5DA 4GYBA 2AH1A 2AZUA 4F7KA 3PAVA 1OF0A 3T6ZA 2YAOA 2FJSA 3T6XA 3G5WA 1JZGA 1WAEA 1E5ZA 3UABA 3WKQA 3RMZD 5HE3B 1GSKA 1PZCA 2BBKH 2CE9A 2Z2NA 5FQDA 3K26A 2QT6A 5CXBA 1N68A 2AVFA 4E9WA 3EI4B 5GMKn 1GS6X 2I7SA 3EMHA 3V9EA 1E5YA 2HX8A 3N0DA 1AS7A 2H3XC 2XYIA 4D0KA 1KDIA 2HYEA 3JB9L 3JTBA 1J9QA 4KOCA 3OMIB 4GMBA 4G72B 3ORVD 3I7PA 2ZOOA 5IC7A 4NERA 3NJNA 2DV6A 5B7MA 3X1GA 1L9QA 4JKNA 4KO9A 2Y1AA 5I26A 2BP0A 5FA5B 3CVDA 4P5RA 2YBAA 1W6LA 1NPNA 4J84A 3HFQA 1NTDA 3CFVA 2IURA 2CO0A 2B5MA 1ILUA 4GQBB 3WI9A 2HESX 3H4FA 1KGYE 2HXCA 2PLTA 4ZOXA 5HE1B 1KYAA 1QHQA 1V54B 2B4EA 3PE7A 4FHLA 4ERYA 3PLYA 2FQEA 2ZWNA 3WG7B 1A0RB 3C5MA 5EARA 3CG8A 3SWSD 5PCYA 5A2Qg 1NWPA 3UVLA 3F3GA 2Q5BA 2YARA 5EMMB 2TSBA 3MKSB 3FQ2A 3PCYA 9PCYA 3MMYA 5TEFA 2WO2B 3HEIB 4G7QB 3I89A 5IJ8E 4E5ZB 3PXWD 1TEFA 1NR0A 3ABMB 5EALA 3FT0A 3PXSD 1A8ZA 3DWLC 1EHKB 4ES0A 3QJVB 2H9NA 2GSMB 4JXMA 2GI0A 1OE3A 2QPDB 3EI2A 5B1JA 2YAMA 3TA4D 1NWOA 3JZGA 4YSDA 6PAZA 1WA0X 2AZAA 2Y69B 1JXFA 1N6EA 2OVPB 3I8CA 5C2WB 1A3ZA 2H68A 2OJYA 4EWRA 4A2LA 3IBOA 3NT0A 5H1MA 2H6KA 4GQ2P 4E5ZA 4FA1D 1PZBA 2AGYA 4N14A 2XYBA 4Y5RD 3OKYB 1SNRA 3FS9A 4GM8A 2X87A 2AGLA 3EF4A 4UANA 2EIMB 1W8EA 3X1NA 4NAJA 4O1QD 5B3SB 1JMZB 1U2VC 2PM7B 1U4CA 1JZFA 4E54B 1QLEB 2CNXA 4YSAA 2O9KA 2X88A 2XLLA 5TF2A 2R7EA 4G71B 4E9TA 1OCCB 2EIJB 1JXGA 2BP8A 3QJUB 3E0CA 3EI3A 2CJ3A 4CSPA 3RN0D 8PAZA 2IUQA 3OL2B 4PC0A 2HJBA 1L0QA 5I6NA 3GFCA 4N4YB 2P9KC 2AH0A 1GG2B 3AL9A 2YAHA 1SDDB 2FQFA 3IN0A 2H6QA 3FPYA 3SBRA 5I6LA 4KOBA 2H9LA 2PM6B 4JHVA 1AOZA 3FM0A 3EI1B 5CYKB 1J9SA 3RFGA 2XX1A 1TKWA 5I5IA 5GXIA 1WA2X 2VM4A 3NJIA 1J9TA 3WKPA 3V9FA 4DP5X 1RZQA 4FWWA 5EMKB 1BXUA 1PLAA 2AGXA 4K3JB 3I2NA 2DYSB 4A09B 2YXVA 4YSCA 4G56B 4J8GA 5LDUA 4A11A 2P80D 2OK4A 3S3DB 1MDAA 2CE8A 4YSPA 2CALA 2IWFA 4TZ4A 3N55A 1F56A 2HXAA 3SFZA 3DSMA 7PCYA 2I0SA 3KW7A 4GQ1A 3JPXA 3UADA 1BAWA 1IC0A 1ET8A 1AR1B 1KCBA 3IKOA 4HHGA 1SFDA 2IH9A 2BZCA 3AL8B 3C75H 4ERQA 4J82A 3RSEC 4A08B 1RCYA 3FQ1A 4A2DA 4YSTA 1B9XA 2OIZA 4LGNA 1ILSA 3WNJA 2J57G 2A3TA 4GM3A 3ULEC 1GYCA 1SF5A 1J5CA 2GC4A 4O45A 3V5WB 5EM2A 4L1QD 1A4AA 3AW5A 3KRWB 5CXCB 2IUPA 4WTQA 4HHWA 2E86A 1L9RA 1JERA 3SBPA 1AIZA 3EH5B 5FC9A 3ZX1A 2OVRB 1PEVA 2CO0C 2PM9B 4L9OA 1IUZA 1ADWA 5FKRA 2CAKA 4GY4A 2J55H 1PGUA 4AI7A 5HE0B 3MXXA 5B1BB 4E9YA 5FKTA 1ZIAA 4KO6A 3EH4B 1J9RA 2IDFA 2ZXWB 2FTAA 4M3HA 2JKWA 4AKOA 4BDVA 3QPKA 1XB3A 1BEXA 3NSYA 2I3SA 3N2JA 4H5JA 3ABLB 3L4MD 3CIKB 3I7NA 3FU7A 4EF3A 4K9JA 1A65A 2HRHA 3MBWB 5I6MA 3UKRC 3QJSB 4FAVD 1XKSA 2J56H 3TASA 3OQRA 2MTAH 2FT8A 1IBYA 2IWEA 3DTUB 3QJTB 5IY5B 5CXBB 4QL1A 1GS8A 2YQBA 4QRJA 4R7AB 5B1JC 3IE9A 4ZOZA 3IN2A 2JXMA 2H14A 4Y7RA 1MZYA 4DP4X 3NYKA 4PCYA 1FWXA 2YNOA 3RRMC 4DP2X 2GC7A 3JZHA 2OJ1A 4QQEA 4CY1A 5TEEA 4A2GA 2N0MA 2H9MA 2JFCA 7PAZA 3FQYA 4FAAB 1L9OA 4A2HA 2BP0B 3IJCA 4HZ1A 1ZDSA 1BXAA 1BQ5A 1CUOA 2IWKA 1AG0A 2UXGA 4QLWA 2H6NA 2EILB 2IDUA 2HKMA 3PVUB 5E9NA 3B7FA 2ZONA 5I5MA 4O9DA 5EMLB 3C9CA 4BL0A 4A0AA 5B1AB 3RYMA 3CZUB 3CVBA 2H9PA 1PY0A 3NSCA 4DPBX 2I0TA 2VSMB 4F2EA 3SCYA 1JVOA 4ERZA 5H17A 2QDVA 1MG3A 5PAZA 4X3EA 3FSZA 3SMRA 4YSOA 1PAZA 1JOFA 2B5NA 2B3IA 4J0WA 4E9RA 3V7DB 1SHWA 1DZ0A 4DPAX 1JOIA 1ETJA 2XXGA 2CN3A 3L4OD 2P9SC 5FXYA 3EI2B 4AKQA 4PSXB 2XWZA 1R1CA 3T6VA 1A4BA 2AGWA 3QJQB 4GGAA 4GZ8A 2YAEA 4Q8BA 4YVNA 3UGEA 4BK5C 1AZBA 3H4HA 3NJGA 5D4IA 3FRXA 5AJAA 2P80A 2YAPA 3UVMA 5IJ7E 3VA6A 2OV0A 1NICA 3SQRA 3CFSB 4RH4A 3EG6A 3NJJA 3JT2A 3NVXA 5SXMA 4D6VA 1CURA 2XV0A 2XL2A 1AZNA 1OLZA 2HKRA 1KBVA 2PPCA 4LG9A 2FT6A 2UZYB 1OE2A 5F7AA 3BG1A 1E65A 3NP4A 1PLBA 4YVDA 3U4YA 4HDJA 5K19A 3V9CA 4A67A 1RZPA 2NRDA 4KFMB 4FA5D 5AKRA 2WSDA 1NIBA 3IEAA 2R7EB 3ABGA 4HCGA 4DP9X 1NIEA 1M56B 2DWTA 2GC4C 3S3CB 3IIWA 1PCSA 2BP8B 1VYHC 3TU6A 3EI3B 2UXFA 4PAZA 1PMYA 4IA9A 3OMAB 2EIKB 4G7SB 4YSQA 3ZDWA 4M4RB 4YSRA 3S8GB 4A2MA 5HYNB 1SJMA 4OZUA 2GHZA 4J8BA 4G70B 5JWZA 2OCCB 1PNDA 3NJLA 2DY2A 4G7RB 2HJ4A 4DP1X 4PBZA 1NIDA 3SXTD 1VLXA 1JXDA 3IJ0A 4DPCX 4CI2A 4FA9D 5IT9g 2WO3B 4P5SA 1TU2A 5EHFA 3BWSA 5I6KA 3KRXB 1V10A 4HIPA 1SHYB 1M57B 4JD2C 4ENZA 1NIAA 3ZIYA 4A11B 2BHFA 2XX0A 2DWSA 4GM9A 3GXUB 4J77A 1N6DA 4CZYA 2Q9OA 3N0EA 3P4FA 2BW5A 3VGZA 4GP8B 1JZEA 2QPEB 4GP5B 3QJRB 2Z2OA 3I7OA 3MX0B 5AFU3 1E67A 4J78A 4F2FA 4PNKB 5D4JA 2OK6A 2HRGA 3I7LA 2FNWA 5KDOB 4KNTA 5FLXg 2QXVA 3JRPA 2GC7C 3X2QB 4J73A 4YL4A 1NDTA 3H56A 4BXVA 1JJUB 4PXWA 3OMNB 1OCZB 3HB3B 4J0XA 5EM2B 2EINB 4L3GD 1ERJA 4YSUA 3NSFA 1FA4A 2Z2PA 4FA7B 1T5KA 1BQRA 2IAAC 3FPXA 2RACA 1PI6A 1CYXA 1HAUA 2EBSA 4HAKA 3ABKB 4L3HD 2XU9A 4J86A 3EH3B 3ASNB 1M9WA 1N70A 3OM3B 2CBPA 3WNIA 4JT6C 4LG8A 4A0BA 1UATA 5GSAA 4K3ID 4BDVB 2AANA 3UAEA 3F3PA 3PVWB 3D12B 1MG3C 3FU8A 1KBWA 4X63B 3MKQA 3FU7B 3UVOA 5C9ZB 4A66A 3DXMC 4CC9A 1TYQC 1NZRA 3GDCA 2TSAA 3S8FB 4KNSA 2YNPA 3UVNA 1NPJA 2CCWA 1MG2C 1XB6A 1Q47A 4FB1D 2UX6A 3MZKA 1A4CA 1TEGA 1YLBB 2J56A 2XVBA 4AKPA 1OMWB 4GGCA 2MTAA 2PPAA 1OCOB 4QKTA 2YMUA 3AZUA 4W1TA 2PCYA 2VM3A 