5I5IA

Shewanella denitrificans nitrous oxide reductase, app form
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
571
structure length
539
Chain Sequence
b'VHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHMEMRGRMLVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
molecule tags Oxidoreductase
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
total genus 170
structure length 539
sequence length 571
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5iA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5iA01
4DP8X 1JERA 4X4KA 2FT7A 4PC0A 4QT8A 2XX0A 1OV8A 4ES0A 1YLBB 4A2LA 5B1JC 3UAAA 3NVNA 1AG0A 5HYNB 2IUPA 3UABA 2HLEB 1FA4A 2DV6A 2GBAA 4G70B 1SF3A 2IWKA 3C5MA 4O9DA 4FAVD 1FFTB 3PPSA 2HZHA 3N0EA 4W9ZA 1NIDA 5HE2B 3H4FA 3AH8B 4BL0A 4A0BA 1K8KC 4ZOYA 2X88A 3S8GB 3RN1D 3ASOB 3QJQB 4CY1A 1V55B 4GY4A 1SFDA 4HIPA 3IIWA 4HHWA 3V9EA 1NDTA 2IDQA 4J77A 4J79A 4DP6X 2CE8A 5D4IA 2H6KA 1SDDB 1AZBA 3N55A 3TU6A 3HFQA 4U7AA 1BAWA 2EINB 2H9MA 1KBWA 2R7EA 2O9KA 4O1QD 4FA4D 3J80g 1IBYA 2QDVA 2B5LA 2IDFA 2PPEA 2H47A 2QPDB 4CZVA 5I6KA 1PF3A 2HX7A 2DYSB 5A2Qg 3PSCB 1BYPA 2VW7A 2AH1A 2XLLA 1VYHC 2MTAA 3C75H 3OW8A 4I79A 2XUWA 1AR1B 4PNKB 5EMMB 3DM0A 3AL9A 4NSXA 2OCCB 1GOTB 1KV7A 4YSEA 1JJUB 7PCYA 1E5YA 3GXUB 1OE3A 3QJUB 1MZYA 2I7SA 3AZUA 3PLYA 2IUQA 4BDVB 1RI6A 2EIKB 3DXMC 4J73A 5E9NA 1SJMA 3CDZB 2Z2OA 3MKQA 3BQVA 2GSMB 2OIZA 2YAMA 2UX6A 4A0AB 4K9JA 1AACA 5B1BB 3CFSB 2XV0A 1W6WA 1KCBA 2PPAA 5FKTA 2Q9OA 2QT6A 4E9TA 3PXLA 2XL3A 3NJJA 2IURA 3PAZA 4E5ZA 3L4OD 1IKOP 3SQRA 1AQ8A 5B7MA 3OL2A 4J84A 3KW7A 3UKRC 4ZN4A 1AIZA 1I53A 2JXMA 4WKXA 1SFHA 2JKWA 3FSWA 2VW6A 3SWSD 1JZJA 3T9WA 5TK4A 3C99A 3EI4A 4J0XA 2P9UC 3PSLA 3NSYA 4A2HA 2GI0A 3IIYA 2H9LA 2MTAH 3SFZA 1SNRA 1KDIA 1ZDSA 3T6ZA 1KDJA 4YVUA 4JT6C 1L9PA 3AG2B 1JZFA 2AZAA 3ASNB 5B1KA 5KDOB 3S3BB 4AKQA 4CSZA 1VLXA 2YQBA 3EI2B 3WKQA 5C9ZB 1J9RA 3AFCA 1AANA 1NINA 1KGYE 2DWTA 1NWOA 4YSQA 3WI9A 2BP0A 1OCZB 2YAOA 1L9RA 3IN0A 5HE0B 3OMNB 5I26A 2H6NA 1WA1X 2PPCA 2HKMA 4E9VA 1MZZA 4AZUA 4ZK8A 1OCRB 2J56H 2OK4A 3UGEA 3UVKA 3CVBA 3WNIA 2CN2A 3NVXA 3RFHA 4FB1D 4HCFA 4ERZA 1ID2A 3NJNA 3JZHA 1E65A 4J86A 5I28A 1PLBA 4RH4A 1B9YA 3IJ0A 2YAHA 2AGZA 5F7BA 2P9LC 4JSVC 4LG9A 1TU2A 2IDSA 3FM0A 1NPJA 3FPYA 1GG2B 1N6FA 2NRDA 1HFUA 2EBSA 2PM9B 5FXYA 3CDZA 2CCWA 3L4MD 2UXGA 1Q47A 1HAWA 4KNSA 4YL4A 4AEZA 4BXSV 2UX7A 3GFCA 4D6VA 1SF5A 3OM3B 1R5MA 4G7QB 2H6QA 3KRXB 4GP8B 3SMRA 3D12B 1AZRA 1RZPA 3WG7B 3T6WA 2W18A 3CG8A 2J55A 1IBZA 3JZGA 4A67A 2CO0C 4K3JB 5CYKA 1E5ZA 4G7SB 2BP8B 4YSTA 1ASQA 2HRGA 2FNWA 3FU9A 4NAJA 4MFHA 5TF2A 1GY2A 1T5KA 4ESGA 2J56A 4GGCA 3OKYB 4YSAA 1ZIAA 1SHYB 4G72B 2GC7C 3ZX1A 1ILUA 2H9NA 3F3FA 5IC7A 4FA5D 3JAMg 3EH4B 3FS9A 4HHGA 4UANA 2H47C 1U2VC 3X2QB 1PBYB 4A09A 2IDUA 1W8EA 1NPNA 3V9CA 4BXVA 5IJ7E 2AGXA 3AL8B 2RACA 3IJCA 4M3HA 3B7FA 3AG3B 3K26A 3IJ1A 4GGDA 4BWWA 5AMSA 2XWZA 3UR4A 3I7LA 2P9SC 1JXGA 4N8UA 3NJLA 3EI1B 4DPCX 3RLMD 1J9TA 4YVDA 3EF4A 3UACA 2H3XA 2UXVA 3SHFA 3ORVD 5FLXg 1AZNA 1PAZA 2Z2PA 1BXVA 4CY5A 4GQBB 3JROA 3U4YA 3PAUA 3FU8A 3IE9A 2J57A 2IUVA 1J5DA 1ZV2A 2PM7B 5B1JA 1TKWA 4WTQA 1RKRA 2IAAC 3DIVA 1P22A 2PM9A 1OCOB 4DP0X 4JSXC 3MMYA 4X63B 4XEIC 4JSNC 5AJAA 5GXHA 3DXKC 2Q7QA 1WS8A 3EWEA 4HCIA 5TDHB 4QRJA 2IH9A 2MRYA 4KO7A 3BG1A 4E54A 1V54B 2GIMA 1L9QA 4GXFA 1NWPA 4FWWA 5HQGA 1U4CA 2EIMB 2VW4A 2OJ1A 3ZWLB 5EMKB 1OLZA 2GHZA 2BO0A 4O45A 2ZOOA 2CNXA 2EILB 2FJSA 3DWLC 1AG6A 2LLNA 4J78A 6PCYA 4JXMA 2B5NA 4X60B 1NEXB 2GNQA 2CALA 1JZIA 3T6XA 2AVFA 5EAPA 2YAEA 3ABMB 3NJKA 4JT5C 1BQRA 4L3GD 4CY2A 3PXWD 1AS6A 1ET8A 3RYMA 2OV0A 4HALA 2QXVA 1SQ9A 2IWFA 1GYCA 3OKYA 4Y5RD 5ANHA 2PM6B 3C9CA 2I7OA 2XXFA 1B3IA 1PLAA 2Y1AA 2DWSA 3ABKB 3AW5A 2AH0A 3OL2B 1UATA 4ENZA 3OD3A 4GZ8A 4KFMB 2VMJA 2XXGA 1BEXA 1MG2C 4CZYA 2CN3A 3ABLB 2YAPA 3HB3B 3IKOA 2VM3A 1OOWA 1A3ZA 3JRPA 3V5WB 2H5UA 2OK6A 2H14A 3RMZD 2XV2A 1XB3A 2QC5A 1GW0A 3QJRB 4J8GA 4LG8A 3NP4A 4CC9A 2YMUA 3QJTB 3S3DB 3BVDB 1N68A 4FA7B 4GM8A 3RN0D 4KNUA 3MKSB 3SVWD 1X9RA 2BP0B 4BK5C 4Z8LA 5A7EA 1AAJA 2YARA 1ZIBA 5D4JA 3NSDA 4DP7X 4IA9A 4GP4B 4UF7C 1AS8A 1WA2X 5SXMA 1J9SA 1TEGA 3AY2A 1NIBA 2HRHA 1K32A 2YXVA 3OMIB 4E9SA 1XB8A 2OJYA 1JZGA 4QKTA 4H5JA 2BHFA 3SBRA 4X3EA 4OZUA 3UAEA 2TSAA 5H1MA 4FA9D 1NTDA 1PLCA 4Q89A 5IGOA 3UADA 3IN2A 3TBCA 4DP2X 1MDAH 5AFAA 4EF3A 2I3SA 2H68A 3PE7A 5CXBA 4A08B 1BYOA 3FPXA 2HYEA 1IC0A 5EARA 5C2VB 4AKPA 3NYKA 2ZXWB 3AG1B 1WAEA 2J57G 5THAA 1HAUA 4J87A 4BH6A 2FQEA 2VM4A 3T71A 1NIFA 4FA1D 3NJIA 2I0SA 3JPXA 4Y7RA 2DYRB 3EH5B 3FU7B 1CURA 4NB7A 3ZIYA 4GQ2P 3DTUB 3FQ2A 3QPKA 4P5SA 4D0KA 1KBVA 3RRMC 2HESX 4TZ4A 1A65A 3GDCA 3EI2A 1JMZB 3ULEC 1SHWA 4K3ID 2YAQA 4L9OA 3X1FA 4BWTA 5H14A 3ODTA 2CJ3A 4KNTA 2I85A 1URIA 2HX9A 4F2EA 4QL1A 1SQJA 5GMKn 3VH0A 4EWRA 5CXBB 4A08A 9PCYA 5K1CC 3CZUB 5TEFA 3X1GA 4ZOXA 3NP3A 4CY3A 4E9XA 1L0QA 2BCJB 2J55H 2XV3A 2FTAA 2I0TA 3E0CA 1JVLA 3EU7A 5I5JA 4AI7A 3I2NA 3OTTA 4YSDA 1JZEA 5EAMA 3NJGA 2PBIB 3L45A 3MBWB 4DP9X 1TEFA 1CYWA 1PCSA 2HKRA 3OKWA 1NIAA 1GR7A 1FWXA 3FT0A 2BZCA 5I6PA 1M56B 3NVQA 4A0AA 3CVCA 3G5WA 4L0PB 