5I5IA

Shewanella denitrificans nitrous oxide reductase, app form
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
571
structure length
539
Chain Sequence
VHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHMEMRGRMLVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
total genus 170
structure length 539
sequence length 571
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5iA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5iA01
1IBYA 2CJ3A 3MBWB 4AKPA 2AGXA 4O45A 1MG2C 3AW5A 5HE0B 4HHWA 4F2EA 5FA5B 4CZYA 5EM2A 3GDCA 3DXKC 1BYOA 4HCGA 3I7LA 4X4KA 2Z2NA 3EI4A 2HRHA 4KO7A 3PVUB 4G7QB 1NPNA 3I7PA 5IGQA 4GQ1A 2MRYA 4G7SB 1SJMA 4BXVA 2XXFA 5EMMB 2EILB 3KRXB 2PLTA 4M4RB 2HJ4A 3AL8B 4E9SA 4KNTA 3EH4B 2EBSA 3IEAA 3GYRA 2XWZA 1JZEA 4ZOXA 1K32A 2DWSA 3C99A 5EAMA 5HE2B 3ABMB 4CI1A 1GY1A 1BYPA 1IKOP 1KCBA 4DPCX 1QLEB 3NJIA 1MZZA 1AQ8A 4K3ID 3X1BA 1NTDA 1ILSA 1M57B 2H9MA 3ZIYA 3EI4B 4J0WA 2OIZA 4M3HA 2XVBA 3T6XA 4E9VA 3MXXA 1L9PA 1SFHA 1JVLA 2FJSA 5E9NA 2YARA 1L9RA 4BDVA 1NR0A 1R5MA 3I8EA 2FQDA 3NJMA 3PSCB 4X61B 1V55B 2YAPA 2H6NA 4BH6A 2P9IC 4J8GA 2IAAC 1T5KA 3T9WA 2BHFA 1EZLA 4E9YA 3AH8B 1HAUA 4N4YB 3EI3B 1J9QA 1AIZA 1SHXA 3OM3B 5IT9g 3MKSB 5AMSA 3RFGA 2PM6B 3FU7A 3UABA 3NVNA 4IMMA 4ERZA 2YQBA 1E67A 2GBAA 2AQ5A 3FYIB 4Q8BA 3RYMA 2WO2B 1SDDB 1J5DA 4BDVB 5PCYA 5EM2B 3PAUA 4UF7C 3FQ1A 4GZ8A 3NP4A 4AZUA 3MKQA 3IN2A 3NVQA 2HXCA 3T6WA 2IDTA 1CYWA 2PP7A 3TA4D 4BXSV 1YFQA 2VW6A 2ZOOA 3ERXA 3EU7A 2QDWA 4CSZA 4YSPA 3EH3B 4G72B 1KBVA 3FRXA 2CO0A 5A2Qg 2CN3A 2OK6A 3DM0A 3GFCA 3HB3B 2B5NA 2GSMB 4GXFA 3FSVA 3SXTD 2G99A 5H14A 4LGNA 2AGWA 2EIKB 4BUJC 1E65A 2VW4A 1N6FA 3JT2A 3RLMD 3FYEB 4HZ1A 1ET8A 1J9RA 3FGBA 5IJ8E 4KO5A 4WTQA 4HCIA 3PSLA 4OWRA 2BZCA 1NPJA 4HHGA 4CSPA 1K8KC 4NSXA 4Y7RA 2PP8A 1XKSA 1JXDA 4GP8B 3NVXA 4A67A 4XYHA 3BQVA 5I6MA 1PNCA 1A4BA 4L3HD 1GYCA 4U7AA 3CVDA 1DZ0A 3FSZA 1KYAA 3MMYA 1NICA 1VLXA 4YSDA 2J55A 2XLLA 2P9KC 4O3UB 2QPEB 3SVWD 2FQGA 2GC7A 3ODTA 4QQEA 1ET5A 1TEFA 2HX8A 1KV7A 4UANA 1L0QA 4Q89A 2OJYA 2BO0A 3HFQA 4CY3A 4AKOA 3BWSA 3QJVB 2YAQA 3V9EA 3PE7A 2BW4A 4YSRA 3IBOA 3GREA 2P9NC 4A66A 4QT8A 1OE2A 5FKSA 2RACA 3C5MA 1AS7A 3CDZB 1XIPA 1JOFA 4FA5D 5I6KA 1OF0A 4YSUA 3UADA 4IA9A 3QJTB 1IBZA 4PNKB 3CFSB 3UAAA 3N0EA 5AFAA 3EI2B 1OLZA 1PZCA 3NJNA 1PNDA 7PAZA 2PPCA 1KBWA 3IJCA 2BZ7A 4O3TB 5HE1B 3W15A 3N0DA 1ASPA 5EAPA 4FAVD 3BVDB 5TDHB 3PVWB 3NYKA 1WS7A 2CALA 3OD3A 3SFZA 1OCOB 2X88A 4CZVA 1ASQA 3RFHA 4OZUA 4CI8A 5JWZA 1PMYA 2YXWA 1GXRA 4WKXA 3N2JA 5EARA 5EALA 1PZAA 1J9SA 3CDZA 1AACA 1JZJA 3WNIA 4DP9X 1SQJA 3DWLC 1SHWA 4E9TA 7PCYA 2B4EA 3ZX1A 2UXFA 3V9CA 4KOBA 3GXUB 5D4JA 3SWSD 2E86A 4DP4X 4N8UA 3RRMC 2IWFA 1V54B 2OCCB 5AZUA 3AFCA 1ETJA 4PBYA 4DP6X 1OMWB 1PAZA 4G56B 1RCYA 2P9PC 4X3EA 4N14A 3RSEC 1L9SA 1NIAA 5B1JA 4JSXC 2DYRB 4JT5C 3ABKB 3PAVA 1B9XA 1EHKB 2H3XC 2CUAA 3N55A 4A08A 2GC7C 1NZRA 5I6OA 4HIPA 3QJUB 1UATA 2J55H 4J8BA 3SBQA 1U2VC 3RN1D 1A4CA 1I53A 2BP8B 2XV0A 5GMKn 4AX3A 1MDAH 2IDFA 5FKRA 1PY0A 1GS8A 1GY2A 1ZIAA 2G9AA 1FWXA 4CI3A 2IDUA 2UX6A 5FLXg 2OVRB 1MG3A 4FWWA 5HQGA 3QPKA 1V10A 3SHFA 5I6NA 4L1QD 3JZHA 4JHUA 4FA7B 4CY5A 4YSAA 1AR1B 1F56A 2IH9A 1N6EA 2H6QA 2I3SA 4ES0A 1WAEA 2H9PA 4DP1X 5SXMA 2XU7A 3ASOB 2Y1AA 3WKPA 1BQ5A 1IUZA 2BW5A 3WKQA 1ZPUA 3I89A 4LG8A 1PF3A 2A3TA 3X1FA 4ERQA 1PLCA 2AGYA 5IGOA 4YSTA 1N6DA 1AZUA 2FNWA 4JKNA 5B7EA 2I3TA 3FT0A 3K27A 2VW7A 3K26A 1CYXA 3EWEA 2TSBA 2MTAA 3I7KA 1KDIA 4FHLA 3FSWA 4DPAX 1CUOA 1NWOA 4J0XA 3PAZA 1CURA 1AZRA 2VMJA 1WA2X 2YBAA 5IC7A 4KNSA 3NT0A 4HAKA 2H68A 2GC4A 4AEZA 3SQRA 2PBIB 3B7FA 4QRJA 5AFU3 4JSVC 2HKRA 5K19A 3X1GA 2J57G 3WNJA 4H5JA 1KDJA 2IUQA 4GQBB 3PPSA 1NWPA 2PPEA 4GP4B 3SCYA 3ZDWA 4KO9A 1L9QA 1ZV2A 3QJQB 3TBCA 4EWRA 3JROA 3ASNB 3X1NA 3V9FA 1ID2A 4BWUA 1QHQA 3NSDA 1GSKA 1BAWA 2FQFA 1JZFA 2HXAA 2QT6A 4GYBA 5I6PA 2QXVA 4GGCA 5KDOB 4YVNA 3F3PA 3MZKA 1NIEA 1X9UA 4JHVA 4TXVB 2H14A 5CXBB 2FWLB 2AH0A 2XUWA 4A7JA 3EI2A 4D0KA 2J56H 5D4HA 3VGZA 4E5ZB 1OE1A 2DWTA 4E9WA 4GM9A 4GM8A 1W6WA 2GIMA 3FU9A 4AKQA 1PGUA 3OMNB 2PPAA 4A09A 2J57A 2J56A 3OMIB 1OV8A 5FQDA 4ZOZA 1JOIA 3SN6B 4PC0A 3T6ZA 3VA6A 5ANHA 4NERA 3FSAA 3NP3A 5I5JA 3EG6A 1DYZA 4YSCA 3ABGA 1JZHA 1KGYE 3CVBA 2IWEA 1JZGA 4YSQA 1FA4A 1JJUB 2HJBA 5F7AA 3TBBA 4J84A 2JXMA 1JVOA 5B7FA 5D4IA 2J5WA 4KFMB 5CXBA 4X63B 4GQ2P 1AS8A 3NSFA 4AI7A 3EHBB 2CN2A 3C9CA 1AAJA 4QKTA 1HFUA 3QJRB 1WA0X 4UI9R 3NJGA 4E5ZA 2IUVA 1N70A 2XL2A 5HE3B 3DIVA 2R7EB 1X9RA 5K1CC 5FC9A 4QLWA 1M56B 4YL4A 2BP0A 2P80A 2GNQA 3FQ2A 4EF3A 1A8ZA 3JZGA 5FXYA 4AOWA 2EINB 3UAEA 3EI3A 1QNIA 3IKOA 4A0BA 2YMUA 2ZWNA 4PBZA 4GY4A 3MZLA 1FFTB 1VYHC 3AG1B 4K3JB 3IJ1A 3TASA 2XYIA 3ABLB 4W1TA 3I7OA 4XEIC 5CYKB 2OV0A 3EI1B 2PP9A 1TYQC 3SMRA 1TEGA 3H4FA 2B3IA 1BQKA 1J5CA 2H6KA 5GXHA 2OVQB 1MDAA 2HX9A 2IDQA 5TK4A 2N0MA 2P9UC 3UVOA 1ADWA 5CXCB 4ERYA 2XU9A 2P80D 2I7SA 2YAEA 5B1JC 1JMZB 1XB3A 2BWDA 2H3XA 1TBGA 2AFNA 3A0FA 2IWKA 4RH4A 2YB8B 4J78A 2QPDB 5B1BB 1PI6A 3VH0A 4O9DA 4ZN4A 3JAMg 2JKWA 4J86A 1ILUA 4E9QA 3BG1A 1RZQA 2HZHA 3D12B 4J77A 2HRGA 3F3FA 2XV3A 3DKHA 2UXGA 