1WS8A 3SN6B 3TBBA 3AG1B 4UAHA 2BW4A 4AZUA 1I53A 2J5WA 3JROA 3CVCA 5ANHA 3FYIB 4A2FA 1AS6A 2J57A 3K27A 3PSLA 2DYRB 4Q89A 3X1BA 2P9UC 3JZNA 3OTTA 1ZDQA 1BXVA 1HFUA 1XB8A 2VMJA 3FU9A 2YXWA 2B5LA 3OKWA 2QDWA 5EAPA 3SHFA 4JSPC 2HZHA 2YAFA 3BVDB 2QC5A 1KV7A 2IAAA 1CC3A 4A0AB 1PNCA 4HCIA 4L0PB 2BWDA 2VW7A 4HALA 1ZIBA 1L9TA 1GXRA 3NVNA 3RLMD 4JHUA 3NP3A 4H5IA 1IKOP 2UX7A 2YNNA 5EAMA 3VH0A 1BQKA 2B08A 3L45A 3T6WA 1AACA 1AANA 1KCWA 2TRCB 3I7KA 1BYOA 2PCFA 2BO0A 3FGBA 4TXVB 1GR7A 3NVQA 4FA4D 1PZAA 2GNQA 4O3UB 5EMJB 2G9AA 3SBQA 2W18A 2XU7A 3EI4A 1AZCA 5THAA 2FT7A 1EZLA 2XV3A 3DKHA 2XUWA 4BWWA 3FSAA 1OOWA 1CYWA 1SHXA 4GGDA 1OV8A 1P22A 1NEXB 1SQ9A 4ZN4A 5D4HA 4FAND 3J81g 1B3IA 1MG2A 1RI6A 2VSKB 3EWEA 3CDZB 4CY2A 5H14A 4BH6A 2GBAA 3AY2A 3GYRA 1AQ8A 2UXTA 1AZUA 1JVLA 4U7AA 4GXFA 2P9IC 5TDHB 3CDZA 3OD3A 5TK4A 3TBCA 1ASPA 4KNUA 2H47C 4A2EA 2G99A 3OW8A 3DIVA 1N6FA 2BZ7A 4DP8X 2PP9A 1URIA 1ZV2A 3AG4B 4BWUA 3J80g 1PLCA 4JSVC 1WS7A 6PCYA 5IGQA 4J87A 1OCRB 4BUJC 3SVWD 2IUVA 3NJFA 4CY5A 3T71A 5GXHA 1XIPA 5IGOA 1HAWA 5B7FA 3MZLA 3PSCB 4OWRA 4ZK8A 1QNIA 1GW0A 1SQJA 3UACA 4IMMA 4CY3A 2P9PC 3SLED 4GP4B 4X4KA 3X1EA 4XEIC 1ID2A 5K1CC 3FYEB 4E9VA 4ZOYA 4X60B 3EHBB 4E9XA 3IJ1A 5C2VB 3FSWA 2GB2A 4AX3A 3JAMg 4BWTA 2Q7QA 3PPSA 4E9QA 4UI9R 3ASOB 5AZUA 2YAQA 5FKQA 2HX7A 3NJKA 1W6WA 2H3XA 1TBGA 1GS7A 1KDJA 2IH8A 4MK0B 1K32A 4WKXA 2VW4A 3I7HA 4U1EI 4PBYA 2AFNA 3WIAA 3ERXA 3AH8B 2IDTA 1BYPA 4N8UA 1PBYB 3OKYA 2FQDA 4A68A 5FKSA 4CI1A 1ET7A 1K8KC 1PF3A 1ET5A 4KO7A 4JSXC 4JT5C 4A7JA 1V55B 1B9YA 3PAZA 4CI3A 2CN2A 3RN1D 4E54A 1JZIA 3PAUA 2HLEB 1X9RA 2I3TA 2BCJB 2GIMA 4J81A 2H47A 1X9UA 3S3BB 1AS8A 3FSVA 3ZWLB 2IDQA 4AEZA 2FWLB 3OL2A 1NIFA 3QQXA 5B7EA 1YFQA 3GREA 3UKUC 3PXLA 1AZRA 3EU7A 4YSEA 2OVQB 3UVKA 4KO5A 1SDDA 1GP2B 4ESGA 4BXSV 2FQGA 5F7BA 1WA1X 4XYIA 1DYZA 3C75A 5TK2A 1SF3A 4ZOVA 1OE1A 3EI1A 5CYKA 2VN3A 2W8CA 5I5JA 2UZXB 3I8EA 1MZZA 4A0BB 1JMXB 3W15A 2I7OA 2PPFA 2VW6A 2H13A 4W9ZA 1SFHA 2YB8B 4UF7C 2P9LC 4QT8A 1MDAH 2XL3A 3ZBMA 4HCFA 4NSXA 1GY2A 5HQGA 1RKRA 5B1KA 4E9SA 3AFCA 3T9WA 1XMEB 4X61B 4A09A 3IIYA 4DP0X 4DP6X 2UXVA 2XV2A 2IDSA 3ODTA 5I6PA 3NJHA 3SJLD 2J55A 3NSDA 2HX9A 4YSSA 5A7EA
chains in the Genus database with same CATH superfamily
3QP3A 2PO6C 4O3TB 3MXWL 5C8JB 3A0FA 4MMZC 4PJAF 4IIZA 4AE0A 2ZE0A 3NN8B 1IBZA 2PKDA 4JL1A 2J88H 1AG6A 2FJUB 5HJ3B 5E6ID 1BPLB 1IGMH 4XPHH 2V7NA 1J8HD 2AQSA 2MRYA 1GY1A 1DBJL 4NX0A 4OLXH 5AL0A 5H35B 1TQBC 5EU6D 1BECA 4OJEH 5H35A 2NTFB 4F58L 4M7JH 4PRPB 3W39B 2AJYL 2MNUA 4XAKD 5I17B 1ASQA 3NJMA 2FGWL 1ZPUA 3NACH 4OFIA 3W39A 4DESA 3V55A 1GZQA 3M1BA 5IVZB 1O7SA 3WNOA 2DQJL 2K7QA 1YAZA 3ECBB 4W9JC 4DQAA 4JFZH 2XXFA 4QOKA 3S36H 3V0FA 3ZE0E 3ESUF 3SDYH 4PJIA 1NL0L 3HKFA 3HUJB 3X12B 4PS3A 4V1DE 2HVJA 1J5IA 4CC4A 2V5TA 5BVJB 2VXSL 3KYOA 2BBKH 2Z2NA 2CDFB 2H0PA 1N8ZA 4RX4A 3R8QA 4EZKA 3HUJA 3UBXA 1PX8A 4GQ9H 4HEME 4RRPA 1BPVA 1WAAE 3VI4A 2XYIA 1DVFB 1VEMA 2ZOOA 3LNIA 4M5TA 4QRPD 3V6OC 2VXQH 3F04A 3X1GA 4R7VA 3JSSA 5EU5B 3SDCC 1OPGL 1RJYA 5CKAA 1O7DE 4UTAL 3RFZA 1BCIA 3QJFA 1E6JH 3SPVB 1AH1A 5IKCA 2FO4B 4MMXB 2FUTA 3EO9H 4JY4A 4CL7A 4WNQA 2GT9B 4MXQC 2F53B 4RRPM 4F8OA 5EARA 1QSFB 3OV6A 1U3HD 3TV8A 3C60C 3BKML 3AU1B 3GSOB 4N0UE 5KSAB 2FJGB 4UU9A 5E2VL 1SOSA 1TEFA 4LLDB 4ZUSB 5L4MA 1BVZA 1CGXA 5HYQB 2F1BA 1RL1A 3P2DA 2VOTA 5MHSE 1YEIL 2QPDB 3GDBA 5B1JA 3LRLA 4GEIA 3G6DL 1SJEB 3QXUA 4O58L 2Y69B 5LBVA 5CFHA 4EWRA 1IB5A 5JTWA 3OJ2C 1IM9D 2ZSVA 4FFVD 1ZEAL 1NGWB 3O3BA 1G7PA 4A7UA 4BRJA 1B3JA 1VRSA 3K5SA 1AR1C 5AOJA 3EF4A 1VZ3A 4ZPTA 5E4IA 1JDDA 1VERA 2PM7B 5IEKB 4KHTH 1RJLB 1CD1B 3B3IB 4XC1H 1DJHA 3AXLA 2CNXA 2Q6WA 4PVNA 1WFIA 3O81A 3D52A 2VZ1A 5IEKA 1RJLA 2WNKA 1CD1A 1T04B 5CCHE 2CJ3A 4PJIF 3OL2B 3TH4T 2AEQH 4HS6A 2LU7A 3TO4C 5I6NA 3C6EA 4XPTL 1XBDA 3VG9C 3TF4A 2P47B 1X4ZA 3EI1B 2H0FA 3Q1EA 2FR4B 5E6SA 4RWYH 2WVSA 3QUZD 2XX1A 5J6HB 1JDCA 3GRGA 1WZKA 3L17A 4P5TD 2WY3B 3U7YH 3CFTA 4YS4A 5KBPA 5IVXF 1PW3A 5AW7B 3VRJB 3ZDZF 3V0EA 3Q0HA 3FUIA 4WNSA 3OAZK 1U8PB 4JGNA 4NQCB 3LZFL 3PGDB 4PIRF 4TZ4A 2HXAA 1WFMA 4MDJB 4HZAA 4ABVA 3ZMRA 5M7QA 3DVGB 1IC0A 1DQDL 2K1MA 1XR9B 5E6UB 2G9HA 4HHGA 5KVMC 5ITBL 4NSKA 1F02I 1O6FA 4A2DA 5BO1L 1IBGL 4HZLA 4ZXBD 4M93C 2J5LB 5HHNB 4N2AA 1P5UC 3U1SL 5L7XL 3CFEB 4WFEE 1P7KA 5E1AA 1NM9A 4ODHL 4PLJD 4D9RE 4Z7NF 2IPTL 3D2TA 2CJSA 4QR7A 1NFKA 3CFEA 1GTNA 3EH5B 4OV5B 2PM9B 4FZ8L 3T1WA 1DE4A 1J8SA 1CS6A 1EO5A 2FX7L 1S9VB 4X98B 3SKMA 1Q8MA 2ZOKB 2ZX6A 4R0LA 3MXXA 3CCHB 1CFQB 2P5ED 1P1VA 4I0PA 3CCHA 1OLLA 1J8KA 3FC8A 3K2UL 2Y7SA 4JRXD 5JW3H 4K9JA 1A65A 1IVLA 4NM4L 3WN5A 5C9JB 2QTVA 2H3KA 4FMKA 4ZT1A 4ZFFB 1C5DB 1NCTA 2QPSA 3L8QA 4MBRA 5C9JA 3M6DA 4JDVA 4KXCA 5F9JB 1TVHA 4RZCA 3VSQA 4ODUB 1SXBA 5C0GA 1L6ZA 1K9TA 3LPOA 1MFAH 1CXIA 3MV9E 3ZYJA 1CF1A 4P2RA 1MAMH 4UT7H 1V05A 4LOUC 4QTHB 3UZEC 1MY7A 2KDYA 2KZ1B 2MCMA 4BKLB 5CAYB 3VWKD 1JHLH 1XCTA 2KERA 3LV3A 1J18A 3TJPA 2BP0B 5I18H 1CLZL 1R9FA 2D2OA 1TFHA 1MN4A 5C07A 