5I5IA

Shewanella denitrificans nitrous oxide reductase, app form
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
571
structure length
539
Chain Sequence
VHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHMEMRGRMLVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
total genus 170
structure length 539
sequence length 571
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5iA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5iA01
4XEIC 5H17A 1RKRA 3G5WA 1MZZA 3OKYA 5K1CC 2I0SA 3FYIB 1PLBA 2CUAA 1KBVA 3AW5A 3BVDB 4CI1A 1NPJA 5FA5B 1AS8A 4W9ZA 3RRMC 4E9QA 4O45A 3UVNA 3AG4B 5H14A 3SLED 1FFTB 3UADA 3OKYB 1PBYB 4G70B 3EI2B 5I6LA 2VN3A 5CXCA 2XV0A 3IJ1A 3SVWD 1PZBA 3FQ2A 5KDOB 1MG3C 2PCYA 4U7AA 4HIPA 4ERYA 1GSKA 1QHQA 3WNIA 2H68A 1M57B 2XVBA 2J5WA 4H5IA 1Q47A 3PAUA 4AX3A 3QJUB 3QJVB 1J5CA 3ZX1A 2QC5A 3N0EA 4J0XA 1L9OA 4E9WA 4FA1D 1PF3A 7PAZA 2J57A 2XYBA 4J8BA 2YARA 2AZUA 4A67A 3N2JA 3DSMA 3JZGA 1NIBA 3H56A 2E86A 4K9JA 1ZPUA 2BHFA 3FYEB 3KW8A 3AL8A 4PC0A 1WA1X 2H3XC 1W6LA 1XB8A 1OE3A 1AQ8A 3WNJA 1SHYB 3CG8A 1JVLA 3EI4A 3NJLA 3L4OD 2XXGA 4E9RA 1GW0A 2IURA 4A7JA 2AVFA 1NICA 2FTAA 3GXUB 4A66A 2HXCA 3T6XA 4CSZA 4GQBB 2J56A 3E0CA 2XYIA 1GY2A 3ASOB 3EI4B 4J84A 3IE9A 4BUJC 5TDHB 5IGQA 3AFCA 4AKQA 4PAZA 3S3CB 1A4CA 1WA0X 2FT7A 4O3UB 2YB8B 3OMAB 2IUPA 2AFNA 3B7FA 1M9WA 2DWSA 5PCYA 2PP7A 1PI6A 1SQJA 2AH1A 2P9SC 2W88A 3K27A 3RN1D 2FWLB 4BWWA 3MXXA 4GM3A 2VSMB 4O1QD 4HHWA 5HE0B 2BP0B 1SFDA 1SHWA 2RACA 4ZOXA 4F2EA 1WS7A 4GP4B 3NJKA 3SBPA 2GC4A 3PXWD 4DPAX 3C99A 2GIMA 4A08A 2YAQA 1NIDA 1RCYA 1V55B 3RSEC 2P9IC 4O9DA 2BZCA 5I5JA 6PCYA 3I2NA 1AZRA 5I6NA 2AQ5A 2AANA 2FQDA 1IC0A 1AZCA 4QLWA 4WTQA 2J55H 3EMHA 1PY0A 1L0QA 4OWRA 4QQEA 4RH4A 1TEFA 3QJQB 2H14A 4IA9A 4A08B 1E30A 1EHKB 2EILB 3T6WA 4Q8BA 2CN3A 4HCFA 3J80g 3UACA 3BG0A 1NINA 3PSLA 1KV7A 1BXAA 5B1BB 4FA5D 2YAHA 2HJBA 5EMLB 3FQ1A 4G71B 2DWTA 3EH3B 4LGNA 4BWTA 2UX6A 1DZ0A 4BXSV 3AG3B 3JZNA 2PCFA 5B1AB 4NAJA 3FQYA 1ILUA 2DYSB 2YAEA 4GM9A 3BQVA 3L4MD 4KO6A 3RYMA 1EZLA 1MZYA 3OQRA 1PLCA 3GREA 4DPBX 3EI1B 1V54B 4J8GA 5CYKA 2IWFA 1BQKA 2PP8A 2FQEA 3SMRA 5C2WB 2GB2A 1FWXA 3FU7A 2W8CA 4J86A 4TZ4A 1SDDA 3UKRC 1GXRA 1XB3A 2MTAA 1TKWA 3CVDA 1A4AA 3EH4B 4G7SB 4M4RB 4UAHA 3SBRA 5IT9g 2JFCA 3PXLA 2AGZA 1ASQA 1YLBB 4F2FA 1MDAH 2CO0C 2J57G 2GSMB 1XB6A 3J81g 3FU7B 3OKWA 4HHGA 3MBWB 5EM2A 2R7EA 2BBKH 3W15A 3NVNA 1AAJA 2UX7A 3TBCA 2HX7A 2H6KA 2XL2A 1KDIA 3NP4A 3I8CA 1AIZA 2CNXA 3PCYA 4YVUA 1FA4A 1JXDA 2XX0A 3FSAA 1ZDQA 3AH8B 3PVUB 1NZRA 2B4EA 5EM2B 1AS7A 2R7EB 1NIEA 1JMZB 4ERQA 4DP8X 2P9KC 4M3HA 5I6PA 1K8KC 5AKRA 4HALA 3AL9A 4JSXC 1BXVA 1BQ5A 3NJIA 4A2GA 2O9KA 3MKSB 4DP1X 4E9YA 5SXMA 1NIFA 4FWWA 2BW5A 3NYKA 2YNPA 2FQFA 4F7KA 5FQDA 2Z2PA 3FU9A 1M56B 4G72B 2H9PA 3C9CA 3IIWA 1E65A 4YSAA 3JROA 1OE2A 5TK2A 5GXHA 4CY5A 1UATA 3X1EA 4KNSA 4TXVB 1N68A 3PVWB 3PXTD 4JD2C 2BP8A 2CN2A 3HFQA 1CYWA 2QDVA 2WO3B 2H9LA 4E9SA 2OK6A 3EI3A 1AZBA 2QT6A 2IUVA 3EG6A 3FSZA 4J79A 5D4IA 2CCWA 1SQ9A 5IY5B 2QDWA 3UAEA 2BP8B 1A0RB 3IN2A 2ZWNA 1B9YA 4GM8A 4CSPA 1SF3A 3EI3B 3T71A 2B5NA 2HXAA 2AGWA 3MMYA 4E5ZA 4E54A 2AH0A 2PPEA 1CYXA 4GMBA 2GC7C 3DTUB 5F7BA 2DV6A 1ET5A 3NP3A 4Y5RD 5GSAA 4JT5C 4BH6A 2OJ1A 5FKRA 2QXVA 5IJ7E 2YAPA 4E5ZB 5CXCB 2QPDB 1N6EA 5TEEA 1CURA 3SBQA 4CZXA 1NIAA 1PEVA 1ADWA 4YSTA 1JOFA 2Q9OA 2Z2OA 3OTTA 3EHBB 1ASPA 5THAA 4A68A 4K3JB 4DP0X 5GXIA 4CI8A 4L1QD 3OL2A 2IDTA 5TF2A 1AG0A 1PNCA 1SHXA 3ABLB 4E9XA 2H47A 4YSUA 1GY1A 3PAVA 3ZWLB 3NJJA 4YSSA 4JXMA 1JZHA 1CC3A 1W6WA 3AL8B 3RFGA 3UVOA 1NR0A 3C75H 4A11A 3IKOA 4JKNA 4A0BA 2QPEB 2G9AA 2FJSA 5TK4A 1K32A 2BWDA 2VW4A 2I3TA 2I3SA 5B4WA 2Q5BA 2XV2A 1L9PA 1MG2A 1NWPA 2HRGA 4BK5C 3FSWA 4DP2X 2H9NA 3UAAA 1KGYE 1ZV2A 2IDFA 4A11B 1QNIA 5AFAA 4A0BB 3NVXA 4KFMB 5H1MA 1AR1B 3GFCA 1E5YA 1YFQA 2OIZA 2G99A 