2BWIA 2YXVA 2B5MA 4HDJA 3PXLA 5H17A 2CBPA 3FPYA 4CI2A 5C2VB 5F7BA 2PM7B 2UZXB 1HAWA 3NJLA 3DTUB 2H47A 2HESX 1L9OA 5AJAA 5FKTA 1YLBB 3RN0D 1AS6A 3JPXA 4P5RA 3IN0A 3C75A 1E5ZA 2BP0B 3MX0B 2XX1A 5EMLB 5GSAA 4YSEA 4L3GD 3OKTA 2DV6A 2WO3B 4MK0B 4ZK8A 4HCFA 4JSPC 1SF3A 2HKMA 1GR7A 3C75H 4U1EI 3T6VA 4BK5C 4JT6C 4YVDA 4A08B 2UZYB 4GMBA 3EH5B 1E30A 2IDSA 5I6LA 4MFHA 3OTTA 2Y69B 4E54B 2B08A 4JXMA 2AVFA 1BEXA 1S4UX 2FQEA 4J73A 4A68A 4A2DA 1P22A 4XYIA 5B1AB 1JMXB 4F7KA 2XXGA 4GGDA 1BXAA 2YAOA 2MTAH 1AANA 4DP5X 3J81g 2FT6A 4PAZA 2AZAA 1OOWA 4K9JA 1SF5A 1BQRA 3IJ0A 4E54A 1PZBA 3JRPA 1OCZB 2ZXWB 2AGZA 1NINA 1XHMA 1AG0A 3UACA 4A11A 2BBKH 2PPDA 2NRDA 3NJHA 1AZBA 2IH8A 3AG3B 3S3DB 3TU6A 9PCYA 3OKYB 2XX0A 1NDTA 3ORVD 1JERA 4FA4D 3G5WA 1E5YA 2VM3A 4I79A 2YNNA 4A0BB 2H13A 3U4YA 5IY5B 3IIYA 4P5SA 4E9RA 5B4WA 1A65A 1OCCB 2XYBA 1PLBA 2PPFA 1WS8A 2Q5BA 3L45A 3WIAA 2CE9A 1ASOA 3FU8A 3S8FB 3PXSD 4A2MA 2IUPA 1J9TA 1SNRA 3FM0A 1A0RB 2YAMA 3SBPA 2PM9A 1SFDA 6PCYA 3J80g 1B3IA 3JTBA 2GC4C 2AZUA 3I7NA 3DXMC 4J81A 2H9LA 2AH1A 4A2LA 4CY1A 3WI9A 1SQ9A 3OKYA 3QQXA 1R1CA 4X60B 5CXCA 5I5IA 4L9OA 4ESGA 1TKWA 3OW8A 4FA9D 3FQYA 3U25A 1OE3A 2BP8A 2XV2A 1XB6A 4FAND 2TSAA 5I5MA 3CZUB 5TEFA 5GXIA 3UR4A 1RI6A 1BXUA 1JXGA 3EMHA 4DP7X 1ERJA 4J79A 3L4MD 4L0PB 4G71B 3EF4A 4BWWA 2GHZA 6PAZA 1JXFA 1OCRB 3DSMA 3RMZD 5TF2A 5THAA 4NB7A 3SBRA 4GP5B 2YAFA 3AZUA 3X1EA 2CE8A 2B5LA 3NSCA 2QDVA 4NAJA 5B3SB 2GB2A 2HLEB 4A2HA 2I0SA 5H1MA 2H5UA 2Z2PA 4A0AB 2CO0C 4GGAA 4A09B 3OL2A 4DP0X 1GS7A 1GW0A 2IAAA 1NEXB 4FAAB 3IIWA 4BL0A 3UVMA 5IJ7E 1URIA 2H9NA 2UXVA 4YSSA 1A3ZA 4W9ZA 5LDUA 2I0RA 2I85A 2HYEA 2GI0A 3UVLA 4KO6A 2DYSB 2OK4A 1A4AA 1ET7A 4UAHA 3I7HA 3NJKA 4Y5RD 3UKUC 3F3GA 3S8GB 3NJFA 3NJJA 4A2GA 5CYKA 3P4FA 4TZ4A 2FT7A 1L9TA 4CZXA 1RZPA 2YNOA 3NSYA 1RKRA 1JZIA 1XB8A 1PBYB 5PAZA 1SDDA 1SHYB 2BCJB 2Q7QA 2I7OA 4R7AB 5EMKB 4J82A 3OL2B 4O1QD 1CC3A 1IC0A 2Q9OA 2X87A 2PM9B 3I2NA 3X2QB 4JD2C 1MG3C 3ZWLB 3H4HA 1GG2B 3AL8A 4E9XA 4QL1A 3SLED 5C9ZB 1AZNA 3CFVA 5TK2A 2W88A 3AG4B 3AL9A 3KRWB 1W6LA 4PSWB 1AOZA 1NIBA 1KCWA 2OVPB 1U4CA 2PCFA 4KNUA 3S3BB 2CNXA 4CC9A 2IURA 4ZOYA 3FS9A 4ZOVA 1TU2A 3T71A 2P9LC 2ZONA 3UVNA 5FKQA 2WSDA 3QJSB 3V5WB 1NIDA 2DY2A 2LLNA 1W8EA 2VN3A 4A11B 4LG9A 3UKRC 1BXVA 3WG7B 2FT8A 1MG2A 3ULEC 3JB9L 4Z8LA 2UX7A 1PCSA 3KW7A 3ZBMA 1GP2B 2P9SC 2W18A 2YNPA 2H47C 3SJLD 5A7EA 4F2FA 5EMJB 1NIFA 2CCWA 4A2FA 1AG6A 1ZIBA 3FU7B 8PAZA 3IE9A 4DP8X 2CAKA 1Q47A 5HYNB 3OQRA 4PCYA 3EI1A 2EIMB 3PCYA 4DP2X 3BG0A 1PEVA 5B1KA 2VM4A 3PXTD 1GOTB 5TEEA 3FPXA 4DPBX 4A2EA 2FTAA 2XL3A 4HALA 2OJ1A 2W8CA 4ENZA 2I0TA 2Z2OA 1B9YA 4CY2A 1N68A 1ZDSA 2R7EA 1XMEB 5EHFA 5I26A 4YVUA 1WA1X 3AY2A 3CIKB 3I8CA 3PXWD 4J87A 4A0AA 4D6VA 2UXTA 3H56A 2TRCB 4FB1D 1M9WA 2EIJB 1AZCA 3PLYA 4YSOA 2QC5A 5C2WB 3S3CB 4PXWA 1PLAA 3AG2B 2AGLA 5B7MA 5AKRA 3CG8A 3UVKA 2YAHA 4G70B 1GS6X 3OMAB 4H5IA 2O9KA 3V7DB 4FA1D 4JSNC 2AANA 2VSKB 5I28A 3JZNA 1ZDQA 3UGEA 1MZYA 2JFCA 3OKWA 3L4OD 4GM3A 2HX7A 2PCYA 3KW8A 3E0CA 3CVCA 3HEIB 4PSXB 2VSMB 4KOCA 4G7RB 4BWTA
chains in the Genus database with same CATH superfamily
1HSBA 4HLEA 4AKPA 3LSOB 4R83A 1AGEA 1OGPA 2G9HA 5ESAB 3MRHB 1M71A 4AC2A 1SY6A 5GJSH 1HIML 4HCGA 3QXDA 2E56A 2CM6A 4IHOA 1UZ6E 3FT4A 4JO8A 4PLJD 5ENWB 3I50H 1HHIB 2AJZB 3VCLA 3QQ9D 1GL4B 2Q3ZA 4FTVA 4G7SB 4ZUUB 3TN0D 2VMDA 4I1PA 3MODH 2Z7WA 3B9AA 1OK8A 2NX5A 2BWQA 3RTQB 5HI5C 2W94A 3X12A 2I5YH 2NX5D 1EHXA 3VXPA 5JYMA 2Y6SC 4Y2DD 2K70A 1ZS2A 2G4EA 3NTCH 3NJIA 3F12B 3EI4B 1AY1L 1M3IA 3ZRCC 1FHGA 2AGJL 2N1TE 4MA1B 5T33L 4PJ5B 1WK0A 3IGFA 4E9VA 3B43A 1L9RA 3QDGD 4X6FA 3X3GH 2VC2B 2LTQB 4L1MA 1N0LB 2YK1H 4J8GA 4Z7WF 1KULA 1NCOA 4PS4H 4WVRA 3NCXA 2E9GA 1D9KC 3CDCA 4F1SA 3CLFL 3DX4A 2PKDA 2B1HL 1MCJA 2COQA 1YJDH 2D7NA 3P0VL 3SIKA 5AMSA 2CMRL 3RFGA 3QQDA 2Z92A 3V5HB 3WJMA 3U9PL 43CAA 1T03H 1NAMH 2AQ5A 5DGRA 3E8VA 4ZD3L 3QUYD 2WZPA 1AHKA 1QBLL 3MKQA 3GMOB 2HVJA 4GRWB 5DZNA 1WEJH 1B3JA 4YDKL 2PP7A 4LLWA 1L6ZA 1F6LL 4PJBB 4DFIA 4KI5E 1IGMH 3FRXA 5L7XL 3THML 4NO5A 1Q1JH 3FTVA 4PJ8D 2ESVB 1XBRA 2HU7A 2YUZA 4HPYH 1UGNA 3VRLE 3DGGB 3LZFL 1IBDA 5H14A 5GSVA 4L9LA 1LVEA 3RVUC 3ZDYF 1ZA6B 5CD5C 1BWWA 4MS8D 5B8CC 4HZ1A 3GZPA 1FUNA 3QIBB 3UO1H 2VXSL 5H94A 3GC3B 2A4CA 1YCSA 2ATKA 1N3NA 2PP8A 3WGUB 3K6IA 4GP8B 4TNGA 5F8RC 1EAQA 3K6NA 4L3EE 2D9QB 2NZ9C 1MFDL 2QVFB 4LDOB 2DYPD 5G2NA 4MB5A 3PWVA 1VFAA 4O3UB 4TPRH 3BRFA 1SOKA 1JFQL 1YEJL 4WY7L 3MRDB 2BO0A 1HOEA 1W15A 2UVEA 2VJ8A 3CSYA 4JFQB 4JY5L 3QCTL 4KHXH 2NZIA 3F7VA 3V9EA 4MSWB 3CFCH 4TNEA 4AZ8A 3IXAB 4HQQL 3VQLA 2BIQA 2WWMD 1XGQA 1U42A 2Y36H 2FO8A 2O72A 4LVNC 4P06A 2R0WL 1NM4A 3JWNG 5J12C 1A4KA 4ODVL 4OM0L 1OF0A 1QEXA 2GW5A 2Q7AA 3T1FB 1L7TH 2EDWA 4PREB 4G6ML 3HS0C 1Q0XL 1JZDC 4EXKA 1LEGA 3CVHL 1I1RA 1PEZA 2IAMD 1JK9A 4L3EB 1ASPA 3CFEB 3L5XH 4AL8L 5B39B 4OI8A 4Z7OA 1ND0A 3WFBH 2X88A 4OLUL 4WU5B 3P77A 2OXHA 4W6YB 1K3IA 3E8UL 5IFJA 4K3EH 5L6YH 3TVMB 1JZJA 3BPNB 5M61A 3F00A 3RZCB 2HT2C 4TN9A 4TRPH 4G11A 2G3ZA 4I2XE 1ETA1 2OCCB 4GKSB 4N2HA 5C0ND 1YEHL 4K7PX 2QVTA 3F04A 3M8OH 4ZAKA 3QHTC 3EO0B 1PZDA 1A22B 