2EZ0D 3LKRB 5IT2L 1JBJA 3QHFL 2V33A 4PN6A 3ZDXA 3UJIL 2LR4A 2C3XA 3CHRA 5C0NC 3E1ZA 1HDMB 3HOGA 5DEZA 1O7DC 1UJTA 3LRHA 2YSSB 4P2OB 3IDGA 3BIBX 3ZTNH 1MJ7L 4U7MA 4GMTH 5LXGL 2EAEA 5JPNB 4QRRD 5AW2B 1TLMA 3F58H 3ARYA 5DWUL 1K5NA 2XWXA 3K6FA 1JOIA 5FXYA 3HZMB 4LPWA 1S3KL 2DQGH 4FQXC 4N6RA 3EI2B 3U30C 4Q9RL 4KQ3H 3UZQA 4GSRA 4LNRB 5GZND 3W0WE 1HK6A 3L4TA 1ZHBB 1I8AA 3G5YA 3NEEA 4DKFH 4J3BA 5SXMA 2VABB 3FN3A 4D3CL 1R24A 4X7SH 5TE7H 2WLJA 2B39A 1KELL 2VABA 1Q9WB 4NZUL 4UILL 3G7TA 3U4YA 1UCBH 3MYJB 4M7KH 1CICD 4WENB 4BFRA 1KTLB 1I4FA 2G5BB 1KTKE 2O5YH 3IIWA 1IGYB 5G5DA 4F9PC 5MEQB 1AGEA 3QZLA 2G5BA 2EIKB 2YPKA 2DWDA 3TBTA 2HTKD 4X5PA 3ZDWA 1S6NA 3QK0A 4L48A 3I9PA 5HYNB 4Z0XB 3AWFA 3QFJE 2FEEL 2Y7LA 3UTZA 4DPCX 1FPTL 4JO5A 1AQKL 1KJ3H 2AF2A 2H0JA 1NCDL 2AQ2A 2VDPL 1UH2A 4F7MB 2KZKA 1SHYB 1L7TL 3BAXA 2OCJA 4YHYB 5TE6L 3ARVA 5CBEA 1SEBA 1T2JA 1QLEH 5B4MC 2RHEA 5AFU3 5EEUA 1MFEH 1CBVH 3LNHA 3B9KA 3MLYL 4TLKA 2Y3NA 2ARJQ 5B3NA 3BAWA 3MV8B 3UAFA 4KI5D 4JZJC 3FUKA 4R7LA 5D5ME 5CS7A 5I66A 4L3GD 2WB7A 2W59A 3H2PA 1QWHA 3IMTA 2ROYA 4HAFA 3RKDC 2Z2PA 2IAAC 4Y4FB 4G9FE 1CYXA 4OD3L 3KS0H 3GMNB 1UENA 5HDRA 4JQIH 5D7IB 4L3HD 4Y4FA 1IC7L 2XKNA 4J4PA 3QI9A 4NHUA 5CU5A 3EBAA 1TNMA 1X7QB 1YMHB 2XQBL 3IS1X 4XB3A 2OCFD 3S4SG 3S5ZA 2EE2A 3V6ZA 4B0MB 1K85A 1B4LA 2JCCE 3QUYC 1A7OL 4OY9A 1A5FH 3T04D 4MNGE 4L3CA 3GMPB 4HKXB 4X7TA 3DV4B 3HVNA 4Y5VA 3QJOA 3N43B 4APXB 4YFEA 3CZFB 4JE4B 5CP3A 1H15B 1YECL 1MG2C 2ZP8A 4OF3A 3MUZ1 3SCMA 1ZHNB 1E8NA 2Y5QA 4XTRD 2QGDA 2EC9T 1DQML 3MPCA 4U1HB 3APMA 3D8MA 1U36A 5DMIH 5L6YL 1XIWA 3DUUB 1WEJL 2ADIB 2K6WA 3ZUCA 1A66A 3Q1SL 3ZN6A 3N3EA 3GBNH 1KMGA 2DYRB 3WTUA 4GUQA 2ADIA 3APDA 3EW3B 3BEVB 2YXWA 3BVDB 5CSZB 4MCYA 4MQXC 3Q6GH 4LQFL 1YHPA 1CT8A 5F7DA 2YFOA 4GINA 4NJ9L 1NLDL 3F3HA 1I8LC 3IFPA 2WC7A 1SEQL 2EDKA 4YNYA 3PQYB 1PZSA 2X41A 4FQQB 1J1XH 2R2BB 5C08E 5IV2A 5LJYH 3FNKA 4DKTA 1LO3L 3X11B 1OOWA 1MFCH 2R2EA 2C9QA 2BS8A 4PJBE 3GBLA 3AGVA 4YX2L 1MCNA 1VF5C 3AY2A 4O02L 3S35L 4K8RH 5CEYB 4AMYA 1G6RB 4P3WA 1MFVA 1YAIA 4QWWD 1WUNT 4KXZH 4GKZB 3RDTC 5DTFA 3RBGA 3SYAA 2DQCH 5DVLA 3OW8A 2C8NA 4X4XB 1ZV2A 4FERA 1GOHA 5B39A 3DMMC 2KT6A 4MVBD 3FU3A 2BMKA 5C09E 1VGKA 3SVWD 1F6AB 3BD5A 4A6YL 3G6AA 3ETBJ 3PL6A 4HFUL 5INCB 1C08B 1BVLB 4J12A 3IFNL 3UACA 4IMMA 1N26A 4X4KA 1U58A 4JFHD 5CCKH 3HTLX 3NUKA 3QRGL 3KWTA 4N0FB 5KUMA 2X6CA 4UT6L 4PLOB 1N19A 4JZOB 2QQNH 3TLRA 2OX5A 4G1EA 5E4OA 4NQDD 3H9ZA 5D70L 1W6WA 1KDJA 1QABA 3F5WA 5I15H 4WWID 5BMFH 1MCRA 4I87A 1NEZA 5C70A 4L1LA 1MCCA 3JZ7A 4ESKA 2BXYA 5LO7A 3AH8B 5F0JB 2VXUL 3NCEB 2IV9A 4H88L 3LS5H 4HLJA 3FTUA 1K8KC 3HMWH 4JSXC 1ZT1A 5JW4N 5JW5A 1WJ3A 3V5DA 3FW6A 3N9GL 1WTLA 1DQQA 4Y9CA 2EDNA 4YXKH 2CHDA 4RMRA 4AEZA 1HX0A 3CFJA 1ZT4B 3X3FL 1NIFA 2DJUA 4P59L 4W6WB 3KWUA 4KXDA 4HUVB 1RZ8B 3QARA 1VGEH 2HH0L 1A64A 5F9WC 1K6QL 3D08A 4ZMAT 5E9DA 2Z6FA 1JNLH 1AGBB 1XF4B 3D4YA 2OJZL 3KE0A 3QXDA 3UJTH 3SKNA 1T1ZA 4BKSC 2Z9TA 5LAPA 4GFXA 3GUTB 1A6PA 1HWWA 3FO0H 3QHTC 1E28A 5ECGA 2YA0A 3D2UD 4PJ9C 3C2SA 4NRXA 5J13B 5HQGA 5CMAB 4LCWE 4L8SB 4DP0X 1OXYA 1LQSR 4X8JA 3O2DA 2MCPH 5I6PA 1X5FA 4XO4A 1TVBB 3UERA 3IUNA 2BNQD 1NDGA 5A2LH 4DZ8B 4HMEA 5L2KE 1L0XA 3GLEA 4YHZL 2YUZA 3T3PE 2ADGB 3WIIL 5JPMC 4S1DC 2W0FA 1JHTA 4YDJB 5GGTH 5D96C 2BFVH 4H2CA 3C5ZA 4NN6B 2CUMA 1EDHA 4RA0C 4G8GA 3CZEA 5AAMC 3TYFA 3TPKA 5AB9A 3WLWC 2OXGB 1KXVC 2F1AA 4GKNA 1X5AA 3IM1A 1T83C 3MJ7B 4JEGB 1FFOB 4JRYB 1PZDA 1YY9D 3STZA 3DXKC 2DDQL 4N90D 2K9UA 3QAZB 5ILTL 3VA2C 2HG5B 1KY7A 2A74A 4UNIA 4JFQA 4YPGB 1YNTB 3DA0A 4YDKL 5C0FB 4PJXB 4YFDB 3DVIA 4WU7A 3NESA 3RVXC 5HP5A 3V7MA 1GOTB 1F4AA 2CLRB 3QCVL 2PPEA 4FLSA 3WE6A 4M02A 1BPOA 3GSWA 4MNHB 3KPRA 3G5WA 1WAEA 4PB0H 3UABA 4AV0A 3TA3D 3GXNA 4AEIL 2QT6A 3BZ4B 4MNHA 4G7YL 4ZNEE 4FFWC 4N3TA 1E5YA 1SVZA 4X5RA 4EI6B 1LLAA 2CDEA 1ZWIA 3BZ4A 3SDDA 5HHPB 1F0LA 2B1HH 3TIDB 3T8VA 3ZZ1A 2JNZA 4RMQA 2IMMA 3UROR 4FKKA 3JTBA 4GMBA 3FQUA 4JG9A 3I7PA 1JE6A 3T0EE 1JHKL 4KJQD 5B3JF 5L8LB 4V33A 1Z3GL 4I1RA 4EQ2A 2OL3A 2Z31C 4J84A 2EXTA 4WUKH 4CC1A 5EPMB 2CO0A 2DOCA 1CGWA 3K8MA 3NEOA 4H20L 2B5MA 4BELD 3FQNB 3LMJH 3V4UH 5E8NA 2F7OA 1CK0L 1ODUA 1A0RB 1UT1A 3IFLL 3DRQA 5PCYA 3UP1A 4ZMVA 4IJTA 5BS0D 3F3GA 3SPGA 2IXQA 3MOBL 5DJCB 4PGEB 3HEIB 5GS1C 2NSMA 1NR0A 4IRJA 4PR5A 3PXSD 1TZGH 5F88B 3ARBC 5AYUL 4M5YL 4NN7B 4J5VA 4JXMA 4YIQA 4NO5B 3K5RA 2G2NA 5AZEL 3VD9A 4N1HB 3VDAA 3FF7A 2AK4E 4UM9D 5AVUB 3V0GA 4K07A 4IU3A 4CJ0A 1NCCL 4JFOB 3IFOB 1JGUL 3SQOH 1OTUC 2PYEB 3FS9A 3KXFB 1BZ9B 3RWCB 3VH8B 2EIMB 3QNYA 5AVSB 1KBGL 3DROB 4C54A 3Q05A 1UZ6F 3KXFA 1U4CA 3MLTB 4X6CE 5JOFA 3KD4A 4TQPA 3RPIB 3HE6D 4E54B 1UD2A 1ZCRA 2F9BT 4E9TA 1HI6A 4JK0D 3GBDA 5HHOA 3MR9A 5MENB 2B0SH 2ZSWB 3NK4A 3BCFA 1BG9A 1O9WA 2F5BH 5T1KD 2WNXA 3O45B 4Z7QB 5ISZD 1E4WH 4KKAD 4XPBH 4G6FD 3RB5A 2ICEA 4WKZA 5HHQA 2CH8A 3D0VA 1BXUA 1U41A 3QORA 4G5ZH 5DUJA 4K3JB 2VRAA 1WD8A 1ZPLA 2A6KA 1ZSHA 2P80D 1S2EA 1MDAA 4N2OA 3TWCL 4IBUA 3K2MC 4ALAH 2XTJD 