5I5IA

Shewanella denitrificans nitrous oxide reductase, app form
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
571
structure length
539
Chain Sequence
VHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHMEMRGRMLVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
total genus 170
structure length 539
sequence length 571
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5iA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5iA01
4YSSA 4QRJA 1L0QA 4X60B 2YAEA 1DZ0A 1DYZA 3JT2A 4E9WA 2EINB 3OTTA 1NZRA 2GHZA 2IWKA 1AR1B 3A0FA 4ESGA 5CXCA 3KRXB 3NYKA 1CYXA 5I5IA 2OVRB 4MK0B 2BZCA 2HX9A 4KFMB 2B3IA 2OVPB 3ORVD 3C5MA 4AI7A 3H56A 3I7LA 2IWFA 2VW7A 3FU9A 4JHUA 1MG2A 4EWRA 5F7BA 3SMRA 4E5ZB 3FU8A 1PZAA 2AGLA 3AH8B 3NJFA 3QQXA 4FA7B 2W18A 4F7KA 1PZBA 3BWSA 4E9YA 1WA1X 3D12B 3VA6A 2YAQA 1OE1A 5B4WA 1FFTB 2H9NA 2OK4A 1L9SA 1U4CA 2W8CA 2IUQA 5I5JA 5B7MA 4UI9R 2VW6A 3JAMg 3SBPA 3EI4A 1AZRA 5D4HA 2VSKB 4F2FA 3MXXA 3EH4B 1A65A 1K8KC 3MKSB 2BZ7A 2CO0C 2IUVA 4Y7RA 1URIA 2HJ4A 5THAA 3EH5B 3I8EA 3OQRA 5FXYA 3H4HA 1AS6A 5B1JA 3BG0A 3C99A 5HE2B 3C75H 5FQDA 2I7SA 1MG2C 1AIZA 3IJ1A 3OMAB 2UXGA 1PLBA 3WKPA 1ASOA 1AAJA 3NJKA 1NEXB 3I7HA 3AY2A 2XU9A 3CZUB 1BAWA 1ZDSA 2J55A 1J9TA 5I26A 4DP9X 1OMWB 4QL1A 4CC9A 2VM4A 3X1BA 3OM3B 3VGZA 1PNCA 2MTAA 1N6EA 4WTQA 2B5LA 4E5ZA 1J9SA 2AFNA 3X1EA 3IJ0A 2CJ3A 4JHVA 4E54B 4J81A 5B7FA 2YARA 4A66A 4ZOXA 3FQ2A 5GMKn 2H47C 2AQ5A 4CY5A 2BBKH 3OMNB 3AG2B 4DPAX 2CN3A 4YSUA 3FQ1A 3S3CB 4GQBB 3PXSD 3V7DB 3WNIA 1KCBA 1XIPA 5EMLB 3DKHA 4F2EA 2YAMA 2PP8A 1EZLA 1JVOA 2BCJB 1HAUA 4AKOA 4A2GA 1WS7A 2P9NC 4Y5RD 3IEAA 1BQ5A 3ZIYA 4M4RB 1BYOA 4JSPC 3CDZB 5AJAA 2UX7A 4YSEA 1W6LA 2AGWA 3SXTD 2P80D 4GP5B 4J0WA 2J56H 4U1EI 3NSCA 1IBYA 1GP2B 3NSYA 4DPBX 4H5IA 4CI1A 2H47A 2XUWA 4A2FA 2IDSA 1UATA 4CY2A 3C9CA 2CUAA 4PAZA 3V9EA 2I0RA 3RN0D 3SCYA 3SFZA 3BVDB 4JXMA 9PCYA 1V54B 1VLXA 3QJSB 3VH0A 5EHFA 2G9AA 3NJLA 4J79A 2QDWA 4PXWA 2AH1A 4YSRA 1IKOP 4M3HA 5CXBA 1PF3A 2P9PC 1L9TA 1OOWA 4G56B 5EAPA 1RCYA 1ZIBA 3UAEA 3MMYA 5FKTA 1WS8A 4HAKA 4JT5C 1JJUB 1BQKA 5D4IA 2P80A 4J8BA 2FT7A 6PCYA 1AANA 2IH8A 3FT0A 5LDUA 5B1KA 2UXVA 4P5RA 3SBRA 2XL3A 1L9RA 3PXTD 2VN3A 3UGEA 3P4FA 3DIVA 3NVNA 4HALA 3EWEA 4Z8LA 1RZPA 1B9YA 5EAMA 2H68A 3BG1A 3FM0A 1MZZA 4FB1D 4XYIA 2H6KA 5TDHB 1NWOA 3CFVA 1R1CA 1KGYE 1KCWA 2PM9B 2YB8B 3I7OA 4BDVA 1YFQA 4O45A 5H17A 3UVKA 4YSOA 1T5KA 2AGZA 2CE9A 2CE8A 2Z2NA 4GQ2P 1PMYA 3IN0A 4G7SB 1R5MA 4MFHA 3SHFA 1F56A 3HEIB 2XYIA 3WG7B 3EU7A 4I79A 4GXFA 1JZJA 1AZUA 4YVDA 4ZOYA 2VM3A 1U2VC 4AEZA 2Q9OA 2GNQA 2GI0A 1TYQC 4D0KA 2WSDA 1ASQA 3L45A 1BQRA 4GP8B 3TA4D 2G99A 5TF2A 2VSMB 1A4CA 1PCSA 2AH0A 2EILB 4JSXC 1ZV2A 5TEEA 3AG1B 2FQDA 3GYRA 3H4FA 4NAJA 3MZKA 4IMMA 1NTDA 3CVDA 4A08B 1NDTA 4EF3A 2FJSA 1SHXA 1NR0A 3PLYA 2Q7QA 1XB6A 3IIWA 3QJUB 3OKWA 4X63B 1NIAA 3NSFA 3GFCA 2N0MA 3UVOA 4YVNA 3J81g 1GS7A 5GSAA 3FU7B 4YSPA 1BYPA 1KBWA 2BP8A 5B7EA 3RN1D 4A0AB 2XX1A 4UF7C 2AANA 4GGAA 3MKQA 2UXFA 3ZX1A 4BXSV 2PBIB 1BXAA 1E67A 3PXLA 4CZXA 3GDCA 1ASPA 2PM9A 1IBZA 1GY1A 3IE9A 1OCOB 4L9OA 2PPFA 2QT6A 3G5WA 5AFAA 1TBGA 3F3GA 4GGCA 3PAZA 4L1QD 1JMXB 4XEIC 1EHKB 1CYWA 1CURA 2YMUA 1AOZA 3QJTB 4P5SA 2XV2A 1MDAA 2CALA 3AL9A 5K1CC 5IJ8E 2XV0A 1ILSA 1X9UA 1GG2B 3ODTA 2OCCB 4DP4X 5TK2A 2H6NA 4FAVD 1AZBA 3FSVA 5PAZA 4OWRA 1L9QA 1ID2A 4J0XA 2FWLB 3PVUB 1WAEA 4G72B 2I3TA 4PNKB 1M56B 3I7PA 4J86A 5C2WB 2DWTA 1M57B 4J82A 3PVWB 3PAUA 2ZWNA 1V10A 2CNXA 3AG4B 1NIBA 3E0CA 3UVLA 3EI1A 2IURA 4JD2C 1PLAA 2HZHA 2XX0A 2X87A 1MG3C 3IKOA 1JZEA 5B1BB 4A0BB 1OE2A 1JOFA 5EALA 4LGNA 5TEFA 4XYHA 3I89A 4CSZA 1WA2X 2OIZA 3DWLC 4ES0A 4QT8A 3EI2B 4J8GA 4K9JA 4BK5C 2HJBA 4A2LA 3RLMD 3DXMC 4AZUA 4L0PB 1CC3A 5HE0B 4J78A 3RMZD 2GBAA 4A2HA 4W1TA 2Z2OA 3SWSD 3QPKA 4KO6A 4YSDA 3NJNA 4A09B 5I6KA 4IA9A 2GSMB 1B3IA 2RACA 3NJMA 5D4JA 3PXWD 3FSWA 3UACA 1OV8A 1A4BA 1AS7A 2DYSB 2PCYA 3RYMA 2P9KC 3F3FA 2BP8B 3MX0B 5A7EA 2I0SA 2YQBA 3OL2A 3NP3A 5IY5B 1J5DA 4K3ID 3NT0A 4GM8A 1NICA 3RFGA 2OVQB 1ZIAA 2JXMA 3UKUC 1JXDA 1OE3A 4LG9A 5FA5B 3NP4A 3MBWB 4BXVA 3OKYB 2AVFA 3PPSA 1N6DA 3AL8B 3NVXA 3T6XA 2GC4A 4A2DA 4DP7X 4PBYA 2UXTA 4FAND 1NIEA 1AZNA 2IDFA 1VYHC 2FTAA 3S8FB 2UX6A 2MTAH 4A08A 4W9ZA 4LG8A 1B9XA 5AZUA 2H3XC 2B5NA 2HRGA 4AKQA 1ET7A 3L4OD 3ZDWA 2Y69B 1KYAA 5HE1B 1ERJA 2BWDA 1SHYB 4YL4A 2AGXA 3QJQB 4NB7A 4AX3A 3T71A 2AZAA 2XXGA 1GYCA 2UZYB 1PGUA 3B7FA 1XHMA 1RKRA 3HFQA 4NSXA 7PAZA 1RI6A 3DM0A 2VW4A 2QPDB 1MZYA 4L3HD 4D6VA 1E30A 1OF0A 2PLTA 2BW5A 4HCIA 4GM9A 2TSAA 2PPCA 2VMJA 3FYIB 2FQFA 2IAAA 2YNOA 4JT6C 4CY3A 3DTUB 4FA1D 3I7NA 2BWIA 3JZHA 3PCYA 3GXUB 1XKSA 4UAHA 5I6NA 1NPNA 2A3TA 1W6WA 4FA5D 5FLXg 1SFHA 2PP9A 2DV6A 3CG8A 3EI3A 2HX7A 2GIMA 2XWZA 4ERYA 3T6VA 4DP6X 2FT6A 4O3UB 4DP8X 2H3XA 1GS8A 3N2JA 3W15A 1ADWA 2BO0A 5CYKA 1AG6A 2FQGA 3FPYA 1J9RA 3T6ZA 1QNIA 5I6MA 1WA0X 2QPEB 5H1MA 2XVBA 2DY2A 2EIMB 1RZQA 2QC5A 2XU7A 4ZN4A 3JZGA 2XL2A 1JZFA 2LLNA 3K27A 5CXBB 1PBYB 2B5MA 1ETJA 2ZXWB 3IBOA 4DPCX 4PBZA 2Y1AA 4ERZA 4OZUA 4A67A 4HHWA 1PI6A 1ZDQA 1SF5A 4E9VA 4ENZA 5GXIA 1OCCB 2OJYA 4HDJA 3RRMC 