3X3FH 1CFQA 7FABL 3FN0L 3GJFH 3NIGF 1HEJC 3ZZ1A 3HI6L 4E41D 4NLAA 3PHQA 4JO5A 4ZFQA 3BPLC 3IRPX 1T04B 3CBRA 4LFHD 1NANH 3D3VE 5J06A 3W9DA 4PGEA 4DQAA 5FKRA 3DUSA 2VR7A 4JG5A 4X8CA 3P9MB 2CO3A 2OMYB 3KWVA 5KSBF 4PB0L 4KTGA 1WBXA 1MCHA 4JHUA 2BJMH 4D0DB 3J07A 3FO0H 3GMPA 5DRXB 2X6VA 2XSKA 2ARJQ 1UD5A 2KERA 3HI1A 3HG0A 4DIXA 4HULB 5LKNA 5CCKL 4GAAA 4CSTA 3BN9D 5J3HD 2M8XA 4XP9L 3IJYB 2AKRB 3LKRA 5DUBB 2YD6A 1KPVA 1KIRA 5KANI 3ULSA 1CURA 5L8LB 4CU6A 4HAKA 4EOWL 2H68A 2AJYH 1GXEA 4C47A 3TF7C 1Z1WA 3QJHB 1IGIL 5FLUA 5F96L 2A77H 2XETA 4MNQB 4FL4C 3QDJE 2PPEA 3IDJA 3LS4L 1FH5L 3BVNA 5FGCE 3STBA 4MCNA 4XNQA 4FCAA 1ORQB 4BGDA 5FO7A 3ASNB 3Q2NA 5I6PA 3VXSA 2WBJC 1HU8A 1CYGA 4MHHI 4BSWA 2VABB 4ORGB 3ARUA 2CM5A 2WGXA 4D0KA 4APQB 3VGZA 1RZ7H 1WGVA 2V8LA 1IBGL 1J11A 3BLKA 4FXKC 3ZE2F 3ZTDC 1BZ8A 1PGUA 1IGYA 1U2CA 1PDKA 1LDPL 4MDJA 3T6ZA 3K1DA 3GNML 2XZQH 2H6OA 3C5ZC 3FSAA 3N44B 4HSQA 3SJVD 3WIIH 2OW6A 4WJ5A 2HJBA 2C26A 1VEOA 3KLAB 5EZOL 4LDCA 2ZNWA 5T5FH 4ACTA 5KVDE 2KPWA 3PP4H 4KFMB 2B15A 4GQ2P 3TBSB 3WBDA 3EHBB 2HCZX 3OLIA 3ULUD 3O3UN 4ERSH 4GQZA 1Q94B 4W6WB 1RP9A 3DIVA 3QB7C 4NQSB 1JF6A 3E9TA 3B9VA 2CSPA 3K4ZA 4BCZA 2VXTL 3UIYA 4AGPA 2VLME 2WWKT 3S97C 2KZ1B 4ONFL 5CGBA 4OLZL 3SJVB 4EKJA 2V7NA 4PLJC 3QZWB 2Z92B 3WJMB 2YMUA 1MHEA 4NKQB 5AW3B 2XNAB 3CPLB 5E8NA 3I7OA 3WNPA 3CVIH 2B8OT 3QISA 2ZKYA 3L95A 3CH1B 1A14L 2A6JA 4N6RB 2NW3A 5DCCA 1MDAA 5DJ8A 2XY2A 4LLWB 2IDQA 3WE6A 2EVHA 4OCRL 3C6LD 4KJQD 4IM8A 2K3TA 3EJJX 4TTGA 3VWKD 2XG4B 2DS4A 4AEEA 1FN4A 2NSMA 2D3VA 2M1KA 1GPOL 4FLSA 1IIKA 5ABZA 4R4ND 4Q4IA 4DGUA 4G8GB 3DKHA 2WZ5A 1QP1A 3L08A 1PJ9A 3L3JA 4QTHB 2QGDA 2ZP0T 3D48R 1CZ8L 1MI5A 2LAGB 1E9QA 2VDKL 3VXOA 3P9LA 4WFGE 2HKAA 1QFUL 4Z0XA 1JV2B 2ENQA 3L2LA 1IQWL 3TO2A 3BFOA 4PBVC 1UUSA 1HEHC 3INOA 4GRLD 3BIAX 3N43F 4WQOA 4ZNCD 1EGJH 1T1ZB 5DO8A 4YXKL 3F2LA 3DJTA 2Q6WA 2CO7A 1H8LA 5C08B 4AQAB 1JFQH 3JTSA 5CLYA 1E30A 2IDSA 4NKMA 4XCCL 1TNMA 2E76C 1NCCL 3FCGA 1O9WA 4KTYA 4J73A 4BFIB 1EXHA 4DKDC 4XNBA 4YFLI 4P2RB 1YAIA 1AQKH 1CD9B 4OCYL 1DTUA 3NZHH 3O2WL 3UTSD 2JCCF 5SV3A 1DCEA 1QA9A 3JWNE 5GZNC 1BEYH 1NAML 4F3FA 5AG9A 1BFOB 3AREA 3ZE0B 5IMMA 4ELMA 3AG3B 3OJDA 1NDTA 3PYCA 1OOAA 2VR5A 3CXFA 3RNQA 2Y6TE 1IO4C 1G9NL 2PYFB 3HKFA 4JN1H 2H6UA 3WD5H 2YNNA 5KTEH 5IY5B 1EDHA 5I0ZA 2JKSA 3V4PA 4KK5D 1PLBA 3GKWH 4B96A 2QVKA 5K59E 1BMZA 4LCYB 4M6MH 2BINA 5EU3A 5KSBB 1XH3B 4QUOA 4I9WD 1RHHB 4LO9A 1HCYA 3B8YA 3MXVH 5F3FA 1CGUA 1B3IA 3DIDA 3PHQB 3U4BL 4PJAB 5MI0B 4OD1H 3RY5A 3ZDXA 1CE6A 2NYZA 1T04A 3FQYA 4QOKD 1XCXA 4WUUD 3FO2B 1J0HA 5CS7A 1UB6A 4PH8A 1G4MA 3X11A 3D7PA 4YDNA 1U92A 3GB7B 4FQJH 5KVEH 4GP5B 4KHXL 4A1RA 2HLEB 5GIRA 1VFBA 2I0SA 5CBAB 1GSMA 3QHYB 1R17A 1JE6A 3K0YA 2R0ZH 1I3GH 4NQCE 2XVKA 5I82A 5T1LA 3ZKSD 5J13B 2VT0A 2AKRA 3LKRB 5LDUA 2HYEA 2Y5EA 3C08H 5CXPA 5BW7A 1KPVB 5BZXA 5E6UB 3TJHD 5J0BA 3BRDA 4ISVA 4JRYB 5EU6A 2VIRB 1LO0H 43CAB 2FT7A 1L9TA 4Y2DB 4CZXA 1CS6A 4F7MA 1KN2H 2F58H 2NX5E 2QZ5A 2R2HA 3NAAH 4KJYB 3BVNB 3KR3H 3VXMD 4XNQB 2BX5A 3ZE2B 5DD0L 2JLLA 2NCEA 1HE7A 3HRZC 3VRIA 5ABDE 2DWXA 1R3IH 3UJJL 3D07A 1PG7W 2NOYA 1CK0H 3FKUS 5D1XC 5FYKU 1TJGH 3N44F 1ZLWH 4MZ2A 5HHVL 5I15H 3NEXA 4FHKA 5FYKE 3REVB 1MCCA 3SDXB 1MCSA 2VXQA 2AQ1A 4KTDH 3JB9L 1WT5C 5JW3L 5BRPA 1U3YA 1J88A 4EIBA 4YL9A 4HBQA 1U33A 3VQ2C 1BAFL 1KLGA 4F80A 3I2CH 3VXMB 4YHLH 4Z7NB 3OQRA 3KLAA 1PPIA 1PEVA 3GXPA 4LL4A 5HGHA 3KLHD 2JIXD 3MRDA 3VFVA 4Z7IA 5L2JB 2XPYA 1S7QA 2FTAA 2NCMA 4KPHH 2EDFA 3DGCR 2OJ1A 1Q94A 2GIYA 4PJHB 43C9B 1FQ9C 3EDEA 3LEVL 5DZJA 4CY2A 1FVEA 1RZJC 3NCEB 1LD9B 3BKYH 3KXFA 3H56A 3MV9D 3KWWA 2P5WA 5T3XL 1H3GA 3IB4A 3ULAB 3GZKA 4G7YL 1A4KB 4PRID 3S96A 4WWKD 2YN3A 1Z0MA 5B38G 2YAHA 3QZWA 4WI3A 3DX2A 2CA3A 3PWPA 1HYSD 3HZMA 4M61B 4RMTA 2XI9A 4FJZA 5CP3H 1HOCA 4PYGA 1PKOA 5L8JB 1VESA 5I1DB 4WU5A 1KIPB 1KJ2B 3KW8A 4G9FE 3E0CA 3UG5A 3LYRA 5D71L 3DVIA 5GRJL 1SVBA 4WW2B 4ZW3A 5TF1L 1A02N 2MPAL 4R84A 3MJ7A 3RIFF 3FT2A 3WTTA 2DQTL 3BAIA 2X4PA 2CGRH 4QXUH 4L4TB 2VDQL 1CQYA 5I1HL 4IRJD 3T3ME 5ALCH 1EJOL 3ILPB 4H44C 1XCQA 1AIFA 4QKXB 3UTPD 3AB0C 1RZFL 1FZMA 3FB7A 1GKEA 1IC5L 1KLFA 3KAAA 1H2YA 1XH2A 2GJ6A 3K71B 2B59B 5FO9B 3DUSB 3O3DB 3ZT7A 2AJUL 2FBJH 1T1ZA 4OZGF 4TSBL 3SYQA 1NOLA 5CILH 5A16A 2VISB 3RUGF 5E9NA 1NR0A 2ADJA 2IH3A 2P8PA 4HDIB 4HXAH 4NKIH 3WS3B 2XT1B 3WO3B 4B5EA 2BHFA 3TA3A 2BS9A 3SKJL 3WV0A 5IQMA 3HCVB 3IJSA 4KMTH 4KK8C 5HGBA 1P6FA 2K7QA 1GOGA 5IT9g 5IB2A 3BCDA 3KVPA 4N0CC 3IKKA 1PG7X 5E70A 3I2CL 3QZBA 1YMMB 2WO2B 4G42A 5JQ6L 2P3YA 3QDJD 4IS6A 3WOVA 1TIUA 3FQ1A 4ECNA 1JZ6A 1OTTD 5JHDB 2O4EA 2ICCA 3DSFL 5KEZA 2WINB 1ZLVK 2QZPA 4NBXB 1YFQA 3IS1X 2BMKA 4CSZA 3BI9X 3P30H 1DBJL 2IAMB 2UZXA 3A5VA 3H85A 5FYJE 4YAQA 2B3RA 2J8UB 5LO7A 3OF7A 1OM3L 1WZAA 1HVXA 5D1XA 1KC5L 5AZ2L 2B5NA 2A0LC 3W56A 3UC2A 5T1DH 2VW4A 2FO4B 2XWCA 3OJ2C 4JX0A 4YHZL 3EZ8A 1UM5L 1YPZE 4AQ8C 4PRPA 3DI3B 4HCIA 5E6YA 1QVOA 4NSXA 4K8RC 5I8OL 1KN2L 2F58L 3QDJB 4Q58C 5FYJH 3NPSC 3N9GL 3KYOA 3BQVA 3OC5A 5TDOA 4M5YH 1A4BA 4L3HD 3KGTA 3QS2A 4TUKL 1ECYA 4HC1L 1Q0XH 1A6ZA 2X4QA 3BVVA 1KTRL 1UB6B 4YSDA 4YNYB 