4J0WA 3GYRA 4L1QD 4YSCA 4LGNA 1W6LA 2UZXB 1MG3A 6PAZA 3I7OA 1V10A 4G71B 2W88A 2B5MA 3OKTA 3X1BA 3H56A 5FKQA 4KO9A 5CYKB 2UXFA 2BW5A 4L3HD 2EIJB 2IDTA 2CAKA 1N6EA 4XYHA 4A2MA 3NT0A 3SBQA 4GQ1A 4Q8BA 2YNOA 4E9QA 1PNCA 4PBZA 1OE2A 2UXTA 5FQDA 5EMLB 4YSUA 3UKUC 3ZDWA 4A2FA 4H5IA 2XVBA 5B4WA 3SXTD 3V9FA 2UZYB 4A66A 2AGWA 1J5CA 4J8BA 1PMYA 5PAZA 1B9XA 2AGYA 3SCYA 2PP9A 1OE1A 4GYBA 5EHFA 5H17A 2CBPA 2PP7A 3PCYA 2G9AA 2YBAA 2OVPB 5F7AA 1L9SA 3UVOA 3PXTD 3TASA 5B7EA 2PCFA 4DP4X 1M57B 4DP1X 3EMHA 2B08A 3FYEB 4A0BB 3S8FB 5TK2A 1ZPUA 4JKNA 1GY1A 1NICA 3ZBMA 3BG0A 4CI8A 3U25A 2WO2B 3F3GA 4G56B 3FU7A 1JOFA 1GS6X 5HE3B 3J81g 1JXDA 4F7KA 1X9UA 2FQDA 2H3XC 4PCYA 4AKOA 1ZDQA 3WKPA 1A8ZA 3SN6B 1SDDA 2OVRB 3KW8A 4E9WA 2HX8A 4YSPA 3DSMA 1KCWA 5I6LA 1NIEA 3I7NA 3K27A 2AQ5A 2ZWNA 4KOBA 1PNDA 2IAAA 3WNJA 4QQEA 1R1CA 3FSZA 2XX1A 1L9OA 2PCYA 3NJFA 4PSWB 3FQ1A 4R7AB 3I89A 3PXSD 2PLTA 2P80A 4BWUA 3UVMA 3FYIB 2HXAA 2I0RA 4XYIA 3FRXA 2ZONA 4BDVA 4E9RA 2E86A 4KO5A 1GP2B 2BBKH 4JSPC 2GC7A 4E5ZB 3FSAA 4CZXA 2FT6A 3FQYA 2AGLA 3V7DB 1QLEB 2W8CA 3MZLA 1A4CA 1A0RB 4UI9R 4PSXB 3UVNA 3EI1A 4U1EI 4IMMA 2FWLB 1PZBA 3W15A 1CC3A 1MDAA 2XYIA 3A0FA 1E30A 4GP5B 5PCYA 3S3CB 4BUJC 1ET5A 2P80D 2IWEA 3AG4B 2BP8A 2I3TA 4FHLA 3JT2A 4YSSA 1DZ0A 3AL8A 5TEEA 4GMBA 4HZ1A 2P9PC 3F3PA 4ERQA 5IT9g 1CUOA 2TSBA 3QQXA 5K19A 5D4HA 4AOWA 2VSKB 4TXVB 5FC9A 4A68A 1XKSA 4A7JA 5IJ8E 2OVQB 2AZUA 2VN3A 3HEIB 4JHUA 1ASPA 1OCCB 4N4YB 1A4BA 1NZRA 2H9PA 2CO0A 1OMWB 2HJ4A 1WA0X 2CE9A 1XMEB 2YNNA 2AFNA 3EHBB 3QJSB 1JXFA 2QDWA 1MG2A 1XIPA 2VSMB 3MXXA 4O3UB 2BWDA 2Q5BA 1KYAA 2R7EB 2XYBA 1BXAA 4YSRA 1JMXB 3EI3B 2YB8B 3GREA 4N14A 3SJLD 2BZ7A 2QPEB 2BW4A 2X87A 1PGUA 4JD2C 3NSCA 5GXIA 1RCYA 3CIKB 4ERYA 1E67A 1DYZA 1YFQA 2YAFA 4QLWA 5IGQA 2B4EA 2N0MA 3T6VA 4A2GA 3C75A 2HXCA 3EI3A 2TRCB 2P9KC 2BWIA 3QJVB 1GS7A 1ETJA 4M4RB 3CFVA 3SBPA 3UVLA 1PY0A 3ERXA 3KRWB 5I6OA 1NR0A 1N6DA 5FKRA 1ADWA 3MZKA 4W1TA 2B3IA 1PI6A 4ZOZA 4E54B 3JB9L 3I8CA 3ABGA 4KOCA 4PAZA 4GGAA 2FQGA 1AZUA 3NSFA 2GC4C 4X61B 2GC4A 4GM3A 3CVDA 3OQRA 3FSVA 3BWSA 1S4UX 3NJMA 2G99A 1QHQA 4A2DA 5HE1B 3N0DA 5FKSA 2P9NC 4A11B 3SLED 2YXWA 4OWRA 2Y69B 4NERA 3IBOA 4O3TB 1QNIA 2IH8A 1N70A 3N2JA 3I7PA 3H4HA 1TBGA 3I7HA 4MK0B 3TBBA 4YSOA 4GM9A 2PPDA 3OMAB 4YVNA 5GSAA 3MX0B 1J9QA 5B3SB 3I7KA 2WSDA 1MG3C 4PXWA 1JZHA 1IUZA 1GS8A 1OF0A 2CUAA 2DY2A 3EI4B 3WIAA 3X1NA 1RZQA 4HCGA 8PAZA 5I5MA 5EM2A 4HDJA 5JWZA 5I5IA 4FAAB 1AZCA 5IY5B 2J5WA 4FAND 1EZLA 1AOZA 5I6MA 1SHXA 1ASOA 1WS7A 1L9TA 4AX3A 4A09B 1BXUA 5I6NA 4A2EA 3P4FA 5EM2B 5CXCB 4PBYA 2JFCA 1GXRA 2AANA 2YNPA 2FT8A 5FA5B 2WO3B 4KO6A 4J81A 1M9WA 3JTBA 2PPFA 1PZAA 4DPAX 1BQKA 4J82A 2XL2A 4UAHA 3IEAA 1EHKB 1A4AA 4P5RA 5C2WB 2P9IC 2PP8A 5EMJB 5B1AB 1JOIA 2XU9A 3EH3B 1F56A 5AKRA 1XHMA 1ILSA 1XB6A 4JHVA 4DP5X 2FQFA 4CI1A 5LDUA 5AZUA 2GB2A 3PVWB 2H13A 2Z2NA 3I8EA 5CXCA 7PAZA 1PEVA 2A3TA 3TA4D 1GSKA 2HJBA 1CYXA 1ET7A 5B7FA 3FGBA 4HAKA 3RFGA 1PZCA 3VA6A 4A11A 4G7RB 5AFU3 3NJHA 4F2FA 4CI3A 1BQ5A 3PAVA 3X1EA 1TYQC 3PVUB 1ERJA 3DKHA 3VGZA 5EALA 4DPBX 3JZNA 4CI2A 4ZOVA 3EG6A 1AS7A 4CSPA 4E9YA 2XU7A 3RSEC 1JVOA
chains in the Genus database with same CATH superfamily
3QE5A 3VFRB 1Y1DA 4RE6A 2CJTA 2Z91B 4YLQT 4LCWB 4HDIA 4CC0A 3L3JB 1CQKA 2C26A 5CGMA 4TSBL 2HLEB 4F2ME 3MGOA 4IDLA 4PRBA 3QQ4A 4HEME 1ZVYA 4WGVB 1MELA 3GO1H 1JPFA 1YUHA 1H3PL 4BKLA 3BQUB 2OMXB 4XMLH 5FYJH 5B39G 5BO1H 1DQDL 4U7AA 5EN3A 1NFIB 2K7QA 3S3SA 2HJKA 5IEKA 1W8NA 5CILL 2VQUA 4PIBA 1JV5B 1MVUA 4K4KA 2Z7UA 5EC2B 1YEEH 2DQFA 4JG9A 1TJHH 4Y9FA 1TMQA 5E9AA 1MLCB 1OGAA 5GGSB 4W4OA 2Z65C 4P5MB 3QXVA 4F57H 1WUZA 1QEXA 4DQOL 5E6ID 4FQQB 3V0AC 3CDZB 4A6YH 5HVFB 2OIZA 3DURB 4JFZL 1BFSA 2EH8L 4BD4A 4OAWA 1N67A 1YQ2A 2MQGA 5CMAB 4NM8L 2YSTA 1DUYB 1UVQA 5F7UA 1U8OA 5I19L 2YKLH 3DXAB 1TXKA 3SQRA 5B7MA 5FYKE 2DQCH 3MA7A 3VB9A 2JXMA 3WKML 4XNAA 3FSWA 1YEEL 4F7CA 5IR1A 4ORGB 2Y3AA 1IRAY 3ARUA 4LARH 2WBKA 1KACB 1X5AA 4LDCA 4H8PA 5EUOF 2GI0A 2YXFA 1MWAL 2OR8A 1N59A 1MN4A 1UM4L 5C07A 1VPOH 5IQNA 1F3DH 2G0KA 5CD5D 1QPPA 1JTTA 3ZMEA 4L8SC 4IIQA 1NGZB 2Q6WA 1MIEL 3O3BB 5IFAH 1TFHA 1KGYE 1T3FB 5J06A 2ITDA 1JN6A 3PWPD 3DYPA 4JDEB 4D7PA 1AD0B 1E8ZA 4BH7A 3FT3B 4FEIA 2OCFD 3UVKA 4IRZA 4BELD 2VR7A 4PJ5D 5IEHA 4XCCL 5JMOC 4L1MA 1KLUB 5AOIA 5EPMA 1J5OL 4JO4H 4HUCA 4UOW1 5JW4M 3KXFD 1QFOA 2WAHA 1OAJA 1DZBA 4KKRA 3IMTA 4N25A 1G7PB 1D9KB 1NBZA 3EYSL 4K5PA 4AEZA 12E8H 2I25N 1SRDA 2X4PB 3OAYK 4PJDB 1MIMH 1ZJAA 1TPXC 3T6WA 3WYRA 2VLKB 1NCUA 2G5BA 1KELL 4PV8B 4EN3B 2WSKA 3F01A 3I9IA 3U4AA 1OP3K 2BRQA 3DVFA 3I6SA 3KLHD 5KBMA 1H0DB 5CCKH 2BP8B 1DDHA 2FNWA 4FQIH 1AMXA 1HEZA 3KPRB 3CN1A 5GJSL 4GGCA 3DRTB 2CDEB 1CFSA 1JP5A 2YA0A 5I1KH 5I73C 3D4GA 4FQLH 1UWFA 4YO0A 1Z5YD 2V7NA 2KZWA 3FO2B 4YDZA 2ZX8A 2X10A 3DGCR 1WO2A 1DBAH 5IJ7E 3CSPA 1MCNA 3AG3B 4RSVA 4YDIL 2ZTBA 1H3VA 4JHWL 4LXFA 1WBYB 2N59A 1UZGA 4G8GA 3UR4A 1ZGLM 2DQIL 4MZRA 2Y07H 1FAKT 3BPLC 3VU1A 3CFBB 4JKPL 3UTQA 3UYRH 1MHEA 2ZCZA 1C16B 5H37G 1MIML 1NGXA 1TQTA 1UOWA 2HLAB 2UY6B 3ES6B 4HHAB 4MA1C 4PJ6A 4NBMA 5CGYC 3EYQC 1ZEAL 4HFWA 3NIDB 3LHPL 1ZANL 