6PAZA 4A11A 2BP0A 5ANHA 3CVBA 5TK4A 1SQJA 4ZK8A 2CN2A 3K26A 4G7RB 2XYBA 3EH3B 3V9CA 4RH4A 2O9KA 1A3ZA 3FSAA 4HZ1A 3N55A 1K32A 1E65A 3RFHA 3UKRC 1HFUA 4J73A 1JXFA 1TEGA 4E9TA 4A7JA 2YXWA 2R7EA 1V55B 2J5WA 2X88A 1KDJA 2HKMA 3NSDA 3JPXA 3ABGA 1I53A 1W8EA 4J84A 3I2NA 5EMJB 3NJGA 4QLWA 2IUPA 4KNSA 1A8ZA 2J57G 4KO9A 2TRCB 1ET5A 3T6WA 4A0AA 5E9NA 3S8GB 4CI2A 4CY1A 4HCFA 1BXUA 1GXRA 3ULEC 1NIFA 4QQEA 2BHFA 1M9WA 3FU7A 4HIPA 5I6PA 5I6OA 3FSZA 1J9QA 2P9SC 4FWWA 4GZ8A 1N68A 3EHBB 5B3SB 2AGYA 3NJHA 2I3SA 5EMKB 2HYEA 3EMHA 2PPAA 3IIYA 3TBCA 3EI3B 4KNUA 3OW8A 3WI9A 1HAWA 2XXFA 4DP2X 1GOTB 4X3EA 5PCYA 1ILUA 4BWUA 4O9DA 5SXMA 5IJ7E 2CBPA 3JTBA 4TZ4A 4A2MA 3X2QB 1P22A 5EM2B 3UVMA 2QDVA 3DSMA 3PAVA 3NVQA 2H9LA 4FAAB 3OMIB 3IN2A 3AL8A 3UADA 2IDQA 1L9OA 1XB8A 2IH9A 2HX8A 2H9PA 2YBAA 3JB9L 5B1AB 1SQ9A 2P9UC 3IJCA 5FC9A 3GREA 4PSWB 2H5UA 2HESX 4CZVA 1PLCA 2ZOOA 2I7OA 3OD3A 2H9MA 3ZBMA 2GC7A 3KRWB 5I6LA 1GY2A 4BDVB 3FYEB 1BEXA 1QLEB 4DP0X 5FKSA 5C2VB 5EMMB 1AZCA 3NJIA 4GYBA 3FGBA 3WNJA 3UAAA 3KW8A 3N0DA 4ZOVA 2PM7B 3MZLA 1YLBB 3V5WB 4GGDA 1GR7A 4TXVB 1A0RB 1SJMA 2CO0A 1JZHA 3DXKC 4DP5X 3CIKB 2P9LC 5IGOA 5CXCB 5H14A 2R7EB 1SDDB 1PAZA 1KBVA 1JERA 2JFCA 3AG3B 3C75A 3I8CA 5AKRA 2BW4A 5B1JC 2J57A 1SFDA 4KOCA 4PSXB 3I7KA 2B08A 2YXVA 4Q8BA 4BWWA 5IC7A 3CFSB 1FWXA 3SN6B 2H14A 2J55H 3KW7A 4YSQA 4K3JB 4L3GD 1QHQA 1IC0A 2EIKB 2OJ1A 2ZONA 1J5CA 2OK6A 3JZNA 4CI8A 1AS8A 4HCGA 3F3PA 2DWSA 3PSLA 1TKWA 4A0BA 5C9ZB 3ABKB 3EI2A 4FA4D 2PPEA 4X61B 4BL0A 1TU2A 5IGQA 2WO3B 2DYRB 4PCYA 3X1FA 3QJRB 3ABMB 5HE3B 3N0EA 3CVCA 3UABA 1GW0A 2YAOA 4YSCA 4DP1X 3TU6A 1XMEB 2J56A 4E9SA 4JKNA 4YSAA 1JZGA 4AOWA 5FKQA 3EI1B 1PZCA 4O3TB 3PE7A 3T9WA 2XLLA 3ASNB 4BWTA 4JSNC 4YSTA 1E5ZA 1GSKA 2IAAC 1PY0A 4GMBA 4UANA 2CCWA 4J77A 2FNWA 4ZOZA 1JZIA 4FHLA 4CZYA 1NWPA 4E9RA 5F7AA 1JOIA 1TEFA 4O1QD 5CYKB 5GXHA 5JWZA 5K19A 3S3BB 1SDDA 4JSVC 5IT9g 4CI3A 1E5YA 4GP4B 5KDOB 5I28A 7PCYA 2Z2PA 3AFCA 5A2Qg 3U25A 4E9QA 4R7AB 1X9RA 3X1GA 2B4EA 2OV0A 1OCZB 3UR4A 2GB2A 1NINA 2PM6B 1OLZA 2JKWA 4N14A 2HXAA 4GY4A 3S3DB 2P9IC 3U4YA 4J87A 2H13A 4GQ1A 4A2EA 2Q5BA 3SJLD 3V9FA 1MDAH 4KO5A 1N70A 4G7QB 4FA9D 4AKPA 4Q89A 3BQVA 4E54A 3ERXA 5FKRA 1OCRB 4KO7A 2IDUA 2HXCA 3FPXA 3RSEC 2W88A 8PAZA 4HHGA 4N4YB 3SQRA 3WIAA 3SBQA 2YNPA 4CSPA 2YAHA 1JMZB 1ZPUA 3JROA 3OL2B 5EM2A 2QXVA 1SF3A 3FQYA 2H6QA 1S4UX 3ABLB 2GC4C 1AG0A 2NRDA 4KNTA 1XB3A 2GC7C 4BUJC 2WO2B 2FT8A 3AZUA 1BXVA 3AW5A 4E9XA 2I85A 4QKTA 5HQGA 3EG6A 2YAFA 4G71B 1AQ8A 4U7AA 3UVNA 3OKYA 1KDIA 1AACA 3EF4A 4PC0A 3J80g 2YAPA 4NERA 3EI4B 1KV7A 3NJJA 1JVLA 2XV3A 1N6FA 1PEVA 1Q47A 4GM3A 3SLED 3HB3B 4ERQA 4N8UA 3L4MD 3FS9A 4WKXA 2HRHA 5EARA 2MRYA 2FQEA 4G70B 5HYNB 4YVUA 4BH6A 4A09A 1JXGA 4A68A 3SVWD 2HLEB 3QJVB 4KOBA 2YNNA 3OKTA 2AZUA 2PP7A 5AMSA 2IDTA 3X1NA 2EBSA 1PNDA 1NPJA 1SNRA 1SHWA 2PCFA 3FRXA 2UZXB 1A4AA 2BP0B 1CUOA 2EIJB 4X4KA 1MG3A 4A11B 1ET8A 1L9PA 3JRPA 2E86A 3ASOB 2PPDA 3PSCB 4H5JA 3CDZA 3TASA 2I0TA 1NIDA 1GS6X 2CAKA 2HKRA 3ZWLB 5AFU3 3TBBA 1IUZA 2IWEA 5I5MA 3WKQA 2TSBA 1FA4A
chains in the Genus database with same CATH superfamily
1CD1A 1T1WA 1UXSB 4FHKA 1NCBL 4Z7WE 3LNEA 1JHKH 1MHEA 4FRWA 4HWNA 3QSKB 3CFQA 3EJYD 4R90H 4EZLA 1KB5B 1NM4A 3P3YA 4J7RA 4YHLH 1IGFH 3RGVD 5FB8B 4BZ1A 5HHQB 2HX9A 3G9VA 5FO8A 3IDYB 1LHZA 4H5SA 4K5OA 2WNWA 3DXAB 3QARA 3GI8H 1DUYA 3GSVB 1A1NB 1NLBH 4H8HA 4NZUL 5D7KD 3JAMg 4GRWF 1JRHI 2BVQA 5KYYA 2ZNXA 1LEGB 4ZW8A 5IG7A 3EH4B 4FQ1L 5F1IA 3QG7H 2CO0C 1YYCA 1L6PA 3MGAA 2VDQA 3W5MA 3S3JA 3UTZB 3AT8A 1HEZB 2CMRL 4PP1D 4YDMA 2J2ZB 2PCXA 1YZZA 3FRUA 3IFOA 3UTSD 1SMDA 2XI9A 3K8KA 2UXGA 2Q7NA 3SDXA 1FPTH 1RK1A 3HC3L 4FL4C 1JWUB 3C5ZD 3IYLW 1Z5YD 4BSJA 3RY6C 1F6LL 4MQXD 3LVTA 3CFTA 5JQ6L 3OR6A 4G5ZH 4XP1H 5DT1H 3LDBB 1TNMA 2X0WA 4F57L 4X4ME 4YH6A 3OMNB 3SEPA 1X7QB 2DBLL 2ZSWA 3QFJE 2VDPA 4WO4A 5F8QC 4YSUA 1G7HA 3V7DB 3MRFA 3R8QA 4F2EA 1S3KL 1T0OA 3JWNE 1QMUA 4IOFD 4MKMA 1MNUL 1P4LA 2C1PA 3BSHA 3OJDA 4HUUA 1ROCA 4KTYA 5FYKH 4U3CA 5GPRA 4UILL 2NR6D 1MW1A 1V8HA 2ENJA 3RX7A 3VGHA 2OMBA 5FO8B 3BD5A 1EGJH 3CN2A 3SD2A 1J0JA 3LSOA 2ZG3A 4GH7B 1TJIL 4N85A 4J0WA 1ZJAA 4CI1A 5J9PA 3G5ZA 1OEZW 3BYTA 4ZUUA 3VG0L 4HSCX 3GSXB 3C9CA 4HU2A 2NCEA 3HOGA 4PJDF 4JJOA 1XF4B 3ZT6A 1JP5A 3D3VB 1NGQH 5I2IB 2Y07L 5CXBA 1BQUA 2CRMA 4M3HA 2P8MB 5EAPA 4OGYH 3P3UA 1ZIBA 1RK0B 3H0TB 4G1EA 3GMLA 5T3XL 3RVWD 2HFEB 2VDML 3D3VD 3EGXB 4TUKH 2BC4B 4JT5C 3VFTA 3AABA 2FGWH 3L1GA 4XMZA 2ICCA 5DJDA 5HJGA 5LDUA 5AOMA 4P5RA 4TSCH 1S5HA 3P4FA 4Z8LA 5E08H 1D5BB 5K1VA 3BAWA 3T3PF 4XXDA 3KPOA 4G8GD 1U8MB 3UZEC 4O45A 4NQCA 2Y7QA 5JW4Q 2VDLA 3D25A 3KLAB 1OSPL 4IKJA 5E6YA 3L5WA 2ATPA 1MLBB 2VR6A 1RHHB 4OT1H 3VNZA 2F2HA 4NQCB 2P4AB 4LSPH 1VJSA 3L45A 5TFSL 1FNHA 4PBVC 4R2GC 2EEAA 1H2ZA 1XCQB 1X7SA 2NZ1A 5JQIB 1D6VL 4GI9A 4AUYA 5FDWA 4IMMA 1KIQB 1UXMA 5E9DB 1T4KA 4HIJB 4DK6A 2MFNA 3FQUA 4AWJC 3TFKD 2AI0L 3NSFA 1G6RB 2XYCA 3OWRA 1BYPA 3GHEL 5JIIA 4RGNE 2XX1A 5A2CA 3NAAL 1Z9PA 4PJFF 3ARRA 3P3TA 4CKVX 3HPLA 2N1TE 1G7PA 1IQWH 1GY1A 4NZJA 1C16A 1OCOB 5DRZA 5AYTA 2X7LB 3KYAA 3B7RL 1N4XL 2YMXH 3ESPA 