4A7GF 1G7PB 2X4TA 3KL0A 3HB3D 5D5MF 4NRXA 3KCWA 1NC2B 5AALA 5JOEA 4DGYL 1BIIB 3U7YL 4S1QH 2R0ZL 4U0RB 1YO4A 3DV6A 4LLVA 5GIRB 2EE3A 1KGCD 3FCTB 1T0MB 2BVTA 2P46B 1G6RA 3C5MA 2ZCHH 4P04A 4PCKA 1V05A 2A9BA 4AVHA 3MCYA 1H3VA 5DVPA 4HMCA 4P4KD 3DYOA 1CXFA 3BP7A 4UIMA 2YEQA 3DPBA 4XWGL 2J7LA 1FAKT 1FDLL 3TEZA 3QQ3B 2ERJC 4FKHA 1F18A 4P3DB 2XNAA 3CPLA 5C09D 4CI8A 5JWZA 1MHCA 1U8JA 3VSUA 3ZDYA 3L95B 2MHAB 4KJYA 1G1YA 4NBMA 4PGZA 4Q0XL 4D0BB 5FDWA 3D33A 1EMTL 1PZ5B 1VZGA 5ID0B 3ZE1A 5IREA 3MLPA 1DBBL 1I8KB 1PG7L 3HNVL 2BSDA 3WSQL 3DHJA 2BVOB 4WKZA 3UTZA 3ULUE 3GSVA 1OMWB 5I71C 2XG4A 4Z3JA 2Q20A 2NY3B 4TUOA 4N14A 4N8VB 4IRJC 4ZI8A 1FGVH 5ISZA 3ZR6A 1XSIA 4MJ4A 5E1AA 3ZE1F 4ZS7H 4J8BA 3WL9A 4S0HA 2XV0A 1LEKB 4QTHA 2AK4A 1L5GB 3F6LA 2H8PB 4M02A 1PD0A 4CI3A 2UY6A 5AOZA 4GT7A 4PSPA 4AGQA 3EGSB 4Z7NA 4X2UA 3WFZA 3RI5K 3CZGA 4RAVA 3OG4B 5C0BE 1X5KA 4JFUA 5HGHB 2IH9A 3VJ6A 1R3JB 2H9PA 5AVZB 2M83A 2XU7A 1NUGA 3ASOB 1PX4A 2XACC 3PY9A 1WSST 4UV4L 3TF4A 1TDQA 3GJFK 2IIJA 4LPTA 1GZPA 4EI6A 5I6XB 4LMQE 2XCMC 3GMQA 3DIFB 1CYXA 1E8MA 2CDFB 1J7VR 4AM0B 1NAKH 3UTQB 2PCXA 2R2BB 4M61A 3LHPL 4IOSA 5EPMA 3QZWG 1GAFL 4MASA 3DVGA 4XO9A 3MUNA 5KSUA 2DLFH 3HLKA 3OAWA 4NQCB 1ZV2A 1EEYB 5M5TA 2HKHL 3O45A 1JTOA 4OQ1A 3FQUA 3OJDB 4ZUWA 1CXIA 4UCFA 5IHUH 3VI4E 3G6AA 1WAAA 2P5EA 1NIEA 2AXFA 4R2GD 4ZZFA 4Z7OF 4Z7VE 2AH0A 3EO9L 2CJUH 1MEXH 2MKLC 1WEJL 3PWUA 1NQBA 1UOLA 4NHCH 1NBVH 2QR0B 5KSBA 4NNXA 3MRCA 3T8VA 3PNWA 4MA3A 4NKOA 1IAIL 4JGMA 4JL2A 2P43B 3VXTB 5L8KB 1I8IA 4NC1C 1T4WA 1R0AL 4PP1C 5ANHA 2V8MA 1GC1H 2BIIA 1OVZA 5ACMA 3A3YB 1R5WA 2P8LA 1DVSA 3NFSL 4MXWL 5FGCB 5JOPE 5J57B 3PUUA 4GW5A 4LFHG 1M7IA 3WNOA 5CXBA 2QFPA 4S0TD 1PX3A 1W2KT 3UG3A 1QRND 4QKTA 2VISA 1NUFA 5TE7L 2JJWA 3CMOH 5ICYA 3DECA 3BP6B 3ARGD 5EBMA 4KRPC 3QDGB 1BLIA 4MZIA 3UCQA 1J48A 1KCRL 3RJDA 2A6DA 3IJSB 4KVNH 1S3KL 2V33A 5D5ME 4F5CE 2CDGA 4AVKA 3AXIA 4KAQH 3A6BH 4K3JB 2WB1A 1LK2A 3IJ1A 5TDPB 2D0GA 2YPLD 3HI5H 5F1NB 4JRYA 1I75A 1QTSA 3SPVA 4BQ9A 4FXGA 1DVFB 3MV9B 1TEGA 5I8CA 3WTSA 1LO2H 4GG6E 3MSPA 4IKIA 4QXTB 5E8PA 1C5CL 3G04A 3VW3H 2Z8SA 4LPUA 3H54A 3AREC 4BQ8A 2BMKB 1INDH 4YR6B 1DSWA 4C56A 2IADB 2F1EA 1WHPA 4IBTA 5DHMC 1KMGA 3A0FA 2XN9D 5I1AA 3VRIB 3EYOB 5IZ7A 1ULVA 4XBEH 3W82A 4XAKE 4Z7QA 4ORZC 4LF3B 1U91A 3O4OB 3RDTB 2KT6A 2A77L 2FBJL 1DVFD 3DTUB 5DLML 4AC4A 4M3KB 2WXFA 1NCDH 1T21A 3OB0K 4YHLL 5T3ZH 1UQSB 2F7PA 4OCWH 1ZS8B 3EYFA 3VFSA 1I1CA 2VC2H 4IOFD 4L8BB 1DJXA 2N56A 1VE6A 4ZK8A 3CN1A 4LNRB 3SDXE 4EN3C 2WQ8A 2ADGA 3QUKB 4HFUH 4UAOC 3WO4B 5C0CD 1T89C 2AHIA 4OFIA 1F4XH 5F9WB 4I5BB 3GI8L 1XL4A 4M8RA 4UQBA 2HA1A 4G55A 2ROXA 3QG6A 4LMQI 1G6RB 4NHCL 3O6FD 4D94A 5C6WH 1KEML 3R7RA 3L3KA 2BJML 3HRPA 1NC4B 5I74B 4Q6KA 5DD0H 3RGVB 2P5WB 2TRYA 2WD0A 3L7EA 2EZ0C 3QUXB 1JGEA 2RB8A 1XGTA 4ONHA 4N2LA 5D6CB 5E8EA 5FOBA 3D9AH 5A6IA 4ODBD 5FECB 3AGVA 2YWZA 4F7PA 1ZOXA 2XX0A 3K6FA 1CD0A 3OX8B 4R3SA 4YFDB 5IVZB 1VZ3A 2JKNA 5DR5L 3CXHK 3RTQD 3ZE1B 1TZ8A 5ID0A 1I8KA 3UL4A 4AK2A 2PPFA 3RNKA 4F92B 2XRAL 4N2EA 3PS6A 1QFOA 1KCRH 3CJJA 3CSBA 5DLLA 4XXCA 4HPOH 2YZ1A 3L5WB 6PCYA 4YDLC 4YQXH 3V95A 2FCBA 2YA1A 4CY1A 4DVRL 1OTUD 1V3KA 2K6YA 4NPYB 2EE9A 2YD5A 1R3LB 2I07B 4ZFOB 4FNSA 3BIBX 1E42A 1R5VA 2TSAA 4MB3A 2WVVB 3D30A 1MFNA 5JHLA 3HUJA 4HU8A 4L0PB 2B59A 2GHZA 3C6LC 2IQ9L 1QRNE 5EU4A 3FOLB 1A7BA 1T7ZA 4OVUA 5B3SB 2A1WL 2XN2A 1Q0YH 2XTLA 4E9LA 2GFBB 1IAIH 3FFDA 2EH7L 2AAAA 1C16A 5A3IC 3LXBA 3CIQA 4ODXB 3CZNA 3WY3A 4MJ2A 4FAAB 5FGBA 5EEXA 1R3IL 4YSSA 3HUJF 4BUGA 3L4VA 1OO2A 4UAHA 2YKLH 4KBPA 4OZHE 3F3GA 2FGZA 1ZHBB 4LP8A 5CYKA 5E6SA 1DQVA 1XMWA 1QW8A 2DZEA 5IB2B 2H26B 3W11D 3VRLF 3PU7A 4MB1A 5C3TA 4WJKB 3NSYA 5B38B 1JN6A 1RKRA 2DMHA 2HKHH 4RFNB 4XOEA 3US0A 3UBFA 4CKQA 4JFTA 1BZQK 1RPQA 1PKQA 3LHPH 4QL1A 3SLED 1EX0A 1AZNA 3MV7B 2OVPB 5I8KH 2G3XA 3ETBF 8FABA 2GCYA 3FS9A 3MHZA 5LNEA 4PWEA 2AXFB 1IT9L 1TU2A 3ROOA 3JBG7 4X5WA 3H7BB 3U36B 1DQLH 1FVDB 4U4BA 3GS7A 1QEWB 3VFRB 3FAWA 4JPSA 2YQGA 1TETH 3EJYC 1N12A 5ESQA 5JW4N 2WQXA 2ZSVA 4EN3D 1KJVB 1SMAA 4X42A 3E1F1 4M1GL 4Y4HC 1S7RB 4P2RE 1MQ8A 2KQMA 4X4XA 3W0WA 3RFZC 2O6FA 1EFXB 2VM4A 1G7PA 2AXHA 1YPZB 2X4TB 3APMA 4JKPH 3EYVA 4OJFL 1U3JA 1S9VB 1C08A 4PPTA 3RILA 5F7DB 4D9LL 4MJIB 1I1FB 3BW9B 3WHE0 2BZDA 5ICYB 1OTSD 3AY2A 4ETQB 1WWBX 5TH2B 4D6VA 2VDLA 3VXRB 3ZL1A 5AD0A 1BGXH 1RJCA 3GBDA 4G8AC 5B7MA 4HWNA 1F58L 3WXVL 5FHAL 4U1HB 2ZZUT 4G8FA 1BFTA 2VSKB 1UENA 5TDPA 1AGBA 1O6GA 3PUCA 4YXHL 1ITCA 5C0FA 3QUZB 5KBLA 3TEYA 1A1MA 1BVNT 2PXYA 2PCYA 4G8GE 3EBIA 3NZHL 4CA4A 2KZWA 1B0RA 1ZLDA 1AQDB 5GRUH 4NC2B 3CZFB 4EZKA 3SDYL 3GSRA 3TBYA 2WYIA 3MZTA 4OKVB 4HCRA 3QI9B 2CLZB 4TNVK 2ZCHL 3ZPDA 1WZLA 3IRZA 1TJIL 4LF3A 2OR9H 4FZEL 1P7QB 4XO4A 2G5RA 4HXAL 1YMHB 3QEHA 3ARBA 5F89A 2KQNA 5DJCA 1ZKAA 4KKQA 1ACZA 4GUPB 4HJGA 4PCTA 2PWGA 4OM1L 2LHAA 3BGMA 5BVPH 2UY6B 2EACA 5IWLC 4ODTL 2HT3D 2J72A 4J8RA 3WHXB 1U58A 4M8QB 4K3ID 4ZPTB 4EN3A 3BZ4A 2NLJA 4Z1PA 2ADGB 3UZEC 2OR7A 2WMPA 1D5IH 1JHTB 1Q38A 1O6SB 2FJSA 4TNFA 3BIKA 5C2BL 5GISH 1BD2B 4LLMB 2K7PA 1AGFA 1ZV5A 3Q6GL 4CVZB 2P9IC 3QRGL 2IAAC 