5C0DA 2CJSA 5HYSB 2WMPA 1K5WA 4FQHA 1U8IB 2H6PB 2NX5E 1KN4L 3L1GA 4NN6C 4PGBB 3C5ZD 2XA8L 4GKNA 1VEOA 5KSUA 4NBYB 5D6DC 1AMYA 4NPYA 3SDDD 4L8BB 3LZLA 1F1AA 1T0MA 5E2WL 5G4MA 1D2PA 2P7TB 4RGND 2BO0A 3ECWA 1E9PB 5LBGA 3Q2CA 2CNXA 1RPKA 1FYHB 3MOBH 1WRFA 4FFZL 4NNXA 2ZG1A 3R8QA 5JHDB 2XZZA 2IGLA 4MNGE 3V5DB 1NEXB 4F33B 2OW7A 4JFVA 3QNXA 5EAPA 4M1DH 1H2ZA 3X11B 2JI1A 3D1MC 3ISWA 2OM5A 1GYAA 2BSRB 2E9BA 2X89D 1GYCA 2CHWA 4LSQH 4BM7A 3QZPA 2WTOA 4RESB 5C9JA 1MCLA 2Y1AA 3ABKB 5ESVA 5LWYH 2WXRA 3G08A 3OL2B 4ENZA 3NMEA 4UNIA 4HC1H 1JZ4A 3ARBC 4GZ8A 2G3XA 4MQ7B 3IGUA 3U1SH 3RU8L 4TLTA 5AVQB 1P7QA 1SN5A 2XJLA 1I8AA 3FB7B 2YPLD 3CK0L 3KPTA 5AOMA 5HHMD 2L04A 4Q58C 4N68A 3VB8A 3QDGA 3IDNB 1LQSR 1FZJA 4NN6B 4F7TA 1PFOA 2BK8A 2QC5A 3ZDYE 3GC3B 4OGXH 3GSNL 1HH6A 1N68A 4TLUA 2OA9A 2OL3A 2VXVL 2BP0B 4UQ2A 2KHAA 4NO0D 3KPPB 4XH2B 5I15H 1JI1A 2LTQC 2HRHA 4EZKA 4QKTA 3O0RL 1GVIA 3F8UB 4D9SA 1N0LA 1XF5A 4WW2C 1BZ7B 3S37X 3IDYB 5I17A 5LBSH 3WIFB 5IKCA 3EXLA 1HL5A 2ZG2A 1CYGA 4AW4A 2FX7H 1INEL 2R0KL 4RISL 3IPBA 4J87A 1SEQL 2XPGA 3WN5C 5FDWA 2YC1B 2V8LA 2F08A 2A5UA 2QADB 2V5RA 4J3OF 4J12A 3QPKA 4Z78A 4MX7A 5IHZA 3GDCA 4UYPA 2YC1A 5C8JB 1LE5B 4U1MB 4JKMA 4NZRH 1OPOA 4ENED 2AXJA 3KPMA 4EUPB 2X6VA 4YFLF 4XNQA 2VXQA 4N2DA 4N5UA 5L2KD 3DBXB 1HCVA 4Z7WE 5E5LA 1K4DB 1T22A 1WFUA 4FE9A 5GGQH 1P1ZB 3SQBA 2MEJB 4P3DA 3D7PA 1IBGL 4NWTH 2B9BA 4BCDA 1INEH 2R0KH 5E2VH 2UZXA 4EOWH 2CIIB 4J3SA 1LK3L 2DQEH 3UIZA 5FYJU 2XQYK 1EO8L 4L0PB 4X7CC 4HIXH 4LCWD 4UYQA 3BAIA 2Y7SA 4LDOB 1Q9OB 4EQ2A 5IQ7L 1MG3A 5HPOA 5HDQL 3T8XA 3EOBA 3GTVA 5DK3A 4LOFA 4FI7A 4P07A 5F88B 2EIJB 3MKGA 4XN1A 1NMAL 3G5VB 4QRRE 4MAYB 2Y36H 1XCTB 1TJHL 2NPLX 4L1TA 2VDQL 3BVNB 5C0ND 2UV3A 3D05A 1UA6L 3VH8G 1BW8A 4OJFL 1FN4A 2AGWA 4JFXB 1QVOB 3GM8A 2PP7A 3TO4A 3PCYA 1A1MB 5DJYA 1VEMA 3FH8A 1HCZA 1QRND 5DLMH 3HZMB 2XVLA 4KPHL 5M7QA 1GZPA 3TL5A 3QQ4B 4JKNA 4LO9A 3B7RL 1RPUA 3BAXA 4UM9A 3VGAC 1P69B 3BUIA 1FNLA 4KK9C 1W0YT 2BNRE 1MCIA 3ARGD 4YBQD 1M7XA 1N18A 4J7RA 3WKPA 1I8MB 1BBJB 4CC4A 4NNYB 4KXBA 2ODHA 1D5MA 2WNKA 3KL0A 4PWGA 3O6FA 3RX9A 1KCWA 4OVUA 2AQ5A 5JXAH 2ZUQB 3ABZA 1PNDA 4MJ5B 1AR2A 4HUVA 4HWUA 4NKIH 1QPXA 5A16A 1UD3A 3NOIA 4R7AB 1Q8MA 4YXHL 4BV1A 4P57B 5AOKA 1DLHA 3EDKA 2ZONA 4E9RA 2B9AA 3BSZA 2R23A 3PWPA 1DQTA 2WIMA 4HUUA 1UD5A 2NNCA 5A2CA 1HTYA 2QQQA 1T0OA 4WGKA 2XN9A 4BINA 4MMZA 3LRSA 3DOSB 2CNYA 3DJZA 3U9UB 2FWLB 4KKLD 3CIAA 4ETQB 4Z7OE 4QO1A 4C83B 4D3CL 3BW9A 1ET5A 3BH9A 4FHLA 1LNUB 1E6JL 5L6YH 3AL8A 1DQLL 5I2IB 3BPOB 2UVFA 4J8QA 4XE5B 1GJWA 1KTLA 4UTAA 4PJEB 4Z0BH 2QMKA 3MXVH 2IPUK 4PJ5B 3TH3T 2F61A 2M2DA 3MFFB 3ROLB 5EBWA 5D5ME 4K55A 5LKNA 3NBNA 4N1EA 2IQ9L 1JPFB 2X42A 3EBIA 3OR7A 4XPGH 5AZ2H 2JIXA 4OV5A 1I31A 3CHPA 2WSPA 5I8EB 1E4WL 3QIBA 1ORSB 2XYBA 1FSKB 1UWEH 2ATAA 3C2SA 4JFEA 3NRPA 2BW4A 2NTFA 1U2YA 5DZLA 1PZDA 2K3HA 1NCGA 1CFBA 5HHNA 5D1XE 3WAKA 4EUPA 4FNSA 5E8EB 4IU2A 4HJUA 3IGFA 4G6FB 1IEBA 3C75A 3V7AG 3HS9A 2HN7A 3MNWB 3O4OB 1PCXA 1ZANH 1MQKH 2VDRB 4H2CA 3KWWA 4JFPB 5FKRA 5I6OA 3QDME 3AWGA 4FLSA 3VVWA 5KUKA 1FP5A 2GBTA 4LKCB 3ZN6A 2QZ5A 3I8CA 3TNMB 2Y7NA 5CEYB 3VXSB 1FAIL 3D85D 2QTEA 1S7WB 2MPAH 1S4UX 3EAKA 2VMEA 4I18B 25C8L 4A11B 2BVOA 4OWRA 3A4FA 1QACA 4OJAA 1QNIA 3IUQA 4GM9A 3EUUA 3IFNL 2GUOB 3C6LB 5C9KA 2I9LA 2Y1YA 4ORGA 2BSTB 5HGHB 2FEDC 2WIIB 3QUYC 3VGDA 3WIAA 1N6QL 3A6BL 1U95A 3CLEL 4RLDA 4PJFE 3DUHA 3RA7H 1GMIA 4PJHA 2OL3B 3BKYL 1AOZA 1SHXA 2BS9A 2VMCA 1S9YB 3KPOB 5ISZA 1E9OA 3P4FA 2WIIA 3I6LD 1KB9K 2AANA 3ULAB 3FT1A 2OJZH 4JX0A 2K8MA 1ZLSL 3NCBB 2XU9A 4YIQA 4E42B 3VFWB 4TUOB 4I48B 2EICA 4MDIB 4XTRC 1HZHH 1JGDA 1TZHB 1UWYA 5EB9A 1HHJA 1NJ9A 2HH0L 4JPKH 5GSRB 4FA8A 1YNTB 3ZE1B 4Q97A 3PS6A 4TL5A 5CXCA 2QV2A 2NXZC 3LQZB 3QHTC 3RPBA 1D9KA 5LQBL 3V6OC 1IMHC 4K3DL 1AXSA 7FABL 4Y16C 5I15L 3F7YB 1IKFL 2PNDA 3VNZA 1TU2B 1BVKA 5E00A 2HJKB 5DMKB 4OTXL 1OP5H 5HYJA 3PVUB 1K8DA 4YEFA 5JZ7C 2PCPB 2QR0B 4N20A 3HHRB 1B6UA 3GMLA 4E9YA 1ADQH 4JZOA 4QT5B 4JW3A 1T7XA 2YPLB 1N3NA 4QT8A 5GRYA 1OV8A 3VXOB 2J8UE 2FR4B 4AN0A 2VLJE 3IMBA 3NGBB 2GBAA 1J8RA 1YMMA 3L5IA 3LNDA 3D0VA 4ZS6D 2HFEA 5TE7H 4CJ0A 2X1XR 2EDQA 5CN3A 1MNUH 3H4FA 3HR5A 4N5ED 4TSAH 2X88A 3DVNA 4ZOYA 3VMOA 1SFDA 3MYJA 2G3ZA 1E7VA 1NC4A 4J77A 1RMFH 5D4IA 3KGUA 3OLGA 3T6QC 4DQOH 2O9KA 1NGXB 2BIPA 2HLAA 3G7TA 2ZXBA 4Z3IA 4O1QD 2JI2A 4O02L 2OAAA 4LSPH 4HKXA 4IHBA 4OKDA 3SCMB 5I6KA 5A2Qg 3W2DL 2WCPA 3QDJE 2DQJL 1LQBC 5KUMA 1VFUA 3DTXA 4Z7NE 5L4JA 1QABA 1QSEE 4AK1A 2JLLA 2Z92B 3QNZA 3ZW3A 4NBZB 4IBVA 3NUKA 3KLSA 1BOYA 3C75H 4I79A 3GBLA 3AL9A 2A73A 2HPOA 3IRPX 4KRNA 2XCMC 4A37A 2PR4H 4OUUA 2HUEA 3QJUB 5DS8B 3BZDA 2V2WA 2FB4L 5T3ZE 4UNTA 2YAMA 5LO7A 4JN2A 4JQVA 3ZR5A 1EMTL 1AACA 2EADA 4KMLB 4FMKA 1Q94A 5AWNL 5SX5K 3T0AA 1CICC 2DQFB 2JJVA 1R3JB 3D06A 1T0NB 1FFQA 1WF5A 2WK2A 2VDNA 5FV2A 4X98B 3FRPB 3QG6B 1IM9A 2JSFA 2ZIDA 2WUCL 2F19H 5D70H 2ATPA 5GQBA 1DUZA 1Z2KA 1INDL 1CI3M 4F93B 2VZ1A 1O6GA 2P9UC 1BA9A 3BPNC 3K4DA 3GTTA 4KK9D 3K5RA 2VUOA 3QJOA 3T0XA 4JZNA 4LCCB 1OF2B 5C7XH 4LRNH 5HHXL 5J1AB 5I1LA 2VDOL 2CPCA 3OZ9L 2ADJB 1JWMB 3DOIA 4I0CC 4OZFB 