1KFAL 3WFHA 2BNUA 2YMUA 3KLLA 4OF5A 3KCPB 3GSXA 3MO1A 5IQ7H 1OAUH 2E27L 1B4JH 4JN2A 5EF2A 3U7YH 3GMPA 5KSBF 2DMCA 4OZ4A 2AABL 1G84A 4L0YA 2JKJA 3PP4L 1P1ZB 2K45A 3HIZA 2P7TA 3II2A 3OC5A 2B4CH 1HZLA 3BCFA 4G72B 4M4RA 5I73B 4NUJA 4NWUL 3V0FA 2ARWA 2WKOF 4DKDC 4BCZA 4JO4H 3N43B 5I1DA 3DK2A 4QTIL 5EF0A 2P7TB 5E1AB 3T8XA 1TKWB 2VWEE 1RIVH 4ANKA 3SCMD 1LO0H 2YK1L 4JY6A 3MXWL 5HY9A 4XC1H 5IW1A 4LLMB 4JHWL 3DXMC 4L0PB 1ETA1 4A2HA 5L4FA 3RWJA 1LE9A 3O3EB 4OQTH 2Q87A 5IMLA 1AS7A 1IM9B 1B90A 4MVBC 5A40E 1NGYA 2J8UA 4YGVB 1NM9A 1PDKB 2VLJA 2WBXA 4I5BB 1NICA 4Y5VC 5D6CA 5DHMC 4F8TA 4KZEL 1OE3A 4JQVC 3PPSA 2ESVB 1SZNA 2NY6C 3TEXA 4CC4C 3WEXB 2VKWA 5C6TL 2MTAH 3KL0A 3I75B 5E9DA 3RDTA 3QR1A 2H3XC 4WWOA 2OMVA 3VMOA 3C5SA 1Z2KA 1ZJBA 3QUYA 4L4VA 4LARH 2J25A 3HR6A 3FTVA 4HS8L 5KYUA 4FMVA 2JJSC 2B20A 4AC4A 3IGKA 1AP2B 4JDVA 2VW4A 3WIIL 4Y2DC 1S9XA 2XZGA 3OHXC 5KVGE 2O6EA 1NAML 2Y1VA 4ZQKB 1FORL 5AOZA 1N5AB 4ZMVA 4P9ML 5E5UB 2OMWA 1F4YL 1WUZA 3I7NA 2ALAA 3VWJC 1T5WA 5I6NA 1R3HA 1U8QA 2R27A 3FONA 4L8CA 2PP9A 3QH3A 3HHRB 3WSQH 4I1PA 1B0RA 1SEQH 3SYOA 3KS0J 1F90H 1UKSA 4KWUA 2EUVA 1LMIA 4UIKH 1HESA 3MCYA 2JKNA 1E2VA 4LCCB 5B21A 3MJ8A 4EBQH 1CQYA 5IFHL 5CP3A 3B9VA 1WEJL 4Y5VB 3WDIA 1PG7X 2A73B 2XVBA 2P47B 1JWSA 3DSNB 5AG8A 3K27A 1IFRA 4DPCX 3KPRD 1CGSL 4TQPA 4X0NA 5F7NC 1CL7L 1N2RB 2MNWA 2ZX7A 2WVSA 4CGUB 5E00A 5GXIA 2EDRA 3FMGH 3NCJH 2X6VA 5AOJA 4RX4D 3T0BA 5FS5A 4A11A 3KLDA 2XFXA 3X17A 1UXWB 4Y4HA 1SQJA 3M17B 4LBAA 3DJTA 4AT6B 3TH2T 3OXSA 4LDOB 1GCFA 2B39A 1G6RH 5EO0B 1MHPH 3OJMB 1RJYB 4DF9A 3L2LA 1J8SA 3CXHK 4AJYV 4EIUA 4RAHA 3LRSA 3ZRCC 3RNKB 2J57G 4A0AA 4P5MB 2H1PL 4QAMB 3ULEC 2BNRD 3BX7C 5I6OA 2ITCA 4F7PB 3QH3B 4LMQE 5B3SB 3HCVA 1MAJA 1OVZA 2V2WB 5BVJB 5IR1A 2NY1B 1FH5H 3P11H 3UXFA 4NAQA 2D0FA 3VYPA 4Q6KA 3HNTL 4ACPA 2VXUH 4WV1C 2FWOA 1NL0L 3WAJA 5EM2B 3UVMA 4XPBL 1OQOA 5DFVC 1Q9KA 3EAKA 4OD3L 2O6DA 2AS5M 1A12A 4DEPB 2Y06H 3D3VE 4P99A 3NCJL 3SQBA 4EUPH 4JR9L 4JFDB 4X99A 3QIWD 2YBAA 3QIUB 3RGBA 2BHUA 4APQC 4EUPB 5B39A 4CZVA 4YXLL 3U2SB 2L04A 4NRXA 3KPSE 4LE8A 3ZBMA 3IS0X 1GY2A 1T83A 5F9JA 2NX5D 1Y6NR 4WTZG 3Q01A 5MEOA 4ZAKB 3COOA 3ARDC 4IRSA 5GZNC 4KH2A 3KJ4B 3GNML 4GGDA 4MQSB 4WWKA 5D96B 5A3ID 5DD5L 3V5KB 2XQBH 4S1RH 4AQ8A 3F3HA 3O3EA 3LRKA 4FXKB 3QXTA 1OKEA 2K9FB 4TSAH 5HHME 3I7KA 1YN7B 2YO3A 1VZGA 4Z5RB 1KN2H 4JCWA 1PG7H 3WIHH 3ILPA 1E50A 4U2ZA 4CDHA 5KS9A 4UU9A 1VERA 2J1YA 2NUPB 3QO0B 3HC2A 4HCGA 4NPJA 5I0VA 3UBXB 5IMOB 2EDHA 3OKLA 2CNZA 2FEEI 4J86A 1HQRB 3B2UD 2P8PB 4RNRA 4B9ZA 4YSCA 4KI1A 5CHNA 5J1TC 4BFOA 3BIKA 3EI1B 1PZCA 3ILDA 3PE7A 4GRLD 1PY0A 4GMBA 3HI5H 1FNSH 2CCWA 3QJHB 2AC0A 1ZLVH 1I3VA 2QJDA 3DMMD 1BA9A 4WLCA 5AG9A 3NZHL 2Z7ZA 1ZHLB 5IT9g 2YRBA 5BS0B 1T3FA 2NY5L 2KT6A 4LEBA 1OD7A 3K4ZA 5DD5H 4NENB 1AE6L 4HA1A 1GIGL 2OV0A 2ZXAA 4G59C 3VXNA 3GGWA 2PM6B 1OLZA 4L9LC 3VQMA 5ESAB 3EQ9A 2P9IC 2ZOKA 5MP6L 5HDBE 5SV4A 1IAIH 2H13A 4PVMA 3O6FC 2V3DA 5GS2H 5KBPA 4X50A 1U58A 2WBJB 3IF1A 4O4YL 3K2UL 2EVHA 4BGLA 2HT2D 1G9NH 1S5IH 4GRMB 5AW8B 1IBGH 2OCJA 3MOBH 4FMFA 4NO0A 3SDDC 4GI6A 5HHNA 5FKRA 2H3NA 2AK1H 2XV6B 2MQ0A 3JV0A 4N4YB 3BUPA 4ZO8A 1UADC 1QQDB 4FXTA 3SBQA 1JMZB 2YNPA 4ERYA 4IBTA 3CZEA 12E8H 2YC1B 3MLWH 3GSWA 4QY8B 5DFTA 1ZT7A 3QC6X 1RP9A 3L4CA 5MEPA 2OULB 2XIBA 1KWKA 4BUQA 1OGSA 2ZCKH 1FNFA 1M1XA 5IJBC 3RNQA 3OX8B 2Q10A 4P2RE 3CK0H 2NDFA 3T4YA 3PPEA 1A4JB 1BJ8A 2BHZA 5HDWA 1I7RA 1QUPA 1I7UB 1RIHL 3QYMA 4A09A 3WLBB 3NOIA 3CHPA 3SDDA 3NDZE 3BEVB 4WY7H 5DHVA 3V5DA 2YNNA 3CFKA 4I48A 2AP2A 4K3EL 4NM8L 5E24E 1GPOL 3J2PA 1E8ZA 2X3BA 1E3FA 1HJBC 1SHSA 5DJ8B 2WWOA 5G4NA 1SVZA 1D5RA 2R56L 4H2AA 4JFFE 3K2UH 1KZQA 2Q7AA 4C56E 1EFXD 3OKEA 3S5LA 5LGJB 4F7TA 3ZWLB 5MENA 3P30H 1HVXA 4KDVA 4L1LA 4ZFGH 4JKPL 3JXAA 4F58H 2IQ9L 1CDHA 1L0QA 3GHPA 5F9WC 1DYZA 2B3RA 2EINB 3QIUD 4AQ1B 3A0FA 4AM0Q 1P4BH 4G5AA 1H0DA 3FW6A 1J9CT 3LN4A 1MFAH 3AXLA 3L95A 4JB9L 4KX8A 2OVPB 1W72H 2IPTH 8FABA 1AHKA 3B4NA 4PCTA 4UDTB 4KKNA 4X8XA 3ILEA 5F9JB 3WEMA 1D7CA 2XPYA 1RHFA 4JUTA 4X4XA 4EN2A 5E4IA 3KHOA 1OGAA 2J2ZA 3IFOB 1QFPA 3ULUD 2OMUB 1BM3L 3TWYA 1C8PA 1FN4B 1FC1A 2GJJA 1JNHA 4K7PX 2G60H 5LGYA 5H35B 1OGAB 2NXZD 1MG2C 2X28A 3BESR 5A16A 4Z7OB 2YZ1A 4RFEB 3MKKA 2OMTA 1R5IA 4LO9A 3US0A 3IKCB 3QORB 1SHMA 3F5WB 3O9WB 4H8WH 2V17H 3H42L 1K8IB 2B5LA 3KEDA 4E5ZA 2AJ3A 2AXGB 2B5IC 3MV9E 5C0JB 3KYOB 4QJ3B 1EXHA 2C7UB 2Z8SA 3QXAB 4S1SH 3NMEA 2A5UA 2YPLA 5B7FA 1UOLA 3DX6B 4X5PA 2WQRA 4YUEL 1XCTA 4FYSA 3AG2B 3HS0C 4H25A 2CN3A 2E6PA 3ZO0A 5D7IE 3WXWH 1SBSH 1IC7L 4DK5A 4GFXA 3I9GH 2ZJSL 3PGDB 5F3HA 3ZIYA 3E3QC 2AEIT 4MD4B 1JGDA 4TMPA 5DK0B 5HHQA 2UX7A 1T3FB 5ITFB 2CJUH 3L16A 1EDYA 1JNLL 3KXFB 2XWDA 4NO0D 5I5RA 4F24A 4WSKA 3E8UH 4X6BB 3F04A 4W6YB 2I60L 2BNUB 5ITFA 1FPTL 3RN0D 4OGZA 4X6DE 3VWKC 1UTCA 1XF2B 4PM1A 3GTVA 2BIIA 2WW8A 2BWQA 1PF3A 3BVXA 3MFFA 3QR0A 4GS7B 4UM8A 1TLKA 1CZ8H 2ADGA 1D2PA 3A4FA 2DBLH 4QGYA 4OUUA 3AREC 3D51A 3DGGA 1N0XL 5KVEH 5IMKB 1AANA 5GIRB 4LCYA 5D1ZA 3QUXC 4OZGB 3NVNA 1N19A 2DQJL 5T1LD 1RZPA 4HJJL 3EYUH 3BG1A 3QEGL 4PR5A 2H8PA 3DDGA 3MLRH 3QB7C 1GAFH 1N6UA 2RB8A 