4EAEA 3DSMA 4H25A 4PQXA 3JPXA 1NEPA 3VI3E 2FECL 3E7JA 4JO2L 3IKOA 4MAYC 2DTMH 1Q1JL 4KVNH 3FBQA 1UB5A 2ZX9A 5IOPA 2YZ1A 2A3TA 3RTQA 5FV1L 1J5CA 2ED7A 1UASA 1NGPH 5JYMA 1RSYA 1NCIA 1USQA 2VLLA 4OZFH 5F7WC 2E86A 3Q5OA 1JERA 4XVJL 3U2IA 1G7MA 1YN7A 2W60A 2H2PD 1NJ9A 3ESVF 1QX1A 3CSYA 5BZXA 3GXPA 2CIIB 2XTLA 5DD5L 4C56E 4N8CL 2OR9H 4E9YA 3ZT6A 2XZCH 2BH0A 2I69A 1CGYA 5ADPL 2DI9A 2EDWA 3NIFE 1F8TL 1ZHKB 2XJLA 4BP9A 4Q6IC 1UM5H 3UGXA 3DURA 5DT1L 4ZDHA 2ROXA 2MTAH 4JFFD 2L7QA 2IWEA 3R18A 1FIGL 1FVCA 3EFOB 1VADB 4QRJA 2Z8VC 3HNSH 3IJSB 1CE6A 3CXHK 1E8XA 3D85B 3IF1B 4D7BA 3WIFB 4F37F 3E6FB 1Q94B 3U0WL 1R3HA 3NH7H 3WIFA 1NAMH 2WKLA 7PAZA 4DVRL 4FAAB 1TVDA 4FI7A 2HT2C 2NZIA 3RWGA 2VC2B 1CUOA 2OW7A 1B4JH 1QMUA 4OCRL 4Q2ZA 5I0YA 3CSTA 3T0EC 1OSEA 2MNJB 4XWGL 4IHOB 1RMFL 1DBBH 1LM8V 3VXRE 3T3MB 1E4KA 1IGIL 2H3NA 4WW2B 2FUQA 4PH8A 3JV0A 4B50A 3UFIA 1BBDL 4X3EA 3LNEA 5CCJA 3DWTA 3H9SB 3T09A 3BAYA 3GZQA 2LW3A 5IQ7L 4GQQA 4HUUB 4QRSA 1X9QA 2X38A 3V0AC 1QBBA 2JV6A 5DUBA 1ADQL 1S7SA 5F0PB 4K9EH 3DOSB 4FXTA 4H1LH 4AQ1C 1XGZA 5C0CA 5I8OL 2YAEA 3ROOB 2WINB 4FXKC 2OYPA 2ODIA 3NRPA 4YVNA 1ETB1 3B7UX 3EDEA 5FYKU 3U2SA 3TFKD 3FH8A 1XTLA 1O0VA 4M61B 3WFEH 3MRJA 3T1FA 3KDMA 5FOJA 1FNEB 1NOFA 4QRPE 1NC4A 2FZ3A 1HXMB 3WJLA 4WCYH 2HRLA 2KQMA 2OZ4H 4BUHA 4JM2B 1H2ZA 5SWSA 4U2YA 2CG9X 2HT4C 4MS8C 2OM5A 5FM8A 3K71B 1R47A 2KI6A 2BIQA 4EBQH 4MZ3A 4HJJH 4ICWA 5B22A 1LE5B 2OCCB 1QSEE 3QUYD 1C16B 5L8JB 1FNSH 4FG4A 4DP1X 2RMNA 5JHDB 3F00A 5D71L 5D7SH 2YO3A 4GSUA 4POUB 1OKEA 4ERSL 5TE4H 2NY1D 2ZF9A 5C0EA 4EI5A 4E41B 4PJGB 4RFOH 1Z9PA 4A11B 2JIXB 1KOAA 3QBTB 4NI3A 3SE8H 4E41A 5DMKA 3L3KB 4BHUA 2WQVA 2ZYRA 3LAFA 2BVTA 5K9QG 3TJHC 1EJ6A 3ENEA 4QYOB 4Y16C 3ZOAA 3C5XA 1UWFA 1HOCA 3CHXA 5LB1A 4YL4A 1DBML 1NDTA 2BFGA 4QYOA 1HVXA 1JJUB 2P48B 4LKCA 3MU3A 3HB3B 5FHAL 2QGCA 3TXAA 2WN2A 4YWGL 5BUPA 3GHPA 4IIQC 1N6QL 3MO1B 4HAKA 2BSEA 4LHUG 2BC4A 2UZXA 4O4YL 4Y19A 2HU7A 4A0BA 4WUUD 4PJDF 1KIQB 1O6TA 2J1XA 2FX8H 5GSAA 4ODXB 3CVHA 5J4MA 4AUJA 1TZHA 4JPIA 3L9EA 3EBIA 4P46C 5TQ2L 1H3WM 4GRLD 3BFWA 3SJVD 5ICXB 4XC3L 3PUUA 4PJHE 1OSYA 4GAJH 3S8FB 2VXVH 1T21A 1OP9A 5D2LE 3CQQA 2F54B 1OCWL 3NTCH 4WFHD 4NLHA 3VFMA 1O6GA 1M2OA 3F62A 1T6VN 4FQ1L 1YLBB 1PFCA 4Y4HA 3IMBA 1OMWB 4CU8A 3QPXL 3IURA 5HGAA 3FB6B 4QKTA 1ULVA 5I1EL 1E40A 3RDTD 3AZUA 4W1TA 2CMRH 1MJ8L 2DM3A 2O6DA 2V9QA 3WBDA 3SN6B 3AG1B 2HKFL 5EO0B 1QFPA 4AZUA 2MHAB 4MHHG 1DANU 4G43A 3UYRL 3RU8L 2VNCA 4JCMA 3MXVL 5A3ID 3G5VB 5F9DC 5CUSL 1WK0A 1AD9B 3H3PH 5HGDB 4P57B 2VUOA 4UTBH 1M3JA 3IMSA 1N7ML 4CA4A 4F9LA 1QFUH 5A2KH 2EYSA 1J88A 3P2BA 4ZX6A 3NCCB 1W72L 3HE7C 4M1GL 5JOEA 4NRYA 5DK3A 3FFOA 3PP3K 5AW6B 3UPCA 4D8PB 3CFIC 3O8XD 4KROD 3FZUC 2B1AH 4PWEA 5LDSA 2NXYC 5HDOA 3BAKA 4BFIA 2X7LB 4MX7B 4U1LA 4H8UA 4TL4A 5KS9A 5JIMA 1LGVA 2X7LA 2GBAA 3MLZL 3GYRA 1ORQA 2DM7A 4X4ZA 1AQ8A 1L9NA 1BZ7B 1A3RL 1KB9K 2WSKA 4LSQL 4OZ4B 1T0OA 5FYKD 3FQ4A 2ITCA 4O5LH 1QFHA 3V7AE 2APFA 2O5ZH 1LO5B 2CDGB 6FABL 2DF3A 2IG2L 3F2LA 5D9SB 2AJUH 2BVQB 3VGDA 4Z77B 4JSVC 2LGNA 4CY5A 3IJEB 4J8RA 3ARTA 2NY6D 1ACYH 3DLQR 3GM8A 4DCQA 5B7FA 5SWZB 3C08H 1J1OL 4J3VA 5DS2A 4JN2B 3WSQL 2GJ6E 1EVTC 1TSHA 5D7LD 4HISA 4BWTA 1DSYA 3FCSA 1PZ3A 1AHWA 1RZFL 3GJEA 1EH9A 4OIIL 4UTAA 1E8ZA 3O3EB 4WV1B 3K7UA 5CN1A 1FZMA 3G6JE 4K3EH 1HHGB 3ZE1E 4IGBD 2P45B 1FJ1B 4BH7B 3MDJA 2MOGA 2O5NA 4Z7OF 2VAAB 4CI1A 4BH7A 2KZWA 5H4YA 1PF3A 3U4EA 4JT5C 4CDGC 4OLWL 4HW6A 4KZ0A 4OJFL 2G75B 3M45A 3RZCB 1QTYT 5KVEE 4L5FE 4M5ZL 1JYWA 5HD8D 4TPRH 3UKUC 1TDQA 3S48A 4YSEA 2E7LC 4ESGA 1SDDA 3TEWA 2CIKA 5K9KB 2L04A 1G7IA 5F1SA 5B8CB 4DGIL 5F7EH 4Q4EA 4PLNC 5GHWH 2ZX5A 2VLRD 5HI3C 2ETWA 4GAGL 5FIEA 3H9YA 4HCRA 1JMXB 2VW6A 3SDYL 2I9LA 3D0AA 1MWAH 3KJ6H 5DEJA 1KJ2B 3B9EA 2C9UA 2DQIL 3PP4H 4A09A 5M5TA 3FK3A 5E51A 4IYKA 3GJFB 3P69A 1ZKAA 2ZX7A 1A3LL 5JXAL 3INUL 4OM1L 3DXAA 4IRSD 5KUKA 1AY1H 3AY4C 3NDZE 4NKQB 4KITB 3DGGB 4I18A 3BFOA 4ZMTA 3X13A 1I8KB 3N1FC 3KWWB 2WQWA 1QR1B 2WXRA 4Z6AT 3MCYA 1E90A 3LIZH 2EDDA 2DLFL 4MFHA 3UAAA 2YPVL 2FX9L 5DD6B 1TZIB 1J86A 2D31B 3RAJL 1BQLH 1UADC 2C3VB 5D7KE 4XAWL 3LKOB 3NK3A 1CD8A 1TYRA 4R97B 3ARBD 4N9GA 4RMTA 3IVKA 5HE2B 4BKTC 3S4SA 3OHXA 1GZPB 2P3YA 3ZR6A 4OQ1A 2QR0A 3VFGH 1GSKA 2ENJA 5A1AA 1OSPH 4K94H 4OGZA 2WBJA 3QUKB 4IOFC 2DWEB 3KHOA 4FXGB 2WBKA 3IXAA 1F5WA 2WQSA 4YHMH 3W11D 4Z7AA 2W0KA 4AQ8C 5A2JH 1IBBA 4X9YA 3L3IB 1DBKL 2BSSB 2Y24A 4NBZB 4XPAH 4ZFOB 4EN3B 3NJNA 3MBED 1BW8A 2X2YA 2AV7B 3MRLB 2BSSA 5I74C 4EN3A 4YAQA 3VXNA 3L3GB 3MV7B 1J05A 4M6MH 1A6VH 1RUPL 4G42A 2YBAA 4QXTA 1ID5I 2X6VA 1EMTL 1MIMH 4PM1A 4OGXL 2YUWA 3BP7B 5DD0L 1VZIA 3D3VB 3P0VH 3VXUA 5HVFB 3DIFA 3VXPB 2B4EA 2VLME 1R5VB 4WEEA 4XXWC 2ZWNA 4B60A 1BJ1J 1S7RA 4MBOA 5DGRA 5E5RB 3NAAL 5GXBB 3MMYA 2X6MA 1W0VA 3U48A 4RGOH 3SOBH 3DX7A 2APWA 2BERA 4HC1A 4LGPB 3H6JA 1M6OA 1SXNA 2PW1A 1E9PB 2WXLA 4M8QB 1IX2A 4HIQA 4G8IB 1LD9A 1TZOA 2LAAA 4ODWB 3IRCA 1FBIL 3S96B 1FLRL 1I8MB 2K70A 2ICES 4NQSA 4ODWA 1AO7B 