3F3PA 2YNNA 4GZ8A 4H5JA 4L9OA 3X1BA 1PCSA 3CVBA 2X87A 3ULEC 3T6ZA 4FA4D 3H4FA 3TASA 4LG8A 4A0AA 3AG1B 4YSCA 2UZYB 5B7EA 2H9MA 2XL3A 3FGBA 5AMSA 4FA9D 4BWUA 1OOWA 2X88A 1JERA 2OK4A 4CC9A 3FM0A 1J5DA 1OMWB 4L3GD 1GS8A 5FKQA 3UVLA 1WAEA 6PAZA 1GOTB 3SHFA 4A0AB 3EH5B 1R1CA 1AS6A 1URIA 1OE1A 3GYRA 4A2DA 3CIKB 4PNKB 5PAZA 4JSVC 1KCWA 1JZJA 5I5IA 2H13A 1U4CA 2PLTA 2HKMA 3KRWB 3NT0A 2FT6A 4GP5B 5HE1B 5A2Qg 3SN6B 2IH8A 5HYNB 2YAFA 5C9ZB 3DM0A 4GQ2P 2JKWA 2OVRB 5EMJB 2BW4A 1MG2C 3I8EA 1HAUA 4DP6X 3H4HA 5EAMA 5FXYA 3QPKA 1JZFA 1TU2A 5D4HA 2MTAH 3UKUC 4ERZA 3IBOA 1BYPA 2AGXA 4FAND 3JTBA 4A2EA 5I28A 2XLLA 4KO7A 5IGOA 3SWSD 3CDZA 5I6OA 3BWSA 1PAZA 4J77A 2HRHA 3BG1A 1CUOA 3I7HA 3EU7A 2ZXWB 4G7QB 3IJ0A 1PZAA 3N55A 4W1TA 3AZUA 2GHZA 1BXUA 3I7NA 2IDQA 2GC4C 3PAZA 3NVQA 5HQGA 3OKTA 1GYCA 4MFHA 1A4BA 3UGEA 2N0MA 4EF3A 4CZVA 2EINB 1GG2B 1SF5A 1ETJA 1JXFA 2YAMA 5F7AA 4DPCX 2IAAA 5HE2B 4GYBA 4FHLA 5CYKB 4YSEA 4E54B 4AKPA 1WA2X 5B7MA 3AG2B 9PCYA 3N0DA 4CI3A 3V9EA 3PPSA 5C2VB 2B3IA 2I0TA 2YNOA 4N14A 3QJSB 2TRCB 2UXGA 1TEGA 5E9NA 4GXFA 3X1FA 3P4FA 4YSRA 1SDDB 4YVNA 5LDUA 1TBGA 1VYHC 4J82A 3OD3A 1ET8A 1GR7A 2HESX 2UXTA 4XYIA 3WG7B 5IJ8E 2PM9A 4PSWB 2P80A 1BAWA 4AZUA 1JJUB 2XX1A 1OF0A 4KO5A 4K3ID 2P80D 1N6FA 2HKRA 3S3DB 3ZDWA 4GGDA 1JZIA 2PM9B 3D12B 3ZIYA 1A8ZA 3V9FA 2UXFA 4PCYA 5EALA 2BCJB 2XU7A 4AOWA 3FS9A 1X9RA 3NSFA 4HCIA 4CI2A 3UABA 1E67A 2I0RA 4HZ1A 5FLXg 1SFHA 2IUQA 2CE9A 3NJGA 4A2LA 3ASNB 4A2FA 1JZEA 2I85A 3CZUB 3RFHA 3SXTD 5JWZA 4JSNC 1ILSA 3X2QB 1B9XA 1SNRA 4P5SA 3X1GA 1XHMA 3JZHA 3EI2A 2JXMA 3VA6A 4NERA 1VLXA 3SCYA 2CAKA 1KDJA 4DP5X 1XKSA 4X4KA 1ZIAA 4X63B 2CE8A 3ABMB 3SFZA 2TSAA 4AI7A 4GGAA 1IUZA 2ZOOA 1OLZA 3CFVA 3PE7A 3V9CA 5FKTA 4L0PB 4G7RB 1X9UA 2P9UC 3SQRA 2EIMB 4GP8B 4CY2A 8PAZA 1MDAA 1OCZB 1PZCA 5A7EA 1NTDA 2DYRB 2YXVA 3I7PA 2YAOA 4UF7C 4KOBA 4GGCA 4ZOYA 3JB9L 3QJRB 3ABKB 2J56H 1A65A 5D4JA 2P9PC 2Y1AA 2IWKA 4MK0B 3UVMA 3I7OA 1NDTA 5K19A 1RZPA 2Q7QA 3VGZA 4PBYA 2OVQB 1L9QA 2H3XA 4J81A 5CXBA 5AZUA 1ZIBA 1N6DA 1PGUA 2YBAA 2XWZA 2PM6B 1A3ZA 4BXVA 4X60B 1ZDSA 3OMNB 3OM3B 3CFSB 4ENZA 2IDUA 2EBSA 2YMUA 4IMMA 2I7OA 4J0WA 3NSCA 3IEAA 3L45A 3PSCB 3QQXA 4AKOA 5CXBB 4EWRA 1BYOA 1GS6X 1OV8A 2ZONA 3DXMC 2W18A 4HDJA 3X1NA 3FSVA 2HZHA 1BEXA 4QT8A 3C5MA 4ES0A 3VH0A 3PXSD 3F3FA 1PNDA 3U25A 3RN0D 2B08A 2YXWA 1JMXB 1NPNA 2CBPA 4KOCA 1J9QA 1OCCB 2Y69B 3JRPA 3OL2B 4A2HA 5EAPA 4GY4A 4JHUA 2H6NA 2FNWA 3V5WB 4U1EI 1L9TA 1E5ZA 2MRYA 4R7AB 4Z8LA 3NSYA 3I7KA 3S8FB 4E9VA 1KCBA 1TYQC 3T9WA 1HAWA 1JXGA 2B5MA 4HAKA 3TBBA 2OVPB 2CALA 3A0FA 4L3HD 2H6QA 1PMYA 2OJYA 1AACA 3ABGA 5AFU3 4XYHA 3MKQA 4JSPC 4OZUA 1XIPA 3JPXA 5B1KA 5I26A 3FRXA 3JAMg 2HLEB 2H47C 5I5MA 4PBZA 1PLAA 2IDSA 2HX9A 3S8GB 3S3BB 3EWEA 3SJLD 2BP0A 5ANHA 4CZYA 5B1JA 5EARA 4HCGA 1N70A 4YSOA 2FT8A 2PPDA 4I79A 2VM3A 2AGLA 4X3EA 3I89A 1HFUA 1GS7A 1JVOA 1J9RA 1QLEB 2BWIA 3FT0A 4KO9A 4N4YB 4QKTA 2FQGA 4YSDA 2HJ4A 1B3IA 2DY2A 3IN0A 3QJTB 5EHFA 2XUWA 2BZ7A 4O3TB 2XU9A 3TA4D 3WIAA 4PSXB 4UI9R 4YSQA 2WSDA 3AY2A 5GMKn 4J73A 4BDVA 5B7FA 4X61B 3C75A 3UR4A 2VW6A 3UVKA 2WO2B 3DWLC 2XXFA 1RI6A 4YVDA 4BL0A 2HX8A 4D0KA 3OW8A 2PPAA 1U2VC 1AG6A 1T5KA 3EF4A 3CDZB 4GQ1A 2CJ3A 2BO0A 1W8EA 3RMZD 4BDVB 3I7LA 2P9NC 1ERJA 7PCYA 2IH9A 4KNTA 3TU6A 4KNUA 4ZK8A 3DXKC 3V7DB 2CO0A 1KBWA 1KYAA 4NSXA 1JZGA 4A09B 5B1JC 2B5LA 2VW7A 4ZN4A 2EIKB 1ASOA 3NJNA 4ZOZA 4ESGA 1SJMA 3GDCA 4FA7B 1IBZA 1AOZA 2PBIB 3RLMD 4FAVD 1AZNA 2GBAA 3EI1A 1NWOA 1JOIA 2NRDA 3HB3B 4G56B 3OMIB 5EMKB 3MX0B 4A2MA 3FPXA 3KW7A 2EIJB 3NJMA 3MZLA 1DYZA 2J55A 2AGYA 3JT2A 3WKPA 4J87A 4Q89A 1RZQA 4DP4X 3FPYA 3WKQA 3ZBMA 4JHVA 3F3GA 2TSBA 4Y7RA 4UANA 5HE3B 3U4YA 5I6KA 5TEFA 5B3SB 4CY1A 2UXVA 1F56A 2IAAC 3CVCA 2HYEA 4AEZA 3WI9A 3ERXA 1BQRA 1ID2A 2A3TA 3ORVD 4NB7A 2LLNA 1AANA 4FAAB 1P22A 3NJHA 3IIYA 2XV3A 3ODTA 1V10A 4FB1D 4YL4A 4N8UA 3IJCA 5AJAA 4QRJA 1J9SA 2OCCB 1GP2B 2VSKB 5EMMB 3KRXB 4WKXA 2P9LC 1I53A 3NSDA 2VM4A 2PM7B 2UZXB 4DP9X 2Z2NA 4QL1A 3DKHA 3HEIB 1R5MA 2GNQA 1ET7A 1NEXB 2PPFA 1WS8A 1AZUA 5I6MA 2GI0A 5FKSA 3K26A 2OV0A 5IC7A 2YQBA 3FU8A 4ZOVA 1MG3A 1L9RA 4P5RA 2I7SA 1IBYA 1IKOP 1J9TA 2H5UA 4YSPA 2VMJA 4E9TA 2GC7A 2AZAA 5FC9A 4D6VA 3PLYA 4A09A 4J78A 2PPCA 2IWEA 1OCRB 3NJFA 3T6VA 2PP9A 1OCOB 3MZKA 4LG9A 3DIVA 4JT6C 4CY3A 1XMEB 4DP7X 1S4UX 1L9SA 4PXWA