1R1CA 1KGYE 2X2IA 3EDDA 4BDVA 5GRXG 5IMMB 2CE9A 3IDNB 5TF0A 4PJHA 5D1XA 3B9AA 1S7WB 3VGGA 5H35A 3VYNA 1R5MA 5DEFB 3SHFA 2AJUL 4QRUA 4EE2A 3I2CL 3SDAD 4I79A 2DWXA 4BSVB 1WTLA 4X6FA 4F8LA 1RV6X 2EYTB 3KPQA 4Y16D 1MPAH 2H2PD 5CJXC 4XVTL 1IGTB 5D6DA 3MLPA 2IWGA 3D39E 4L9DA 3AREA 2W5PA 1WZ1L 4Y1TA 3FQNA 4JFYB 1AGEA 1MUJA 3QUXA 3N04A 3NIGF 3KPQB 3FF7A 3PL6B 5IESL 5ICZA 2KZBA 3P73B 4ADGA 3K6NA 5KZCD 2Y6TE 3X12B 4BH8A 2E6JA 4OF7A 3ZR6A 5IFAL 4QHUB 3REVA 3BLBA 3TT1L 5C9JB 1XF3A 2EYRA 1E5TA 4ZFZB 1P6AB 1QNZL 3F83A 3VW3H 4N2FA 5GRJH 1O9ZA 1F18A 4AK1A 2QT6A 5EZIH 4BCXA 2QR0B 4DGWC 5LG6A 3A6CH 1BMGA 4U1LA 4AIZA 5IVNA 1HL5A 2ZAHA 1YEEL 2GJZB 3CQPA 5CJ5A 4RQQB 2FZ3B 3MODH 4DP4X 5IROD 2H6NA 1JV5B 3PV6A 1M42A 4MLIA 4ZO9A 1JV2B 4PNKB 4XX1G 2ED8A 4MAZA 5I8EB 4P4KB 1V10A 3O6LL 3UBFA 2Q7YA 4N22A 4PRDA 2NUTA 3EJTA 3B9DA 2CRIA 3JWNG 1WGVA 5FF6A 2VC2L 2VDMB 3PGFH 4J4PD 3U4EB 2IMNA 3L1FA 2W95A 3S48A 3BT0A 4BK4A 2PN5A 2HTLC 3DPDA 3ETSA 3OKKB 3VFVA 5ERWB 4PGCA 4WWPA 3WD5H 3KLQA 1UD2A 5HDRA 4R8WH 4HUXA 2BNQE 3TF7C 4TLKA 3TPUA 3V0DA 2Z2OA 4MJID 3MN8A 2QADB 3E7JA 3MXVL 2V5SA 4IIQB 2R2BB 4ELDA 3TM6A 3NH7H 1TJGH 2YPKA 2P9KC 5LQBL 4UIMA 1Q72H 1T22B 5A7EA 4QHUA 2YQBA 2OYKA 3N1MC 3REVB 2IBGA 1J5DA 1G6RA 5T3ZD 4MA3A 3WXVL 2JXMA 3RWCB 3HZYA 1J8HA 5EUOA 3P0VH 1TZHB 1EV2E 2R2HA 5E6RA 3VXQA 2A6JA 1U91B 2UXTA 3N44F 1VYHC 3RTLA 3DSFL 3S88H 2P5EA 3V0JA 3QQ4B 5HVHB 4P23B 2F7RA 5JMRA 1NKOA 3QQNA 3FCUB 5TTRA 4FNLL 5IGXH 3QWRD 4RMSA 2AZAA 3DARA 4V1DE 4XPAL 1QLRB 3EFDH 4L3CA 1LD9A 3DM0A 3HLAA 1QAWA 3BAYA 5GRUL 3MRLB 4Z3GA 4KJPC 4LMQI 3KPRB 4MB5A 4ODTH 2AV7B 4XVJH 4BZ1H 1KCVH 3LN9A 5CSBA 5BZWB 5FPIA 1H6FA 4CY3A 4XXDB 4F37F 2GVYA 4PREB 1V05A 4J2XA 1U8MA 5FAAA 3BRGC 4U1HB 3GI8L 1NPNA 2X6BA 4FA5D 4M61A 1R17A 4ES8A 5INDB 4HUXB 3DGGB 5A3IC 1BOYA 4QRPE 4R4FL 1L4IA 3OB8A 1CFNA 2CBMA 4MJHA 4ERSL 1FVEA 3G5YA 1SUHA 2NMSA 4WSJA 4ELKB 3CFNA 1AG6A 5LB1A 1MCOL 4UTAH 5C09B 1W0VB 2H32H 3MLZL 1P2CB 2DKMA 2NUTB 4GT0A 4M7LH 4JFPA 4C83A 2WNKA 1DQDH 2FLBT 4Z0BL 3QEUB 3HC3H 1SEBB 2WLJA 4OLUH 4O00A 5EH1A 2EO1A 3OPUA 5HY9B 1R6VA 4OM1L 2NY1D 2X41A 5DT1L 5FWQA 1FNAA 5IVXB 1SMOA 5B39G 3IVMA 2AXJA 3SJVB 1TYEA 3CVBA 3MMEB 4CVXA 5GRUH 4J6IA 1G1YA 1SJHB 4KY1H 4DN3L 3CSFA 3FB7A 4WU5B 3V0VB 1UA7A 2WZPD 5E8PA 1MVFA 4NN7B 2B1OA 4PS7A 4NO5A 4D8OA 4PN6A 3GMPB 4BFEA 3I9IA 3GK8L 1QSEE 5KG9A 4WK2B 1F86A 1XEUA 3ASWA 4N1CA 5C9JA 5HYSA 1GXRA 1OIOA 2X9XA 5I6PA 2H3KA 1E6JL 1U3YA 2J3SA 4DZ8A 1J9QA 5E6SB 4G82A 1MCIA 2PPAA 3LS4L 1Q9KB 1QRNE 5DRZB 4GQPH 5I6XC 4J5VA 2J12B 5JW4N 5SWZD 4N2EA 5ANMB 4MDRA 1BZQK 4G8GA 3NVQA 2JI2A 1CD0A 5IB4A 4X80H 4JLRB 3BXNA 3K7UA 4KRMB 4PRID 2VDQB 4LBEA 4TVUA 5B1AB 1JD7A 3U6RB 4NQDA 3MLXH 4MJIA 2WTRA 2E0PA 3KJ4C 3KRWB 4LL9A 2FX9L 1ROWA 5E1HB 3TA3A 2X6AA 2FIKA 3QE5A 1O7VA 4DP0X 4YBQC 4Y4KB 2ROYA 4ZDHA 4AK2A 3B5HA 2F8OA 3U0TB 2QKIA 2FX7L 3DYMA 2A4CA 3KM2A 3T2OA 1SDDB 2VXSH 4YPJA 5L6YL 4JJ5A 4XCFL 4KBPA 3I74A 2HT4D 4YHOH 3QQDB 2YUZA 1SPDA 2XDHA 2CHNA 2EIKB 3IDXH 2CPCA 4B3EA 1P7QD 4NRYA 2NY1C 1ZE3C 1YEDA 4PS8A 5D8JL 3S9DB 2BJMH 3SDAC 4ZXBD 4Y8AA 3N0EA 5DSCB 5LAPA 3D09A 3MRJB 3PFQA 3TU6A 4LLYA 3VTAA 1EEQA 3TWCL 4LPYA 3PWPD 4IRJC 1ZWIA 4HC1L 3CUPA 2I5YL 3DO7B 3UZEA 4MXVE 3UO1H 3MJ6A 3EOAB 3M1CA 5IFJA 2E27H 4G42B 3S3BB 2AV7A 2XQBL 4S1RL 4F57H 4FGMA 1NBVH 4PB0H 4U1IA 5FYKD 5DJAA 4N68A 4ODVL 3DDFA 4HAGA 4Y4KA 3MFGB 3CMGA 1P9MC 4Z8FL 35C8L 5SWQA 4DEWA 5F7UA 2EVFA 5FKPB 3UR4A 4NSKA 3VGDA 5BO1L 1I8KB 4PTTA 3TGXA 4AOFA 1MNUH 3W0WB 4AN0A 4FEIA 1KTKE 1MJ8L 4UM9B 1TMCB 2Z1KA 3JVGA 1SN0A 1FFOA 5ALCL 2DJSA 4OJYA 5GZND 3OAWA 4K5NA 4WQOA 3RL2A 5FFGA 1X44A 5DXWA 5BS0D 1N70A 4IJTA 3WENA 3ULAB 5TDPB 3PL6C 2WWNA 3RRQA 4F7CB 2HKHH 3ERXA 5DJYB 3EYFB 5JMOC 1CO1A 4HHGA 3DPBB 1DQLL 3CV5A 4OCRL 4Y4FB 5EO9A 4B9KC 3ESMA 3MRBA 5BUGA 5IMLB 3ABLB 1AG0A 4B5EA 2GC7C 2OMYA 2BNQB 2F53E 3EYFA 4RMUA 4UT9H 5F21B 4U6XB 2J7LA 3KXFD 2OXGA 4Y4KC 4E9XA 1PZSA 3PQYB 5D2NC 3VH8G 4G71B 5CNHA 4P23D 2NYYD 3EF4A 4PW4A 3ZKXC 2CCLA 1KGJA 2AXHA 1WAAE 5GGQH 1OAQL 4IU3B 4JRYA 4WKXA 3O4LE 4FZ8L 4NO5B 5JA9A 1ZLSL 3D7PA 4WJKA 2HFFA 4XNZB 1S9VA 5EWIL 3VSUA 3WKNA 3X1NA 3OKEB 3S5LB 2P5WA 1H3PH 3K4DA 1SNRA 4N0YL 4G8IA 2NXZC 4PYHA 4WFFE 1IVTA 3NFPA 1R24A 4P46B 2X0UA 4X5QA 1X6LA 4Z7QB 1QLFA 4NOBA 2DMHA 3UPRA 2JK5A 4NLHA 4XN9A 5EDXA 4HISA 1F4YH 2ICES 2N01B 4LSQL 2PF6A 1F02I 2XJKA 4WCYL 1Q9OA 2FRGP 2CU9A 3BT2H 2OL3H 5I71C 2F18A 1EAQA 1NGWA 4OSUL 5E8NA 2G2RB 4N6RB 2PW1B 2WZ0A 1K8DA 4JPWH 3KRXB 3RJQB 2WKLA 2ICWJ 1RL1A 1CVRA 3LXBA 1KPUA 2B3IA 4XZUB 4DUWA 4P23C 1EXGA 2VW7A 5KANI 4MSWB 3LXUX 4MNQA 2E5EA 2F7QA 3DXAD 2L3BA 2G9HA 5CP3H 3RVXC 4YHKH 1PG7W 2FLMA 1S3KH 4NKMA 4E9YA 3D12B 1CGSH 3KLKA 1UFUA 2VDKH 2W8CA 2IUQA 2VDLL 1AKPA 1KB5H 1OAUL 2KERA 4U1GB 2O5YH 4UB0H 3RVWC 2HJ4A 4XCNA 3S34H 5CLYA 1ZLDA 3P30L 5F1OB 5H4YA 5CEZL 1FCCA 1FRGH 5GGRA 2WBJA 1XGQA 3WKPA 4Y2NA 3CZUB 4UQ3A 1JYVA 3D08A 2GIYA 4H8PA 3D69B 5A2KH 5HHNB 3IJ8A 4FQLL 1FL5B 3IJ0A 1I9RL 4BEIA 3KH4A 4WKZA 5EBMB 2P9RA 1BEYH 4Z76B 3DOHA 4IQHA 3MROB 4ADIA 1NBCA 2W59A 3BP7A 4MB4A 3UL4A 3O3UN 3OQ3B 1I1AB 