3WDIA 4KUZL 3OZLA 2JXMB 3TO4C 4G6KL 4PU2A 4V2CB 4CA4A 3F85A 3AT0A 4JQVC 4I0KA 2YUZA 4X6CE 2EDMA 4N1HB 4MAYD 5F1OB 1EHLL 4AQAA 3QFDB 3ZUNC 1U6AH 4OFYD 1F90H 1E4HA 5C70A 5I28A 1Z9PA 4XPTH 2B0SL 2X53A 5CHNA 3TVMC 3UBXG 3ARXA 5D1QB 2Y6TE 5J4MA 2UVEA 2GY7B 4V1DD 2AGJH 2WZ5A 1Y7VA 3BI9X 3CDZA 1SM3L 2F7IA 5SWSA 2UXGA 4NJ9H 3CVIL 1QTYT 3DBSA 3ZYOA 3DI3B 3KGTA 1MCEA 4I77L 4M6NL 4MXVE 4YDIH 5GRVK 1G7JA 4XN5A 4XO3A 3EOBB 4M8VA 3A67L 4JFDD 3KPSB 4MXWL 1A0QL 3ZSSA 3QUZA 3T3MB 2A9NH 5T5NG 4LVOB 2R0WH 4PRAB 4F3FB 2JKJA 4WHTA 1UG9A 2HPTA 2Q3XA 2WNXA 1QO3A 1R5WA 2R56L 1FGVL 3E2HB 4PW9A 3P0YH 3IF1B 1LDSA 5C8JA 5D7IA 4G42A 4BWWA 4DZ8A 1DVFD 3WY1A 4H0GA 1TTCA 2ZWZA 3S34L 1DQML 3CH1B 4TMPA 3SQOH 1IBBA 3DBXA 5AVVB 3U46B 5BS0B 2F54B 4M9OA 5D1XB 1TZIB 2A77L 2AJSL 3OKEA 4PTTA 2ARJB 1BXVA 2EKSB 2BHUA 3QNXB 4IM8A 5IVXF 3VXTA 1RFDH 2R29H 4X9BA 4G43B 3V4VH 2YUVA 1YY9C 2F54A 2IAAC 1JGIA 3LPGA 5ICXA 4NUPA 1NLDL 4QKXB 1R47A 4X6EB 4OLUL 4UQ3B 3RVTC 4KO7A 2AJUH 5DD3H 4NCDA 4FFWD 2EIMB 3B9AA 3QCUH 4Y5VA 4CBZA 5DRNB 4YFEA 2QV4A 4N0CC 2ICCA 3EGXB 5K59F 4FQHB 1SPDA 3ARSA 3G6JA 4Y5VB 4OCMC 2VSDA 2YAEA 4L3GD 2OMWA 2AI0H 4FQ1L 3QUMH 3LNEA 1WBZB 5DHDA 3QI0A 2NW2A 4IBQA 3L1EA 5ALBL 2RAMA 1SQMA 4G6FD 3TYFB 4LLMA 1HJCA 4WUUA 5HYIA 1WBYA 2NY1B 3F65A 4G8GB 1T03H 4RRPA 5HYQB 1YEDB 4U4BA 4F91B 4KQ3H 1MF2L 4DK6A 5JYMA 3FMGL 1ZTXH 3HZYA 3L7EA 3B6SB 3V5WB 2BNQE 2H5UA 3D85B 3P4OB 4KTEH 5KVFH 5DD6B 1DEDA 1H8LA 2NXYC 1RUPL 3S4SG 4E41A 4CC9A 2ZCLL 1QQDA 3KH3A 2H2PC 2APFA 2ZWYA 1ETZA 4H0HB 3WD5H 1EPFA 2EDRA 4HUWB 3VXOA 1GYUA 2ODIA 3OMIB 3VXUB 1AC0A 3CHOA 4MB1A 1KN2H 1NTDA 2ZPKL 4DP2X 5CBEA 4RFNC 3VTTA 2K6YA 1ODAA 1DN2A 2ZOKB 5C2VB 2X2UA 5CP3H 5CM1A 3HG1A 5GISL 3AG1B 1WAEA 2JQMA 5EMYA 4PVBA 4Z7WF 2J57G 3AY4C 4XAWH 5J5EA 2ZXEB 2VLJB 5I1DB 4X4ZA 1R5VA 3WHE0 4ZQTA 1G6RA 4DGVL 4OFKA 1WT5C 4Q9BA 5EOTA 2X6AA 1A65A 1TO5A 1RHHA 2ZSVA 3CFUA 3K4AA 4PJIB 4I0PC 4JREC 4W9GC 4IMLA 4Z7IA 3LRHA 1UJ3A 3ZQWA 4IKKA 1U8MB 3TV3L 1P9MC 4M00A 1HHIB 3MRLA 2H7WA 4JFEB 4RZKA 5CFAA 3Q8FA 2PXYA 5I18L 3NA9L 5K1CC 3X1GA 4FYSA 4E9XA 5C0FA 3BVNA 1OAUL 4Z3JA 3EU7A 4WI0A 4UT9L 1CFQB 1GTFA 4NUMA 5A2IH 5D1XA 1ORQA 1D7FA 3DX6A 1RV6X 3FT0A 4N2NA 1QBML 2VXSH 4P2RD 4YDVA 1DJZA 3BWUC 4A0AA 1S9VB 3MYZA 3TO2B 5I8OH 4JRLA 3WJJC 1XR9B 3UTTD 3LQAL 1EEYB 4JGMA 1N4XL 3BEVB 3RFRA 3HE6A 3VD2A 4S2SA 3WL9A 1E5BA 2MKLC 4IRSC 3GK8L 4UV7L 5IFHL 3G9VA 1WBXB 1EHNA 3DVGB 4PRHB 5KSBA 2YNOA 1EJ6A 2DOCA 3WJMA 3ZR6A 4HPYH 3RWCB 1DE4B 2P52A 4YSUA 4HF5H 4HSCX 4U1LB 1VKXA 5DWUH 1UACL 1AXTH 3V9FA 3SCMD 3AMKA 2F1AA 3UJJL 3T8MA 1KZYA 5CJQH 1B9XA 4PGEB 4KFZC 4OCSL 3NDYE 3KBHE 3Q8CA 5L8KB 4DO5A 2W1NA 3LRLA 2YGQA 1TQVA 1RULH 4YXHH 3OKMA 5FUOL 3SGDH 5JYLA 4PMFA 1MXDA 1MCOL 2VDQB 1IX2A 5C08A 2A9CA 4JVUA 1PLGL 4QTIL 3HCVA 4Q56A 3WELA 1NGZA 2X3AA 4WI5A 2HX8A 5E9DD 2NY3D 1SEBB 3MZTA 1OGAE 4FLQA 4NHUA 4FXGB 5H37H 3K27A 2PW2A 1N5AB 3Q2WA 2BNUB 4BCBA 4PJ5A 3FSZA 2VE6B 4KK8C 3BJ91 3GD1C 4MDRA 1BZ7A 1Z9NA 4BFRA 3U36B 1U6AL 1U8QA 3QORA 4DIXA 3POCA 3PGDB 4MRBA 4M8RA 4OCSH 5JOFA 3FF8A 3LH2H 3UBGA 3WGVB 3DWTA 4CZXA 4FQJH 5I74B 5L2KA 4LIQL 1R5WB 5E6IC 1YPZE 5E08H 2DICA 2W8CA 3FXIC 5AW2B 3V7DB 2E7MA 4JG1H 4PSXB 1B4JL 2XG4A 4YHPB 3ZKXB 2WO4A 5J9PB 3ARDD 2WUBL 5EOQH 3UTSE 2R8SL 2OX5A 2XTLA 4M6NH 3VFMB 1UB6B 1NGWA 1MEXH 1FNFA 3F3PA 5IT9g 3FJTA 4FQ2L 2DI9A 2J25A 4MCYB 2RCSL 1A4KB 1RQ5A 2P8MA 1NKRA 3NZHL 5BOPA 1C8QA 4IS6B 3BQUD 4HMEA 4JHUA 4GG6E 2VGLM 3JV4B 2ZCHH 4GO6B 4K8RL 2VXUL 5AG9A 2O5ZL 1H6UA 1YNLL 4MCYA 4HWEL 2CE9A 3OSKA 1T2XA 4JQXC 5D1QD 3BAJA 4I7ZC 4WEBH 1NSNH 4V1DB 5HPMB 5ADPL 1MREL 3MXXA 4O3UB 4APQC 1NCJA 3L1FA 3ULVF 2P26A 2YD2A 4Z7QB 5K9OB 3RI5F 3QHZH 1B4JH 1HXKA 4R7XA 4X6DE 5HHVH 3IULA 3LPOA 1OQOA 4PJBB 1EUTA 1OTUC 1Z5LB 4JFDB 4JZJA 4KVPA 4HLZG 1KEGH 3MJ8B 1BPVA 4JRYA 1NGQH 2Y5QA 5LAXA 2GAZB 2QKIC 4B5EA 5KVGL 5DF0A 4Z0XB 4AJVA 4EIUA 3UVLA 2CLVB 1QSEA 2VRKA 1VFMA 4EZMA 3FT2A 4UUJA 3MRDB 1IAKB 3DX9A 3KR3H 1E2WA 4HS8L 1HL9A 5ETUB 1MCHA 3FO1B 3ALPA 4HCRA 5DDHB 5BV7L 2XQYA 1A1OA 3RTQA 3MGTA 1DVFB 2GTQA 3MLWL 5ANME 5IHHA 5IBTL 3SEPA 3KPLB 1BFOA 4NM8H 5BS0D 1J12A 2NY0C 3I7PA 5D1XD 3ZZLA 3JTSA 4YHKL 1PG7L 2EP6A 3LS4L 2F74B 1J9QA 3I7KA 3NRFA 1TZHA 2ZT9C 3FB5A 3EI4B 2BINA 2VJ0A 5EM2A 2GEQA 1ZV5A 4RWYH 4X5LA 3ZVVA 1RSYA 4OD1L 5B38B 1DQJB 1P6FA 4FAND 1BMGA 1L3WA 3EO1B 4BK5A 2OMYA 3N41B 4J28A 1BZ9B 4OIAA 3T04D 4LCVA 7FABH 4XNMB 2FRGP 1IEAA 2BFVH 4EQ3A 3C9NB 5E1GA 4ZSOE 1E8NA 4P5RA 5FO7A 2WQWA 1N8ZB 2BCKA 4EN3A 3MA9L 3ILPA 1GAFH 1ZSHA 4I13B 4RQQB 3LSOA 3MLUL 4ODWB 4I88A 2ALWA 1KJVB 4AV5A 2CUHA 4XPFL 2B7DT 3M7OA 4XNUL 5JW5A 1UCTA 5CWSB 3ZE0B 3PABB 4L1HA 1NAMH 5LXGL 2AXHA 4PCKA 3FGBA 2NY1D 4G8GD 3RGBA 1JTPA 3VGZA 4PS4H 4OQTA 4CI2A 1VF5C 2ZCLH 2FSEA 3P9WB 2DBJA 1JRHL 2IJ0C 2QVFB 3GTNA 1FFPA 3K4ZA 4HJ0D 1DR9A 1KXTB 2C3GA 3BIKB 3GDBA 2X1QA 3D8MA 2VOTA 5K33A 2OQJB 4O02H 5TFSH 2VIRA 4DCQB 3HC0B 3OVUB 4YK4B 3PDDA 1RURL 4P5TD 2ZF9A 3B4NA 1GAFL 2X7LA 2NCEA 3OHXC 1HL8A 3QJQB 1I9EA 1A2YB 2QFRA 3Q3GB 1RJYA 1UC6A 5ADOL 3HBZA 2CE8A 2YBRA 3OF6D 4V33A 1G7QA 1H3PH 3OB0K 2AQNA 1JMXA 2FJGA 2YLKA 