chains in the Genus database with same CATH superfamily
5K1CC 4MXWH 3AW5A 3DRQB 4OM1H 1Q72L 1BBJB 2W0FA 2WTRB 3HC0A 3NAAH 4N2OA 5D96C 3GMNA 5E6IB 4OIFA 4XCFL 3VFNA 3CH8A 1GCFA 3AG4B 3RL2B 2ICEC 2O6FA 2YRZA 2YUXA 3KWVA 4J23A 4ODUB 2BWQA 3AITA 4BUQA 1PZBA 3FQ2A 4U7AA 2EKSA 2WP3T 4GEJA 2FWOA 3PHOA 3RHWK 3C09C 5KWYC 4Q56A 1L9OA 2K3TA 3OAZH 2R0ZL 3N43F 1GOFA 1AKJA 4NCDA 4OFPA 3FYEB 4E41E 3MXWH 2J2ZA 1PD1A 1BMWA 3MU3A 2EVFA 1IM9A 2H0FA 5E7BA 2KI6A 5ES4B 4HUKB 2FTAA 1KCSH 3BZFB 4Q0XL 3LNDA 3T6XA 1M53A 3DMMC 2DLFH 2R0LH 4M6NH 1I3RB 3E0CA 1DQJB 1DVTA 3RDTC 3TIDB 4UT7L 1OAQH 5D1ZA 1U8CB 1TZAA 2ZG1A 5CIPH 1DVFB 2H9GB 2JJWA 3SE3A 1A3QA 4AE1A 2VCOA 1YDPA 2P5WE 2R29A 3D85D 3J8F7 3OHXA 4F3FB 1UA6L 4Y4FC 3RN1D 1YYLH 3UFIA 2ARJB 1IFRA 2ZOLA 3U0TB 1WIUA 2BP0B 5FAAA 2RACA 3O2WL 4C47A 4DK3A 5I75C 2V37A 2X10A 1H6TA 2ZCHL 1LE5A 1RZFH 4M5TA 5HDRA 1C08B 2YPVA 1X4YA 2AEWA 1BJMA 3PL6B 3RSEC 2C4FT 2ZAGA 3O4HA 3E6HA 5EZOL 1VGKA 4GKZA 5L88H 1U2CA 5IJDC 4NJ9H 3K4AA 1AZRA 2O1AA 1DDHB 3IMUA 4X6DA 2VOTA 3HG1E 1IC1A 1L0QA 2ILLA 2Z8VC 3VD4A 1U36A 2Y24A 4IA9A 3TX4A 3MOQA 1USZA 2DLGA 4ZDHB 1G1OA 1E6OL 1GJWA 4CJ0A 5H4YA 2M2DA 1XBRA 3C5ZC 3QDJA 2A83A 4KKAD 3RL1B 4LLQA 3BRGC 3VXRE 1PGRB 3QPXL 3UZEC 3WCYA 4U7SA 1JFQH 1OAXH 2X4TB 3KDMB 3MRPB 4HIXL 4U1IA 5F0PB 1ZS8B 4RMRA 1LEGA 5KUMA 3JZ7A 3BZEB 1QPXA 4Z76A 4A37A 4P5KA 2M8XA 5IBTL 3DJRA 1V54B 1AD0B 3AT9A 4PRHB 2P7TB 1NDGA 2WHVA 3NCXA 4G8GE 5DZ9A 4B50A 1Q72H 2V2XB 4M7LL 2AJZA 1YEGL 3I6SA 4GG6A 3LKQA 1TITA 3HI6L 2VZUA 4IOFD 4UAHA 3WSQL 2JFCA 2LLGA 4AYMC 4F9LC 4CL7A 5I15L 5KBNC 4ZMWA 3BVNA 2HU7A 4NLAA 3KGRA 3CBKB 2BKLA 5GGUB 4QYAA 4JNXA 2UX7A 2XQYA 4PMFA 1W15A 2KZWA 4E42B 4LCCC 4NT6B 1I85C 3DX7B 3T0EE 2R0ZH 3OKMA 4TLUA 1YMHA 4ZS6C 1FYTA 2CDEB 1YECH 3B3IA 4IW4C 1UEYA 3THMH 4J3UA 3MKSB 1BQ5A 3QG6B 1YSOA 4O4YL 4A2GA 2O9KA 5B4MC 4LGPB 4I5BA 1FUNA 4WO4B 2DN7A 4AYGA 1U8MA 2AK1L 2FB4H 1KGCD 4M61B 5CD3B 4XP9L 1GTFA 1L7TH 2AQNA 2H2SC 1PJWA 2CM5A 2GSGB 3AREB 1MVUB 3OZLA 1XMWA 2W65A 2WSPA 5TPWL 3R0MA 3VXUE 1LK2B 3WFEL 3UDWC 4KC3B 1MCOL 5ILTL 4S1RH 3RY4A 1M2OA 4LCUA 3F2LA 4LKXA 1SUHA 2BDNL 5CMAB 3T77B 5I1IH 2IUVA 1UA6H 4Y2DC 3EG6A 3FSZA 2X9ZA 2CCWA 1JCVA 1SJEA 3IDJB 3P0VL 4HIEA 4BKLA 1A0RB 2B5NA 3V55A 1J8HB 2ZCHH 3W82A 5KG9A 3V6OE 1P4BH 3N06B 1MVFA 1LGVA 4NFDA 3QZWG 5IQNA 2YO3A 4Y5RD 2K9FB 1ZVHA 5EZOH 1EANA 2MNJB 3BIAX 5D7IE 1T1XA 3JWNH 1EZVY 1PEVA 4WQOA 1KXHA 5C0BD 3SO5A 1E6OH 3MRFB 2SEBB 3K2UL 2WXIA 4N26A 5KJ7E 3CZLA 4JY5H 1VESA 3LKPB 3MCLH 4WGKA 5FGBA 1BP3B 2OX5B 3IXTB 4EQ2A 3QPXH 2H47A 3PAVA 2WCSA 3DXAD 4JXMA 3R4RA 1HHHA 1KTBA 2WQUA 5DJ0A 3WL9B 1EVUA 1U4EA 5EO1A 2JB6B 1QFUL 3LZPA 4GQZA 4KK5C 4UU9A 3TEUA 4CUCA 4EZLA 4F7EA 2BWDA 4OF3A 4K3JL 4BZ2H 5AW0B 3AS2A 4MGXA 4FFVD 2UZYA 3UAAA 2VERN 5IBTH 3HMXL 4WFFE 4TSCL 1I3GL 1MELA 1QNIA 2QPSA 3FO1B 2VL5B 4M02A 4XVUC 4AH2A 4WK4A 2R56L 3AM8C 2G99A 1A6PA 1YEGH 2OMZA 3WNKA 5IBUB 1YEEH 3HI6H 3WSQH 4LGSB 5DC2A 3CN0A 1HVXA 3EDFA 5I15H 3NESA 2FBJL 4P2RD 2ZUXA 1KB9K 2H2PC 1GS8A 4YK4B 2C9SA 1A6ZB 4PBXA 1Q9OA 1W8OA 1AS6A 4A2DA 1RJLA 2VMEA 4M43L 1L0YA 3WIHL 2WVTA 1Z5YD 4YIQA 2EXWD 3S36H 3VJ6B 5HY9B 4NQVB 4Z7OB 5HYNB 1AR1C 4OQTL 1WEJL 4U6HB 2X7LA 4ZO7A 3IGUA 4KZCA 1X5HA 5ICXB 1EDQA 4P46D 4C58B 1CFQA 2A38A 3JTBA 5SWSB 1ZLUH 2X4PA 1WFNA 2HRHA 4GG8A 3ESMA 4LNVA 1I1FB 3EYOB 4Z78A 1XAUA 