2IAMB 5TQ2H 5EMLB 4L0ZA 1T1WB 2F5BH 3CGTA 4AENA 3RUGF 1CFBA 3GC3A 4XZUA 4NUGH 4XXCA 2UUDK 1H15A 4KPHH 4MKTA 1Q8MA 1QRNB 3CLFL 3KPMB 5CN2A 5BS0A 3CFEA 1YNTF 2OFQA 4AIXA 2WB7A 1XTLA 3IFLH 3VFRB 1YPZF 2WXKA 2H45A 2M26A 3BN3B 3ZE1E 3IGLA 2L4OA 2ISDA 3VXPA 3EH1A 2A73A 3GI9H 3ZKNC 5GGVL 1OW0A 1A6TA 5KN5A 3FSOA 5F7LB 2E9JA 2HP4A 4I4WA 4U05A 3QHFL 2JCCE 3TJHD 5FYKE 4PJDE 5DUPL 3TBSB 2ZQKA 4WWKB 2FT7A 5E94B 1INQA 3SCMB 4KVCH 3SE3A 2WSKA 2XL3A 4FFWC 1L3WA 4G6JH 4NZTH 4DEUA 1NLDH 1E43A 5DHVB 3TYFA 2F5BL 2KLRA 2ZP0T 2ICEB 2RR3A 4NQXA 5AZEL 1MZZA 5LBSA 3FF8A 3DVNA 5E2JA 1IQWL 1FFQA 1REIA 3DX6A 3VFWA 3TV3L 1QKZL 2CE8A 4YDZA 1IX2A 3MJ9H 2XWXA 2EC9T 1F56A 2A83A 4GO9A 1JGUL 1U3NA 4ZOAA 3S37H 3U1SH 1FFPA 3U7YL 3QORA 1TYQC 1E5UI 4IBQA 4FZEL 2DM3A 1HSAA 4N0UB 4DVRL 1M7IB 5E2WH 3V4VB 3RUGB 5BNXD 1GOHA 1OQXA 3MLSH 3FL7A 1TIUA 3SHSA 2QTVA 3KPLB 2X4TB 1UWXH 1P7KA 1KELL 3QHFH 1G87A 2DOCA 3X11B 4KKBC 4UDTA 1P0SE 5D93B 5DD6B 3BGMB 1LP9E 3RN1D 3S35L 5F7EL 2CA3A 4NQEA 1S7SB 2EJ1A 3FK3A 1CFQA 1XIWD 4G6JL 3SJVE 1ASPA 3MLRL 4GMSH 1MHPL 3WMPA 3BZ4B 3A5VA 3WLWD 1TZOA 2F53B 4DVBA 4XEIC 1IAIL 2GY7B 3K6FA 4MWFB 2EUZA 4GB9A 4MMYA 4YWGH 3DVIA 1W8NA 1CTMA 4AJWA 3ETTA 3O4GA 1OL0A 2RA1A 5CINH 4QHMA 1INDL 3RWHB 5TK2A 3VM7A 3FQRA 2WQWA 4JKKA 5JW3L 1CD1B 1KTDA 4XN8A 3CVHB 5DFVD 2FWLB 1BZ7A 3U0PB 5DC4B 4V1DA 4FQIL 2XBTA 5HYFA 1M57B 1A7NL 4XPFL 1K5WA 4EN3B 3J8F7 4DQAA 1QHPA 3NESA 4LSUH 4J3OH 3CZSA 4W6WB 1GSMA 4L8SC 1QTSA 2BP3A 5CBAB 2B5IB 5F44A 5A2BA 1AGDA 2DMKA 1X9QA 1FO0A 3ECBB 5E5RB 4OLZH 4A2LA 3SODB 5A6LA 2DRUA 4OJFL 4LASL 5F3HB 1I7RB 1D6EB 2WXHA 3CN1A 4FKKA 4Z7UE 4XHQA 3FFCA 4MD4A 5DK0A 4F5CA 1B3IA 3NJMA 3PXTD 3ZE1A 2DLGA 2DYSB 4PJ9D 3SQOH 2I0SA 3NP3A 5BQ7B 1VGEH 3WS3A 5LAXB 3K6SA 3HUJA 4Z0XA 3MBWB 4B5ZA 3QZWG 2X70B 5ESVB 4ZS7H 2BVUA 3ZGHA 5I17A 3OGCA 2QMJA 3MRPA 4ONGL 4PBYA 1INDH 1OAXH 4XPHL 4ORGB 3SE9H 4K7FB 3QULA 1ZHKB 2IADA 2VDRA 3VX0A 5BMFL 2Y69B 1KULA 4AL8L 4Y2OB 2E7CA 3BH9B 4NKOB 2X4QA 2XXGA 3FAWA 4Y4FC 4AGNA 2HN7B 4HKXA 4HJUA 2ZUQB 1FNGA 1JGVH 2CGYA 2BW5A 2AJVL 3VXMB 3FQNB 4JFYA 4Z7OF 3W3BA 4ZX5A 1DUZB 4FTDA 3W56A 1WZAA 2V2TB 3LZOA 4OJFH 2XFGB 1A1NA 2A3TA 1DBKL 3ALWA 1XGRA 3P9LA 3HKFA 3SGEI 3GTTA 1I1RA 4QO1B 1PVHA 3IDYC 4XBPA 4DP6X 1QR4A 4KKAC 5IW1B 4QCIA 3BSZL 2E7DA 1OARL 4K7PY 3SE4A 4AL8C 4BQ8A 3BE1L 1AIFA 1OSZA 4MYPA 5KVGL 1X5JA 5E6UA 5H1MA 4J4PC 2JB5L 3WE6B 3ZL1A 5J3HD 3A4EA 3U82B 1F58H 5HGHA 4H8WL 3M86A 1E27A 2ZXWB 3ZY7A 5D7LD 3PQYE 2MIZA 4KJYA 4R3SB 2Y1AA 5JHBA 2VXUL 2Z93B 1OCCB 4XWOD 3I6GB 5ICXA 3VD4A 1E4KA 2GG1A 2APWA 5TK4A 4YBLC 4CRPA 3RKDD 4B7LA 4XAWL 3KNBA 1LO2L 3TBTA 2KPNA 4IBVA 1UT1A 2EO9A 4B53A 3N55A 1E65A 3PS6A 3ZIMA 5T5NG 1JXFA 2ZCHH 1UWFA 2APFA 4AGLA 1Z3GL 1JPGB 2BNRE 4B50A 5EU4B 5J13C 1WFNA 3ATBA 3UGUA 3BFOA 4M1CC 2XKSA 3VXMA 5IW6B 1OGTB 4XTRC 5IVZB 5DLMH 3MRGA 5IJVB 5D7IB 1PSKH 5J1AB 1H3UA 2MQCA 3K4AA 4M62H 5JHDA 1A3RL 4UTAL 4JEGB 3VG9C 2R69H 5C6WH 1XGRB 2GITB 1TYRA 3P9LB 1SY6H 4WFGD 1N68A 1H9DA 3D85D 1DQDL 5LKNA 4M61B 5FDWB 1XBRA 3NA9L 4MB3A 3C8HA 3NZ8A 2V7NA 4OTXL 4A38A 3HZVA 4JFXA 1DO5A 4P2RA 1OPGL 3QDHA 5AWNL 5T1KB 1YNKH 1NMBH 3NFNA 3B2PA 2WGXA 4X6DB 2GTQA 4BQ9A 5ADPL 3RWGA 3A4AA 3UJIL 3IJCA 3T3PE 3D30A 1VGKA 1M7UA 2NY3B 4TV3A 1LQBC 5DJCB 1TO4A 4K73A 5CF3A 1UM4L 2DQ6A 3IM1A 1INEH 4IEFA 4WEUD 5CN1A 3ROLA 3ARWA 3KL3A 4X5XA 4NYLA 2ATPB 5E6RB 2GTZB 2HFGL 4MDJA 3QUXD 3LZRA 1KXQE 3EQ8A 5DYOA 5SX5H 3U0WL 2R7EB 3CAFA 3GHBL 3AG3B 1GMEA 2P43B 3DBXB 3SD5A 5AKRA 5B1JC 1SFDA 4XX5A 1MCSA 1QLEH 2B08A 4UNTA 2X4OA 5TE6H 4CGTA 3ILQC 5I2IA 4JFED 2CGRH 2H14A 4HOWA 2VMDA 4LSTL 2OK6A 3FTXA 1A8JH 4IS6A 4Q9BA 2YWZA 3BVTA 2AEPL 1JBJA 4WFGE 1O7DE 2OJEB 3ABKB 3QYNA 5T5NF 1JL8A 3D18B 5AD0B 1BZEA 2DYRB 2WO3B 3KXFA 3U2IA 4WWKC 3GBML 1B4TA 3BWAB 3AC0A 1M2OA 1II4E 2IANE 2F74A 2QHLA 2B9AA 5C0ND 2LU3A 3D06A 2HRPH 3QDMD 3SBWC 4UOZA 5D7IF 2Z8VC 3T9WA 3QIWC 2IAAC 4QWWD 2I32A 2Q86A 3A6CL 2HWZL 4XAKE 2W0FB 4OLVL 3O6KL 1UC6A 4GKSB 4YX2L 1IC4L 3ROOB 1Q0YL 5T1MB 4Y2LA 4UNVA 1UENA 2UYLB 4PB9L 1MJ7L 4MMZB 3CK0L 3ESNA 4R7AB 4TLTA 1GMIA 3HI6H 2C3GA 3NIFF 3PQYD 5F9OL 1QEWA 2X1OA 1LWRA 4QOKE 4XB7A 3WJMA 4XN2A 3GF8A 4J87A 4YFLF 3SJLD 2Q5BA 2QHRL 3OGOE 5JPNB 4UT7L 2ZKWA 3IJSB 2BXZA 1WWCA 1PIGA 5I23A 2HPTA 5A2FA 2WNGA 4WW2F 1F6AB 5HHXL 2FYYA 4AGQA 2BNQA 4K23L 4HXBH 3VQLA 5IOPA 4O2FA 1J0HA 1TTRA 2C3VA 3IMRA 3TWCH 3UTQA 4F2ME 5CCKH 2BVPA 4HK0A 4I8DA 4FJYA 2GC4C 3CQFA 4N2BA 4L1MA 4X7DC 5ABZA 2IQAB 1YY9D 2I85A 2AW2A 3DOSA 3LY6A 4XPTH 5HD8C 3MV8B 4J3VA 4AYGA 3A67L 4L4VD 4CVXB 2Q2LA 3UVNA 4R0LA 1VFBA 4S0SD 2I9TB 2WOYA 5M5RA 5J7CC 3EDKA 1JN6A 1I1FB 3MV9D 1ADQL 3NGBB 5FCSH 3DSFH 4DKFL 5I16B 2BVOB 1VZHA 3CUPB 4WUUD 3T3PA 4X5LA 4X9GA 4BH6A 4AH2A 2MHAA 4OW6A 4HWBH 3WFDH 1LVEA 3WTXA 4FFYL 5BXFB 3UG4A 3UGXA 2HG5A 1ZMYA 5JHLH 2I69A 4XPAH 3T1FB 3WTSA 1WVZA 4NIKB 1G94A 4FP8L 3GTNA 3BUTA 3CHXA 1TZAA 4A7SA 2E56A 1IBBA 2AV1B 2EDLA 4I85A 3VWJD 5DYFA 4P2QA 4AQAA 3ARXA 4GQRA 4AE0A 4L1SA 4D8PA 2HKRA 3CFEB 3NRQA 3PGCA 4HSAC 3L1OH 1A6UH 5EU3B 1ZTXL 2LABA 4OZFG 1QASA 5AVUB 1VACB 4AYSA 4EXPX 1DLFL 3IMUA 2X09A 