3HHMA 1RUMH 2QDVA 4L1BA 5EG6C 2N01B 2YSSA 2J4WL 3APCA 2XBTA 1U2CA 1LL1A 4WFFE 2OYKA 1KIQA 5IROD 1ZLWH 1IJ9A 3E8UH 2H45A 3QQNA 3QUKB 3PWLA 3ZMRA 2EEFA 1JSYA 1K4DA 1P5UA 3IJEA 1EJOH 5AYTA 3SDDB 1M7DA 2MTAA 4LLQB 2LW3A 3AREC 4RGNB 5E6RA 3BPOC 3MO1B 5AOZA 4ES8A 4P5KB 4ZFFA 3WFHB 1U2HA 2VUKA 4R7DA 1LP9F 3QSKB 1BD2B 3IPFA 4Q9RH 5JHDD 2NDFA 1NANH 3UGXA 5C9JB 1A7RH 1MFAH 3UTZB 4X2UA 4ZMOA 2GUOA 3C6LA 2XV0A 3RBSA 2BS71 1S7SA 4FULA 4ABUA 5CJ5A 2XL3A 2H3KA 5AYUL 5KWYC 5JXAL 2AAVA 3TVMA 3PJNA 4FFYH 5EA0L 3CZGA 1MCKA 3CE1A 5FUCE 4J84A 4XC1H 3IXAA 2YD1A 2ZUVA 2CK2A 5EDSA 1JK9A 1HHHA 1PIFA 3T9WA 4J0XA 4LPVA 3MREA 3BGMA 4U6VL 1ERNA 4G59C 5ELIA 4KMTL 3VDAA 4UOZA 1UEMA 4CNIB 3TJHC 1T83C 5DUJA 2Z6FA 5C07E 2AGJL 3BT0A 4EI5C 5KYYA 1A6PA 3AFCA 3U2SA 4PW3A 4PB9H 3UTTB 3FONA 2BY1A 4JJ5A 1A7RL 2EE9A 2XZAL 5HE0B 1NFDE 2AJ3B 5DWUL 3APNA 1GZPB 2F6AA 1T0PB 1OEZW 3F6IA 4M7JH 3QS2A 5BCAA 1IM3A 2CN2A 2VDMA 3RFHA 5TGBA 4ZXBA 3KVDD 1HWGB 4NSKB 1PLBA 4RH4A 4QCIB 3KL3A 2B5IB 1GGCL 1O6SA 5KSAB 1UXSA 2IOIA 5K5YA 2CWRA 3GXFA 2P8LA 4NUQA 5F7FA 5FIEA 3WV0A 4D8PB 2F7PA 1R5MA 1SOSA 3JV4A 3L6FA 1G5GA 4G7QB 1J8HB 1AGDA 2VDPH 3LZQA 4PTUA 3ELAT 1Z9MA 4HQQH 5DFWH 3RFZA 2W18A 1CL7L 3JZGA 2EZ0D 1YPZA 2CO1A 2OMTA 2ZKMX 3AS3A 2BMKB 4V1DA 5B8CA 2DD8H 5MENA 3GMRB 1XH3B 5C0NC 4FYTA 4KJQC 4A04A 3HI5H 4FYQA 1KPUA 4KHXH 1OGSA 4NYLB 3SE6A 1X7QA 2HFGH 1CLOH 1IAIM 3O3DA 5J1SC 4UQIM 4L1LA 3DO3A 4YDMA 4YUEH 3BKCH 4QXTB 3EJUA 4XBEH 4GGDA 1CR9H 5K9JL 4DAGL 2NX5B 4ESKA 4X4MA 4BP8A 2ADYA 3DSNB 3QULA 3VFNA 2NY2D 2GITB 4UBDD 3O81A 4RZCB 4G82A 1TZAA 2PABA 4X6DB 3QFDA 1MW0A 4HFWB 4PMEA 1E5AA 1A02N 3PAUA 2MOVA 2FEEI 3ARDB 3MBEC 3V95A 3SGJA 2R69H 4RDQG 5AJAA 5DYFA 4EIBA 3B5HA 2AQPA 5HVHB 1ZWIB 3CPLA 4OBSA 3ARDA 4U6HA 5E7FA 2DQEL 5JA9A 4ABVA 5HYEA 3BLPX 5HQGA 1HXMA 3QAZC 5CSBA 3T0DA 1AR1D 5KSBE 3WS3A 4O45A 4XP9L 5DD0L 1KYDA 4HKBB 4V11A 2EZ0C 1NBCA 3RWCA 2H1PL 5GGRY 1JZ7A 4O4YH 4KKAC 4KX8A 1BAGA 2NY5L 1Q9WA 2DLIA 4GI6A 4XNYL 3SIKA 5FCUL 5GS3A 1SJHB 2IWFA 5JXEA 1P4BL 1YYMH 2DN7A 5DO8A 4Z9KB 4TTDD 4NQSB 3C9CA 3QEHA 2XXFA 4FXLA 4DK3A 1CLZL 2WLYA 3CXFA 3MLZL 3VWJA 1KTCA 1I3GL 4FKEA 1G9MC 1UATA 3ARGB 4ICXA 4Q52A 3ZPDA 5GS2H 5I66A 3P30L 2CG9X 1FE8L 5LB1A 5GS2D 1BEXA 2X4RB 1XVSA 2OBGA 4ELMF 2EVIA 3BKMH 4HOWA 1HH9B 3F58H 4YHYC 1HDMB 2D3JA 2OSYA 4LCYA 2K70A 3EOAA 2CO6A 2K4WA 3ULVE 4M8UA 3I75A 2EDHA 4KJPC 5AVRB 4TVPD 1C7SA 1XR8B 4K0OA 4XOAA 3RAJL 3SPHA 3IUNA 3QAZB 3MRNB 3NPSC 1YNKL 3GSNH 5EIQA 3TYGH 5CEZL 4XAKD 1AD9A 4BKLB 1XB8A 3NFPB 2BHFA 2VLMD 2QELA 1S7RB 4RMRA 1FHGA 3PNWA 4XPFH 4DGIL 4JDTL 4OR1A 2XWBA 3ULUD 3RX7A 4ALAL 2VDPA 4R8WH 5FYJL 2X5PA 4XN8A 3MA9H 2ZXWB 2OMWB 2XPGB 2C7UA 3FQXA 3ULVD 5F21B 4TUKL 4HWZB 4Y7RA 3P9MB 2NNAB 2A6JB 4LLWB 5HYSG 3VXSE 3RJDA 3DTUB 4TNVF 3O45A 4QF1B 4GMTL 3RL2B 4D0KA 5DK2B 5DVLA 4BQCA 3TM6A 5I0YA 2DQIH 4BHUI 1F4WH 4L2LA 4GUQA 1FO0H 4Q6IC 2A6KB 1LWHA 5GIRA 4G8IA 4MCNA 2QHRL 2EDYA 2Z8RA 3FQUA 1T7WA 2CRZA 3W1ZA 1FO0B 4O9HL 3NP3A 4LESA 3INOA 4B3VA 4WJ5A 2XV3A 3D25A 2GT9B 2XKNB 3UPRB 2CK0H 4HX1A 5HYFA 1S7SB 4JE0A 1NIAA 3G5YB 3VXSD 3B8YA 3QZOA 3NVQA 2X4OB 3GYRA 2EYSA 1EV2E 3V5HA 5HHXH 3F7VB 4KKBD 2HFFA 4WU7B 3BZEB 4L9LA 1N2RB 4G71B 2ALAA 1G1YA 5D7JD 3L54A 5ANMA 3RZCB 2V5MA 3T0ED 2GTZA 1KLGB 3FTSA 1F4WL 2COVD 4GW4A 5BZWA 5IJCC 3JYCA 4BQ9A 4HBCH 4C4UA 3HW7A 5B8CC 4ODXB 5FQDA 4QTHB 3ZDWA 1MJ7H 3FTUA 1S7QA 1EXUA 2DL2A 5T1KD 3RPKA 3GSNB 3OJ2C 3MV01 4NQUA 3S6CA 3ZE2B 2PP9A 4KGLA 2OP4H 2ZG3A 4H0IA 5ABAA 4WFGD 3GJFA 2CZNA 2NT1A 4MYWB 4PRIA 3NFSH 5E2TL 5AG8A 4DP4X 2IAMB 2ZICA 3V52H 3MGAA 4Y4KD 4LCWE 1GY1A 3UTSD 4XVJH 4MB5A 1D5ZB 1BD2D 3WNLA 4MD5A 1CTNA 1JDCA 1MCPL 4FG0A 3HRZB 1ZDQA 2DQHL 1S5IL 4E9WA 4HBCL 2DMKA 1U21A 1N26A 3HB3D 1T2QH 1V3LA 3LEYH 5DHVA 4GRLC 2R56H 1EFXB 3Q7JA 4IYKA 1E6OL 3I89A 4BWUA 2JI3A 4YHOL 5E6SB 4KXZI 3TA3A 3D2UA 4M5YL 3EJZC 1OLLA 3ZOAA 4E5ZB 1F97A 2AGLA 3FHQA 4JM0A 1UQSB 4UI9R 3TCLA 1XD1A 4U1EI 1CFSB 3HE7A 3FUKA 2I9TA 3TS8A 3RIFK 1QI5A 2BSEA 5EEUA 43CAB 4BUJC 4K5NA 3VFVA 5J6GB 3QR1A 2I3TA 5F1IB 5JQ6L 1H3TA 5TEEA 1WH0A 2DQHH 1A7OH 1ADQL 2P9PC 3QEQD 3V0DA 1G7JB 3QI9C 2Y7OA 1KB5B 1ZHLB 4EXKA 1B3JA 1OTSC 4FTVE 1NOLA 2AXFB 1YZZA 1PW3A 2GG1A 2O6PA 2ICWB 1MVUB 1MNUL 3P2DA 3PWJB 5JNYA 4L3CA 5KSAD 1S8DB 2X9YA 2HT3C 1UCBH 1KYAA 4Q7DA 1BXAA 4WO4A 4NKOB 5IMLA 2H2SC 5KG9B 4HS8H 2JKIS 4KHXL 1UB5B 2Q7AA 3QEGH 1RCYA 4MCZB 3QEUA 1NQBA 1O5DT 4BQ6A 5D7LA 1HE7A 2BWIA 3B7UX 4YXLH 2GTWA 3JV0A 4GQPH 3BPCA 1BG1A 1CT8A 1URLA 3IU3A 5AZEH 5JW4N 3EJZD 5DEGB 1D5RA 2V6HA 4P2QA 2J43A 3WTYA 2ZAHA 5IJKC 3EDEA 4BUHA 3UBXB 1I1FA 2GTWB 2UWEB 2X70A 3B2MA 4PJGF 4XMLL 3F7KA 3W5NA 1QNZL 4HK3J 5EO9B 1U8NA 1WG3A 1HYSC 3IURA 3MJ8A 4UV4H 1XBDA 1E4JA 3GSOB 1PYWB 1XDTT 2NY2B 5D1QE 2IH8A 1EJ8A 3QJHA 4Z3GA 1KMGA 2R1WA 2VZTA 1RZ8A 3CBJB 3GZKA 1PKOA 4AVKA 3L48A 5FKPA 3I50L 5EU4B 3CSBA 1E40A 1U92A 5TJWK 1NLBL 5HPMA 5I6MA 3BVTA 3UAJD 2CKNA 3QARA 4LLVA 3QDMD 4FEMA 4X7TA 5C7XL 4I3GA 2WLJA 3O11A 1MH5A 4AITA 4KO6A 1HSBA 3TN0A 1LO3L 5DC9B 4QPEA 3OAUL 2W80C 3L9YA 3KEHA 3IEAA 3N1FC 3BKML 2Q8AH 4PS4L 5KYWA 4OF5A 5B1AB 3MC0A 4TQEH 