2CHXA 3OKTA 1G84A 3WFEH 3LZQA 4NJAL 4Y8DC 3SDCD 1P5VB 5F7AA 5HJGA 4F7CB 4UQIM 2BDNH 4OR1A 4B41A 4E54B 3ATBA 4Z7QA 4HIHB 3PE9A 5ID0B 3LKOB 3N0DA 1KIQB 2EXTA 3P0VH 5D9SA 4LIQL 4KHTH 5F96L 1R3HA 5MENE 1R33A 3ESUF 4L1SA 4NRZB 1FPTH 2UZPA 2GJ6E 4N14A 1LE9B 4YHYC 1E8XA 1EAPA 5E9NA 3ZHFA 3K91A 4MJIE 4YVNA 4IEFB 4ZO9A 2ZXGA 3K74B 2UUDH 1Q0XL 2X6AA 3GXMA 4PJBE 1UG9A 4S1DD 4J82A 4KBPA 2NY4C 2OXHB 5MP6H 1GZHA 2ATKB 5KSAD 1O7SA 2H8PB 3ZYIA 1YEKL 2L0DA 3E7JA 4KO5A 4UDUB 1MCEA 3FO9A 3H3PH 4NUGL 1XL6A 2ADGB 2FLBT 3EO9L 4XN1A 3DTXA 2W91A 3B2UD 3DJZA 1T0NB 3K2UH 3QNZB 1QWHA 3UC0L 3VFOA 2KDYA 2C9XA 4EDWL 3P4NA 5B39B 3SDYL 4Y4KA 3AMKA 5L0QB 3KXFE 2GBVA 4I9WD 1QFUH 4Y89A 5HSFA 1T5XB 4K3JH 1INQA 3GSNL 3ZY7A 4WAFA 1JGDA 4WWKA 3W5NA 3K80A 4TSCH 3DO4A 3B9AA 3D3VA 3PE7A 1HCVA 2VDMB 5D96B 3SBWA 5FKTA 4GUCA 2PO6C 5EU6A 4YHIA 5DLML 4EI5A 4F92B 2ICEB 2AEIT 1RUML 2FBJH 3I7PA 1X5YA 2R8SH 4WDIA 1CIUA 2NSMA 2V33A 3CFDA 1WZMA 3HHSB 3Q43A 5K69A 3TF4A 3FQUA 4BFEA 3PDOA 4PP1D 4PBYA 3FXIC 1MIEH 4JANA 4XN8A 1ZIBA 2G2NA 2GABA 4OQTH 1WEJH 4A6YA 5FS5A 3CFSB 1ZLDA 5T1KD 2I7OA 2V2TA 2BNRD 2Q0ZX 3Q8AA 1XTLA 5CXBB 1MF2L 1WLHA 1H3PH 4NXSA 1YHPA 2J8OA 5ESAA 4QHPA 4JZNB 4RZCB 2P5EA 5JW4M 1D5ZA 2QZPA 2LU4A 4BFIB 5HYQB 4PHXA 5D1QE 4QJ3B 5FB8A 1JZ8A 3RDTB 2Z92B 2FNWA 3FN0H 4UBDC 3U1PA 3SKUD 3VFSB 1S5HA 3VRJB 2JKXA 1O7VA 2QV2A 3D18B 3S8FB 1KCBA 4KZ0A 4RQQB 3MCKA 5AUMB 4HWNA 4LIQH 1WBZA 2AV1B 2F15A 2WN3A 4PJHF 5DD6B 1D5XB 1WH0A 3UC2A 3QI9A 5FYKL 1IAOA 5DR5H 4HS6A 4RMWA 3WLBA 3JAMg 1WFMA 4M5SA 1U8OA 4LO9A 3OJMB 1FL5A 1Z9SB 3QIUB 3ARBD 4WUUE 4WWOA 1DQLL 2Z65C 4XNXL 4BFKA 4D0BB 1GYAA 1KJMA 2PPDA 3BJLA 3KM1A 3EO9H 4KK8C 3VFUB 1E8NA 3JV5A 2RTTA 1PZ5A 3UC0H 1X9LA 4GW5B 2BZ7A 1TVDA 1XXDC 5ID1A 4X6BA 1RERA 3MRMA 5CCKL 4POZC 2M1KA 1T21B 1IGJA 3TEWA 4Y2OA 4G6FB 3OW8A 2BHZA 3VI3F 5TGBA 1WT5A 2OSLB 4ZT1A 5FXCH 3BP7B 1BFOB 1S78D 3G5XB 4DEUA 5MHSE 5TDNB 4Q2ZB 3OLDA 3D30A 3L5HA 4MAYC 5HGAA 5B22A 4ZW7A 1LP9F 3MV7B 4CAGA 4DKAA 1E4KC 1JGEA 5DLMH 3T4AA 1EERB 2WLMA 3MGOB 1S3KL 4YDVB 5KSVB 3MJ9A 1T7VA 2CRMA 3QUKB 4KRNA 1RUMH 2YPLE 3JZYA 4P05A 5C8JB 5K93A 1J86A 5GGRY 3UTOA 2Z7YA 4Q6IA 3ASWA 5E1HB 4AEIH 3NJMA 2DI7A 1MJJB 3LPGA 4L1DA 3QUGA 1JWUB 1QR4A 4UINL 5IEKA 1JPTL 5DVOA 4X8JB 5HE3B 3CZNA 2DQDL 5I6KA 3U4YA 5L2KE 2R2HB 4PGDB 4NQED 1VGEL 1YMMB 3CVCA 2EO9A 4MXQC 3MRQA 2FUQA 1MF2H 1ZANL 4NFCA 2OXGA 5ACZA 1DFXA 4MKMA 3DJTA 5BXFA 1DQKA 3LJ3A 4HKBA 4K94C 4DERA 1SN0A 3E3QE 3WN5A 2NDGA 2VRKA 2VZVA 4N3TA 3WTVA 3V6ZB 3GMQA 3L6FB 3AC0A 3BEVA 3F7RA 4N0FA 4ZS7L 5F88B 4UOJA 3BGFB 4DP9X 3RG1C 4JM4L 4QRPD 1ET7A 5BCAA 3T0VA 3ZPDA 2VDNA 5JIDA 1XH1A 2FD6L 1P6AB 4QPEA 1EXHA 1IQDA 2I26N 4PJDE 1J8RA 5AVWB 3GTNA 5F70A 2AEPL 2BCKA 3FULA 3WJMA 4J78A 2QGCA 3SGDH 4TUUA 1R3IL 5FYKH 1BVKA 2ZX5A 5GRYA 1C5BL 1NANI 3P0YH 1DQDH 1JYXA 1FHNA 3ULUD 3O3DA 3CNKA 1EAOA 4F15C 1MZZA 2PWGA 4W6YB 5IZ7A 1KBVA 1C5CL 4JHAL 1TSRA 1CZ8L 2CDGA 2R23B 3HLAA 3SPCA 2WANA 4M8RA 2P43B 2WUBL 1ACCA 3RTQB 4RNRB 3F5WA 2IDCA 1A1NB 3JWNE 3RP1A 1IARB 1WD8A 3L81A 2EDKA 4UM8B 2J1XA 3FQTB 1XGQA 1M57B 4AM0Q 3BPOC 4Q9CA 4UAOB 1H8LA 4G9FB 3U30B 1HDMB 2XKNA 2Y06H 4FLSA 5H8DA 3ARFD 1DEEA 5A2JH 5KVMC 1MNUL 1QSEE 3IDXL 4K9JA 1II4E 2NY0B 3BMWA 5A6LA 3MROB 5EEYA 1FORL 5CHNB 2HG0A 1EEZB 3CG8A 3L3HB 3Q5TA 4NUJA 1EA9C 5DYOA 2R1YA 4FDWA 3B2PA 1RQ5A 1BMGA 1FZOB 1GMIA 3D2UA 4KY1H 1VE7A 4KFMA 2NXYB 2A6IB 2QQKL 4JY4B 5F0LB 4LLDA 4V1DD 2MSPA 2JF1A 4UINH 4ZMQA 1JPTH 2HH0L 2DQDH 5C7ZA 4JK0D 4OZIF 3QFJE 2JI3A 2B77A 4DNUA 5C9JB 1BVLB 1SHWA 5T5FL 3OX8A 2D73A 4TNFA 3HA0A 4IRZL 1WS7A 1ZANH 4IQHA 4J3TA 5IVXA 3PXWD 4DZ8B 1NC2D 4JZJA 2P8MA 3MMEB 3GIZL 4NC1C 2G2PA 4GKSA 1PPIA 2EYRA 5K5YA 5KSUB 1DVUA 2R2BA 3R06B 4WHTA 4P4RB 4ZS7H 3QJQB 3TTSA 4JM4H 1ZAGA 2NDFA 5EF2A 5HJDA 3U4EA 2ZUQB 5JQIB 2FD6H 2VIRB 1IKNC 3B5HA 1CLZL 3AQYA 