4XVUC 1H6UA 5AAMC 5EU5A 2R23B 1MJJA 1YNLL 4G8FA 4PJIF 3T04D 3DX4A 2H41A 1XT5A 3T2NH 2A6IB 3AQYA 3VQ2C 3NCCB 5FKAA 1UB5B 1FVDB 4F7MA 2EEBA 3EYVB 1J12A 4PJ8D 5F6HI 3GSWB 4YMPA 4GBXC 4EI5C 1UOKA 2CSPA 1PZBA 4M02A 4UTCA 2Q6WB 3ZU8A 1G7JB 4Y1SA 1VDGA 3I9GL 4E0RB 4AEIH 2VW6A 2N4IA 5EN2A 3EI4A 3BEWA 2D0GA 3HKZA 2VSKB 5JHLL 4HIXL 1BAFH 3CX5K 3KVQA 1I1YA 2V9QA 1I7TA 3I02A 3WNPA 5B1CA 2R2EB 3MJ9A 1EJ6A 4TNFA 4HS3B 3B7UX 3VQ1C 1HDMB 1MI5B 4AJ0A 3WUWG 1O6FA 3QQ4A 4TPRL 3TTYA 5KJRH 1HH6B 5AW1B 4A7TA 3RL1A 3PGFL 4E54B 1DLFH 1LK3H 4A66A 1B4RA 1D5XA 3H7BB 2NSQA 5ACZB 2BBKH 4HX1B 1QACA 4TSCL 1WK0A 3IU4L 4A1RA 3QUHA 4EDXA 1CL7I 5B8CB 1GZQB 3MNVB 4HZLA 2XG5A 2K8QA 1G0XA 3SKJL 5E8NB 3SOBH 3QUMH 5HYQA 1EFQA 1LK2A 2BSSA 5JYLA 2C9UA 4NWTL 4CJ1A 4ZPTB 1A14L 3CPLA 4HJIA 2YIHA 1U93B 2XTJB 4CKQA 2AV1A 2ODHA 1U8IA 4TLUA 2Y5TA 3F85A 1OTUC 1MKFA 3HJEA 4NNPH 1QFOA 4PV9B 3BPLB 5AVWB 1DJIA 5TFSH 4CW1B 2A4EA 1HOCB 4LKCB 4Z3HA 3S3PA 4OFYA 2OJZH 3QJSB 1HQ4A 4ODBD 5DHYA 3RTQB 4O02L 4Q9CA 1R3JB 3ILQD 2WXIA 4Y7OC 4YSRA 4BV1A 4LLVA 1KLGA 3GO1L 3UPRB 3F7VA 1I9IH 4ZBJA 5F3BA 5CGMA 4HAKA 5HGAB 3B1UA 1S7RA 4KQ4H 1LK3L 4KJQC 3RDJA 2HKFH 3W57A 2ENSA 2P80A 4OI9A 4MJ6A 4L4JA 4XVJL 4F7EB 4ZFFB 3OKDA 2QFRA 5ENWA 1GZHA 1RZKH 1DVFC 2DMBA 3LV3B 5C0DA 4IRJD 1RZGB 2N56A 2NDGA 3GZPA 4YEFA 2H6KA 1NWOA 3WAKA 2COVD 1S8DA 1OTTC 3L6FA 5A6MA 3N0AA 3M6DA 4ZX6A 4ZMQA 5GJTH 4GSQA 2EE9A 1T20A 1U2VC 2M8XA 2GNQA 4NP9A 2WSDA 1HKLL 1MCNA 4UINL 5D1XD 3WN6A 1BQRA 3CFDB 4XN4A 1AXTL 1CF8H 4JO4L 3O3BB 4J3OC 3WEBA 1NJ9B 4YE4H 1G9ML 2XN9B 5EBGA 4ODHL 3MLYH 3B1TA 1K2DB 1SHXA 2O5ZH 2VLKB 3PLYA 4KVCL 3CHSA 4X42A 4ZSOA 1AD9A 3MCKB 2VDOA 2BP8A 4LVHC 1R0AL 3UAJD 35C8H 2HMID 2UXFA 3MKQA 4GW4B 1ZVSA 4DSYA 1CXLA 4NSKB 4LNVA 1JZ7A 5TE4H 1J05B 2I9LB 1UJ3A 2QSVA 3V4VH 2HLAB 1EAOA 4N3TA 1CGWA 4LP8A 3LJ3A 1Y6KR 4IBZA 4FI7A 1CURA 2H0FA 3CDFA 1E8XA 2NT1A 4PS4H 4ZUWB 5HD8D 1I8AA 1FIEA 3GM0A 1HQRA 2DL2A 4RNRB 5HTSA 4RRPM 1P5VB 1DQLH 3FCSA 1OK8A 3ZE2A 3QISA 4LSRH 5C0AA 3Q06A 1MFBL 2DQTL 1FFNA 4L8BA 3RTQC 1CIUA 4L1DA 3QS3A 3ZDZE 2OS7A 3O4OB 3UC0H 5AUMA 4OFIA 4ANXA 3PFUA 4PRBA 4FNLH 3VI4E 2JJVA 4PJ7F 3KG5A 7TAAA 4QMEA 2Q0ZX 2CDFB 3TNNB 2G2NA 1FZMA 4MASA 4J8GA 4KJYB 5I8CA 3ARFB 3T0VA 1U8OB 1HIMH 4KRNA 4AZUA 5I15H 4GXVH 5DFAA 3R1GH 1AHWC 3D69A 1DTUA 1GGCL 3HN8A 1OV8A 4HUUB 3WKYA 3MCKA 1UUSA 2Y36H 2YBRA 2CIIA 1JZ3A 3TIDB 4ALAC 3RWEB 5DD3L 4U6TA 3T09A 3T2PA 1E2ZA 5C9KA 5AAWC 3NVXA 4IHOA 5JORB 5B3JF 2VLRD 3BKYL 3KS0H 4FQJL 2FTAA 3O9WA 3OB0K 4APXB 5KYXA 2R69A 5A2JH 1J8HD 1ZA6B 2HRGA 3NK3A 4N8PA 1YCSA 2WIIA 1KLFA 3QDME 2BWDA 2VERN 5GS1A 4PWKA 5JW5B 2OL3A 4KMTH 3V0EA 3H2PA 1GYCA 5KYXB 4PJCB 2J21A 1HK6A 2YD8A 4MHHI 3L95B 2FECL 4JY5H 4P5TD 4YC2B 1RUAH 4FQ2L 2AAVA 3GSUA 4HDIA 3WCYA 4Q0XL 4CA4A 1R47A 3O6FB 4E41D 3T2LA 2CBOA 3SDXE 1AC0A 3KVDD 5J6HB 2BK8A 5HDBF 4OCMC 4BE5A 1KCRH 2I5YH 1RQ5A 5BZDA 2YFOA 3L9YA 4E41E 4PW9A 3CXHJ 4FQQB 4PJXB 1U8JA 3AB0B 3NSXA 1KB5A 3AS2A 4KJPD 1FAIH 5IHHA 2A9DA 1CS6A 1IGFL 5EU7E 2H3XA 5GSRA 2E7HA 3FPYA 3LH9A 1J9RA 3PABA 2YPLD 5KSAB 1MY7A 4G6AD 5M61A 1SMAA 3QZLA 4DEPC 4ZN4A 3JZGA 2XL2A 1NGPL 2ZUYA 2OXHB 2B7DT 1MJUL 1FO0B 3ECBA 1I9RH 4M1GL 4KTGA 1CCZA 1BZ7B 3U0PA 1JJUA 1GTNA 3ZTCC 2GBVA 3P0GB 4Z7UA 3BI9X 3M1BA 2XYBA 4IS6B 4ZAKC 4RH4A 2DAVA 3D39D 5J6GB 2O26U 1GRWA 1FLRH 4ZD3H 8CGTA 2ZWLT 3TZVB 2XXCB 5T1DH 1NSNL 4BQ6A 4XE0A 3V4PH 4P8QA 3MYJB 4JKMA 3FTWA 2AHIA 1U41A 1VEMA 4ZQTA 5K59E 3I2NA 1OARH 3MRLA 1ET5A 5DQJA 1U3HD 3QIBC 4NCC2 5AALA 5KVFH 2MQGA 3L4WA 5C0RH 7CGTA 5CZVH 1QYGL 3FSZA 3IF1B 4Q4EA 3UOAB 3M8OL 1OD9A 4LGPB 4L4TE 3IIYA 1TCRB 1ED3A 3BP4A 4IOIA 4FZ8H 3K6DA 5L6YH 2W91A 1I3RB 3T0XA 5C0AD 1IC5H 3CMOL 2VABA 1ODAA 4OGXL 5I1EH 1YMHB 2NR6C 3P9MA 1ZA3B 2QDVA 2X4RB 2H9LA 2H6PB 1RUPL 3RWFA 4AYID 4NQVB 5DJZB 2YPLB 2IH9A 3V52L 2VABB 1UWGL 5EV7A 3EJQA 2NY7L 4P05A 3CDYA 4LSQH 4ISVA 3FO9A 3FUDA 3HN3A 3FYEB 3K72A 4K94L 1IM9A 4XVUD 5FKSA 1ZAGA 5TE7L 2VDQL 1X4ZA 1Z7JA 5LBSH 3G04B 3V4PL 4FLHA 4NUMA 4I1NB 1HU8A 3DMMB 3RVTC 1BJ1J 3MJ9L 1P69B 4A7GF 3MCLL 4KROB 2KI6A 1GR7A 2IFGA 5FGCB 4WV1A 2F53D 4OZGF 4KQ3H 2YEZB 4Y19A 2P9LC 4H88H 4TQEH 4FNRA 4OLWL 2X10A 4OIIH 5SX4H 1DBAH 1GW6A 3DTDA 3Q2NA 4Q8BA 4R3SA 3ALPA 2FEJA 4BWWA 2IBZX 4L37B 5L8KB 4K5MA 4UT6A 2V5RA 2ZONA 4LARL 1KYUA 3MTXA 2DWSA 4RZCB 5HYIA 4MZRA 3D0VB 1E4HA 1AFVL 3DUUA 1JPST 5DZJA 4L29B 2R2CA 1T83C 2FZ3A 4ZMXA 1E27B 4XT1C 5HHMB 4KH9A 3VFRA 3CFBB 3K1DA 3L3KB 4FXGB 4PLJD 4AOWA 3VXPB 4DO5A 4U1LB 4OCRH 1HI6B 3EBHA 1LQSR 2F54D 5CWSB 1MW0A 4N8CH 4S1QL 5I71B 2H2SC 4O1QD 5GXHA 3HAEA 1AIFB 3LZQA 4BE6A 1KPRA 5DJ6B 3QI9C 3MLVL 3UYOD 1LM8V 2WXQA 1BGXH 1WEJH 4QR7A 2R9HC 5DQDL 3OWEA 4XBGA 1C16B 1M6OB 5C2UB 1RSFA 4GY4A 3BZFA 3S3DB 3AREB 2GTWA 3FN3A 1CWVA 2AJZB 4Y5YC 4ABUA 1YC7A 2R0LH 5BJTA 1ZXKA 4FTVE 3IFLL 4F8PA 1GGBL 2WSPA 1FO0H 1F41A 3Q1SH 8PAZA 5I1GL 4PJAA 4P2RB 4YHML 4DJMA 4JHNA 1O6GA 4M6NL 2XIDA 1AYRA 1S4UX 3DMMC 2NRDA 1IAMA 3L9RB 3LPOA 2WO2B 1JZ6A 3AZUA 1RPUA 2R1YB 1PZ3A 4W4OA 1T7VA 5DS1A 3HG0A 4P5MA 1KJ2L 1MCWW 1MJ7H 1J8HB 1LWHA 4WI8A 4ZS7L 3ZTJG 3AQZA 3IE4A 1E0OB 