5CJ5A 3QEQA 1UM5H 5F6IC 1NSNL 3D05A 3L3KB 1A4JB 4I3GA 1OSZB 1AFVL 3NCFB 3OM3B 2I69A 4Q6IB 2PM6B 2CXGA 4F33A 4L8CA 4JFSA 4NQEE 3NVNA 1H6UA 4GXUN 4PRBA 3RYMA 3W81A 1KZQA 3D85B 1X5XA 5FUZH 2H1PL 2WGNB 4N2MA 5GZNA 4K73A 4ZW7A 3LH8A 1MNNA 1BMWA 1JV5A 4LSUH 1ZLWK 2DDQL 2FD6L 3MCKB 3O3BA 3QJZA 4XCEA 1EEYA 4DESA 3PGCB 3DM0A 2X0WA 4ZUWB 4Q4EA 4QTFA 3ZTEA 1OPGH 3ETTA 2FZ3A 3BSZA 3TESA 4D8PA 4E42B 1NKOA 4AMYA 1MUJB 3QORD 4JRLA 3B83A 4Y5YA 5BS0E 1XVSA 3JYBA 3E6FA 2HWZL 3PWUB 4MVBD 5DUJA 1I82A 1JXDA 2BFVL 2DQGL 4A67A 3OPZH 4M5SA 3T2OA 2X10A 5JA9A 1UWGL 4XOBA 1KYAA 5IGQA 3L1GA 3GF8A 3SGJC 4RE5A 5CJBA 3N0AA 5CEZD 2FATL 15C8L 1KCSL 3MJ9A 4JKKA 2C3VA 4CY3A 1NCBL 4Z7UE 3IBOA 3L48A 1KCVH 3EH1A 2PR4L 1U3ZA 4GI8A 4IKJA 5JW3H 4QT8A 3UROR 2GFBA 2ZXGA 3FFDB 1ACCA 4YIQB 1XF2A 3SOBL 1JOFA 3STLB 5JW5B 3GHPA 1A7OH 3FUEA 1M7DB 5F9JA 1PNDA 2BZ7A 3S8WA 2IXQA 3N0PB 2EDKA 3BAYA 5T3XE 4HK0B 2CIKB 1IGTB 2XXMB 1I1AD 3O3AA 3P0YL 1KJ2H 3D34A 4NJ9L 2OMZA 5D1QD 1FI8C 1RZJL 3FUKA 4UDTA 1J9SA 3SPVB 1I9EA 1QFWL 5A2KH 5MHSD 1WZ1L 3BDYH 2B4EA 1RY7B 2WO4A 3VI3F 3B3IA 2B77A 1UWEL 4XVSL 4Z8FH 4PY8I 2BOCA 5E56A 2Y7LA 2DEXX 5D7SH 1XGPB 4G9FB 2R39A 4RQQB 4XP9H 5AYUL 3OKNB 4OCXH 4XNUH 1EBPA 1MCDA 2IQAB 4PVNA 3KM2A 1NFDA 3D3VA 1L9SA 1RURH 3VU2A 4JFYB 4YO0B 4LOEA 4A7GA 4OZHA 4WUUB 1FVDA 1NZRA 4Y1AB 1AKPA 4JO2L 1N0XL 3WEAA 1QFPA 2IG2L 2UZIH 1ZAGA 3AXLA 5IW3A 4F58L 3MFFB 1JNJA 2APWA 4XZUA 2VO8A 3V5KA 3TYFA 3LEYL 3HI5L 4GQRA 2JVUA 4Y4HA 4PWJA 4DNVA 2NYYD 3W0WB 4FA7B 5DEJA 3DHUA 4XX1G 5DYOA 1J5HA 4C8XA 4ICWA 3F58H 4XHQA 1AE6L 2YPVA 3PREA 5IVNA 3FCBA 3I9GL 5JHDE 3VGGA 1ZPUA 4RAUA 4IBUA 3ARDC 1M2VB 3GSNB 5TH2A 2WWOA 4JFFD 5KSAC 3K26A 4Y8AA 3V7AG 5F1IA 3FT3B 1PX8A 2XG5B 3HPJB 3KBHE 2FX7H 2YHGA 4A7TA 1V7ML 2F1BA 5K19A 1FHNA 1FFQA 4EDXB 1MFUA 5J1AB 1HHKB 3CBKB 4ZD3H 4CGUB 1ZGLA 5T3ZL 3FRUB 3HMXH 1BZ9A 1L9QA 4FQ1H 4KK6D 4V2BA 4X9BA 2JKRM 1WH0A 2BCKA 3P0VH 4KH9A 4RFEB 1I7TA 3NJVA 5GRZA 5MEQB 1KACB 2XHNA 1W8NA 2FQFA 3HE6C 4MJHA 4KHTL 5E2WL 3IFLH 2OYPA 3WS6A 4HGKC 1S7WA 4NOBA 3LKQA 4CMHB 1KN4H 5D4HA 4S1DC 2D4DA 2H2SC 2F53A 1OGAB 1PD6A 3I9AA 2W95A 3CZEA 1UTDA 1VFOA 3L5WA 4EVNB 3GXNA 2NUPA 3CTTA 3KH4A 3ARBC 5F89B 2F2HA 2P8MB 3RUGE 4PJ5D 1K9TA 1JZ2A 1JBJA 3L2NA 4J4PC 4BCXA 1U6AL 2AITA 3KYMB 3P4NB 4ODTH 5HDOA 4Z3TA 2B9BA 4CN1A 1N19A 1MFDH 1SJHA 3QQ4B 5DF0A 4KAQL 4JRYD 4ZPTA 4F27A 1I3GL 1YSOA 1NCNA 3ARFB 4M48L 5CCGE 3OKLB 1O6SA 5ILTL 3SYAA 2PR9A 4MA7H 1VKXB 4YHML 2VDRA 4JFWA 4Y16B 1RIVH 4NRZB 4QLWA 1MVUB 1RK0B 1I8LC 2CHNA 4ZFFA 3DO3A 2PW1A 3DV4B 4NC0B 4JKMA 4Q52A 2HP4A 2BVYA 1T6WA 2APXA 4AOWA 2J8OA 4UTAL 3DI2B 4Q9RL 4R7DA 2HUEA 4X7SH 1UB5A 2X4NB 5FA3B 5E6SB 5CYKB 5FKPB 5BXFA 3MLTB 1XHHA 1CXKA 1GC1L 1LK3H 4IRSD 5AW4B 1HKLL 1JV5B 1Q9KA 2P9UC 2BNUA 1JF1B 2YBRB 1VGKA 4N85A 3N41F 1XB3A 1TJGL 2CRZA 4QHNA 3VH8A 1QMUA 4PP2B 2ZCZA 4HWUA 4FD0A 2FZ3B 4K94C 2GCYB 3MLZH 2VDPL 3WFCL 3TA3D 4LIQL 1MUJA 3WMPA 1MJJB 1UD3A 3BMWA 4MGXA 3ZR5A 4XCCH 3TOPA 2HTLD 2J25A 2BNRA 2XA8H 4WI0A 3GMNA 1GMEA 3MACH 1QWHA 1DBKH 4FFZH 4WI5A 4YBLB 4CL7A 4PR5B 3WXWL 4P5TB 1BVKB 3IN0A 4FYSA 5EEWA 2V5RA 3RX5A 3NBNA 5DA0B 5EMLB 1JNNH 1U8KB 2C7UA 5HYIA 4LKCA 2HKMA 4FQHB 5F7FA 4GO8A 3U6RA 1TR7A 5IIEB 1EFXA 3CN3A 3WY2A 3IMUA 4X8XA 2UZYB 1J0ZA 5I6LA 4HISA 3V0EA 4L1LA 5D1XD 1UWXK 1HEZB 4W9IC 1CBVL 1H6TA 3B3BA 3F7QA 4PJDE 4G83A 2YA2A 4RIRA 3UAJD 3ZHNA 2ITCA 1HHHB 2XKNA 2DMGA 4YPGB 3VXRA 4GGDA 2ZOUA 4LLUB 4JJOA 5DHVA 3FU6A 5LN4A 3VE0A 2EYSA 1HH6A 4HWBA 1G84A 3KD4A 2V7HA 1WAAE 2PPDA 2BNQB 4JZNA 2Q87A 4FG4A 4ZTEA 2ITFA 1A1MB 3DK2A 4LRIC 5CFHA 5C09B 2OCFD 5KYXA 2JJTC 3CN4A 5E9DB 4A04A 1XGPA 4RQQA 1CG9B 5T1DL 1Y0LB 4J3OC 5DHEA 3NOIA 3TV8A 2VRQA 3VDCA 1OSYA 3TBYB 3SKMB 1L0YA 4A0AB 4ENEC 3QI9A 4F7TB 2A1WH 1G5AA 1V8HA 4NJAH 5DMYA 3MLRL 2CPCA 4ZW6A 4FA9D 1MLCB 1OE3A 4WGVB 3U25A 4WFHD 4HIEB 1AQKL 4W4NA 3I02A 4GUPA 4UM8B 5BVJB 4LOFA 3DBXB 2X09A 5IQNA 15C8H 1KCSH 3GIZH 5C09E 5DYOB 1H3XA 5I9QB 1KF9B 5DC4B 4PJ8A 4IBWA 3G5ZB 2HJLA 3HN3A 2WUBH 1XR8A 3K6OA 4HSAC 4P5MB 1EHLL 1CU4H 4NQUA 1A3ZA 2NYKA 3BKCH 1EIBA 4M7ZC 4PJFB 3UVLA 3R0NA 1Q1PA 1A4AA 4NNYB 1CFVL 4QRRD 5ISZE 4FF9A 1DQMH 4WTWA 1JPEA 2OPCA 4MCZB 3V7MA 4MJ5B 3VNYA 1I9JL 3M1BA 4GI9A 2I60H 3D39E 4PRBB 1XB8A 5EF3A 2FH8A 5PAZA 4Z8FL 4I1RA 4XPAH 3DX7B 3BWAA 1WZ1H 4B41A 2IOIA 3U46A 2ZIDA 2AEOA 2APVA 3AL8A 4FFWD 4G3YL 5TK2A 3N91A 5BO1H 3U7WH 1NIBA 3IFOB 1KJ3L 2CNYA 4ZS6D 3RVTC 4DQOH 3OKDA 5HHOE 4JFOB 3MV11 1U4CA 2ZCLL 4NBYB 3V4VB 3NIDA 1T4KB 5FKQA 3UVNA 2LLNA 5E8DH 1CFBA 3ETBJ 5MERB 1BXVA 4LARL 3ZBMA 5D7IE 4N0YH 2W18A 1MQKL 4Y5YB 2BSRB 1Y1UA 2ZKWA 4JDVB 2PTVA 2Y7SA 4A2FA 2COVD 4Y7MA 1A12A 2MCPL 3QDGE 4GEJA 4K2UH 5FYLH 5HYSA 3OAUL 1MRCL 3NIDF 4RESB 3FZUC 1TTCA 3BG0A 3E3QC 3PHOA 2XWBB 2Y7NA 4DN4H 4PGJA 3T4AC 4S2SA 2XL3A 2GKIA 3OKLA 3D08A 4N2AA 3MRQA 5F72S 2CHDA 4F1ZA 2EVFA 2AV1A 1JTPA 4RWYH 5LXVA 1JD7A 4NRZA 4D9RE 3POHA 5IGXH 3JYCA 2QSQA 3SO3C 5C2WB 1TVHB 4PV1C 4TSCH 4WI9A 4S0SD 2GAZA 1CDCA 1KGXA 5KBDA 5IMKA 5E8OA 3TZVD 1QTYT 2LVEA 3P3TA 2X4NA 5FA3A 4HCRL 4TYUA 4F91B 4XX5A 2JFCA 2F08A 3BT2H 3FTGA 4PI0A 1ZT4A 