4I9XA 4B5ZA 3BAEH 2AEPH 3R8BB 5HHOE 3Q0HA 1MVYA 1AKPA 5KAQF 5I2IB 1AQDB 1C5BH 4ZPVB 5TDPA 3OR6A 1PKQE 2GQHA 1T83A 2KLSA 1L3WA 3GMPA 3AY4A 1EZLA 4KO6A 1MZYA 2ZTBA 4M4RA 4MNQE 5B38B 2Z1KA 1WBYA 2DLIA 4JHAH 2OTUB 3KGSA 5LBVA 3EFDL 3VGFA 4EVNB 1WHPA 3PREA 3KPPA 4KRPD 5AOLA 3SDAB 1RVFH 5C07B 1U58A 4NPYA 4MQXC 3J81g 4I4WA 2O30A 3HC4L 3UTQA 2CIKA 4JQVC 5J12C 4Z3JA 1RZKC 5DJAB 5I5RA 2WWKO 2CJTA 2R1XA 1EFQA 1ES0B 3FSAA 5EIIA 3AXLA 5E00A 2AV7A 3IDXH 1T03L 5LAPA 4HEME 4HWBL 3KPQB 1F6LL 4NO2B 3DO3A 3TBSA 5E99H 2BVOA 3WEAA 1FORH 3LHAA 3NG5A 3ETBF 3QWRA 5D7LD 4F7KA 3RFZB 4P2OB 5TK2A 4RFEA 1FLTX 3PHQB 4XCCL 3B9KB 2X6BA 4KK9D 1K8IB 4LVHB 3X1EA 4UDTA 2YFOA 2QQKH 1H3VA 2A6DB 3ZDXF 3NCYP 5HHMD 1TVBA 2XA8L 2A73B 2JTDA 3UMNA 2WWMC 4JREB 3OKEA 4YO0A 2HH0H 3ETBJ 3BDYH 4QRQB 5DWUL 3DJ9A 3L2MA 3UAEA 5KJRH 1INDH 1P9MC 4JKWA 4DUXA 4NKOB 4PJ7B 4QOKE 3RPKA 3ZE1E 3QO1A 5KS9E 4IRZH 4E5ZA 3B7RL 1ONQA 5KBPA 3EJZD 3QULA 5IHHA 3VFNB 2V5YA 4C57C 3GIZH 1KBBA 2FCBA 2Y4SA 4HKZA 5DMGC 3EADA 4ANUA 3EHBD 1SGKA 2EKSB 3LKNB 5TE7L 3HBGA 3BSZL 3FB7A 2CLVA 1K4CB 2XTJC 2ZCZA 3HJ0A 2CG9X 1T4KB 4H2AA 5INCB 2V5SA 1G9MH 4XT1C 1AKJB 1BJ1J 4IU3A 3DHPA 3RFGA 2IAND 4L4TA 2J2ZB 1DQVA 1XHHA 3HNSH 2Y22A 3E6FB 4A0BA 1ZXQA 4OLZL 3L3OC 1W91A 4HGWA 1ITCA 1NWPA 1AXSA 4JUSA 3SCMC 4DP2X 4LIQE 2F8XC 2H9NA 3JTSB 4GSXA 4J5VA 3MRIB 4NOBA 3KMDA 1LDPH 1TSHA 4FF9A 2PMZA 5D1ZB 2XA3A 3ULEC 1PCSA 3EFDH 3FFCB 3VSUA 1AGEA 4IS6B 5DD3L 5C0CD 3OHXB 1QRNE 4N8PA 5IMOB 1A6AA 2QR0A 2OI9B 4OJFH 1KLFB 3EH5B 3REVB 3PQYA 4XO3A 2O6EA 5HPOA 2XWBA 1HHKB 1IB5A 5M95B 4Z7VF 5HDBB 3T2OA 4D3CL 2BW4A 1OD7A 5FXYA 1ANUA 1FCGA 1HAUA 1OLLA 4HWBH 4DP6X 1TUPA 3I8EA 4X6DB 4I8DA 4LCWE 4GRLA 5MEPB 1E7UA 1OD9A 1H6UA 1NDMB 4J77A 2JNZA 2A83B 3ZYZA 1UA7A 3SKNB 5E6RA 4M6ML 1CB4A 1ED3B 4W9DC 4BEIA 4PRPB 1MWAA 1NOFA 3UGEA 3UTSB 4HEPA 3W0WA 1TZ8A 2GAZA 4WI0B 2KZ1B 4B9PA 4Y4HD 1JXFA 1LEGB 3D0LA 5ENWA 2GBUA 2XA8H 2VZ1A 3TESA 4LBAA 5GGVY 4M7LT 4ZQKA 5B7MA 4F24A 3BGMA 4U1JA 5DWUH 2OTPA 2VITB 3MX0A 4WI9A 4L18A 3JWDC 4GQPH 2P5PA 3NCYS 3NZUA 5D1ZI 3P9LB 3P4FA 2AJZB 4S0SD 3LHPH 4WV1C 1UOOA 3QNXA 1HCFX 4UT6L 2HESX 2HT3C 3L3KA 1G7PA 5FKAA 5C0DA 2X4OB 1IE5A 3VWJC 1UZ6F 2OYKA 2XCMC 1CDUA 3IDYC 2UVEA 5D2LB 1ZE3C 5TE7H 1T0MB 5D7JD 1PSKL 3RX7A 4B9FA 2RMNA 2G3NA 3RGVC 3UGUA 4C56D 3W38A 5EALA 4H5SB 1GRWA 3UABA 1A7OL 3W9DA 1ZT7A 3TZVA 4PLJC 3SPIA 2YD3A 4GKOA 4I5BB 1LD9B 3KCPB 4JGNA 1EEYA 4H20H 2NUPA 1O9WA 3ILPA 3W39A 4B9ZA 1A1MA 2Z8RA 2CAKA 2WW8A 4FZ8L 4J4PA 4C54A 4F15B 1SXSA 3P4MA 2W65B 3PGCB 3VI3A 1Y1DA 1QI3A 3L3JA 4PRID 5FYKE 4ZMOA 2W9DL 4O58L 3VGEA 4PJ5A 1OAUL 5MI0B 1HHJB 5DD3H 4MXVF 4H8HA 4LKXB 2BLFA 4OLWH 5CR1A 1H2XA 3NJVA 5CZVL 3GUFA 3FDWA 1KJ2H 1LP9A 2G5BB 3QFDB 2YXFA 2Y1AA 1A3LL 5CWSB 1MFBL 4R26L 3JXAA 1NPUA 4KMTL 1MH5B 5F7UA 4O51B 4PSPA 2YBAA 4D3CH 1WIPA 4ZODA 3OM3B 1EXUA 3EOBB 5DHVA 1AGFB 3PDGA 3RWFB 2BY2A 3B8YA 3L45A 5JXEC 4EOWL 3GXIA 1TLKA 1BQHA 2J43A 3VVVA 2EVGA 2ORBH 5IK3A 1MHCA 1BEXA 5EWIL 3Q5OA 1XIWD 1GZPA 4BKSC 1KGXA 3LV3A 2DB8A 2YXMA 2YXWA 4PJXB 4LSPL 4KOCA 4EPSA 5DK0A 3NFNA 3KPRB 1H15A 2GJPA 3QO0A 2NW2B 4PW3A 4G6KL 1NFDB 3ZKND 1HJBC 5EO1B 1XF5A 4ZX3A 5FYJD 4Z7NE 2YSSB 3LB6D 4A38A 4NM8H 4LL4A 3QXVA 1Y0LB 4L3HD 3RX5A 3NIGB 1MHEB 4XGZA 1VE6A 1C1EL 1P5UC 1PU0A 2NY6D 2MCG1 3FUJA 3V7AG 3K1KC 4A7VA 1CYGA 4NFBA 1KG0A 4O9HH 5C0JB 3ARTA 2DWEA 1WTLA 3OG6B 5FK9B 3DETC 5AW2B 5B1JA 2WCGA 2GTQA 1IIIA 2JIXB 4U6YB 5LWYL 3N42F 1OCWH 1U0QA 2QSTA 1PSKH 4EN3C 5C3IA 4H8UA 1J9RA 2CUIA 4X5XA 4KAQL 3FO0H 3MRRB 35C8L 1TJXA 4ZFZA 3CX5J 3GJFH 4TQHA 1DP0A 4GMTL 4CSTA 1A7OH 1PZDA 2YMOA 5BV7C 1NUGA 4H26B 2WVUA 2JVUA 5F8RC 1G94A 2NY5L 1CFQB 2PPAA 2HTKC 4S1SH 2HFFA 2ICWJ 2VQ1A 1BVOA 3BVXA 3RMZD 1KPRA 4LLUB 2JJTC 2IH9A 1E9OB 1A5FL 4H1LA 5SV4A 4FZ8H 4HG4K 3CZSA 5DGQA 1DTUA 1GAFL 1T1WB 2X2JA 3FKUS 1IM3A 