3SE4C 3BLBA 5IB5A 2ZOLB 4NFBA 1FORL 3CVHH 1FH5L 3SYCA 1ONQA 2MCPL 2P8LB 4RMTA 1KJ2A 4A6YA 4I2XA 3KPSD 1ET7A 3QO1B 2IXQB 4HAKA 5AFU3 4WDIA 4G7RB 2G2PA 1YEJL 2F53B 4OZHA 2B4CH 2ICEB 3RB5A 3F7RA 4FN0A 5I1HL 3FH7A 2DPKA 1B9ZA 1G7IA 1UT2A 1WGOA 3NAAL 4H26B 4NLAA 4NXSA 3X14A 3O2VH 4U1MA 2YD7A 2Y24A 1OZUA 1KGJA 3FCTB 4G70B 1SF3A 5T1JA 1T7ZA 3CC5B 1FL6A 3FZUC 4ZFOA 4M29A 2VLJA 5I1DA 3IMVA 3LZFL 4WV1A 4G1EA 3V9EA 5CXPA 3TU6A 5AOJA 4PG9B 4PVMA 1KBWA 4DQAA 4B9PA 2N4IA 1XCWA 3EYQD 2VO5A 4X9GA 1F41A 2QPDB 2FLBT 3IPEA 2B4CL 1B2WL 3EJRA 3CIQA 3NABH 4CVXA 3SKNB 1S9XA 5J57B 2AH1A 4ABQA 4WY7H 3OW8A 4NZTH 3NG5A 3KDMA 3KYKH 1A47A 2BNQB 1UADC 3AZUA 1BX2B 4JDVA 4MD4A 1RJLB 4BJLA 1FL5A 1OARH 1TEYA 3BVVA 4J3VA 3DDFA 2CMRH 1TTBA 1KCBA 1Z5HA 3S2AA 2Q9OA 5FDWB 4N2EA 1WLHA 2HFTA 2VDMB 4DGWC 4I4WA 3SO3B 2Y5TB 3OL2A 3EYOA 3KW7A 1AOHA 4MA1B 1IZKA 5KAQG 3E0GA 3NTCL 3VXQB 3US1A 2W07B 2F7OA 4ZTPL 2WUCH 2WXNA 1L9PA 1OF2A 1UM5H 1JZFA 2AW2A 2XKSA 4U1JB 4XGZB 3DO7A 3O2DL 2Y06L 3CZFA 1J9RA 1AANA 4L8SA 3UDWA 1KTDB 2QR0A 2BP0A 5D7JB 1BZEA 3MR9A 3RZCD 1D7CA 4H1LA 3T0EB 3PFQA 3KM2A 5BV7C 1K5NB 1INQB 1OAQH 1Z0NA 5JDSA 3LN5A 4DUVA 2WTRA 5T5FA 1TLMA 1IE4A 5BVJB 1O7DC 3NCXA 3POHA 4X6CA 2WXMA 3I74A 3CFJB 1BGXH 4WI4A 1IV8A 2CCWA 5FGBC 4ZTPH 5B4MD 5LXVA 5A1AA 2X4OA 3A4EA 5F89A 5FHBH 1S7XA 1X5HA 3UZVB 2A38A 1Z6JT 3IJYB 4NJ9L 5M5TA 2VDPB 2VLJD 1BXXA 2GTZB 4YGVB 3AU1B 4NAJA 4LT7A 4P04A 1IC7H 4YQXL 1AC6A 1UXSB 2J56A 2WKLA 3ZX1A 3F3FA 4JB9L 1KYOJ 2FECI 3OPZH 5DJAB 1G7QB 4OM1L 4PREA 2YBRB 2P5WE 3DSFH 4K7PL 4XXCA 5F8QC 3D18A 4AC2A 4AQ1A 4JFED 4N5EC 2IDCA 2VO8A 2X9WA 3Q48A 5MERB 2FYVA 1RJZA 2BRRL 3WTXA 2WCSA 2P9SC 4I18A 5IB1A 3EI1B 5IF0B 8CGTA 4YBHA 1AZNA 5GRJL 2WGXA 4P2RB 1ZV2A 5AAMC 1F1DA 5EN2B 3LH8A 3SYQA 1P22A 1JUFB 2NNRA 3ECBA 1QR1A 4Q6KA 2CLRA 4FLHA 2EAEA 5DQDH 3RVXD 1A3RH 5E6UB 5LGKA 2MRYA 2OXHB 1QBMH 1QBAA 4LLDB 1V54B 1ZT1B 2FLRT 4FMFA 4GG6F 4PRHD 4XWOC 4HUWA 2I60L 1DEEA 2X3CA 4OZIE 5EMKB 3B56A 5DRWB 1Z7JA 3RPIB 6PCYA 1CD8A 4P3CH 4LL9A 4OZHF 4KGJA 3QP3A 2TRHA 3RQ3A 2Y7LA 4ZW3A 5GRJH 1BQRA 1NOFA 2IPUG 4UILL 1PZ5A 5CMAA 1M6OB 1SQ9A 1KTKE 4EOWL 3WMPA 4G5AA 3M6DA 3AW5A 4XN2A 2NSXA 4IGBD 3SGKA 4CUCA 4H20H 3RTQD 4FQXD 2A9ML 2ORBH 5FCSH 3VACA 1A3QA 3E6HA 2G60H 4N0YH 5DO2D 1T1WA 2V7HB 3JTTB 5E9DB 1AKPA 4X6DA 4ISVA 5EV7A 2CN3A 2V33A 1G7HA 3KL5A 5DSCA 5ITFB 3HJEA 3VRLE 3BZFB 2B77A 2P5EB 2O6CA 2ADIA 2BVUA 2LR4A 4PJ9D 2VZ3A 4LG8A 3NP4A 1IAOB 4JGNA 1JV5A 2DM3A 2H6OA 2ZAIA 1YA5A 2D0HA 3VXMA 3FQRB 1OALA 2BY3A 4GP4B 5LQBH 2OYMA 1AGDB 1CFQA 1MFDH 1MLCA 4XO5A 3AY2A 2YXVA 2AXWA 2ROXA 3CVHL 2YHGA 5I16B 4ZPTB 5KYXB 1OT2A 5J6HA 2CHXA 3CC5A 2WLMA 4ZFOB 3UADA 5IGOA 2QQNH 2C4FT 3LCYA 1JWSB 2CUIA 3ATBA 2YPVH 4XPBH 1FNGA 1FPTL 3QDMB 4KUCD 4YX2H 1I1FB 4DUWA 1DQIA 1B2YA 1ZVSB 2AJYH 4UINH 3RJOA 4PGDA 1DUYA 4ZZKA 4LLAA 2XXCB 4HEPG 2ADGA 4M93B 1JZ2A 4NB7A 3HS0B 2JB5L 1B9KA 3DSNA 3MA7B 2HESX 1XV8A 4TZ4A 1I1AC 5FYKD 3AJ7A 4ZUWB 4J1UB 4Q14A 1EAOA 3NCCB 5H14A 1LK2A 4EI5D 2G4EA 3MCG1 1YEIH 4GKNB 5KSUB 4TL4A 1PEWA 1Q94B 3Q13A 5D2LF 4F2EA 4XBPA 1SQJA 1YRKA 5IMLB 1JK9B 1HHHB 2K9FB 4OF0A 4F27A 4PY8I 4IOSA 4ZOXA 5MERA 4QTHA 3RUGA 5FECA 5JR1H 3EG9B 2EKJA 1JVLA 1DN0B 2F53D 4HG4J 3DVIA 4OLUH 3E2HC 3FFCB 1PCSA 1WEJL 3SGKC 5DUPL 3G04B 1JDDA 4P2QE 1J1XL 1OO2A 4WTXA 2JH2A 4LGNA 3NCEB 2XDHA 5E8DH 1XR9A 4AVIA 3IWUA 5DJ0A 4KJYA 3PGDA 4UT6H 4JR9H 5EO0B 5E6RB 1VEPA 4QCIA 2CAKA 2J1ZA 3NT0A 1X5LA 2IQAA 4QLRA 3ZE1E 4OSUL 1QKZL 2J8HA 2PTVA 1LMKA 4ZJ9A 1G43A 4QXVA 3L4WA 4LL4A 2DAVA 3L4VA 1JAEA 4GAFB 2PO6B 3ML9A 1H0DA 4HMCA 3EYVB 4XP1L 4DVBA 3CGTA 4TYUA 4J8BA 3N9GH 5DQJA 4HF5L 4G7YL 3BFWA 1NCAL 1T7VA 3GF8A 3L9RB 3K2KA 2ZP8A 2JF1A 4NGHH 5F3BB 4M7KH 3L4CA 4ZO7A 1J0JA 1YQVL 3V7MA 3VRIB 2EDTA 2XQBL 4JHNA 2VLRA 2DMBA 1AYRA 1G6RH 4XCYB 5FO8B 4A39A 4IDJL 1BBDH 5B4MC 5I6LA 3CBRA 3ESUF 2VRQA 4OCLC 2ZCKH 3CFQA 4QTIH 3EJTA 4OZFG 3OF7A 2KLSA 1SM3H 2Y0SA 1F1GA 4JHZA 2WMPB 3AAZA 4GG8B 4AYEC 3PWJA 5A6LA 2EO1A 2FWUA 4IMKC 2DBLH 5CR8A 1ZRUA 4ZQKB 4BFKA 3P4MA 2CD0A 2EIBA 3NCMA 4L8CA 2NT0A 1SVBA 1JD7A 2E9JA 2JQAA 1OAQL 4WEMB 5F7NC 4MXWH 4AL8C 2COQA 4PCSA 3S3CB 4S2SB 3D39B 3MUOA 5CFHA 4M5ZL 4DOHB 4P5TB 4PYGA 4DZBB 4UIMA 4CKQA 1B0WA 3MJ7A 4U2ZA 4OLWL 1P1ZA 1WUNT 1FL3B 2HKFH 2ZJSH 2FHBA 3FN0L 5EFIB 5IQ9B 2PYFB 3CDGA 2ZYHA 1YYLL 3GJEB 3MODH 3CZLA 3DV4A 3PWLB 4CGTA 2PWDA 3QIUD 4JRXE 1A4JB 3BC9A 5T5FH 1LVEA 5B38A 1NCBL 1JNLL 2BWDA 1MJUL 2RMNA 2AJUL 2WQ8A 5HSFA 3SDYL 4YHZH 3WEXB 4PJGE 1PGUA 1KB5L 2OMYB 3D50A 1KNOA 4N8CH 3L3IA 5DZNA 1RXLA 5FB8A 1YFQA 4S0HA 3MLRL 1BFTA 2ITEA 4NKMB 1HINH 1NCTA 4C4BA 3EI3A 3P4LA 1KC5L 5JO5B 1KIPB 3SO3C 3OKNB 3P9LB 4IOIA 1HKLH 3ZL1A 3DRQA 4W6XB 1ADWA 4Y19E 1G9NL 4W1TA 5K39B 2R4RH 3K6IA 5HDOA 4DEWA 5GRUL 4M7LH 1ZWIA 4YDLB 1W72B 5HDQH 3OQRA 3FSVA 1FV1B 5BRZE 5KN5B 4I48A 2MHAB 3MGTB 1RMFL 5T3ZL 3LVTA 3BP6B 3P0GB 3GSNA 4MAUH 1EBAA 4OJEH 1E7UA 4QIRA 4X0KA 3M17B 5CJQL 2ZKYA 3KJ4C 4XZ4A 1CIDA 4L8DB 4HIEB 3LKQB 4LSRH 1IUZA 1UKTA 4ZSOB 1X5IA 1T03L 4AYSA 3F3HA 3IS0X 3REWA 3ROOB 1GGYA 1ZS8A 3MV8E 5K69A 3EYVA 4N3UA 3FTGB 2BOCB 4NQDE 5HYJD 4FHJA 