5TQ0L 5C2WB 1A3ZA 1DQTA 2YKLH 5FA3A 2KYIA 3CDGB 4J3OD 4PRPD 3RVUC 4JM0A 4MB1A 2WTRA 4ODSH 1P9MA 1YC8A 3CUPB 2BIIA 1B9KA 3LKNB 3VWJA 2FHBA 3ARGA 5EUOB 1VKXA 2BHZA 3U2JA 2OSLA 3MRPB 3SPIA 4L4TA 1JMZB 3LKNA 4WO0A 2O6EA 3H7BB 4LVNC 2VLJB 4YHIA 2R7EA 1ZT7B 2YEZA 5GRVL 4WLCA 3FN9A 1INEH 1JN6B 5DA4A 1UOVA 4I3SH 2C3GA 4PJEE 5DEGA 4X6FB 2EO7A 4QXGL 3PSCB 5HE0B 2R9HD 1TCRA 5DZNA 2P24B 5HYSB 1BFOA 1I7UB 2EUZA 1SOKA 4IEFA 1WYJA 2NOYA 3A67H 4KRPD 4JFHE 3MHZA 4HH9A 4OJAA 2BRQA 1RZQA 3HG1B 1AXTH 5AYQA 1JYXA 4X6DE 4LCCC 2ZUUA 1AMXA 2OK4A 2VR7A 5GGVY 2R0ZL 4G1MA 3S3DB 3BO8B 3SFZA 1F56A 3S34L 3QR1A 4QY8B 1AFVH 4LASL 5HVGB 1GCFA 1KJVB 1MLBA 3DX6B 4HGWB 1LEKB 1QVOA 1L5GB 4Z7VE 3O3DA 5DLMH 1ILSA 1N18A 1K2DB 3FT3A 4XN1A 2ZCLL 1E8YA 1SF5A 3M1CA 2VDPA 1P2CA 1YMMD 3NIDB 2IUPA 2CWRA 2EDFA 4K9EC 1FH5H 1JPFA 1JTTA 1Q9OA 1R3IL 2QQLL 3BZ5A 3EFFA 3T0WA 3U9UB 4WWKC 1P7QD 5LWYL 4GY4A 5ALCL 5CGYC 5B1BB 3FO9B 3DX3A 2X6UA 4G6MH 4JN1H 3MLVH 1YDPB 4J28A 3ZJAA 4UIMA 3ISRA 3KJ4C 3QDGB 3TBWB 1HSAA 3BZEB 5KANG 4MA3A 4Z76B 5E94B 1OT4A 5DK2B 2P52A 1A7QH 3VVVA 5DFVD 4L1TA 4DKFL 1RXLA 4I1PA 2R1YB 4JPKH 5EORL 1D6VL 3RWFB 3NCYS 1CD0A 2JQMA 1ZVNA 3TVMC 2BNQE 2VDRL 3UBGA 2VJ8A 5J9PB 4HJEA 1KUMA 5AZ2H 3B2UC 4Z3TA 5JQIB 4CY1A 1Q9KA 4ZQTA 1N8OE 2X4OA 4IBWA 3DUHA 4YH6A 3T2NH 4WI7A 2BINA 2WIMA 2M1KA 4HHAA 1V7MH 4OM0H 2NX5A 3OHMB 1QW8A 3IJCA 1KACB 3VSUA 3F7YB 4RZKA 4GKLA 1ORSA 2HKMA 1UD3A 2AABL 1I1CA 4BL0A 2ZONA 3IB4A 5C0AD 2HT4D 4OFVA 3BKJH 2LU5A 2VQ4A 2FSEA 3JYCA 3Q3GB 4GOSA 1I1FB 3RP1A 2A6DA 4AITA 1RQ5A 4YMPA 2F08A 2C5DC 2EACA 1KFAH 4LCIH 4PJAB 5CZXC 2A5UA 5C0RH 5DC9B 1REIA 2YWZA 4HWEH 3D39D 1OQXA 3FQTB 3BQUB 3QWOB 2R0KL 5EG6C 1HQ4A 2LV4A 5GGRA 2IVFC 2QVTA 3FSOA 1G9MH 1OM9A 2MCAA 3ABZA 3GSRA 2AGJL 3SODB 2QADD 1IC4L 4ACPA 4WHTB 4XCEA 2OYMA 5KYUA 4MCZB 4HWBL 5SWQB 1NCWH 3HC3L 3LDBB 3BN9C 5ITFA 1EO8L 2AAVA 4MCZA 3HAEH 3SPJA 5AVRB 4OR1A 2LQRA 1AZNA 5DRNB 1OLZA 1FL3B 1M42A 3HRPA 3SGDI 2UZYB 3Q2LA 4L4VB 2J6EL 5E1QA 3A4FA 3UTSB 4PS4L 5BJTA 5K9JL 2OS7A 1W80A 3BKCH 3MLPA 3AJ7A 4RFNB 3JWNH 2PXYA 1AGDB 2P28B 2GIYA 4Z95H 4O02A 2AQTA 4FKEA 4QT5A 4G70B 5C0BD 4NWTL 4GW5B 3HI6L 4TF4A 2WXJA 5C6TL 4JGMA 3IJ0A 2VDNL 1ONQB 2UVFA 1SJHA 4RAUB 4RFEA 1YNKH 3GI9H 4KJWC 2XZAL 2AQRA 2X4PB 1Z9SA 4JFEB 4HIPA 3RNKB 5HBBA 4A6YA 4JD2C 1U8LB 4Z3GA 1JZ4A 5H2BA 4YZFF 2YN3A 1AI1L 4JFSA 2DI7A 3WUZA 2AXHA 2DMKA 2Q9OA 4Y1AD 1DQVA 4BK5A 2HJKB 3BE1L 2DAVA 5K1JA 4J78A 2X70B 2Y5TB 2C9RA 3HZ3A 2JJTC 1NCJA 4UT6A 1MI5A 3DX2A 4PJ7F 4EVNA 4MB5A 5GS0H 5KDOB 3V4PH 1U8OB 4FA6A 1EEYB 1JFQL 2RIKA 2VQUA 4WQOA 3A5VA 3BP5A 1H3PH 3FH7A 1BIIB 1KCVL 5JQ6H 1NBQA 1XGQB 3L48A 3ZE2E 3QVAA 4QHLB 2EBSA 4FRWA 3NGBB 4X5XB 4PJFF 1WAPA 4APQB 1I7RA 2GHWB 3HE7D 4B5EA 5I1GH 2VDLA 1DQKA 4QCIB 4XBPA 3KCWA 1QRKA 4H0IA 1CXLA 4X63B 4K7PH 4WK0A 4GMSH 1W2KT 5GGUB 4XCYA 2CO6A 4KI5F 4PYGA 3UXFA 3HS8A 3WY1A 4KNSA 4HS3B 4ELMB 1JSYA 1SM3L 1XH3B 4ZSOA 1HKLH 1CIUA 5CZRA 2VR8A 3QEQA 2UX6A 3D9AH 4F2MA 4HIXH 4AIEA 4NENB 3OKKA 2N4IA 1OCOB 3C8HA 3CZLA 3O6FA 1MUJA 4WO4C 1DQJA 5HHXL 1DSFL 5DZAA 3DDGA 1ICTA 2DQCL 2NNFA 4HDIB 3I9AA 3WMPA 2PR9A 5IUCA 4P3DA 1K8DA 3FCTB 3VG0L 4DQOL 4WI2A 2AXJA 4KUZL 4QRFA 2ZCZA 3B3BA 5IVXB 3WFCL 3GHBH 3ZDZB 2BY2A 3L2NA 4GRWE 1OAQH 2QDWA 1LWHA 3L3HB 3VXSB 4U0RC 4ZUTB 2Y23A 4XR8C 3RHWK 2VL5A 4PV9A 3IUQA 3VXSA 1WFOA 1A7NL 4H5IA 3HR5A 4QJ5B 5BOZG 5KBKA 4NS0A 5HI4C 1JNHB 5IHZB 1A1OA 1G84A 4PJ5E 2WBXA 3MTXA 5KVDH 5EC1B 4N2FA 1XGYL 1CR9L 4FDWA 4K5MA 5EMJB 4O3UB 2XA8L 3MV8D 1OM3H 4B95C 2PO6A 1A21A 4PPTA 1IMHC 2B59A 3PIQA 1KB9J 3NIGF 4IOIB 1MCWM 1S4IA 4MMZA 2LTQB 4Z7NB 4GGDA 3MLSL 1F1DA 3L4VA 4IMLA 1RI6A 3IGUA 4WI0B 3HMWL 4CY2A 1YEEH 2VDML 4LLYB 1GJUA 2LU3A 4PTTA 5F72S 3HJ0A 1H9VA 3RE0A 2QQQA 1SQMA 2IANA 4L3EE 4PGBA 2WMPA 3I75B 1OAJA 4AQZA 2H47C 1OGAE 1S7TB 4U1SB 3S5LB 3BZFA 2R8SH 4G8EA 4KMTL 5TGBA 2DQUH 2XWJA 1LDPL 5FB8A 1KT2B 2D0FA 4D7PA 1XXFC 2CLZA 1J9CT 4LVOC 4ZMPA 4QAWA 3EMHA 2GCYA 3BPLB 3GJFK 4F7PA 2NUTB 2ADFH 2Y07H 1IM3B 1CQYA 1JL8A 4F20A 4GG6F 2OA9A 4FMFA 4YDLB 2PN5A 4AVJA 4AT6A 3VCLB 2B8OT 3RB7A 3FDWA 4LNVA 2NY2B 5FKQA 3IJHA 2Q76B 4HUWA 5DHMC 3KYNB 4NHCH 4EQ3A 2QVFB 2EEDA 4HWZA 3O11B 3BVXA 2AEPH 4ZMWA 3VFNA 1NFDE 5DJXA 1BYPA 2CM5A 4DO5A 1VCAA 3WOVA 3LN4A 3SDCA 2JKSA 5I1KH 1RUMH 5CZVH 3VGBA 3GSNB 5HI5D 2EC9U 4GS7B 3O6KH 1WZMA 4NCC2 1AZZC 2H7WA 4Q56A 1FGNL 3FSVA 4FE9A 1N4XH 5F96L 3OZLA 3T08A 4K73A 2VZVA 4AW4A 1M9SA 2YOAA 4KVCL 3WE1A 3APCA 3C60A 5GIRB 2X4RB 3C6SB 3QNFA 5DWPA 2Z34A 5I8KL 3PWNB 4AMKH 3E1F1 5D8JH 2BHUA 3H6AA 1BQSA 5CYKA 1G9NH 4KK9D 3HBPA 3MZGB 1N59A 1JF1A 3BT0A 3CHSA 4PB0L 3OKDB 3ARFB 3PV7A 4A63A 3F7RA 4LCVA 2ATPA 3EJUA 1MFDH 4NBYB 2XWCA 4P07A 4UMSA 1VCBC 1IFRA 5IK3B 2EABA 1GGBL 1FN4B 3FTYA 3LZLA 1S7WA 2B1HL 1DQLH 2Z65C 5CSGA 2NY0C 2I60H 5GGQL 2NY4B 4BJLA 4ELKB 1PJ9A 4MCMA 3W56A 2KMWA 2W88A 5AVWB 3O2WH 3D48R 3AL8A 3I3DA 2FL5B 1LEGA 2MIZA 4X99B 3BIAX 5DI8A 4DTGL 5I6OA 5FUCE 2YRPA 4PJ6A 1MCLA 1VACA 3LIUA 3S88L 2WCGA 