5LNDA 1HH6A 4O58H 4G5AA 1CFTB 5FKPA 4FQXA 3TYGL 4ZOZA 1N3NB 3HLKA 4FA7B 4OZ4A 4J3OG 3CV5A 3KJ6L 3WFHA 5CZVH 2XNAB 5HHPA 3O3AA 4JZOA 1H8OA 2IAMB 1VADA 1A3LH 4F7TB 2BP3A 3ZZLA 1MFBH 4R26H 5IQLA 3O3BB 4DP4X 3CLFL 3PY9A 3D52A 1YY8A 1IGIH 3NGBB 1S8DB 1AD9A 4OVVA 5ESVB 1UUSA 1WTGT 5DA0B 5E6SA 2NT0A 1Q94A 4EOWH 1DJIA 1KELH 4MB5A 2FO8A 1ID2A 4IK7A 2NNAA 3QQDB 3FO9B 4F8QA 3TEYA 1AP2A 5EWIH 3VFWB 1P22A 1I82A 4NC2B 4OZIA 2YJLA 2C4XA 1G6RB 1QTPA 3G6JE 4QRJA 1JHLL 4LSPH 3P4NB 1GP2B 2VSKB 3BFQG 4M5YL 4PJ8B 2KMWA 4Z7UE 3O9WB 4G6KH 3SGKC 1R5MA 4DZBA 5L8LB 1UT2A 6CGTA 3LMJL 4HH9B 3GXDA 3QZMA 1ND0A 1R5IA 1JGDB 2RHEA 3ML8A 3RTLA 5EU3B 1EFXB 2ZP0T 5HP5A 1LO4H 3HHRB 4UCFA 4ZRGA 3GMOA 1C1EH 3ZE2B 3VQ1C 4P49A 5CBAA 4HUVA 2AJYL 3RHWF 2V17L 4J12A 4EI5B 1KXVC 2DBLL 3MLZL 4LOUC 4B5EA 1GA2A 4LLVA 4ANKA 2WZAA 5E6ID 4AN1A 2NPLX 4GQQA 4WI6A 3SIKA 3BIBX 4WK0B 5LWYH 5B3JF 3CFDB 3NACH 1PLGL 3QEQA 3GTTA 2IOIA 1CICA 3PDOB 3QCUL 3BKJL 5F7MC 3DMMA 35C8H 1QLFA 2IMNA 3FCSB 4JANB 4OZFB 4AENA 2EVJA 1CDBA 3GLZA 3CFKB 4A6YB 2N01B 5E5UB 4OFIA 5F6HI 4JBSA 3FQNB 5KDOB 2D31B 4F8PA 4LPTA 4N9GA 4NQCB 4ZXBA 3ULUL 4HSQA 2NY5H 2VQUA 4ZI8A 5C0EA 3LKRA 2UZIL 5J13C 2HTLD 2J57A 2B1AH 1K3ZA 3GSOB 4JKMA 5A2IH 1A5FH 4JB9L 1QEWB 4Y9CA 1GAFH 5IHZA 4YC2B 1UOQA 1PG7X 4N2GA 3RKDD 1CFNA 1S5HB 1UQSB 2R59A 4IJ3B 4ERSH 4MCYA 3WY3A 2XN1A 3TYGH 1KTRL 5FFLA 2OQJB 3GXUB 4EE2A 1WAPA 1IC7L 2OMYB 1DVFD 3A47A 1I8AA 1THCA 1A64A 2A1WH 3GSWA 1RY7B 4LSVL 3UTPD 3C5ZA 1MHPL 4PTTA 3CLFH 1U8OB 2VDRL 1XT5A 3UZEA 3WJJC 4HPOL 4OCWL 1FCCA 4AL8L 3GK8H 4MX7A 8CGTA 1WPCA 1IC5H 3MLXL 3PL6D 4Y88A 5KJ4A 3UJIL 3II2A 4GP4B 1N8OE 1IE4A 3VNYA 4DWHA 4Y9FA 5C1MB 2VDOA 1V55B 3NTCL 3RVUD 3OV6A 5D5MB 5K1JA 3U36B 1L6XA 4M5YH 1A4JA 1O0VA 4G8IA 2CHDA 4CGTA 1PY0A 4LK4A 1OAKH 1TEFA 3RIKA 2A6KB 3DYOA 2NZ9C 4HCFA 4F9LA 4WW2B 4L4VA 2LU7A 1ZRUA 2XICA 3VXMA 4KTYA 4MMXC 3QDGA 4NIKB 5HVWA 2W80C 2PCFA 4HPHA 3OF6A 1I85A 3DYPA 1F2QA 4AIZB 3BCFA 2ZCLL 3N43B 1JGEB 4XN9A 4PRHD 4K5OA 3MR9A 3WO4C 1OGPA 2DBLH 3MLZH 1EVTC 1ZVYA 4MLSA 1KGCE 4J8GA 3O11B 2YD7A 5ISZE 1DEDA 3BP6B 2HKFH 2ZWKA 1RLWA 5LN4A 3QVAA 3MBWA 4TZ4A 1PLGH 1SDDA 2IADB 1GXRA 4N2EA 3BKJH 4LLWB 5M94B 1QFMA 1LTXA 1Q9KB 5IEKB 1AYOA 3CVIH 5CINL 2V7NB 2HLFD 3WE6A 2ZAIA 3KNBB 1JMZA 2IGTA 3WEBA 3ULUH 4NDMA 1KFAH 2H6KA 2IO5A 1ESOA 4QUOA 4Y2DA 1DSWA 4ES8A 2YMXL 4IU2B 1N6VA 2WBJB 2VR7A 4HKBB 4DP8X 4WO4D 5AKRA 4MA8L 3NJIA 3GMQB 4N0FB 4RAVB 3BEVB 4LDCA 5J3HC 2WIIB 4Z7VA 3ARED 3L2NA 2BNQA 3HPJB 4MS6A 2P8PA 4QHMA 4B96A 4Z9KB 5C0BE 1U30A 3JROA 5IB3A 1IC7H 3KJ4C 1A47A 3HE7B 2FL5A 1A4KB 5E1GA 3PWUA 3S5LA 5ABDE 4K71B 2DYPA 2BCKB 2LOEA 3WJMB 2HT2D 3E8VA 4W9LC 3DXAE 1MHPH 2H32A 3K0YA 2QT6A 5E8EA 1JF1A 2F1EA 4QDGA 5GGSY 3U6XS 3ZZQA 1MRCL 5DLLA 1KTLA 1VFAB 2B3RA 5A2FA 4NBZB 5HYSG 4HPOH 4OCWH 1J8HD 3D09A 4AL8H 5LCVL 4GM8A 3EJCA 1IBHA 3MLXH 4FRWA 5I1KH 1E7VA 5ALBL 2HXAA 2ENJA 3UJIH 1V7ML 1H0DB 1ROWA 1CYXA 3HLAB 4DN3L 3NTCH 3I2CL 2OR9L 5I16A 1CXLA 4TUJA 3B2XA 4MKTA 2X4SA 3EO0B 3GNML 5J9PB 2EE9A 3ZOAA 5HVFB 4F7PB 2WY3B 1F4XH 4P2RE 4AMKH 5F89A 3ROOA 3ULVL 1U8PA 1HZKA 3VG9C 5BZDA 4F2ME 3SQOH 1G7HB 2XKNB 1J7VR 1NUFA 5JLZB 3NCJL 5GGTA 4FKEA 2CO4A 3IMVA 3HAEB 3HJEA 3EW3B 3UVOA 3C6EA 3M1BB 4PJCF 1P5UB 1NR0A 3T0EC 2GVYA 1GYUA 2D3LA 4NUJB 2ZCLH 2G9AA 2I3TA 1G7QB 1ERNA 5IOPB 1OTTD 4QCIA 2HRGA 2XC8A 3WJLC 1HSBB 2HG5B 4Q14A 3GEWB 3CDGA 4KFMB 2X09A 2XPGB 2FWUA 4L9LC 1ZV9A 5IMLB 2FJHA 1VEPA 3X1BA 1KB9J 4F7MA 4KKBC 4BZ1L 3SPHA 5HYJA 1VENA 1HQRB 5IM7B 1SYSB 5CP3A 2CZNA 5IB2B 2BOBA 5EOTA 5J1AA 3MV8A 1U4FA 1WWAX 1Z3GH 4X5RA 5CP7A 1IC4L 2G3MA 3NT0A 4BSJA 4JZJB 2P8MB 3PGDB 1A1OA 3QPQD 5SWSD 1K4DB 2EYRB 3H9HA 3V6OC 3NRFA 3DIDA 4H25A 3QUXC 3O0RL 3FTGA 4FEMA 2CK2A 1NCAL 3MLTA 1KN4L 4I2XB 4HJSA 3CFCH 1ZGLA 2BNUB 1RUPL 4KJPC 1TTUA 3BWAA 3D8MA 4HOZA 3IDIB 1ZJBA 