3FBKA 3BH4A 4UDTB 4FNLL 4ODHL 3OMZA 4ZQTA 1DFBL 1IBYA 4JFPA 5IG7B 5IF0A 2YKKA 5GJTH 1FFNB 2BERA 3C6SA 4CZYA 3TBWA 1SYSA 4AXWB 2RR3A 2X9WA 2RJMA 4L1HA 1EZVY 2WLIA 2XYCA 3RWFB 2QPFA 2FHBA 4S11A 1NFDB 3N1PC 5AVTB 1XDTT 4BXVA 2B2XL 5C0AE 2Y2WA 2LOEA 2YRZA 1FFPB 4WI0B 4P4KC 2ALWA 3GPSA 5DJAA 5DJZB 5B8CA 4KJWC 2CHWA 4X7EC 2WY3B 3IEAA 3AXLB 2H3KA 2EDMA 4IU3A 3U6XS 5IQ9A 5EAMA 5D6DA 3VUAA 1YEEL 3QR0A 4NN6B 3L8QA 4TNWF 3VM7A 1UCBH 3VTMA 3QULB 3BGFB 5ICXA 4Q2ZA 1Z7JA 5IFHH 4ZFGL 2DWYA 4WENB 3I8EA 2IAAA 4IEFA 3GIVB 3DDGA 2JJUA 1U8OB 4XPFL 5AUMB 1X6LA 3CLEH 5FUOL 4RIRB 4WWOA 4CILA 2YSSB 1R3KA 2YR3A 1JAEA 4DKTA 4FXLA 5JA8B 4O2WA 3TA3C 5TGBA 3FYIB 4XVUD 1FLRH 2AJVL 4O5LL 1JPSH 1I3RB 2PF6A 3BQUA 5PCYA 5HHQB 3WN5A 2DLFL 2Z1PA 1AKJA 3T6WA 3BQUD 4G59C 2BK8A 1UWGH 3QWOA 1JWSB 1CYWA 3QXWA 4L29B 4F8NA 1L6PA 2VDNL 5J6GB 4E0RA 1S7SB 2RQEA 3ERXA 3ET9F 1OTTC 2VITA 1S6NA 4G72B 1FPTH 2EO9A 2VUYA 4UDUB 1XR9B 3AU1A 5CJXA 1YJDL 4BUJC 5IOPA 1J05B 4KZ0A 5FHAH 2XY1A 3TBTB 3PL6C 3K2IA 2VR8A 1MW3A 5DFVC 1S9XA 3WD5L 4R97B 3QUYB 1MWAH 5E24E 3ZKQD 4XYHA 4HW6A 3HC4H 2B20A 3BAKA 4XNYL 1GYCA 5DDHB 5AKVA 1MLCA 2OZ4H 3D0VB 1WFIA 1NGPL 5IJVB 1T7VA 4S1SL 4RDBA 2QPEB 1SXZA 3KVQA 3BP4A 3I6LD 2BC4A 1RZGA 1KB5L 1F02I 2VDNH 3FF8A 2VRKA 4PJFF 4AIXA 5ICZA 2BY3A 4YE0A 4U7SA 3EQ7A 1SEBA 2EICA 1QPXA 5DQJB 5CN2A 1KTDA 1UXMA 1J8RA 3CDZB 4LSRH 3DUUA 3QFGA 3I50L 4KZEH 3EBGA 4HSCX 3B2UC 4Y16A 3ZE2E 5I6KA 3NTCL 2Q7YB 3CFSB 1YG9A 4OB5H 4P46D 4HGWB 3S2CA 5MENA 5HE1B 3ECBA 3II2A 4PJEF 4NNYA 2CK0H 3N0DA 4TL5A 3CVHA 1PJWA 3QCUL 1IM3D 3DSNA 1R47A 1FSKC 3GWJA 3K2UH 4FQIH 3IDGB 1LWRA 2YMOA 4G82A 3P73B 2E7MA 4N9GA 3T3PA 1SJEB 2G0KA 5DEFB 1SM3H 4Z7UB 1OSPL 3GXUB 1AGDA 4ELKB 1XF1A 2FDBP 2NR6D 1FE8L 4XRCA 5DEGA 3UYPA 4I89A 4M29A 3WMQA 1ICTA 1Q90A 2WLLB 1SXCA 4MYWB 1BX2A 4YHYB 4XTRC 1EXGA 1N5AA 4F8QA 5DO2C 1BZ7A 4H26B 2HPTA 3DYPA 1EXUB 2LFEA 2R1YB 4AUUA 4WEMB 1K72A 4HIPA 3ZGIA 2QHRL 4X7TA 1QUNB 5DUPH 5E9DD 2J1XA 3IFNH 1VACB 5LXGH 4NCC1 1O7SA 2BNRB 1BJ1H 2H45A 3K2MC 4N5EC 1PY0A 3JV4B 3N43B 3AVEA 3B7UX 4QAWA 3CC1A 4Y2OB 2UX6A 3SGDI 1T5XA 4PR5A 4PJGE 2BSTB 4X0KA 3D2TA 1VZ2A 2YQ2A 1YUHB 2QKSA 2XWBA 1F56A 3BEWA 3ZRSA 1BLNA 4TF4A 4KU1A 3ZHKA 35C8H 3VFGL 1WAEA 5SXMA 4NHUB 1OPOA 3CFQA 3JV5A 3U6RB 2A7BA 4P5KA 5BNXD 1YQVL 5FF6A 5J6HB 4ERQA 2UZYA 2JIXA 3AS2A 4KKLC 4UINH 4AENB 4NAMA 3NZUA 4F57H 4WI8A 4HJUA 4RVBA 4MA1C 3MBED 3VFNB 3TCLB 2YN5A 1MJ7L 4AYMC 2ZX5A 1U3NA 1SXSA 4QYOA 2ITCB 2XKNB 4WDIA 2HFFB 2R1WA 5EU7C 4QRJA 3ILQC 3Q7JA 4HIJA 1JHLH 2KUTA 1WJ3A 4URKA 2BHZA 2Q76B 3D25B 3M07A 2DICA 4H1LH 3VGDA 4CJ1A 1BF8A 3SCYA 1P0SE 3FB5A 1HQ4B 3MRLA 3QJQB 3JROA 4HK3N 4R7LA 5IJKC 4MAYB 1ADQL 1AZZC 2BIOA 4YDJB 5FR3A 1QBML 1I7RA 4BBWA 1FBIL 1O9ZA 3MZKA 1RZJH 1SYSB 2XWJB 3DK0A 4I77L 4AXWA 5BQ7A 3B9KA 3B6SA 1DEEB 2FLRT 5FW8A 4EMZA 3DX6B 4GM8A 4KRLB 1UOOA 3ISRA 4P2OC 3C8HA 1XAKA 3QWNA 5LAXB 4AGNA 2VDOB 4ZOZA 2HMIC 3WUWB 3LS4H 4U6HB 1Z3GL 1U8IB 4L3CB 4J3XA 1P7QD 3NGBC 1OP5K 5I5JA 4I0PA 1FA4A 3TJEL 4I0PD 4LEXL 3F64A 5IEKA 1HQRB 2XZCL 4U6VH 2J5WA 4OSUH 4XAWL 4PYHA 2VQ1B 5ICXB 5E94A 1DDHA 4OZHF 5D7IB 2FATH 4WO0A 2V2TA 4JPVH 3T0BA 5HE3B 2R7EB 4QJ4B 1OSEA 2MIZA 4F20A 5DZ9A 3IFNL 1G7LB 5B1CA 2NXYB 4CUCA 4JDZA 4XN2A 1FC1A 1WBYB 3A4FA 3I9GH 1R3KB 1HH9A 1KCVL 1NEZB 4PBZA 2DJSA 2MEJB 1JK8A 1FFOB 2DD8H 2G9KA 2FX8L 4QT5B 3ML8A 4P9HL 1JXKA 5I0DA 1YA5A 3KMDA 1WQVT 4LEEA 4F15B 3DURB 2DQUH 2Z31D 3KPQA 5HI5D 1B9ZA 4PTTA 1I9IH 4XNMA 4AIEA 1EERB 4XMUA 5KOMC 1S7SA 3MV8A 2IPUK 1ZANH 2CKBA 2P80D 4O02L 5EDSA 2B5IC 4FXGC 2V2WA 4GT0A 2CD0A 1D6VL 2EIZB 3APFA 3WLWD 5KW9L 4PU2A 3ZGHA 3RZCC 4P23D 2BNQD 1KENH 5CEYB 2VLLB 1UYWL 5CINH 2BWIA 4Z3GA 4ZX6A 3PXLA 5HGDA 1I7UA 2C9RA 3PIQA 4U6XA 2O5ZH 3X14B 5AJAA 2B1AH 4DO6A 5TFSL 5SWSD 3MRJB 2ZWLT 3L9EA 4UM9D 1RZGB 3TYGH 5SV4A 1XCWA 1Z5YD 4FC3E 2MOQA 3I3DA 1ZLUH 5IVXB 4WHYH 4JVPA 3MCLH 3PHOB 1X5YA 5IWLA 3GUTA 4BK5C 4MAZA 4HJJL 2W91A 1I9JH 2BIMA 2VKXA 4MFHA 4R6UA 4MRBA 1N64H 1OK0A 4YHNA 4PJ8C 3I74A 4KRNA 2F5AL 2JQZA 1VHPA 2WQVA 2YSTA 1ZVSA 4X99A 2UYLA 2PYEB 4A2DA 1LE5A 4AQEB 4HEMA 1S78D 3VFOB 1UASA 3ES6A 4R4BA 1XGUA 4X4YB 4FQCH 4CDGC 3TPUA 3ILQD 4FI6A 5E0QA 5D93C 1FORL 2VMEA 5LBSH 1E28A 3UTSE 2WXLA 3UACA 4J3WA 1I8MB 3U1SH 5H2BA 4E5XA 2E7CA 3B1TA 3ORVD 3DHPA 2GBUA 3MI6A 5GS2H 5IJKA 4P2AA 1X7SA 5GRUL 4CN6A 3WENA 3WEBA 2H13A 5KBNC 4ELKA 4JY4A 4Z7AA 3QC6X 3QFJA 1A6TA 3U9UA 1P1VA 3HLAA 3X3FL 4V1DE 1QPKA 2IALB 4C58B 3C9NA 3PP3H 4F9LA 3OSVA 3LZFH 2D7PA 4YC2B 4JG0H 2W9EH 2OMVA 3EFFB 1XAUA 5C0CB 4KROC 3LH2L 1EXUA 2R1YA 2XZAH 4XMLH 3BHBA 3OKYA 5CN1A 2D7MA 1TKWA 5K93A 4WK4A 2DRUA 3KJ4C 2YMXL 3NIDE 2Y23A 4DKFL 5TEFA 3S35X 1XIWD 1INQA 4HLJA 2L04A 3M45A 3NA4A 3P4MB 4G71B 5M5RA 2VDQB 1KT2B 1PTZA 1WVZA 1A6AB 2YAFA 4OQTA 3U4BH 4A2HA 3TWCL 4XX1E 3GBNL 4H0HB 5HD8D 3OL2A 4IGBA 2C7FA 1NSNH 3FQWA 4HJTA 5LCVL 1DUZA 1YNKH 2CHXA 3SDDA 1AHWA 4MJ6A 2C9PA 3IJ9A 5LBSA 4YQXL 3MLXH 1ZHKB 1KC5H 5AZ2H 3RQ3A 4K0OA 3O4HA 3MLWH 2R59A 1M1XB 5GGVY 4O1QD 5T1KB 1IC0A 1VGEH 2YBGA 1MCIA 3W11C 3VSVA 3UG4A 1QPPA 3ZT5A 1SOSA 4FMKA 4FX5A 3UCRA 4ZMQA 