5E9DE 3CBKB 4OTXH 1PLGH 4N8PA 4B96A 2CUMA 1CDYA 1QRKA 4J3OG 1E8XA 3QRGL 3CFEA 1CI5A 5FM5M 1PVHA 3G3LA 4WI3A 3AREA 3FUJA 4OLYL 5E0QA 5EF0A 1FNEA 2PF6A 1KEML 4U31A 3V5DA 5EMJB 3EFOA 1RZJC 4NC1E 3DX1A 2DWXA 2E8YA 4H8HA 1MRCL 4P5MA 2LV4A 5GGSA 4LLYB 4U1HB 1QFWM 4IRJA 3B37A 5CEXA 1J8HD 2CIIA 4X7TB 3BP7B 4JVWA 4PJCB 3VJ6B 3DDUA 5F7EH 1JYNA 1KXQA 1AGEB 1PZCA 4H44C 5I6XC 2WXQA 4OGAC 2QPSA 2W81C 4FQXB 1BQ5A 4GKZB 4OT1L 2ROYA 1D7DA 2VABA 3DKHA 4NLHA 1KIUA 2BIMA 2WJ7A 1M71A 3QEQE 4N2GA 2A4EA 4Z7OA 3JVGA 1REIA 2EACA 3COOA 3RY6A 3CQPA 4NO3A 4GRWE 1PSKH 3W9DA 2NTFB 2NY6B 3VFTA 2P5ED 3NVNA 1JNHA 1EFQA 2AQRA 2IUPA 2HMID 3MJGX 2E9GA 2NX5D 4Z78B 3C5MA 2J1YA 4ZW5A 1NSNL 1PD6A 1YO4A 2F18A 4L3EE 5ITBL 2GSGA 1ND0A 1OPGL 1X3DA 3PWNA 5EIIG 3HI6H 2QADC 3VXTB 3E3QE 1CDJA 1PJ9A 3NA9H 3C08L 3TX4A 2UUDK 4ADGA 5TE4L 4OZGB 5GGSY 4PS3A 1P5VB 3QPQC 1FIEA 1UOQA 2NY5C 1RUAH 2X89A 4NIKB 1MHHA 4Y9EA 4HH9A 1TJIH 2W92A 4UU9A 3T2NH 1OWWA 3QCVH 2P5EA 1Y18A 4GKLA 2FWOB 3WEXA 2J2ZA 4CKVX 1AGCA 3VG0L 1AR1B 4OB5H 3T77A 5ICYA 4ONFH 1AHWB 2X4PA 1MQKL 2CDFA 4J6RH 5FFLA 2EH8H 4XBGB 4ZFZB 4AEFA 1DE4A 1O9WA 4B9CA 3IAGC 4NQSA 2AABH 1NCWL 3LN4A 5GRWA 5C0IB 5B1BB 5CJXA 5I1AA 3MV7E 4WEUD 4NOBA 4N2MA 5LG1A 1SMDA 2KI6A 3BESR 1J8HA 4PJ7A 1T2QL 1U3JA 3VGFA 3X3GH 3PAZA 4IRJD 5F6IB 4E5ZA 4FNLL 3STZB 5F9JB 2QPUA 2GCYB 3FU0A 3P2BA 4D9RE 1P84J 1TJIL 4XNXL 5D6DA 1T4WA 1CGSL 1E28B 3LOWA 4W81A 3FFCD 3T0BA 2R2HA 3KVPA 3SFZA 1RZGB 4I1NB 5E94A 5AKVA 5B1KA 5F96L 3DHPA 4AYFA 4DTGL 4GMSH 2AV7B 1NWOA 4XZUB 1ZHKA 1BVLA 4WF7A 4XC3H 4AJYV 4XRCB 3RNQB 4L48A 2CKBA 3MRIB 5D96C 2VMFA 2NYZA 3BIKA 1YEHL 1S7TB 1TG8A 4P3WA 1G7MB 4QHUB 2ADIB 2HLFC 3WNIA 1JHTA 1F0LA 1ZT7B 5E2UL 5MEQB 2PCPA 4FFYA 3L2LA 5GGVH 5ACZB 2DZEA 4U6XB 2PO6D 5HJGA 4N0RA 4AYID 2IMNA 1KWGA 5DFTA 1ITCA 4LDEB 2XKUA 3EFOB 2YD8A 4M93C 3D4YA 4TQHA 3SQOL 1UT1A 3OM3B 5JQIB 4R4BA 5I71B 2NOYA 2R2CA 4Z8FL 4EKXA 1G87A 3HOGA 1A6WL 3DX4A 4X5WA 3CG8A 3U7YL 4NXKA 5FYLL 4EEEA 1CDUA 4AEHL 4LMQI 1EDYA 4YSAA 1NPUA 1SHYB 3QWOB 4ODHL 1ILUA 4PJEA 3RWIB 3T0VA 5BRQA 2IWGA 2X4SB 1YNLH 3DUSB 1QATA 4MQ7A 3B1UA 4IBLT 1HN1A 2H8PA 4TNGA 3W0WD 4OCWL 3BAWA 2DMHA 1MREH 4XMPL 3ZXAC 2FX9H 1VZ2A 2JNZA 3IJ1A 4PY7B 3U30C 2NLJB 4S1QL 3BH8B 1XF4A 3D0VB 4JRXA 1JHLH 2NW2B 4DPCX 4KK8D 4R83A 4P9MH 1C5CH 3IDMA 3KCPA 5KSBF 3T2LA 1DN0A 5GISH 4B97A 2YEZB 4PJGA 1EO8H 1F4HA 3RWDA 1AY1H 3D39D 3DIVA 3UO1L 4EI6A 5MEOA 4XAWL 2CGRH 4GLRI 5AW9B 2WBJA 2P28B 3MRRB 5SWSE 4M4RA 1QBLL 2BERA 3IGKA 2C8NA 4HKJA 3BG1A 2DTSA 3CHRA 4OU3A 1MFAL 3K2UH 4H8WC 2GW5A 4WHYG 3FUMA 4PJDE 5E1HB 3PWUA 3GI8L 3X12A 2HG5A 4DJMA 1HZLA 4FWWA 5BRZB 1CTMA 2ZNWA 4X7SL 5KSVB 4ELMB 1OIOA 5TDPB 4ZD3H 5T1KB 4P05A 3TA3D 2B5NA 1BVKB 2XZQH 5DMKA 4KI5C 5E00B 2XT1B 2AJZB 3NK4A 2IADB 4F24A 3WTWA 3QWRD 5CZKA 2IAMD 2WWOA 3FTWA 4Y4KB 1XBRA 4QHKJ 4XR8C 3UTSB 2IC2A 5IW6A 5DMGC 2I7OA 1ZSDA 1B3IA 2VH5H 1K85A 2VLRE 1S9YA 3KPOA 3O3UN 5HVWA 3DX0A 4KAQL 4PR5B 1AGFA 2HAZA 3AUVA 1IL1A 3FRUB 4Y4KA 4X5QA 4HS6A 2DWYA 3ABLB 1SDYA 3N42F 3HB3B 3ZHNA 4YO0B 1EIBA 5F0JB 1BDYA 1A6TB 1JF6A 5DEFB 1EFXD 3QULB 3KNBB 1XH1A 3RMZD 1UQSA 4FD0A 2J5LC 2JCCF 2YRZA 3A47A 4RETB 3A22A 2Z0UA 5C92A 4HJSA 2GABA 2X05A 4BK5C 5A7EA 4YDJB 4DP7X 1C9IA 2VZSA 4K94C 4Y2OA 2E7LA 3PGCA 1ZT7A 2ZUUA 3C09B 4WHTB 5KVEH 4HPHA 1A2YA 3Q3GA 5CZVL 1OM9A 1YNKH 4QY8B 1MRFL 5LXGH 4L1SA 2XY1A 3GLEA 3UAEA 1LP9B 4NENB 5IJKA 2YRPA 3WLWC 4FA9D 2OMZB 2HVBA 2I3SA 3D3VE 3U9PL 5D1QA 5HYJB 2EDXA 4OLYH 2FX7L 3QEQB 1OAUH 5F7DA 4RDBA 3WS3B 5EARA 3Q6GL 4MNGB 2R27A 3PWVA 4HIIA 4M8QA 3ESMA 4DGIH 2BDNH 2FQEA 4Z0BL 5E1QA 1A0QH 4LPTA 3BLKA 2MCG1 4Y7MA 1DBBH 3ZE2F 3GXDA 1ZHNB 3BQUC 3ZKNC 2ITDB 1CURA 3FQTA 1IVLA 1WFTA 4ZMQA 2BKLA 3BUQA 1JGUH 2WYHA 1ECZA 3WHXA 1TCMA 1CE1H 1A4JA 1G5AA 1P4LB 3P0YL 3PJLA 4BWTA 2RA1A 2HX9A 4H8UA 2JJSC 5IESH 4AQEB 4K8RD 1IT9L 4E41E 2HP4A 3ECBB 1MI5A 3FUDA 4J4PA 4O02B 3VFSB 1QR1B 3BWAA 4F8QA 1RUKL 5D7SL 2EDKA 5IJVB 4BZ2A 1E2VA 1OSPH 1R19A 2JKXA 3C09C 4QYOA 3UJJH 1T1YA 1DL7L 1Q0YL 1KFAL 5IHUH 2IPKA 3VWJC 3BGMB 4L4VE 2VC2A 3KPQA 4F8LA 3JVFC 3BUPA 1D6VL 2D0GA 3ARGA 4CVXB 3TV8A 1U91B 4FX5A 3KPLA 1P4IL 3FBKA 1LE9B 3RUGB 3T08A 1J0ZA 3BW9B 1IGML 1TF4A 1F6AB 3RWJB 3IK2A 1P0SE 4HV8B 4Q0XH 4DW2H 5C0EB 3WFEH 2X41A 4PGCB 4POYA 1MXGA 5FXCH 4K94L 1VJSA 2IFFL 4XXDA 3LKSA 3E6FA 4LKXB 1HHIA 3MRLB 4NQDA 4A66A 15C8H 4X4XA 3CPUA 4AIEA 4UM9B 4HDIB 2Z92A 4YNYA 5DI8B 4D9LL 4YDLC 1FE8H 3N41F 4LCCA 4WO4D 1HQRA 1XCXA 4AM0B 2PCFA 3C5JB 4UCFA 2B16A 1D5MB 1HE8A 4J3UA 1ONQB 2VDOB 4YHLL 1VZ3A 4CI8A 1YN7B 4XPHL 4YNYB 4N8VB 4LVNC 4NRZB 5DI8A 1JWMA 4YBLB 4F7KA 5CCKL 1X9UA 4M7ZC 5F7WC 1K3IA 4CBPA 3EJCA 2VDOA 4NPYB 4HQQL 2DJUA 2X4UA 1T0NA 5DYOB 4M6OH 2XNAB 4GW1B 4X9YA 1F11B 3FOLB 1UD4A 5FV1L 2IAAA 4H1LB 3NJFA 4IRJB 3ORJA 4U1HA 1W0VA 1DBAL 2ATPB 4IIQC 2R9HC 1OP3H 4BIKA 1UH4A 4KO5A 1JTOA 1WSST 5INDB 4JO5A 4U1LA 1WK0A 3BH9B 1NEZB 1A21A 4XC3L 1VKXB 2JB6A 5GHWL 4XPGL 1RP8A 3ETBF 3W15A 1WZ1H 1I7TB 4HJ0C 5CS7A 2OMVA 1E30A 4GP5B 4OF3A 5I73B 4O2CB 4RFOL 5E5MA 5L7XL 3A0FA 1TOXA 4HT1H 3I3EA 4MS8D 1C5DB 5AW5B 5D4HA 5IBUB 3OAYH 4XB8A 1IM9D 4IBZA 