5DZPA 2Z7WA 4CZVA 1JTOA 2IAAA 4GYBA 2RJMA 4GKNB 4YNYA 1I9IL 3O2VL 5TDPB 4I9WE 1MCJA 4ZMPA 1MRCH 5EDSA 3L4UA 3AS0A 4FFYA 9PCYA 4ANWA 4AWJC 5LCVH 2LTQC 3CFJB 3EGXA 5ESQA 1WBYB 1MUJA 2BSTB 2A74B 4RMBA 4XAWH 4MZRA 1V7MH 3HZVA 4LPCA 4HVBA 3ARQA 1HK6A 3GS4A 4X4XA 5CFAA 2B5IC 2V8LA 4DN3H 3KPPB 5D8JH 2OR9H 3TIEA 1RP8A 1U58B 1LWRA 3GNMH 2AERT 1YNKL 5CD5C 5DJXA 4IBVA 4XNMB 5I0VA 2PO6A 3V5KB 4FQHB 4OCRH 3TURA 4FJ6A 2ITDB 1GMEA 1LMKA 1W2KT 4NNXB 3D12B 5F3FA 1A8ZA 3V9FA 3EFFB 2FECI 4N8VA 2WV3A 2W94A 4DNVA 4RRPA 3NCJH 2ICWA 5I9QC 4F8OA 2A6JB 2BMKA 4HZ1A 2J6EH 4DH2A 3NJGA 2WWOA 2BNRE 3FQWA 3GXPA 1G7JB 5IB1B 2I85A 5JUEL 1EGJA 3DIFA 2DQCH 1J88A 5EU5B 3TVMD 1B9XA 1NMCB 4P5SA 5I1JL 3IGAA 3OC8A 4XZUB 4EQ3A 3L4TA 4GXUN 4JHWL 4X5LA 4XNYL 4RFEB 5LGHL 2HWZL 1XKSA 3KBHE 4KY2A 5C9KA 2TSAA 3CMGA 1ITBB 1BM3L 1DVZA 5JPMC 2WYTA 3VFVB 2IPUK 2DQIL 3G6AB 2K78A 2OMWB 1JI2A 4BZ1H 4PD4K 4GBXC 1E8WA 5I8KH 3RJOA 1MAKA 1OCZB 2AP2A 2VAAB 1NTDA 4YO0B 1N6QH 3ISWA 3A21A 4JPKL 4XCNA 1A7PL 3IJEA 5DF0A 5C0RL 3EKCA 3FK3A 2Q7QA 4P48A 3O2DL 1IC4H 4NO3A 3MUY1 2CO1A 2ZXAA 4YN3A 3CK0L 2PWHA 4GB9A 5J13B 3WO3B 3BI9X 1DQTA 4R3SB 1KN2L 1SY6A 1HNYA 4IMMA 5D2NE 3CCHA 3GHBL 3EGDB 3O0RH 3TL5A 2EADA 4IBQA 1NMAL 2HKAA 1NCAH 1JG9A 1YEFL 4MNGB 4QT8A 1KN4H 4HWUA 1E28A 3QUZC 3I75B 4WLCA 1HOCA 3KWWB 5DJDA 1SLXA 2X4NB 2Y69B 3E0GA 4X6EA 5JOFB 3L7EA 1MJ8L 3DX3A 3EXLA 2KT6A 4MDIA 4IU3B 4L4TB 1Q4NX 3K2IA 2WXJA 1I9IH 3H2WA 3N85H 1XGRA 2XG5A 1HAWA 2OL3L 1SJHB 4Q9QL 1JF5A 2Q76A 1C5DA 1GKOA 4EIZC 3LZFL 3J27A 1QNZL 1BAFL 1T6WA 5AFU3 5EIVA 4LBEB 3FBQA 1KNOB 4P5TA 4LOFA 1U8JA 3QIUD 4IRSA 4KI1A 3HPLB 2IDSA 3KG5A 1DJGA 2F7RA 4MAYA 1A6AB 1YNKH 5FYJL 4NAMA 4D7PA 2H1LM 4RAUB 4CZYA 1E4KA 4C4UA 4ZOBA 3BWUC 1HFUA 1MCWW 4KO9A 4XAKD 4J1UB 3ARDC 4FG6C 4NZRL 3PIQA 3WIAA 4PSXB 4O02L 4YSQA 4MYPA 1NGZB 1BQSA 4G6FD 2WN2A 3D7PA 1EEQA 3N40P 4NNPL 2EE3A 2AXGB 3LRMA 1I3UA 4NQEE 3TC9A 4QXWA 4DCQB 1K5NA 1RXLA 3EF4A 4Z3IA 1BWMA 5I1JH 4PY7A 5FCUL 3VXQA 4XNYH 3QCVL 4WNQA 3V7DB 5LGHH 2HWZH 1NCHA 3IS0X 4EDXA 5E6RB 4HDIB 1P7QB 5M5UA 1BM3H 1LJMA 4N5EC 2DQIH 1JTDB 4Y9EA 5D1QC 3DSNB 1ZLVH 1NGQL 4L1TA 1YNTF 1FSKB 4BINA 1FO0L 3JBG7 4JPKH 4HFWB 5EG6C 5JDJA 3EYSH 2E59A 3O4LA 3MX0B 1M4KA 3KLHC 3OZ9L 3VNZA 3ZLQC 2PTUA 1DYZA 2J55A 3GC3A 4LLYA 1DCEA 5C0RH 2AGYA 5I73B 2QJDA 3O2DH 4HKJB 1ZVSA 3WKQA 1CT8A 3B9DA 1YMMD 5EO9B 4LHUA 2ZUWA 1AMXA 1TVHB 4UI2A 1KN2H 2EEFA 2F5BL 3L3KB 1A9EA 1G7PB 4PJHB 4YPGB 4X7FC 5B4MD 5C0DB 4AQ1C 3GHBH 4ZUUA 3ULUE 3WI9A 5BVJB 5T3XD 2NYZA 1NMAH 2A3TA 5IBUG 1YEFH 2FEEI 4NB7A 4AMYA 2HT4C 1B0IA 5CGYC 1M2VB 1U8IA 4HKXB 4EXKA 3H55A 1NJ9B 2YN3A 3KRXB 2EKJA 2N7BA 3TJPA 4XXWA 1MJ8H 2VB5A 1NA8A 3SHSA 1WG3A 3UGXA 5TH2B 2YMTA 3NQIA 4QL1A 2VR4A 4D0DB 4MDRA 1BDYA 4N2MA 5C71A 3S37L 2A77L 3PNRB 3BAYA 2IGFH 3HC3L 5FM4A 4AUUA 5J11C 5JA8B 2OL3H 2NUPB 1T6VN 1Y6KR 4LPVA 1HL5A 1YQVL 3LZFH 4JN2B 1QNZH 4AGLA 4YAQA 1BAFH 4HQQL 3LEXA 5J7CC 2Y1YA 4E0RB 1HZLA 1DE4A 3VI3B 2P9RA 3L3JB 4NQXB 4ZUVB 1RP9A 4G7VL 4LSQL 4L23A 1A14L 3RUGA 1EPFA 3QXTA 3UAJC 4G83A 2ZZUT 3LNIA 1OQXA 3HZYB 5DMJB 5FYJH 3B7TA 1J0YA 1OALA 1XGZA 1BPOA 4JEGB 3WKNA 3RTQD 3W37A 1OW0A 3IUQA 3B4NA 4GEIA 2WGXA 5M7QA 3AABA 4V1DE 1HXMA 4NZRH 3SB3A 4O02H 3IJ1A 4JCMA 1B9ZA 4FN0A 4PJEE 4G9FD 4NNPH 3CVHL 1QHQA 4KZDL 1FJ1A 2VR6A 3CIAA 2VDLA 1QD0A 2WLZA 3ZX1A 2JLPA 2RR3A 2NY0D 3C5JA 2QLYA 1GZPB 1KEML 3L5JA 3P4OB 4POYA 5JW3H 5EEUA 3QCVH 3NFNB 2BHFA 2B2XL 3AL8A 3R8QA 1PEWA 3W81A 1SHYB 1JVLA 1N18A 3RNQB 3E3QC 2WB1A 1XF5B 5B39G 1KYOK 2AJ3B 5KVFL 2NXYD 4XTRC 2J7LA 1FO0H 3NFPB 2J56A 1WISA 3GSXB 1U8HB 2LW3A 1A4CA 2FT7A 4EUPA 3M6DA 4OBRA 4CU8A 1WWWX 3Q44A 3MO1B 4G82A 4WTZA 1JN6A 1IJ9A 5C97A 3K27A 4FQQB 1I1AA 1LM8V 1P7KA 2W88A 2DWEB 2F5BH 1E50A 1WJ3A 1OTSD 5IROC 1BAGA 1CR9L 1QI5A 4I3RL 1QEXA 1T0OA 4QWWC 4V2CB 1J11A 1C16A 1JUFA 4OJDH 