1PZDA 2XV3A 1EDQA 3QWRA 3UDWA 5FUZH 4OI7A 3SLED 4PBWD 3MLVH 4QHNA 2HRHA 2X2HA 1LTXA 1THAA 3MYJA 4G6KH 5EU4A 2AJSL 5I73C 1S5HB 3IMSA 4MMXC 1KG0A 2MCG1 4JRXE 3AGVA 5FHAL 4XX1E 4AQAB 3CZFA 4N2KA 3WMQA 3HBQA 3AU0A 4OD3H 3PGCB 3S96B 1VRSA 2F7OA 2IGLA 3GWJA 3JRPA 1JTTA 2WB1A 1UG9A 4J1UA 3SPGA 3CDZA 1CFMA 4GRLA 4CSSA 3FJTA 5HHVH 4B9CA 2VH5H 3WKQA 4YSSA 1UT9A 4AYEC 5TDNB 3LMJH 4KI5F 1M7XA 4HGWA 4XWOC 3RILA 2NW2B 2QLVB 2CLZA 1O5PA 1ZANH 1R3KB 1T5XB 2B0SL 2WYZA 2V6HA 3BO8A 1WP6A 4IGBC 5D7EA 5G5DA 3W2DH 5CXCA 3QUZA 2KZ1B 4LSSH 1PZ2A 3BKCL 3CFJA 4X98B 2JE8A 1FIGL 3HZMB 4JBSA 4WK0B 4X7CC 4G55A 1F1DA 1SBSL 4LKXA 3UPCA 4Z7NA 2CNYA 3M1OA 1GYVA 3AH8B 3KYKL 3V55A 4J28A 4U6XA 1KN2L 1NFIB 4M56A 2AJSH 5FW6A 3VA6A 2VDPB 1L9SA 5T3XE 4C4UA 3MKSB 4QRSB 3WE1A 5IOPB 2HT4C 5FK9B 3BRDA 1H5BC 3I8EA 3HZYB 3MRDA 3QIWB 4HWUA 1RUQL 4CDGC 4J3OD 4Z18A 1CD9B 3VXME 2BSEA 1JK8A 1NEXB 2BLFA 4M7LT 2PO6A 3ISYA 3O2WL 2WHVA 1T89C 3OM3B 1TTUA 1SXAA 2AFNA 1AD0A 1Q0EA 2CJ3A 4HJ0D 3KGSA 4H5SB 2UYLA 3FQ2A 4H20H 2J73A 4KK5D 3UYPB 2R69L 3VFVB 5HYSB 3WKML 1GL4B 1RK7A 3GSVA 1A6WH 4DQOL 2FH8A 3DX8A 1EHAA 5IQOA 4DAGH 5JIPA 1XIPA 4H44C 5CWSA 5HPMB 3MJ7A 2JI1A 3T3MB 1NLDL 1MCQA 3VXRD 3QCUH 4GBXB 4EI5B 3Q2VA 3QO1B 1JV2A 5JDJA 4U0RC 4S0TD 3U2JA 3ARGC 1E8YA 4GW1A 1S7XA 5E9AA 4TUJB 1Y07A 4YDJB 1NFDE 4OZHF 1SXBA 5J3HC 1L5GA 1A7PL 3SYQA 3GIVB 3HE7C 4X6EB 2A6KA 3VFOA 2RQEA 4FQPA 4ZT1A 4BFBD 1QPPA 2WINB 2PTTA 4DKTA 4HGWB 4YR6B 2OA9A 1URLA 4UAOB 4JXMA 4FZEH 3VH0A 4LHJB 2BFVL 2VIRA 4OZGE 3VM5A 4AL8H 3FU0A 1IM3B 3PWNA 4UBDD 1RCYA 3ZSSA 4XP9H 4RE6A 1EHXA 1B9KA 5E99H 3RBGA 4PWHA 1ZLEA 5IFAH 4I18A 4LCCA 5E00B 1SXCA 2Y0SA 1P7QA 3S36H 3DRQA 3DIDA 4E42A 5CJBA 3VVVA 4UOJA 4GQ9H 2WWMD 2EYSA 2IG2H 2CGRL 4DESA 3V10A 1YPZA 4GMTL 5TDHB 2EIEA 1ULVA 2YRLA 3CBJB 2PM9B 1NPUA 1VCBC 3LRHA 4GFTB 6FABL 4WZ9A 4F7CA 2V9UA 3KDMA 1MFEH 4DGYH 3EJRA 4OZFB 3EJYC 1KTRL 1B2WL 4DO4A 4OUOA 3EU7A 4HIJA 4CN1A 1KXTA 4HEMA 4U31A 4PIBA 4YVDA 1XCXA 5LUMA 3DV4A 4XPGH 1A4CA 4ZFGL 3PXJA 4I18C 5TEEA 1DE4B 4UV4H 5EEWA 2RQ8A 3CX5J 4AQ8C 1NR0A 1A1OB 2X1XR 2XVLA 1NIAA 1YN6A 4LT7A 3SGKC 5JW5A 5GGTL 4XC3H 2Q6WA 1QSFA 4PJDA 2XE4A 3WY4A 4BXSV 2P24B 5KSVB 4YO0A 5HJ3A 1KTLB 2CK2A 2Z8RA 2VLRA 1PAMA 3BDXA 3QJHA 3G5WA 2IG2L 3SPIA 2LLGA 2W92A 5B38G 3GSOB 4G9FB 4MJ6B 4ZTPH 5K39B 4FDWA 5E5MB 3NRPA 1J8RA 3PNRB 2WLNA 4MDIB 4DZBA 4MJ5B 1DBJL 1F45A 1X9UA 3O41A 3WUWA 1JGEA 1P7HL 3ODTA 2XNAB 4U6YB 3WIFB 1NGYB 2ENYA 5PAZA 1OAKL 4J8QA 3F2LA 3TVMC 1LEIA 4OWRA 2FGZA 4XP4H 5C08A 1EA9C 1G9MH 1QFUH 4AGOA 2DN7A 5LCVL 4JRWA 5JHAA 3ARFA 4Z5RA 3SGKA 3JQOB 1QG3A 4PJHE 1PX8A 3C08L 5D1XE 3EJPA 3UBXA 5KZCB 3JROA 1GKOA 4OJAA 4YLBA 3ZYJA 3DURB 4ES0A 2P5WD 4JAMB 1P7BA 1ADQH 3RBSA 5HHPB 4M5YH 4HUVB 2BVOA 5LDSA 1DZBA 4P2QD 2DTMH 3QPKA 4FXKA 4GOSA 1CF1A 1P53A 1PCXA 2DW5A 2RACA 4RRPA 5KANG 4G1MA 1TZ8A 1J11A 4GG6F 1TOXA 3RE0A 3E1ZA 3SDCA 3THMH 3VDAA 1JFHA 3QRBA 2OZ4A 1Z66A 2AERT 2P8LB 1OP3K 3CE1A 2ZCKL 2MWCA 3OKYB 1R3IL 1PZUB 3WOVA 1LNUB 1ETZB 1SBBA 1T1YA 1EJ8A 4A63A 5JXAH 3BN9C 2DIEA 2OL3B 3F05A 2WC7A 1WBXA 2NYKA 5AL8A 3FOLA 3ZZ1A 3DPBA 2NXZB 1VESA 2OM5A 3EJSA 1GZPB 3IETA 5BZZA 5B3JE 1A6PA 1FG2B 4M7KL 1TVHA 1BZ9B 5CIPB 3ZLQC 1ED3B 3BP4B 4IOIB 1UEYA 2ZT9C 1XHMA 2EE0A 5B4MD 1SYVA 4GRMA 4OCLC 2WWMC 2XVGA 3NZUA 1RD6A 2ROXA 1U58B 4IMKA 3HPJA 2AEWA 4QAMA 1BLIA 1XH1A 3P0YH 5F7DB 1CE6B 3IVKB 2KDGA 4O2EB 4UI2A 2V2WA 2RTTA 2EXWD 4FKEA 5FOJA 1JZ2A 1XD0A 4X8JA 4EIBA 4LPCA 5HGDB 1BWMA 4OLVH 5DD3H 3GMNA 4FG4A 4QYOB 4FQ1H 4X7FC 3ISWA 3OXSB 2E4TA 3KJ6L 3PF2A 5DZAA 3TBSA 4QLRA 1BF8A 3B9KA 3GDBA 1XR9B 2DH3A 1ADWA 4DO6A 3W15A 1F97A 2WLIB 1T2QL 4FTVD 3I6SA 5I76A 1CQKA 2EIMB 1NGXA 5DWUL 4F33B 3MRJA 2QGBA 4IKNA 2BIMA 4ZW7A 2DQFA 1NUNB 4HCRA 4OCXL 2FAUA 5SWZB 2BRRL 2A9MH 2XZQL 4OZUA 1SF5A 3ETBF 3N43F 5FXCH 1BM3H 1MN4A 1ZHNA 3FTGB 3HHMA 4OD1L 4FQ2H 4BKTC 1E3ZA 2IPKA 4G7RB 1B0RB 1A9BB 1UJ3B 1VFUA 3QIBB 4XODA 3T0EC 1RUMH 1KCRL 3U46A 2R0WL 1A14H 5IVXE 4J84A 2DQGH 3FB6A 1BG9A 2R4SH 2GJ6D 3L9EA 4JGNA 3KH3A 2DB8A 2FX7H 3J07A 4UWQB 1AD9B 5E9NA 3GSUB 4IIZA 2APBA 4RAUB 2VR8A 2WD0A 5DD6A 3MRMA 5BV7B 3BJ91 2P5WE 5L7XH 1QA9A 4AW7A 2P9SC 4FWWA 5J6HA 2DYPB 1CXEA 1SDYA 3JTSA 5EMKB 4WI3A 1FG2A 1BVLB 4JFOA 3TBCA 4NIYE 5JHDD 1HAWA 4HQQL 3V6OE 1ILUA 4CVZA 1NCUA 2X38A 3LXAA 5BUPA 3WFDL 2JJSA 3FQXA 5DC2A 5L4JA 5CMAB 3U7WH 4NRXB 1MJUH 4BP9A 3EJUA 1Q38A 1V27A 3HG5A 5BUAA 1K3IA 3AROA 3MVSA 4XWGH 4ETQA 5EBWA 2YS4A 1L9OA 1IGYB 4I9WD 2VT0A 1HHIA 1OZUA 1Q90A 2ZP8A 3E1F1 1AZZC 3GREA 4BSWA 1QBLH 3HS0B 3LAFA 4F3FA 3G6DL 4P9HC 3RZCA 1HCZA 1AGBB 3DVNB 2H9MA 1BPOA 1MF2L 2R2BA 1TJGL 3TYGH 4WUUE 3VFMB 4Q9RH 3QAZC 3WNJA 1CFTA 4IBWA 2A83B 3DURA 3QC5X 3MV8E 2JELL 2H0JA 4ZO7A 1D2OA 1WIOA 3GXDA 3APNA 1AR1C 2KZWA 1ACXA 4XMVA 4LCYB 3QPXH 4M1CD 2DI7A 5IMOA 3VE0A 1RIUH 1JERA 5FYLD 3WJJC 4JK0D 4NZFA 3U36B 3ZE1F 4FNPA 2FH6A 3O0RL 2JIXD 2VDNA 4HJJH 3CFSB 3GLZA 2J55H 4D0CB 4JL1A 1JF5A 2E9IA 1XF2A 4N25A 2XVKA 1DVYA 1KCKA 2VLLB 1RVFH 3ARDD 3NDYE 2PPEA 2EDXA 3PUUA 4X61B 1YSOA 2UWEA 2Z7WA 4JZJB 1J0ZA 4U2YA 4ZPVB 6CGTA 3GZKA 4L8SB 3T3ME 2GJ6E 