4R7NB 5EF1A 1KGJA 2WUCH 4LGPB 5KBMA 5BO0D 2VITB 1WHOA 4ICXA 1E40A 1JRHL 3CDYA 1CIUA 4ONOA 3SDXF 4LVOC 5JXEC 4JQXA 2H0PA 1A6WH 1F90H 1WICA 4YHKL 4H8WH 4QRQB 1E90A 1G6RL 5EULV 4U1GC 1WCBA 1G9MH 1HSBB 2P9SC 3LSOA 3MLZL 2WZ0A 4N8PA 4Q56A 4HETA 3HPLA 4F93B 3TLRA 4FQLL 4NQDA 3RBSA 1R34A 4J4PA 4FYTA 4PCYA 2FX9L 4GW1B 4UQ2B 3M46A 4IMKA 1KFAH 3ZDYE 2W59A 4CU8A 3FPXA 1M6UA 5F7WC 3EOBB 4UZGA 5BV7B 4ZUVA 1JHKH 3GSUB 4NP9A 1DN0B 1IAMA 2R7EA 2WC7A 4MD0A 4Z7QF 2PMZA 1WA1X 3WNNA 3PXWD 3IVMA 5CLXA 2ZUYA 4FB1D 3CX2A 1AZCA 3DUUB 4PJ9C 4XOCA 5AOMA 4D9QD 4PXWA 4P46B 2NY0B 5JQIB 2R8SL 1F1GA 5E8DL 3LX9A 4YHZH 1QLRA 1GS6X 1NEZA 3Q1SH 4FLOA 3D4CA 5HY9B 3HG2A 3DX8A 2AANA 5LWYL 5EOCJ 2K1MA 3VWKA 1W0WB 3H2PA 5KYYA 3IDNA 3HG1A 3E7JA 3G6DL 3AWEA 3MRPB 3H53A 3IDGA 2DEYX 5I17B 4ZS7L 1UM4H 3O9WA 5GS1C 3P73A 4JPQA 3C5SB 4BZ1H 5K9KB 1SJEA 3L5HA 4BWTA 5AVQB 3UEQA 5HE0B 4HHWA 1ADQH 2G75B 4PVMA 4P59L 4JANB 4PS3A 2IC2A 2IG2H 2HVJB 3HE6A 1R33A 1HHJB 2XRAH 5C2UB 3RLSA 5E9DE 4JFHE 3T0WA 3GXTA 2DH2A 2F68X 3INUH 4YDIH 5IVXF 5KW9H 1NMBL 5EIIA 4FE9A 1LHZA 5SWZA 1DE4A 1Y6MR 3GMLA 2EBSA 1DSFL 3L16A 5EEYA 1DVYA 1K4CA 2GY5A 3PP4L 4OLWL 1QKZL 4JW3A 4AITA 2F6AA 3EDFA 3C99A 3JV4A 3GTVA 4CRPA 1BYPA 5HI4C 1V7NL 3V4LA 3SDAB 4U1SB 2WVTA 5IJBC 5IVXA 4KQ0A 3CFKA 2P48B 1KG0B 1MWOA 1UZ6F 1AXSA 2Y7OA 3PWVB 2YAPA 3NFNA 3QUXD 4Q14A 2H6NA 1LWJA 4JZOB 3VWJA 3CFJA 5J11C 2ZSWB 2BNRE 2FX7L 5DJXB 3BO8A 3PGFL 3N6YA 3TNNB 1ZVSB 5LG1A 3LQZA 3F7VB 4AVJA 5FYLE 5KANG 1X4YA 3UTTE 5HDBE 4B7LA 4KDTA 1MNUH 3IXAA 1MLBB 4FQLH 2JB6B 2X05A 2FYYA 1MEXL 5CD3A 1SDDB 4LCUA 4GAGL 5LLIC 3PAUA 2BSCA 2HFFA 2NXZB 2R1WB 25C8H 1IBBA 4J39A 2IVFC 5GGRB 4F8LA 1I8MA 5LQBH 1ZK9A 3MUZ1 4PREA 4E5XB 1FNGA 4JQVC 4QHKJ 1LEGB 3MUY1 5E5MA 4XGZB 5JW4M 3H9ZA 4O58L 3ZUCA 1H2WA 2PCFB 1FYTE 3B2VH 4R5XA 4Z7OB 1FBIH 2DM4A 4GRLC 4HT1L 3HB3B 4Y7OC 4GXFA 5K1JA 5KUMA 4L3FA 4RDQF 4IRZA 3HLAB 1AVAA 4X83A 1MHPH 1MIMH 5DZPA 1N6FA 3JT2A 4EZMA 3TVMA 1PFCA 4FG6D 4WRLA 4ZT1A 5EA0L 1T3FB 1CFTB 3ARFD 1BQSA 3S4SB 4CGTA 1WD8A 2OJEB 5L9DH 1XZWA 3TZVC 1JGVL 2F53E 1FO0B 4Q9QL 1TKWB 2P42B 1NA8A 4WK4B 4X8GA 2N7BA 4LCWD 2XICA 4PRHD 4ALAH 1UEYA 3ZSTA 5GS2D 5I0VA 4NO0B 1VLXA 4NSKB 3HZKB 3ODTA 1QSEE 3OG6B 4ATWA 4UANA 1G43A 3G6JF 5DMGD 5IT2H 5D1ZI 1BOGB 2N4IA 3K4AA 3O8XC 3B2VL 3VMOA 4F7CA 4Z5RB 5IEKB 2J8UE 2WIIB 5FFOA 2AERT 1NCJA 3P9MA 1MY5A 1TLMA 5F7KC 1S8DA 4EE2A 1ODAA 1AS7A 1BDYA 2X9XA 4I48B 4PWGA 1GGCL 1QLFB 2GK0A 3QI9D 4XXDA 1IBZA 2FB4L 5DVMA 5FO8A 3V6OA 3QQ9C 3TN0C 4TULL 1KEGH 1AHWB 1U21A 2CKBH 4MJ6B 3JWOC 3VYOA 3L3OC 3WY4A 4P2QD 3OD3A 4Y1SA 1OAJA 2OMUB 1MCPH 5DI8A 3K0WA 4UNIA 2L7UA 1ETB1 1H6EA 4J4PD 4LQ1A 5EFIA 5I8EB 4Y9EA 2XQYK 4KK9C 3SBWC 4WWID 3KR3L 2CRIA 4OR1A 2H6PA 4JG0L 4APQD 3QBTB 2PO6A 2ZAHA 3OKMB 5D4JA 5F3BB 3OJVC 2WKOA 1KGIA 1ED3A 4IBSA 3L3GB 2O5YL 4IOIB 4HH9B 4ODVH 3GXMA 2CHZA 1N4XL 2EIZA 3T0EA 4WW2C 1EHKB 2SEBB 1NAKL 3T8MA 1BD2E 3VAEA 4OD3H 2VR9A 5E4OA 4FQ2H 4HGMA 2J8HA 5JUEL 4EIZC 4YHOL 4ORGA 2NTFB 3B2MA 3IGLA 3PIQB 1O6VA 1ZIAA 2IV8A 2IBZX 5KZCB 3BJLA 3MRKA 4P59H 5E2TH 2X2UA 1DVXA 3JZHA 3BKMH 3J27A 2R9HC 4YZFF 2H6QA 2HTKD 1BMGA 1FO0L 3P11H 2NTSP 3FH7A 1GZQA 3OKEB 3BKYL 5HTSA 3I9PA 2VDMH 5ACLA 3U79A 1FJ1B 4NPJA 4MQXC 1ZA3B 1B90A 3N9GH 2BY0A 1NWOA 4H7VA 5GSRB 2XA3A 2UYLB 2EZ0D 5GGRY 5D2LA 4KNSA 4MXVE 4RCAA 5D2NB 1SN2A 5JDSB 3A67L 3BAXA 5EZLA 2XVGA 5HYJE 3BUTA 1U8PB 4JFED 5H2BB 2ZWYA 3V9FA 1G9MC 5IROC 3X1NA 1ZGLP 1TZIB 3O0RL 3QIWB 1AZVA 1SUHA 5D2LF 3OAZH 4KK6C 3ULUL 5DQ9A 4XC1H 3ULVE 3OV6A 3HHMA 3CDFA 4N6RA 4AJYV 4TS6A 2DWTA 2QGEA 5C0DA 4TLSA 1R5IA 1LQBC 1VCAA 5ABAA 4Y19E 2A74B 4Y4KC 2HLAB 1WIUA 2GIMA 3H3PL 1V5JA 3TZVA 4NM4H 5C7ZA 1NDMB 1T5WB 3GSQA 5ESVA 4B9GA 1S7TA 4U1IB 5F0LB 1E5UI 4HJ0D 5SWZB 2XTJD 2FX8H 5KAQF 4YSCA 4WWKC 4D9QE 4JFFA 4YSQA 1MFEL 4JGNA 4MBRA 4MZRA 1E2VA 1TQBC 1EAPA 5D4IA 2I5YL 3BZ5A 1UA6H 3SDAA 1EAOA 1CDYA 4OGXH 4OZIE 1ZGLM 4KKBD 2O5NA 2NY6B 3P9LB 4F2ME 1YUKB 2MOVA 1XSOA 5EU5A 5LBSL 2P80A 4DT2A 4J3OD 3KLDA 1RU9H 1WITA 4UU9B 3H9SE 3POCA 5FX3A 3ZYJA 4AGLA 3E2HB 4A38A 3TN0A 1Z0NA 3IMBA 2ZUSA 2I24N 3LQZB 4U0RC 1HX0A 5DQDH 5E6ZA 4P48A 3M17B 4AJWA 4LSRL 3G5VB 2A83A 5CUSH 2QTVA 3OXRB 5LN8A 1NEUA 1ACYL 2DQHL 2H2PC 2J3SA 3NCJL 2X2HA 2OV0A 4FCHA 3LPFA 1H2ZA 3H4FA 1J5CA 5LBGA 2AQPA 5JIPA 3P30L 1JMZB 2VL5B 4FN0A 2AJYL 1TBGA 3BDBA 1QBBA 1URZA 3TIEB 2YB8B 2BH0A 3AXHA 3QJHA 3IK2A 4BKSC 2JKWA 4PW3A 4GMTH 2HU8A 3F3FA 5AWNL 4Z3EA 3AQZA 3PL6A 1R3HA 1TJMA 1FGNH 5EOCL 1RUKH 2KH2B 4CNIB 1SJXA 3EJYD 4E54A 5CJOH 1LJMA 1OAXL 3KJ6L 4KK8D 4PW9A 1E8ZA 5TDNA 1IGCH 3S3SA 1X4XA 4ZQKA 4IRJB 4AG4H 4NO0A 2JI2A 1GOHA 2R23B 4IJTA 5KS9F 3HZKA 5GQBA 2C9SA 2OM5A 4APQA 5AB9A 4KNQA 1DANT 3B2XA 1LNUA 3V52L 3ZDXB 1I9IL 3KPNA 3ALWA 3MUJA 4Y0GA 3WFHA 1GTNA 3U4EA 4GMBA 3FUNA 1SOQA 4DEUA 4L5FE 1I1AB 2VDNB 4FLQA 1SZNA 35C8L 3AMLA 4DH2A 4FQXB 5C6TH 2XE4A 4LHUB 3TIDB 4GAGH 3A4DA 3VFUB 3NIFA 1SHMA 3HNTH 2YPVH 3GBMH 3HW7A 3IJ0A 5I6XC 1RSYA 2QKIB 2HYMA 3DX9A 2OMUA 5DI8B 3JRPA 4K8RL 3MRBA 4NQSA 1PU0A 4TRPL 2MSPA 5CIPB 3U83A 4FI7A 2ESVD 1HT6A 5KYYB 3FZUD 3B37A 4LCWE 4L4VD 