3A4AA 4QAMA 3LMJL 3V4UL 3ZKND 5LKNA 3TO4A 4H8HA 2NNRA 4NQQA 5EC2A 4FQPA 1U8HA 5ENWA 5H8DA 1WUZA 2A9NH 1X5KA 1XHMA 4J79A 1F2XK 3FFCE 3T8XB 1UOKA 2P7TA 4LHUA 2DIBA 1W0YT 5BOPA 1TZGL 3JWNE 4KPHH 3SO3B 3QIUB 1VAHA 3AFLA 3RJDA 4FA8A 2IPKA 1IAOB 1FDLL 5J6GB 1UM4L 2FWOB 2CE9A 5TF1L 1F86A 2BJMH 5LCVL 1SY6H 1A25A 1PG7H 1G7LA 4XCFL 3V9EA 2YGQA 3O0LA 4BFNA 3FMGH 2UVEA 3GMQA 2OMZB 4J3OH 1QO3B 2BHYA 3REWA 25C8H 4U1GC 3ZZSA 4G72B 4AJYV 1U0QA 4XMVA 4NERA 3L6FA 5L2JB 2SEBB 3RY4A 1TTGA 3N44B 5JR1H 1L9QA 4PUBH 1P5UA 1Z32X 3VB8A 1R5WB 1H3TA 3P4LA 1QLFA 1ZK9A 5FA5B 2A9MH 4KH9A 1JWSA 1YEFH 5T3XD 3CFVA 1FE8H 2CCLA 4GQBB 2JKTM 4R26H 5E99H 3H4FA 2MQGA 1F3DH 1IC5H 3PJSB 4UYPA 4OUUB 3QWRD 4WEBH 2F5BL 1IEAB 4BSWB 2L0DA 4FQIH 4NQVB 1YNLH 5DJ6A 4AYID 3DHPA 4ZOAA 2ALWA 2WVVA 2DQHH 4XPBL 4G7QB 4KK5C 3WS6C 1ETZA 4U4BA 1RZIA 2OMUA 3QDAA 4IRZH 1F4WH 5J1AA 2EXWD 3FQRA 1OAXL 4MQ7A 3QJVB 4K71B 2GI0A 4FFYL 3MRIB 3O41B 1GVIA 1PX3A 3ZE0A 1N6EA 2QSCH 1T66C 1KIPB 4PBDA 4RDQG 1KEGH 2OJYA 3VO0A 4V1DA 3FTWA 1HYRC 3BDYL 4NC4A 3UZEA 2GW5A 4F3FA 3EYOB 4BSVB 3DO3A 3T5WA 4CVUA 4XVSH 4HEMA 2W38A 4K5NA 3ZYZA 1WAAA 3QUXC 1NGPL 4HV8B 4UQ2A 1D9KC 3QQ9C 3GNMH 3UO8B 4XH2B 1ADQA 1KB5B 3S2CA 1MFNA 1LTXA 1UYWL 2FO8A 2OR9L 1Q38A 2H6OA 3SIKA 4Y5XC 4UQIM 4J27A 3FM0A 1CL7L 1WBXB 3DSNB 4QYAA 4XCNA 4Y8AA 1M7UA 5EIVA 5BQ7B 1NC2B 2PR4H 4UQBA 1CFVL 3ULUH 5E08H 5AEAA 3A6BH 3PHQB 3V9FA 4FQXA 4N0UA 5BQ7A 1RU9H 3RG1C 1MCHA 1SBSL 3AAZB 1BX2A 3GB7B 4YSCA 3AREC 5KVDE 4PP1D 1E9OB 4AV5A 2ORBL 5LGKA 1XCXA 1A6UH 1I9IH 3BSZL 3DBSA 1D2OA 3IE4A 1INQA 1BAWA 5KVEL 2V9TA 1UVQB 4L5FL 4OCLC 3NH7L 3SOTA 3KPSB 3UTTE 4OZIF 4NWUH 3G9AB 5HVHC 5BRQA 5DUMH 2BSBA 3U36B 5F7MC 3ZKMD 3PWUB 3IGKA 3B7YA 3PWVA 1T20B 2OMTB 1UJ3B 4WGVB 4AH2A 3VQMA 5K69A 1ES0A 3X3GH 3ROLA 1TQCC 5C6PB 2EDRA 2W1NA 5FUCC 1PY4A 1H5BC 1IBFA 3DI3B 2MMXA 3BP4A 4UUJA 4DK5A 5GISL 1CXHA 2Y06L 4AM0B 1Q0XL 3MRMB 1HHIB 2OTWA 2ENYA 2DWXA 2G5RA 4NO0B 4U05A 3QG6B 4I3RH 5ANMB 1JWUA 4PRNA 2ZICA 1D5RA 2ESVB 2ZXEB 4FTVB 4GBXC 4K9EL 2AJ3A 4LVHC 4ZUVA 5BV7B 4ZTEA 3E8VA 3DX1A 5KJ4A 5CXBB 1MJUL 5L8KB 4HKJA 3S2AA 4LRIC 1S7XA 4N5EC 1CDCA 3NJXA 3H2WA 2H14A 3C9NA 1OGPA 4EO5A 4PFEA 2DN7A 4GPVA 1WZ1H 1E4HA 4YLQT 3IGLA 2YPLE 1IVTA 1NBZA 4N2MA 4XZ4A 3NCJL 2OJ1A 2BCKA 3MBXH 2JI1A 3CFUA 3HI1A 4JZJA 3RWHB 3MZTA 3DOIA 1UZ8B 4I48B 2FWUA 3BLPX 4YO0B 3FQYA 5AG8A 3GZKA 5JQHC 2OZ4L 2NUPB 4MKTA 4OIBA 3UMTA 1UZ8A 4QRUA 4KTDH 3PVUB 3MMEA 2X6BA 1USZA 2GTZB 4AGLA 5J7CC 4A0AA 1FRGL 4N22A 3PS6A 4BE6A 3LCYA 4XP6H 2DQDL 4ZUWB 4F33B 3L7FB 4OGYH 1FNSL 3NRQA 5CD5D 4AXWB 4CN6A 3L1EA 5EUKB 4KKLD 3DO7A 3OXRA 3EJJX 4G83A 1R5IB 2FB4H 2Y7QA 2CHNA 1J5HA 2VQTA 1IFGA 2Q8BL 3MJWA 2VN5A 2W07A 4NPYA 1UM6L 1YEJH 3L4OD 4OD1H 3ILQC 4GSQA 4KC3B 4N2KA 1RVFH 4Q8BA 1NCGA 4E5ZB 1KXTB 3EG6A 2BIHA 3SSGA 4XCCH 1N64L 2MEJB 4IU2A 1W72A 1KXTA 4JO4H 4PRIE 3KNBB 3T2LA 4JO3L 2ID5A 4P5MB 1B2YA 4LSUL 3MV9A 3AWEA 1OE2A 4L9LC 5C86A 5D7JC 2A83B 4HDJA 1BF2A 5LLIC 3RVVD 3V7AG 5CN3A 2C9SA 2VLKB 3GK8L 4PRHB 5KYNA 2WKOF 3TIEB 4DNVA 1MW2A 4N1CA 1XH1A 2CKBB 1FG9C 1LEIA 5D6DC 2CSPA 2G3ZA 2FIRT 3H8NA 1YEKH 4M4RB 3D34A 3W37A 1LQBC 4JFDB 3S6CA 3WKML 4N0CD 5LQBH 4M4RA 4OZFG 4XMKL 1JXDA 2WXQA 3QQDB 4LF3A 5TF0A 1M2VB 4FA9D 5BXFA 1EGJL 5TH2B 4HKBA 3D4CA 4Z8FL 2VXVL 3ZQXA 4RGMB 3IVMA 3MCG1 1M57B 1Q4NX 1QFWL 3QCUL 4UINH 5DC2A 3P9MB 4GG8A 3F7LA 4WO4D 4H0GA 5JNYA 1NMAL 3MJ6A 3QZWG 4XMTA 2DMHA 1AMYA 1MJJB 1XX9C 5ESQB 1MPAL 1MF2H 2WZ6A 4PRPE 1RURL 1MJJA 3W0WA 3H85A 3DMMA 4K2UL 5ESAB 5KG9B 3OKOA 4WDIB 1F90H 1OCZB 4N5UA 5AW5B 4ZFZA 5DCCA 5T8IA 4UTBL 5H37H 3NEXA 1FYTD 3R1GL 5A16A 2I07B 1GGYA 3QNXB 3EYFB 2CGRH 4Y4KB 1U8IB 1BFSA 4LSSL 1Z9LA 1IE4A 2C1OA 3BHBA 3BLBA 4HJUA 3UJJH 4Z7WF 2CBPA 3ZR5A 5DVKA 5JORB 4J3WA 2DQ6A 3UZVB 4ANXA 2AANA 3I3EA 1BLNB 5EN2B 5AW1B 4QRTA 3WMQA 2DJ4A 1BSIA 1IQWL 1ZGLB 4YHPB 2X4TB 3OAYK 4JUTA 3QFJA 4HIEA 1PQZB 2CBMA 4YHPA 1WT5C 5JHBA 5FYLD 1OOAA 1TITA 1HH6A 2FVNA 4U1IB 2ZWYA 4GGCA 2NR6C 4HT1H 2EVFA 1G1YA 2J8UF 3FRUB 4XNDA 1RSFA 4YE4H 5HDQH 2F53E 2GK0A 4H40A 4CUCA 4H1LG 1QSFE 2J5WA 9CGTA 5IESH 5IQ9B 3JROA 2FJFA 4EZLA 3UDWC 4IQHA 4LGNA 5I1LA 4L29B 3RGVB 1YMME 1WHOA 3HPLB 2HFEB 4NGHL 1OK0A 4LARL 4L0PB 5DJYA 3TONA 4JG1L 1MRDH 5D5MA 3BMWA 3CLFL 4H5SB 4XX1E 4XN7A 4PJ9A 1ND0A 4G9FA 2WWNA 3MSPA 3EHBC 1KCWA 2QKIA 1VFAA 3O2VH 1BYOA 2M26A 1CE1L 2YXFA 4TXVB 1GR7A 5SV3A 3WTTA 2G9AA 1A9EB 2Y0SA 4ATTA 3T4AC 5THAA 1AJ7L 1ZV9A 2P5WD 4FC3E 2YPVA 5JOPD 3ULUE 1CYWA 4P4KB 2Z0UA 2JCCA 5JPMA 1SQ9A 1NCHA 1U8MA 4ZN4A 4RGNC 1B3IA 4QGYA 4MNGA 1WF5A 3IDUA 3GKWL 3P4NA 2AQ1A 1WZAA 3DUSB 3AACA 2BK8A 2LOEA 4MAUL 4N0YH 5AAMA 2P9IC 5E03A 1KXVA 2EH8L 3PREA 2Y25A 4TSCH 1FG2B 1S5HB 4KNUA 3QZPA 5DR5L 4I89A 2PWFA 1A2YA 1PLCA 3HG3A 5CIPA 2TRHA 1E27A 3NJFA 4PJ8C 4HOXA 4AENA 4BSJA 5GXHA 5F7EL 3WXWL 2L3BA 5FYLL 3DC0A 4MMYB 4XWOC 1GHFL 1GC1C 2VISB 4K3DL 1G7JB 2XN9B 4JO8A 4HQQL 3CVIL 3VFOA 2Q86A 3FH5A 4NQCE 1G6RH 1FGVH 1IAII 3V0WH 4LCYA 5EU7E 4OGAD 3FT2B 