5J56B 4E9SA 5KBLA 4BUHA 3SPHA 4EN3C 2Y6SD 2XRAH 4JO3H 3BUYA 3BYYA 4NC4A 2I9LA 4PJEB 2NOYA 1L6XA 3IFPB 4BHUI 4EI6A 3PIQA 3HS0A 5IQ7L 1D9KC 1FVEB 3G5YB 3W11D 5GGQL 4Z76A 3I9PA 5LGHH 1DFXA 3GT6A 1MFCL 5BV7H 1ZT7B 1VSCA 3F6JA 5JPMA 4G9FE 2K3HA 4HWZB 4ZMYA 5AB2A 3GKZA 1KTCA 3X1GA 1MFDH 1B0WA 1YMHA 4AENB 4Z7WA 2ZOLB 5J1SC 1MIML 2JKWA 4IDJH 1ZLWK 3W9DB 3SDAA 5GGRB 4ODUA 4ZTOL 3EGDA 2BZDA 4F1ZA 1RIVL 2XWCA 1I3UA 4YAQA 1QBBA 1Z32X 3MRNA 2DLEA 3GFUA 2DQCH 3P9MB 4U1JB 4OD2B 4M1DL 5E2TH 2XWEA 4Q74A 4DN3H 4JFZH 3V6BR 4ODSL 3FQWB 1U8NA 1BIIB 5FGBC 4O02H 3RGVB 3N40P 1W15A 4IOFC 2CKBA 3GO1H 1JPSH 1D3CA 4B27A 4QKTA 4B9JA 1A7QL 5T3XH 5D1QA 4RFNC 4U7AA 5E95B 2Y7QB 2QZ5A 3AXIA 3O3DB 4PGCB 1JK9B 1JVLA 3W37A 3ME0B 1PEVA 1L7IH 1Z6JT 3V79C 5BVPL 3L4MD 5EARA 4GAYA 4LOUD 4R4BA 2HLFC 4U1NA 1JXGA 1JPGA 2YA0A 1BD2A 1ZT4B 3SYAA 1ZOXA 4EZKA 3D3VA 2R0LL 2IDTA 3B3IA 2EBSA 1OGAE 2YLHA 5CBAA 3FRXA 2JCWA 3KNBB 4BUGA 1L9PA 2ZP9A 2E86A 3HG4A 1OM3L 3OBAA 4H5JA 1EDHA 3TASA 1SOXA 3WY1A 3VFNB 1RULL 4PLKC 4LSPL 3TBBA 4F9LC 1S7QA 4JGMA 3CVHA 4M9OA 5D1QC 1JV5A 5I8EA 1U2HA 3DXAE 4U1MA 4KV5E 4P2OB 2AGJL 5HYJE 3CFBA 4RGOH 1G7HB 3HMXH 1DJYA 3SZKC 2GHZA 4LRNL 5IGXL 1XL6A 4F15B 3U0TA 4WV1B 2ZAGA 1OSZB 2X6MA 5I5IA 2OVRB 2BZCA 4J8RA 5KOVC 3EO0A 4KMQA 3V5DB 4E5ZB 3QG6B 3RA7L 2CXKA 5ALBL 1SM3L 3ARSA 1EJFA 4LF3A 4FA7B 3BPOC 4R7XA 1Y1DA 2IV9A 2MTPA 4U7SA 2Q20A 1NGPH 1TZIB 4I89A 2EYRB 4KPHL 2VTFA 1WRFA 4IRSD 4UQIM 4QAWA 3SPJA 1HX0A 2X40A 4M5ZL 4Y7RA 2F58L 1RJLB 2QMKA 3WJLC 3QJXA 2LT9A 2EUXA 2ICWI 2V7HB 3CSPA 4A6YL 1ID5I 1DJXA 2VE6A 5DEZA 1L7TH 4FNQA 4N8VB 4WJ5A 5D96C 3WL9B 4NRZB 5L2KE 1R5VB 3NJKA 5IB5A 4DP9X 1B0IA 1JNNL 3JBG7 1KJMA 4JHBA 1XX9C 3X1BA 1A4KA 4BD4A 5MEQB 4P23A 2MOVA 3LQZB 4AEHL 1BVKA 2WMPA 4H8QA 5E6IC 1JUFA 4JHVA 4LRNH 1OTUD 4OM1H 4Q7DA 2H1PH 4BCCA 2FJFB 5GMKn 4FFZL 1F4WL 4JN1H 1ZLUK 1TZHA 1X5XA 4PJHB 5D1XB 4F2MA 4HIIB 1IQDB 3WFEL 4CZXA 1KXQA 2J5LB 3QWQB 4GAJH 3D4GA 3II1A 3NZ8B 4RWHA 3QDGA 3RA7H 1MCEA 1YEIH 2EADA 3APMA 3FFCB 4I3SH 2VRAA 3K0YA 3RWDA 4FFWD 3ZE1B 5IMKA 3T8VA 2G30A 3TEYA 2PKDA 5AJAA 5CJQL 4TTDD 3QFJD 3WHXB 5ICYA 4PHZA 4WWID 4M5ZH 4H8VA 3ZK0A 4DPBX 5HHOB 4EZMA 1SXZA 4L23A 4FJZA 4A6YH 5SX5K 4KVNH 4HT1H 5JOPD 3O2WH 3VI3F 2X53A 4TULH 1V54B 2VISB 5D93C 1BVZA 4UNUA 5TH2A 3WFZA 5DRWA 1NKGA 4X6DF 4LL4A 3RJDA 2K4WA 1JJUB 4HD5A 2IH8A 4NC2B 3UYRH 2JJUA 1JGDB 3O0LA 4D9LH 3GJFB 3WTWA 1JUFB 1R9FA 4HALA 5LN8A 3QWNA 2FX9H 5DVKA 3NCBB 3MV8A 2F5AL 5MERB 1UJTA 4QCIB 4G7SB 4XMLH 5KYUB 5EEUA 3QI9A 3KCIA 3B7YA 4AYFA 1DN2A 1M71B 4ESKA 5C08E 3MBEA 4WJG3 3FFDA 3ZJAA 2GI0A 4M00A 1A4KB 4HK3N 2EIZB 5KWYC 2BNRB 4Y9CA 5INCA 3HHSB 4MJIB 2EE6A 3OZKA 3UBXG 1ETZA 5AVRB 4CVUA 2X2JA 4UQDA 4LOFA 4WFFD 5DGRA 5IBLD 1XB6A 4JPWL 5K59F 1CU4L 2YD3A 2DLHA 4G8GB 1KPUB 3OKOB 3TA3D 1H9VA 4WW1B 5EO1A 4RA0C 1Z1WA 2Z0UA 4LDLB 2CIKA 2HJKB 4UF7C 4QHLA 1E67A 3PXLA 3TT3L 4LLVB 2DF3A 4LPUA 4RESB 3CZJA 1NSNH 3F7YA 3U4BH 2PPFA 2GAZB 4FAVD 1LE9B 2H7WA 1MFEL 4RETB 4W4OC 4DGYL 2ATAA 3GJFA 4J8RB 4UTBH 4O4YH 4KI5D 2P28B 3LNGA 4PJXE 3I9AA 4X6EA 4X98A 5IM7B 4UB0L 3TO4A 5FEBA 2L0DA 3RKDC 4BRJA 1ILSA 1NFAA 5FF6B 1GOFA 2XWJB 1FL3A 2UVEA 2Z93A 1FO0L 3IK2A 4CBPA 3HTLX 1HE8A 4GW1B 4EUPG 1MELA 4YL9A 4UV4L 5KSAC 5E03A 3M17A 1YEKL 4ADJA 3HZKA 2XX0A 1MG3C 2J71A 1JZEA 2ZPKH 4NC1E 3HG1D 2K6WA 2OJEA 3N5AA 4ZMNA 4QT8A 5SWZA 3H9ZA 3EXLA 5IIEB 3TA3C 1HXKA 2BSRB 5I66B 4J78A 3TEWA 3C6LD 4KO6A 4RFOH 1DBKH 1SUJA 1T4WA 4J3OF 3PXWD 3BWUF 3VJ6B 1A3LH 1WCBA 4ZTPL 5TE7H 3KE0A 2NNCA 3L5XH 4K8RC 3ROLB 3U9PL 2DD8L 1T5WB 4GM8A 3ATDA 3PQYA 3ZE2F 3Q8FA 4FCAA 1KCLA 4URTB 2WLLB 2QQNH 3IUJA 1PYWA 1N6DA 1QLRA 3IUQA 3H85A 1KBPA 1UA3A 5AKVA 3NFNB 2ADFL 4HC1A 3T77A 3K3QA 2BOBB 1UD6A 5CO1A 5AZUA 4CBZA 4NWUH 4UUJB 2NW3A 5G4MA 2PW2A 4LLWB 1ERJA 5EG6C 3GEFA 2DYPA 5CZRA 5I18H 1THCA 4NB7A 3QDJD 3TPKA 3UX9B 3E0GA 3L5WB 1ZVHA 2UZYB 3FCBA 1OAYH 1JD9A 3PY9A 1J5HA 3EH2A 1PGUA 3R8BB 2YPLE 2ZPKL 3CFJB 5CEYA 5AW6B 1FSKC 4R96A 1LO2H 4L4VE 4P4KC 1U4FA 2CO1A 4LLUA 4MCYA 3FYIB 5H94B 5K9KA 2I07A 1USQA 2JXMB 5HHOE 5JPNC 2WWKO 5IHLB 1TETH 2OP4L 3FUEA 3DX0A 2NY2B 3N91A 4PY7A 3Q8CA 5DTFB 3MJGX 3S98A 2GQHA 1V3MA 4I18B 2YOAA 3VACA 3AMLA 1UYWL 1HE7A 4WU7B 1NANI 4OVVA 4XO5A 3S2AA 4WI6A 1MCPL 2OSWA 5FGCE 1HHHA 5IWLC 4P3CH 1UZ6F 3RPKA 2ADFH 4TVSa 3RFZB 3M8OH 1KLGB 2DY2A 4LPWA 3EG9B 3Q9PA 1VF5C 3ZZQA 1MCWM 3IFNL 4R83A 1P5UA 2AXWA 1OOAA 2E7MA 1YN7A 4LLMA 3KYMB 4OGXH 3KLHC 3GSNL 5DHEA 4J27A 6PAZA 5DQ9A 3T3MF 1JPFA 5GRYA 2OBGA 4D0CA 3QCVH 1J8KA 1E9OB 4QXTB 1A6WL 1WBZA 3FO1B 2QKIB 4ZK8A 2I26N 4DQOH 3DVGA 3KYMA 2W60A 4NQDE 3S2CA 3ISRA 1TQWA 3DX3A 3K2MC 4HZ1A 3K80A 4WIQA 1XXFC 4WTZA 4JFQA 5HPMA 4HLJA 3WV0A 5JIDA 4N2NA 2OYLA 3LZNA 1LK2B 1LP9F 3MLWL 3NCMA 1SJEA 3SE4C 4NP4H 3X13A 4JPSA 4CC1A 1M05B 3NJGA 3D5OF 2WTRB 3LOWA 4MJ5A 4MNQD 4PV9A 4D3CH 1F90L 1KJ3H 3ZKND 1NFDA 3L9BA 5DZVA 5DEJA 2CIKB 2HJKA 1TCMA 3IAPA 2C4FT 2OTUB 4F9PC 1CLZH 3GHBH 1XH3A 1ANUA 2EDWA 4ERQA 5JW3H 2BFGA 5TQ2L 2D73A 1ACZA 2Q8BL 4PUBL 1QPKA 3CSGA 1U8HB 5C3TA 1XEDA 2IOIA 4MAYA 2WXNA 1IZKA 1Y0LA 4TQEL 4UZUA 4I1RA 1AI1H 4P59L