3MRHB 1SXNA 4D0DB 1BFVL 1RZ8B 1ZCRA 2ERJB 5DJDB 1JDAA 4DAGH 1OMWB 5EEXA 2CO0A 1YYCA 1ND0B 4TUUA 3QI9B 4QXWA 4WTZA 1TQUA 3EHBB 3T2OA 1ZLVH 3TYFA 3KLDA 4EIGB 1WFJA 3IDGB 1YR2A 3MLWH 2WQUA 4N6QA 3TEWA 5GZOD 1TLKA 5JHBA 1HNFA 1R3LB 2PW1A 3H42L 3MNVA 3PAYA 4M7LL 1KXVA 2YPVA 5GGUA 3BP4A 1CO1A 1NBZB 5LAPA 1UJ3B 1DYZA 1YAIA 3N3EA 4OI7A 4LSTH 2UWEE 2E5EA 5T1KA 4PP1D 1F18A 1AJ7H 2BNQD 4JANA 2B39A 1TYJA 4DT2A 4MHHI 2P9KC 3VO0A 2EH7H 3QDGD 1XQ4A 1I85A 3D48R 4ICWA 2VXSL 3QPXL 4JY5H 4E54B 4KI5D 3LD8B 4NQQA 3O3EA 1FLRH 4KOCA 3MROB 3UCRA 4G8EB 3LQAH 5H37A 3ARFB 3WEAA 4RFEA 3W0WB 3HRZA 5ADOH 3FQRA 2RR3A 2FJHB 2BC4A 2YIHA 4WHDA 1CBVL 3SGEH 1EEYA 3ULUF 3VTAA 5DHYA 4ZX3A 3BEWB 5EZIL 2OJZL 3VH8B 1DQQA 1J8HE 3AS0A 3UTQB 1GS8A 2NMSA 1A6ZA 3I85A 4RX4D 3S5LG 4E5XG 2FGWL 1A7NH 5EU6E 3LNGA 5IY5B 5DMJB 4IOFD 1W2KT 1F8TL 4P48A 1DANU 1A6ZB 1TQSA 4PBYA 2QFPA 3QUYD 4OH2A 2PPFA 2AJYL 4NT6A 1EZSA 4PN6A 3P02A 4HKZB 1YPZF 4DPAX 1S7XB 3AT8A 3HIZA 3OKLB 4OT1H 5IFJA 3CSFA 1TZOA 2DLTA 3OKOB 4XMVA 4OV5B 5IT2L 3EH3B 4FQPA 1XHMA 1TSRA 1F45A 4CI1A 5AOLA 1UWXK 2FQFA 2KMWA 2UY7B 3GI9L 1ZHBA 3STBA 1JYXA 3I6KB 5FFOA 4OKVA 3SKNA 1MLBA 1MFBL 4ODTH 3O41B 4PJAF 2MQCA 5C6WH 2P24B 1MAJA 2WINA 4YFLI 5CCJA 3V4LA 1GW6A 3NJHA 2HN7B 2EUZA 2OZ4L 1CU4L 2A6JA 1E9PA 3S37L 4YE0A 1JVOA 4MCMA 2AP2A 2Q87A 3V4VA 5BQDA 2FT7A 3WJMB 3SGJC 3QUGA 4A2LA 1CFTA 3ARYA 1AG0A 4N2OA 3JBG7 5JZ7D 1FA4A 1KJMA 3V0HA 4AJ0A 4TSAL 5HI3D 4JFDA 1IFRA 1YC8A 3LDBC 2NDGA 3PJSB 1HZKA 4GUPB 1CLYL 5JHMA 4CY1A 1N59B 3OF6A 3EGSB 4YJZL 3PL6B 5BNXD 4Y1TA 5FWRA 5KSAC 3EQ8A 3RY4A 4NN5C 3LZFH 5DQJB 1RFDL 2R29L 2NNFA 4OFDA 3NEOA 4HUMB 1PF3A 3PP3K 1CGXA 1MFEL 5A2BA 4IHOB 4OV6F 4PI0A 3ZDXA 4JGJA 2VW7A 4PJXE 5CEXB 4FFVD 1QFHA 3L7FA 2ZX9A 5K9OA 4JFYA 3S5LB 4ZYKA 2BWQA 4JN2B 2XUWA 5EORL 3GMOB 1OK0A 1IQDB 3QDHA 4MAYC 1A9VA 1YEDA 2JWYA 4RA0C 4JHAL 4PRNA 4AGPA 1UZ6E 3K71A 2AK1H 2VR8A 5GRXG 4PB9L 1XGPA 5I8OL 3LPWA 3BCDA 5HI4C 3KPSA 4FJ6A 1U8HB 4O2FB 3SDXE 4ELMA 5EU3A 5FKTA 1S78C 3G6AB 2BJML 4QHLB 2F1BA 4HGWA 4F2MB 5C09A 1JHTB 5D7IF 1CJYA 3MJ9L 3AACA 1ZGLP 2OX5B 1ACYH 4IGBB 1U3NA 1UOPA 3RTQB 4U0RC 4F7MB 1KCSL 1YEKH 2ZUYA 4U1KB 1GZQB 4XO8A 4UILH 4ZOCA 3ARWA 5H2BB 2J8UA 4WVRA 1KDIA 1SHMA 3VXUA 4YVUA 1SBSH 4JY6A 1SJXA 3O9WA 3WNMA 3GHBL 4XVJL 2L7JA 2JJTC 3DV6A 4PJ9B 3C6SB 2EVHA 4D3CH 2ICEA 1OCZB 2CLZA 4UM8A 4M5ZH 1RZIB 5I26A 1MAMH 3C6EA 3CHSA 3ZDZE 3U79A 4O51B 1MZZA 1NUGA 2WXLA 3Q5TA 1OCRB 5LN4A 2X40A 4U1NA 3B7YA 1JYVA 4JM2F 3OB0H 2WXFA 1RZGA 1B9YA 2X4SA 2AGZA 2P9LC 1C1EL 1FVCB 1F86A 5EOTB 2OTPA 1ETA1 3LKPA 3LS5H 5F3HA 2YJLA 2IQ9H 5AZ2L 1JUFA 4WSKA 2ENYA 4P2OB 3FB8A 1O6VA 1Q47A 1KCRH 3OC5A 4QY8A 4UM9D 5CEZE 5SWZE 2K8QA 4YDKH 4MS8C 4QRAA 4M48H 2L7EA 4V2BA 4WO4B 3KS0H 5GSVB 5BUGA 2HJFB 3T4YB 3RVTD 5AW1B 4KXAA 2CO0C 4S1QH 1TVHA 2WYZA 4AW7A 3H0TA 1P6AB 3VFMA 4YSTA 1ASQA 2FBRA 2X1WL 3SDAD 2H9NA 4JFWA 4AGOA 4FQIL 3IXTB 5DJAA 4C4KT 4EI5B 2BFGA 5CSZB 5KJRL 3ULVL 4BXVA 1U41A 4P2CG 1E8WA 5F0MB 5EF3A 1UCBL 3UL4A 3TBTA 3MCKB 3VYNA 3QXTA 2HLFD 4XCEA 3L17A 4K3EL 3CD4A 3P4OA 4HIEA 1SXZA 4AQEA 4EDWH 3KAAA 4JFQA 3VI4A 3SKMA 5D2LE 1R3HB 2RFXB 3RY5A 3BXNA 4QAMA 4LSSL 2LLLA 2QVMA 5BZDB 1WAAF 3VXRD 4WNJA 4K7PX 3DK0A 4QGYA 1TKWA 5F7KC 1WIUA 4C4KO 1DJGA 5K59E 1G84A 3VFUA 2QQKL 2MMXA 2Q3ZA 1OB0A 4Z5RB 2CLRB 3BKJH 5T3XE 1OHZA 4LVEA 3NIFA 4HOZA 4A6YL 1WC7B 4NJAL 4MDJA 3V6BR 4P59H 2NCMA 2EO9A 3GLAA 5TE7L 4AVJA 1XIWA 2A0LD 1U4CA 2DIJA 3RKPA 2ED7A 2ZOKA 3OKNA 3GXTA 4IOIB 2GHZA 4K7FA 4OGAD 1X7QB 1LMIA 3QI9D 2EILB 1AG6A 4K3EH 1CXEA 1E4KA 3Q1EA 3ISYA 5D7HA 1Z0MA 2ADFL 2IALA 3HC4H 1AIFA 1CCZA 1JZIA 5IMOA 1E8MA 3IDYC 1UASA 1A8JH 5AENA 4U33A 3FT4B 2DEYX 1I3VA 4S0SD 3RYMA 3CN4A 2J6EH 4MHHG 4HIJB 3O11B 2DWSA 4PY7A 1MWOA 2GHWB 2OL3L 3P40A 4HIHB 1FH5H 5EBWB 3QUMA 4KFMB 3O8XA 2NYKA 1O6SB 3B7TA 4OZ4A 1EGJH 1JHKH 1X5FA 5IEKB 2WVVB 3VNYA 5J9PA 2MNUA 1T1XA 2F7QA 3GMPA 2Q8AL 2YD0A 35C8H 4R96B 1RK1B 4FL4C 5CLZA 2RHEA 3SD2A 1YEJH 4WFFD 4AXWA 3K1KC 3W82A 2ADFH 5I1HH 3WD5L 2X4TB 4U6YA 3BDXA 1ZIBA 4I0PA 3NSDA 4G8IB 2BVPA 4R5VA 5SXMA 1CGYA 1WA2X 5JHAA 1M7DB 4ALAC 5FHBL 1XGYH 3CMOH 4N90D 1EX0A 2AK4D 4FQCL 2EDOA 4ES0A 1JZGA 2PWHA 1CDBA 2HA1A 4J3OD 2FUTA 3TEYA 4LPXA 3N06B 1T1ZB 4ZUUB 5GJTH 1R5VB 1XEUA 4O2EA 4WTWA 1EGJL 1JHKL 3QIUA 1YVLA 2AVGA 5CAYB 5I23A 5GJSH 2JMRA 4QRFA 3QUYB 5C86A 4ILDA 3FUEA 3GI9H 4N0UB 3WMSA 1XF2A 3Q5YA 5E4EC 1JMZA 4MYPA 3QIUB 3HG5A 5FDYA 1UD2A 3EH5B 1JZ6A 2G9KA 4L18A 2LQRA 4G8GE 1A6AA 3FO0L 1MCCA 2W94A 4MWFA 3UZQB 2V8MA 5DJYB 4BH7B 2TAAA 4NQTA 5HHVL 2W5PA 1JGDB 4Z23A 4LBEB 2D7TL 1QI3A 2A6DA 2NYYC 2QSCH 3HZVA 3BT2L 3MCKA 3UTPE 3H55A 4M62L 2EDFA 4YSDA 1JZEA 3NJGA 4NN5B 1R3IH 1QX1A 2X9ZA 3L45A 1TEFA 4GRLD 4BFEA 1UXLA 4Z7UE 5DRZA 4XNBA 4JO1H 2RFXA 2HKRA 5I0VA 5I6PA 2BY2A 3BP5A 5ID0B 1BP3B 3JUZA 3GRWH 1UZ6F 5F96H 4XXCC 3T3MA 1KGWA 1ID5I 3ELQA 2Z31D 4D2NA 4GG8A 5E8OB 5HXMA 2DIEA 3EYFB 3KGRA 3MUUA 3VX1A 1M42A 3VFPA 2DTML 1QO3B 4RFEB 3VI4F 2O4EA 3W0WA 3S34H 2R2BA 1O6TA 4L2YA 4WU5B 4GQ1A 4ETQA 1OE2A 2YXMA 4C54A 3UKUC 5GGVL 4A2FA 4Y5XC 2XVBA 4OD1H 1ZA3A 5L88L 4E41D 1NBYB 2V17L 2KKQA