3D09A 5D1QD 5DRWA 4TUJB 3T0VA 4O2CB 3QG7L 1L6XA 5I1AB 2UWEE 1NLBL 3IDIB 3CFBB 3TNNB 3GMRB 5J13C 2JVUA 4I9XA 3QUML 4GAFB 4P2QB 4L3FA 5C08A 1PBYB 4M4PA 3V0JA 4P2QA 2VDQL 4JDZA 3SDAD 2Z31A 4PJBA 1KF9B 1I3VA 1Y18B 3RN1D 1QZ1A 1U92B 1DJIA 1AOHA 1HCYA 1R4XA 1QBML 2DBLH 4AEHL 2NY5H 3RWIA 3QXTA 4XPGH 3EU7A 3A23A 4KO5A 5BQDA 2VITA 4PHXA 5FM5M 5I1CH 5TDPB 4KK8C 5GS1A 4L8BB 5IHWA 5C09A 5E8OA 1CLCA 2Q3AA 1DLHB 4FLRA 3W15A 4UF7C 4MA8L 1OSPL 5A6LA 2H1PH 5D6CA 4AYFB 1VE7A 3IIYA 4YHML 4KMQA 4D0BB 1P5VA 3H0TB 5FHBH 3D69A 1MFBH 1EJFA 3TCXA 5CLZA 2EDJA 4LSPL 3KLQA 4DN4L 4XPAL 4Z8LA 3X14A 2PPDA 2YSTA 3ESMA 3N42F 4G9DA 2P42B 3U9WA 1DVFC 3IJ7A 3W3BA 4DUVA 1DUYA 2BRRL 4P0DA 4OVVA 3PXTD 5B4WA 1A6VL 2JI3A 1DVUA 5L4JA 4UM8A 5T3XH 1U8QB 3C6LB 4GO8A 1VJSA 2LLNA 5KTEL 4I1NB 2PP8A 2APBA 1YA5A 2ZCKH 5D1XD 4WEUD 3D51A 4NP9A 4MMXC 3UBXI 3IPBA 1AZVA 2Z8SA 5HYJB 3HMXL 4ZTPL 3SDXF 1E5CA 3QIBB 2LE9A 3BPCB 3DVNB 4JG0H 3QQ3B 3UPAA 3IDMB 2FDBP 3R0MA 2IGLA 3UC0L 5M5VA 1A1MA 3V52H 3MRRB 5K9OA 2APTA 2DH2A 4UOW0 1XGRA 1QNZH 1XT5A 4M6NL 5I0WA 4AZ8B 4NCC1 1N67A 4PJBF 1FZOA 2J44A 3BYTA 2Z7UA 1EV2E 3VXMB 4HPHA 2HX8A 5DRXA 1HHKB 2XL3A 3BZDA 4LCWA 4MAYA 3WNMA 5IMLA 1AKJB 5BNXD 1H3VA 2V3DA 4MD0A 4UBDC 4JHNA 1JGLH 4PJDB 1QOKA 5L2KA 4KO9A 5B1CA 3T3PA 3OKNB 3G08A 3ULUC 4Z3HA 5I0ZA 3DPBB 1KENH 1G5AA 2F2HA 4OLUL 2DLEA 4DEWA 4I3SL 1XF2A 1F13A 1J1PL 3C8DA 2NW3A 5C0JA 4WI8A 4JZNB 3SWSD 3V0HA 1L4IA 4HLZH 5BVPL 2VDRA 3QFGA 4O2EA 1MHPH 3CMGA 1BD2D 3A67L 2WXKA 3R7QA 2WO2B 5DEFA 4ZAKD 5IJ8E 3PXWD 1UTCA 2MOQA 1MDTA 4NT6B 2NT0A 1ZSDB 2XA3A 4TRPH 3GFUA 3US1A 4WHYH 4R5TA 1CLYH 5KBDA 1WWAX 3KPPA 1BVNP 3U4BL 3MV8E 3Q8AA 1BMGA 4QF1B 4W9FC 5T1JA 5HHVL 4BK8A 3AU0A 2H6KA 3V0VA 1ZLWK 4OZGB 3N1QC 1JPTH 5KSUA 4ZS7H 1URLA 2XYBA 3KM2A 5EU7C 4ZNEA 3BDXA 2X87A 3VFRB 1AXSA 4GXVL 5ADOH 5D1ZB 4I88A 4YGVA 3WJMB 2CXKA 5D7IE 3BUYA 1QLEB 5DC0A 2J5LC 2X1XR 4LVEA 2VWEE 5TF2A 3WO4B 3FHQA 1G7HA 5IB4B 3EJZD 3I9IA 5IR1A 3T0EA 2WM0A 5TPWL 1P84K 1KC5L 1UXSB 3QH3B 1L0QA 1KG0A 2PUQT 2ADYA 3MRQB 1GG2B 1T03L 3SE9H 3SGDH 4G6ML 1PD0A 4JN1L 4JHVA 1LNUB 3VMOA 1BLIA 3DPDA 3KPMB 3NABL 4QNPE 2WWMD 1NGXB 4LEOA 3CFCL 1I1AD 5HDBF 1H6TA 3LEYL 3T0AA 5G4NA 2BSCA 4FYQA 2YIHA 2VDKL 5EMKB 4AQ1A 5AWNH 5E00B 3UP6A 4HF5L 1U9KA 4FXKA 5EO1B 4BCZA 1I7TB 1CDHA 2IH1A 2IWFA 3GS7A 2BWQA 3QIWB 4UAOB 5CEZD 1XZ0A 3NFPA 3QDJB 4MJID 3T65B 5I2IA 3Q9QA 5DZOA 1X7TA 1A02N 1N6VA 4MWFB 2AK4A 3V95A 2BPBA 2IGFH 2CPUA 3BXNA 1XL4A 4OM0L 1TQTA 2Z7WA 3LKQB 3JXAA 2DEXX 4F92B 1B9XA 2VDNA 4J3XA 4M7LL 4Y2DB 3ULEC 1IJ9A 5BW7C 2O30A 1E2VA 5EM2A 1XAUA 4NO3B 5J57B 3L9RA 1CVSC 2OVRB 3PQYE 1AIZA 1LVEA 4XBMA 4X6CA 4ZTOH 4UV4L 4PWFA 2CAKA 3EJYC 1YPZB 3CH1A 4YUEH 2J55H 3TT1H 3SE3C 1AO7D 2D73A 4HWEL 1SXZA 3O4LD 1HNGA 4KH2A 2ZXWB 4Z7OB 2FTAA 2Z7YA 1U95A 5I1HL 3QPKA 1R46A 1UEYA 4P2OC 1EFXD 1RP9A 3HG4A 4JAMB 3N2JA 2VAJA 4ZPVA 5FGSA 1ZLUK 3IS0X 3MLRL 2FO1A 4MD4A 1DFXA 2C7UB 2BNRD 2KPWA 2D4DA 4HGKC 3ARZA 2D2CC 4B53A 3TASA 1BOGA 2Q8AL 4QL1A 3ARDD 3DSFH 4P06A 2X9ZA 4X7EC 4YR6B 4EE2A 4UDUB 4ZOZA 3NZHH 2XVLA 1MNUL 1MHCA 4Y7RA 3KLAA 3A6CH 1BWMA 2CNYA 2XBDA 4AG4H 2BNUB 2ZT9C 4R83A 4FNQA 1WIOA 4R4BB 1AGCB 4Y16A 3B56A 4ZX4A 3WY2A 5EZLA 2DMGA 1NFIB 4KK6C 5A2BA 4EDWH 2JFCA 3I02B 4Y5YB 4ELDA 3VI3A 5T1LB 3KHQA 4HZ1A 3BKCL 3CBRA 4QLWA 1FNGA 3Q01A 1RZGB 3TZVB 1UTDA 2EILB 4XO9A 4Q9QL 3D05A 4AN0A 4U1NB 3SKJH 2H32H 1KTBA 1XHHA 2I0TA 2IQ9H 1J5OH 1NCBH 3WEBA 3S37H 4ERZA 1IV8A 3BP6B 4B7LA 2OSXA 5E8DL 3IWUA 3CFDA 3PWPB 4P46A 3LD8B 1KLUA 1JRHI 2V9RA 3AMKA 1C1EH 5GRZA 3RZWA 3BP6A 2BVUA 4ONHA 2BOCB 2JJSA 1F3JB 4C56A 4UQAA 2YK1H 4YHKH 5DS1A 5IB2A 3UPRA 5IMMB 1GOGA 4JANA 1F3JA 4R6UA 5EFIB 2VC2H 3NZ8A 1YEDA 4GSXA 4YHYC 3NIFA 4ETQA 2WSPA 5E9AA 1XZWA 2Y7NA 1SXCA 2HKAA 2IAMB 2YD5A 5AJAA 2DM4A 4PY7B 5GS0L 2IAMA 1E50A 3L2LA 4Y1SA 3ES6A 1HS6A 2HKRA 4OFKA 1KLFB 2ALAA 4JY5L 3NZUA 1EDYA 4Q9BA 1PD6A 1HE7A 5E4EC 1UOLA 3DTXB 3NP4A 2Y1YA 5K19A 1SYVB 1KGUA 5E6IB 3D30A 4FNLL 35C8L 1RIHL 5C9KA 1FV1B 1M7IB 5T3XE 4JREB 4XP1H 1J8HB 2KLRA 1PMYA 4FTDA 4B9IA 1JNJA 4Y4FC 5EU6B 2HTLC 5EB9A 1I9EA 4OT1H 3JV5A 3QUGA 2VDMA 1H19A 1DJGA 5I8EB 4JPSA 2FD6H 1OTTC 1LMKA 3AVEA 4P2YA 4G7RB 2VE6B 5HPMB 3IMWA 3VXRA 4L1MA 4A7TA 5ABZA 3GLZA 5JLZA 5EHFA 3VTTA 3OAUL 5EEVA 5I1DB 3WDIA 1SYSA 1ZVSB 1SXSA 4WW1B 5I73B 3RWJB 1BQHG 1OVZA 4HPOL 4JHAL 2OYKA 3N0EA 5IG7A 4UOZA 5I8CA 4F7EB 1CF8L 3IT8D 4JRYE 4PIBA 3CFKB 2VZ3A 1EUUA 3RL2B 1DO5A 2OMXA 1DSWA 1OD7A 1RZJC 3GMMB 4CMMB 2J1WA 4PJXE 3RIFF 5FLVA 2ZJSL 4QRPA 2A1WH 3HPJA 1QKZL 3TN0D 2V2WB 5F6HI 5LAXB 4TNVF 2CRIA 3U46A 2V2WA 3AQYA 3LEXA 3LKSB 5KVDL 3B83A 2VH5L 5IVOA 5CHNA 2MTPA 2YQ2A 3OJDB 5JA9A 3VACA 1OM3L 1MG3C 1U3HB 5KZCD 2AHIA 1ED3B 2OK0L 1MEXL 1EA9C 1QRND 4K3HA 1QSEA 1U3HA 2GUOB 4UB0L 3DXMC 4QDGA 4ZO9A 1UWGL 3K6SA 1YEEL 4GRMB 1CU4H 2OXHA 3MZKA 4LKXB 2JXMB 2PCYA 2RTTA 1SN2A 1X4XA 2R8SL 2HWZL 1XV8A 3IU3A 3EJCA 1IM9B 2DI8A 4HULB 5I0XA 1BOYA 3FXIC 3K27A 4XNZB 3X1BA 5AD0B 5EAPA 2WOYA 4HIIA 