4K7FB 2VM3A 2ZKHL 3Q2VA 3O9WB 4E9RA 5CKAA 4U7KA 3AAZA 2CE9A 3MLSH 4B9CA 3KPSD 4OBRA 1KPRA 1CE1H 4PD4K 1EEZB 1RZIB 4OAWB 4S1RH 4WWNA 5I1LB 2R2HB 4RNRB 3IGKA 3KCPB 3P69A 3QO0B 4JQIH 4PJCE 3GXIA 3UC0L 3EOTL 3MA9L 1S5HA 3F6JA 4KI5C 5T3XH 1EDYA 1CDGA 2DMBA 1Y18B 2VERN 4I77H 5DJ2B 1RI6A 4PJXF 3FO0L 4HLZG 2B9AA 4L4TE 5D7JD 4KXBA 5EIVA 3RWIB 3L4MD 2I60L 2Z9TA 3AZUA 4PB0H 3SY6A 4F8OA 5L4IA 1A3QA 3S35L 3NSCA 2CE8A 3S34L 3LRHA 4PRHB 2GB2A 5DUMH 1QG3A 4U3XA 3VXMA 3MGOB 2BRRL 1EFQA 2R1XA 1FNSH 4JZOA 3VWJB 1NFAA 2BHYA 4QCIA 2X6AA 2Y06L 1DJGA 4AMXA 2DYSB 3KYKH 1S7QB 1G9EA 1HWWA 4R96B 1IJNA 4QHMB 1CLYL 4G2AA 4JHNA 1MLBA 3WFEL 1SDDA 3BZDA 3EDDA 4XI5C 5GRWA 4J82A 1NAMB 1CC3A 1T7XA 4HFUL 3L4ZA 5LBVA 3S0PA 1INEH 1U8PA 3MOBL 2VLMD 5J1TC 3OAUH 1XF3B 1X7QB 1S7XB 2PCFA 1NDGA 4UYQA 1C5BH 1OARL 3IWVA 4FFYL 1BEYL 1GVIA 1GYUA 1QA9B 4WGWB 5HHMD 2EDQA 4W68A 2DQJL 4TLUA 3BVWA 1VERA 5C0DB 1ZWIB 1HXMA 1BG9A 4F7EB 3HN8A 3CFUA 3KPRA 3JT0A 4Z8LA 1T3FA 2CJUL 2E6QA 3MJ7B 4FEIA 5A7EA 1NCAL 3NZ8B 4I3RH 2IGFH 1NFKA 3V4PB 3GGWA 3F5WA 4WWKA 4RA3A 5HYNB 3OBAA 3QCTH 4DP2X 3SDCB 3P3RA 12E8H 2OS7A 1TPXC 3C60C 3SE9H 4DPBX 2ICES 3Q8FA 3HG1D 4Z5RA 3MJ9H 4HOMA 1P6AB 1DQJA 4NQED 1OP3H 2YUVA 3FO2A 3JVGA 5EHFA 5EU5B 3X11B 3EGDB 2DQMA 4AQOA 3I8CA 2VE6A 3O3DA 1Q9LB 2Z8VC 3FQTA 4PGBA 4LPWA 2EIJB 3WO4C 5KS9E 3DETC 3DVNB 1KB3A 1PLGH 1S3KH 2DW5A 3LRGA 4X50A 5AVVB 1CICC 1MJ7H 1F11A 12E8L 1L3NA 3M17A 5C0AB 4ADIA 1IEAB 2A83B 3IXTA 4MNQD 4N3TA 3HC3H 4NN7B 4FQJL 4Y4KD 4HBCH 1YECL 3FH5A 4L18A 1A2YB 1YNKL 3VXUE 3OKWA 3GO1H 4OLVH 3APDA 2QVIA 1Z32X 3HCVA 3IGUA 2NY4C 5DWUH 4ZTPL 4RRPG 2AGXA 1A9EB 4HKXA 4M7KH 4IW4C 4IS6B 4RGNE 2ZOKA 4HF5L 3PVUB 1HKLH 4G7QB 2MKWA 5EU7E 1I2MB 5KS9B 5C0JA 4D9SA 3VYNA 1DLHB 2VMCA 2RTTA 3QR1A 1MCWW 3CLFH 4HH9A 3T0AA 3MOBH 1CK0L 1WC7B 1UA3A 4CNIA 4IMLB 1NBCA 1UH3A 4NZJA 4OZFH 1ZT7A 4BD4A 2XWZA 1DJIA 5G5DB 3T2LA 3MRHA 3NAAL 4QRTA 4GQQA 2VLRA 3VQ1C 3SDXA 1PZ3A 2NUTB 1NTDA 1P7KA 2WM0A 3MBXL 5HHNA 3KYOB 5EC2A 4BHUA 2OIZA 3C8KB 5SWQA 2WXOA 4LLYA 3HAEA 4XWGH 3K6SA 3KWXA 3N1FC 5HGAB 1T83C 2MTPA 4U1MB 3TFKD 5DXWA 1FNAA 2J73A 3MRMB 3V4PH 3KEHA 1MRFL 4LLDA 1T0PB 3TIDA 3GMMA 3PWNA 4XT1C 1BIIA 1YQ2A 3IDIB 4XODA 5GHWL 5HHOB 4MJID 2V5MA 4ERZA 1T2QH 2P45B 2YQBA 1E67A 4JM2B 4QRPA 1UHVA 1J5DA 2Q2LA 5DHYB 1H8NA 1LD9A 3IN2A 2KPNA 1HCVA 4OZGE 4AQ1B 4ZFGH 3LXAA 5CIPA 4OCXL 4XI5D 2X70B 3CZLA 4GRWF 4CY5A 1A3RL 3WKML 4Q97A 4ALAC 3BQUC 1XT5A 5KYUB 4WIQA 2F7QA 1M05B 5EOQH 3AAZB 4RFNC 3EZJB 3H2QA 1KJ3H 4BA0A 4LGNA 4LSVL 2YO3A 1EEZA 1RZIA 3MRFB 4OAWA 5I1LA 5C0RL 5L4JA 1CF1A 4PJIA 3ZDYB 4M1CC 1GOFA 2MHAA 5FDWB 5TE6H 3WNLA 2OJZL 1PZ5A 5CD5D 1R5IB 3SGDH 2ZE0A 1K8DB 1INEL 1P53A 2CR0A 2WZ6A 5FM5O 3WAKA 4AN0A 3PGDB 1OM3H 1MNUL 4K5MA 1U8CA 1VJSA 1GZHC 3NRFA 4TUOB 4OZFB 4ZNEA 2IANA 1PYWB 3CFDA 5K33A 1QWUA 2QV4A 4WNQA 1KIUB 1TEFA 3LQAH 5BOZG 1C5BL 4FFYH 1T20B 1OHZA 4LP5A 5ISZB 2AQ3A 4N90D 4ERSL 4OD2B 4BH7A 4M7KL 5C6TL 4NNPH 1JP5A 2CK2A 3H2WA 3WU1A 5E6IB 2BS71 2VXTH 4Q9RH 3RFZB 4G80B 3RWHA 5IM7B 3T8XB 3HTLX 1U95B 1KTCA 4UU9A 3L3IA 1KBWA 4O3TB 4GG6B 2XN9E 1CICD 5EAPA 4Z7VA 3QZMA 1TITA 2Y22A 3CSFA 7FABH 3PVWB 5TDHB 1UXSB 4Y5XC 4QJ3B 1OTUC 4OIIL 2B7DT 1KY6A 5CILL 1ORSA 5TQ2H 5I1GH 2OTUB 1SQJA 3WNIA 2V5TA 3T1FA 5IR1A 3MGTA 2E86A 4M93B 1LDPH 3QNFA 4N8UA 1BPLB 1QFWM 5T1KD 4FRWA 4Z7VF 5FCUL 2OMBA 1GMIA 2J1KA 3GZOA 4Z7NE 4CMMB 1MDTA 1H5BB 2J71A 4DP6X 1FAIL 5ALBH 5I1EL 2C5DC 3QNZB 4S1RL 4UYPA 1H3WM 5C0NC 4JT5C 4QY8B 3EJSA 2OZNA 4QRAA 3MKKA 3UC0H 4AEIL 3VYPA 5L2KA 1OF2B 4FNRA 1CPUA 4RRPA 5BOJA 2EIEA 1XXFC 2Y5TB 2WV3A 3NCJH 1NEPA 1MG3A 4H4NA 3Q43A 2FO4A 4ZAKB 4M5ZL 3DRQA 4J3BA 1WFJA 5AVUB 3PNWB 4L3ED 4MA3B 4MMZC 4NKOB 5DQDL 4YSAA 2KYIA 3AU0A 2D3NA 1KELH 1HHIA 4DN3H 1QO3A 1U8LB 1VZHA 5DK0B 3JSSA 1PF3A 3MXWH 2X4QB 3JVGC 4YSTA 1N6DA 3P9WB 4JM0A 3FCSB 1G7HB 1UZGA 4PGBB 3ECUA 1JGDA 3TO4A 5F6HJ 3VXPB 2QLYA 3WTVA 1UOPA 5GGSY 2QGBA 1VADB 4ZMZA 3REWA 5E7FA 1UXLA 2GC4A 1RSFA 3KS0J 5F0PB 2XWTB 1FV1A 1GGIH 3BH9A 3KYKL 3NIFB 4AEZA 3FFCD 5AOJA 3X1GA 4JPIB 3L1EA 1NCGA 3RGBA 1A2YA 2VNCA 5EDXA 4AG4L 4XB8A 3ZDWA 4YN3A 4EWRA 3TBCA 1QSFB 1NCHA 3WFCH 3CQPA 4OT1L 4NFCA 3GDBA 1GSKA 4XP5H 2HXAA 5D1QB 1E8XA 2D3JA 2QXVA 4YDKH 2EXSA 1A9EA 4HKXB 2QQLL 3BP7B 5EC1A 5M5VA 4K3EL 5L6YL 5M94B 1LO4H 2PWEA 1SXAA 2XUWA 3KXFD 3MV9A 3TWYA 5HYFA 3RVXD 2W65A 1XF4B 4LPXA 2N3JA 1NGXB 5AQ0A 1DR9A 4RNRA 2FR4A 1YEHH 3EJZC 2K8QA 1GIGH 3MV7D 1F4AA 1WC7A 3SN6B 5FO7B 2YGQA 1JOIA 3LDBB 4NZDA 1GJWA 3NP3A 5BS0B 1JZHA 4XO5A 4MNGA 5D1XE 3LIUA 1Y18A 4G6JH 5LCVH 2J1YA 1IGIH 3C5ZD 3DX0A 1G7IB 5GSVB 4JMXA 4HZAA 4JS7A 2BSSB 3KNBB 5CUSL 4XC3H 2AEQH 3IPBA 3BDXA 2OMXA 3QJRB 3ARPA 4QTIH 2ZKHH 1FAIH 5ALBL 5I1EH 1B4JL 2GSGA 4XPAL 1N3NB 1X9RA 3IMVA 1BVLA 3UYOD 1UH4A 3VFSB 2F7RA 4PJCF 3ZUNC 2GJRA 1A8ZA 1FO0H 2R1XB 4G7YH 3UAEA 1A7OL 3FTSA 5CCKH 3CFCL 4M4PA 4GS7B 3RG1C 3MNMA 4HJSA 2CK0L 3PABB 3AUVA 4JHZA 2FH6A 4U1JA 5JLZB 5D7HA 5EN3A 3DWTA 4UWQB 4PRHE 3FSOA 1VEPA 5GJSL 1MCKA 1I31A 4AQ1A 4F9PA 1DJZA 1F13A 1JZ8A 2N0MA 3UVOA 1ADWA 2QADC 3T77B 2XU9A 4PV8B 3L7EB 2A73A 1K4DA 1UA6L 5MEPA