5F89A 3HAEG 4KV5F 1KV7A 2Y07L 3VM7A 4HPYH 4HCIA 4XZUA 1DDHA 3TYGH 4E68A 1E3ZA 2BIPA 3HS0B 4OF8A 2H4EA 3TPUA 4RDQF 4HJIA 4PSPA 4FGMA 3QDMD 3FGBA 2QGBA 3W57A 4Z3FA 4ABUA 4D2NA 3NQIA 3HN3A 5HHMD 1XGPB 2NY5C 4JRWA 2CK2A 2FYYA 2PYEE 1V7NH 3QUZB 2CHZA 4U2ZA 4P5TB 3KXFE 2OMYB 3BAEH 4MASA 4MJ4A 3AY4A 1RUML 3EUUA 3FB8B 4LSTH 3EWEA 3TCLA 1Q72H 4HK0A 4PJHA 2EKSA 5D2LA 4OCWH 1S78C 5MENE 2R29H 1R33A 1F2QA 3F7VA 1NGYA 2QQKH 2VERA 1UWXH 3DHJA 4ES8A 2LHAA 1YYLL 5LCVA 3GQFA 1H8NA 4Z7QE 2EDEA 3SQBB 5B38B 2TAAA 3Q5TA 4I4WB 4N2BA 4ZXBB 1QUNB 3CWGA 5IGOA 3MYZA 5E2UL 3FO1A 1CD9B 4QOKD 2V37A 2O1AA 2FK9A 4UT9L 1DLFL 3JVFC 3PABA 2AQPA 4LBEA 4BEIA 5FR3A 3TS8A 3L08A 1WBYA 3ZDYF 4URKA 4JPVH 2N3JA 4RX4D 1JV2B 3ZU8A 3AT9A 5K39B 1NBYB 1O7VA 2XWTB 2YAQA 5AZUA 4F24A 3OQ3B 1G43A 2DQMA 2G9KA 2P5EB 3FOLB 2R1XB 3W5MA 5LNEA 4AQ8A 4LP5A 4F8PA 1GC1L 1HEHC 1XQ4A 2XXCB 1KGWA 4JRXB 4NKDB 3ERXA 2UUDK 3FHAA 2N59A 1ET7A 4N2LA 4XVUC 3ZLQC 3V6FA 4I8DA 1F4XL 2LABA 3GMOA 5IBUB 3WHE0 1E3FA 2J8OA 5IFAL 4NN6C 2JKNA 2BCJB 4ONFL 5AOLA 3HCVA 4X9GA 1U4FA 1AS8A 3RJOA 4AJ0A 5CGMA 5JDSB 3FFDA 4FFYA 5DJZA 4XXWA 3DX9A 4DF9A 1I8UA 5IUSA 2R69H 2F61A 1WA1X 4W68A 4ZX3A 4FNRA 3VWKA 4WK4A 5KVFL 4NI6A 4B5ZA 5H94B 4A38A 4JFUA 1T4KB 4P5KA 4XXCC 2WLIA 4ZOEA 3CAFA 4NP4H 4LLQA 4UZUA 5BPPA 4PJHF 1T4KA 4OZFA 3KZ8A 5DD1H 2NNXA 2R59A 4BCBA 1BBJB 3CSGA 3L1OH 3O9WA 4XP9L 3VXOA 1X3DA 2GJ6A 2XV2A 3FMGL 3FOMB 3SE4A 3EQ8A 3NJHA 4QRRB 5IF0B 5GS3A 4BH8A 2AQ5A 2E27H 3NPZB 4CZVA 3MKKA 1CDYA 1Z5HA 5AKTA 3RPBA 5JR1L 2VMDA 3G6JA 2N7AA 1DN2A 3OWRA 1IL1A 3QZWA 4P2AA 3X1FA 3ZE1A 2ZTBA 1FUNA 4JX0A 2AMUA 2VRKA 2GSGB 2Q87A 4DK3A 1HT6A 1AAJA 2WUCH 2EDLA 1JZ5A 3T3ME 2DD8L 4S2SB 4ODVH 1KJ2H 2ARWA 4NNYA 3S8WA 3ZIMA 5E5LA 2O6PA 1PPIA 4AMXA 4KRNA 1EDQA 2BWIA 3BSZA 1RAMA 1K4CB 3H9SE 4CSZA 1NAMB 4U6HB 2NYYC 1X7SA 3GJFH 3GSUB 4HD5A 3GTNA 1CICB 4AM0Q 5FO7A 5JO5B 4HA1A 2ITDB 1UQSB 1WE5A 1IILE 4GUCA 4IRJC 3DARA 1UFUA 3H3KA 1GIGH 4YBQC 1T5WB 2YGPA 4PJ7B 4IDLA 3QNZB 5DQ9B 1J0KA 4M43H 3PF2A 5LBSH 2QSCL 1OF2A 1JUFB 3LQAH 5EOTB 5FDWA 15C8H 2AJVH 2CO2A 2ZKMX 4BZ2H 2X0WA 1A3QA 2Z92A 2R4SL 3IDNB 2OI9C 2HYEA 1I82A 5EIQA 1MREH 1CI3M 1BM3H 3BDBA 3OMIB 3ORVD 4PJFB 2YA1A 2AKRB 3IDNA 2VIRB 5F3HA 2WYHA 4E42A 5GSVA 1HEZB 5ERWB 4YDNA 3CVDA 5T5FL 4H1LA 2AV1B 3RJQB 1PLGL 3ARFD 3LQZB 3UAJC 1KPUA 4WWKA 4UQCA 4P49A 1KGYE 4R4FH 1KYAA 3MNWA 4NKIL 5E0QA 1V54B 5JHDE 1GAFH 3ZT7A 2KC0A 4I0PD 1FVDB 4Y9GA 4HJGA 2ZUQB 2ICCA 1RJCA 2BKLA 4ZQKB 2CM6A 2PR4L 3OKMA 2RA1A 3ULUL 4XI5D 3A6BL 2YD4A 1SLVA 4ZQKA 1U91B 4E41E 3G6JF 4PJGE 4ZMZA 2B7DT 2ICEC 4GSDL 1W0WB 3ZE1F 4ES0A 2XV6B 2OZ4A 1X5HA 3QCTL 5ID0B 2Y6TE 4IDJL 1QACA 2HVBA 3MA9L 2L4OA 3ULVE 1DR9A 4E9LA 1RHHA 3TVMA 4P2RD 3G5ZA 1U93A 3LHAA 1JXFA 3SKOB 2EYTA 1I3RB 5JOPE 1KPRA 3HHSB 1CN4A 1PIFA 3QJHA 4QO1B 2I24N 4DZBB 2A6JB 4DW2H 4R90H 4ZNCD 2WXPA 4I77H 3DHMA 3LS4H 1SDAB 2HFGL 5DS8A 4LP4A 1RUQH 5FK9B 4M8UA 4K23H 4HLEA 1U2VC 4BCDA 5C07D 3X3GL 1JZFA 4OIAA 3DDUA 1FO0B 2O9KA 4YSAA 4Q14A 2G60H 2ZXCA 2MPVA 1OCCB 2A73A 4MB4A 1CGVA 3G04B 4CVXB 3M46A 3E0CA 1XR8A 3TH3T 4MNQD 3NIGB 1H6FA 5SV4A 1BA9A 4XT1C 1XBRA 3AL9A 4U4IA 1EFQA 2FQFA 1THCA 2PM6B 4R7DA 4KOBA 1AOZA 4MXWH 3D5OF 1RLBA 5LGHH 4G7VH 1TKWA 4X5WB 5EOCH 5I5IA 5DJDA 1G1KA 2VDOH 4OD2A 2F54E 2Y22A 3JWOC 1D5IL 2P8MB 3II3A 4X5WA 1JAEA 2Y72A 3KYMA 2BVPB 2MKWA 2MCG1 3I2NA 2OTUB 1HN1A 4Z3JA 5EZJA 4L37A 4POZC 1IGCH 2ZF8A 1L7IH 1X5LA 4N2EA 2ZD0A 1WVZA 4ANVA 2D3LA 5I9QB 3FUHA 2EIBA 3F6IA 4PGCB 3Q9PA 5JIIA 4FNTA 4OZHB 3RSEC 3BEWA 1LDSA 4GG6B 1JWMA 2E8ZA 4P9HC 5EN3A 1E9QA 5SX4I 3V5HB 4DVBA 2IFFH 3EO1A 4HMDA 2ZYIA 4C83B 2K3TA 3L3DB 3AW5A 4MD5A 4OI9A 5I75B 2W94A 3DGCR 4NJAH 4D9SA 1R3KA 1IGJB 1Y1DA 3L5WA 3HFMH 1MVUB 5ACZA 2F6AA 1SMDA 1P1ZA 1IGJA 4TOYL 4WW2C 3K6DA 3JWDH 3H1ZA 1D2PA 4PJEA 1U8KA 4XN4A 3RTLA 2Z35A 2H9GA 3MCKA 1KLGA 3GO1H 3Q8CA 4QKXB 2LFGA 1ZK5A 4MLIA 1RVFL 4UTBA 2HT3D 5CZKA 1QFWM 2EUXA 2CU9A 2WQUA 2XG5A 3PG2A 4LLVB 3TT3H 3ZHNA 2I9TB 3B9KD 3IN2A 2DRUA 2O6CA 1TYEB 4NQDB 2JJTA 3NCXA 4NUMA 1SQ2N 3DX8B 4X6DA 1XEUA 1UACH 3HRZB 4BFEA 32C2A 4DGVH 3JZHA 3Q6FB 2DQFB 5TEEA 3VFWB 1WC7A 4Z5RA 3CFMA 4B9JA 5SWZE 2H9MA 4AYBA 3WJLC 1CXKA 3KPQB 4CW1B 4PEEA 5DZJA 1AGFA 5EDXA 5IBTH 5DUPH 2X4UB 4Z7VA 4J4PD 3K26A 3PDOB 3QI9D 2EDOA 3HZVA 3QQ4B 1RZ7L 3HZYA 4K4KA 3MRGB 4R4ND 5FECA 4H13C 1SMAA 3HW7A 2HRPH 4JM2C 1OTTD 5BUAA 3PDOA 5KJRL 3NSCA 1COBA 4F2EA 5EA0H 1FNFA 3MCLH 1EEQA 4U0QB 1CGTA 4XP4L 3KCPB 3DO4A 3UEZA 4BFFA 3JT0A 5K59E 4KXBA 1ZD6A 4XX1G 1YYCA 3WEXB 3KL0A 3P9WB 5KSBF 1JZ7A 3SCMD 1SN5A 3WV0A 3J07A 3O0RL 3D2UB 4TVPD 1K4DB 1MLCB 2JLLA 4KZCA 3I50L 4TQEH 1XIWD 1A14L 1F11A 1T22A 1T0MA 4TNWF 4XPFH 2UY7B 4NZTL 4ORGB 3VA6A 4AGPA 4EVNB 2DKMA 5EO9B 2RD0A 3FBKA 4C4KO 3ULVC 4ORGA 2E8YA 2YRZA 5BRZB 1F90L 4XOCA 1Z0NA 2E6QA 2BNQA 5GZOC 3QA3B 3ILPB 5KBNC 4KFMB 3VU1A 4HCGA 2CGRL 4MTMA 3HB3C 5T3ZD 3EYSL 3DGDA 1TYJA 2UZPA 2QELA 2AJSH 4G7SB 1T3FA 1T6WA 4A2MA 2V2XA 1NEUA 4BHUI 4OLZH 3CJJA 4ZYKA