1XSOA 4FJZA 4YQXH 2V4LA 5HI5D 1SLUA 1MCQA 2D7QA 5DJ8B 3N44F 3P54A 5AVRB 1KB3A 3FT4B 4Z6AT 1CD1B 2QLVB 1DN0B 3NZ8A 4MQSB 5E08L 5JOEA 1U8KA 1IC0A 3BOVA 4QQEA 2HJLA 4A08B 4TUOA 3IUMA 2FGWL 3L1EA 4JUTA 5GHWL 1W72A 4R0LC 1HYRC 3S37H 2A77H 2D7OA 3PFQA 3JWNC 1KV7A 3HC3H 4YEFA 4JQVA 2PF6A 2A7BA 4M9OA 4H1LB 5M5TA 1YQVH 1CO1A 5A2LH 2CUHA 1A9VA 3JZNA 4WHYG 4CVXB 4HHAA 3UJTH 1HH6B 2LU3A 3Q8FA 3V7AE 1LHZA 1RZ7H 2VXQL 5F7WC 3H1ZA 1IBDA 1UFGA 4FQXB 4XOCA 4LSQH 5JQ6L 1RZ8A 1A14H 5HJ3B 5D7LE 4BFFA 3GREA 4PJCA 1PL3A 1UD8A 5FGCE 3IVMA 4ABQA 3SDAD 5C07D 3CPLA 2GFBA 4PWHA 5GZOA 4ISVB 1S2EA 4M7KL 5AW7B 3SJVA 3ZJAA 2E7LC 1TTRA 5HHME 1R3KA 3JT0A 5B8CB 4QO1B 2J57G 4JFDB 4YGAB 1AD9B 2OMXA 3UZVA 4M56A 2AITA 5E6SB 3HS8A 3B9VA 3CZFA 3ML9A 1CK0H 3VGDA 4NQTA 3VXTA 5GGRB 1QSFA 4ELMF 1UXWA 3PCYA 2DQEL 3V95A 3AH8B 3FUIA 1DQIA 4TNVF 4OZIB 1AS7A 3F3HA 4RBPH 2X44D 4OAWA 3HG5A 3ZDYB 2B2XH 2UWEE 5CO1A 5GRJL 4BQ9A 2EXSA 5JPMB 3TP4A 4P2OD 5SXMA 3B9KD 3OKDB 4JFYA 5DFVD 2H9PA 1R5IB 2K7QA 3D07A 2FK9A 2DQFA 3BC9A 1JV2A 4G8AC 3ZKMD 1CYWA 2WO3B 1MQ8A 4QGTA 1AY1H 3MLPA 2IANE 4FNSA 3DPDA 1WC7B 3ATEA 1JK9A 2BP8B 4J3SA 4NRXB 1CR9H 1GOHA 2CCLA 4N0UA 3AU1B 3FT3A 5DSCB 3OPZL 3JV6A 2AH0A 1JE6A 4PG2C 5FDWA 1S7VA 1CICB 2IPKA 2XZCL 3QUZB 4QRRB 3S35L 3X11A 3GRWL 1QLFB 4ZFQA 3T6QC 3L95B 2OJ1A 4DKFH 5GGSA 1MHHA 5C0CE 4XMPL 5FV1L 1CE1H 3MA7A 3QJXA 4YZFE 2FGWH 2YD1A 3NIFA 3AJ7A 2XFXA 5GHWH 1AKJD 5GIRB 3LKRB 4ABVA 1BG9A 1SHXA 4DGWC 3P40A 5C7XL 1JZHA 1BLNA 3VD3A 2F58L 1E9QB 2DQMA 2JH2A 3KH3A 5BS0A 3DVGB 2VXQH 4MCYB 5JQ6H 4CADB 3LRLA 4Y16A 5EORH 5D1ZD 2FJGA 3DYMA 4G80B 3FFCD 4WO0A 2BVQB 3LD8C 5H1MA 2DKSA 2R39A 3IJSB 5DURB 3F3PA 5CEXA 1WBXB 2EDBA 2X1PA 4LG8A 1C8QA 3BPLC 4XI5C 4PTTB 2XN9B 5IJBC 3AS3A 5E6UB 5IOKA 4C83B 2F8VA 4R5VA 4XNZB 3ZDXB 1MFAH 2F53A 4MX7B 5F0MB 3KCIA 4A0AB 4U1MA 4K15A 5E4EB 4XBMA 3IU3B 1RLBA 2VXVH 5L4MA 3KRWB 4Z7IA 2DQEH 5E8DL 4JG5A 3WY1A 4I0KA 3LIUA 3ZR5A 1UYWL 3T65B 4HSAC 4M48H 3KPMB 3P4LA 2V7HB 3LVEA 4G8IB 2XHNA 4EIBA 5BO0D 3D4GA 3UKUC 4HJUA 4FAND 5KBLA 2CO3A 4WV1A 1SHMA 5EFIA 2P45B 3B7YA 4PRPD 5CN2A 3UTSD 3VWJA 5JHBA 4HWZA 3RU8L 1X6NA 3ME0A 3VXMB 1OTUD 4C56E 4MHHG 3TWCL 4DN4L 2N0MA 4LXFA 5M61A 4KVCL 2PCFB 1SF5A 2E5EA 3DECA 3WBDA 3RGVA 3KR3L 3U9WA 2IQAB 1CPUA 4TVPL 2JK5B 4G3YL 3EH2A 1UXSB 5EC2B 2EQDA 2JKLA 3NDYE 3EQ8A 4WFHD 5DZNA 3L5XL 3TN0C 3OPZH 1ZY9A 5LG1A 2H1XA 1FC2D 3KDPB 1T5WB 1SDDB 2PNDA 1OF2B 3EDDA 4LE8A 4PRIE 4ATTA 4DW2H 3S35H 4B6ZA 4EBQL 5LKNA 4LHJB 3KPSB 4EKJA 3HN8A 4XMPH 5JXAL 2O5ZL 4ELKA 1NCDL 3QQ3A 5DT1L 3HR5A 4AZ8A 6TAAA 1PFCA 3MOAL 1C9LA 3MYJA 2ADJA 4MS8D 1T22A 4S1QL 3JVGC 2PM9B 3P3TA 1HEZB 2B14A 2XIBA 4PCYA 3ZR6A 3SSGA 1PG7W 3DC0A 4OUOA 3Q2LA 3T2QA 2OMBA 5FLXg 5C7XH 2RALA 2Y6SC 2F58H 4B0MM 3G04A 4Z7VB 2CR3A 4GUPA 2VNCA 2UY7A 4LSUH 1RIHL 2VJ8A 2ZYHA 3ZUNC 5LGJA 2W59A 3PXHA 4D0KA 2DEXX 3ABMB 2XQBL 4UIMA 1CS6A 5J1SC 2NY3C 1E8YA 2DYPB 3RPIA 4JQIL 4WFGD 4KMQA 4NENB 4UZUA 1C7TA 2H32B 4LSSL 4AGOA 5E8EB 2RGSA 4G1MA 1ZT4A 4NO0B 5DQ9A 5FYJE 4KOBA 3PWJA 1KLGB 5F9JA 3VQLA 4Q97A 4ZW8A 1HWGB 2IWKA 2ZNWA 3BSHA 3JVFC 3JV4A 1CTMA 1KBPA 5E8DH 3U4AA 3BN9D 4I13B 1V8HA 3OMNB 3OR7B 5E94A 4TUJB 2YMUA 2X4SB 5IVOA 3S3PA 3V5HB 1YEDA 1KCUL 2EDDA 5HPMB 3WMPA 3HNTL 3UYOD 5KSBB 3KPRD 1U8PB 1OGTB 4L5FH 3EG9A 3VU2A 4H7VA 5E8NB 1NPNA 5IESH 3RU8H 3EYUL 5CZRA 1P69B 1TQTA 3TWCH 4EN3A 3C2SA 3MKKA 1BREA 3V52L 3BUIA 4KVCH 5JORB 4GRMA 1BG1A 1E5ZA 1GZQB 2EEDA 4FZEL 3DUSB 5JDSA 3S5ZA 1TYQC 3SE4C 3QNFA 1MI5A 2VT0A 1JXGA 4ORGB 2OVPB 1OSPL 3HN3A 3DV6A 4D8OA 3ABGA 3L5XH 1JVKA 3O8XA 3CX2A 2O93L 1XIPA 3IULA 3T3PA 4CN6A 5EF0A 1R3JB 5AKTA 4JRXB 1S9XA 2JJTA 2JQZA 3MA9L 5IW3A 4EBQH 4HIQA 5HYJB 1U8LB 2JIXD 1IGTA 4WEBL 3GUTA 2XETA 2HMID 4N8VG 1NCWL 1KIUA 1YR2A 4PV9A 3SJLD 2O5ZH 4MHHI 2BOBB 1NCDH 3BW9A 4OCMC 3GI8L 2PW1B 4XN7A 5J1AB 5DT1H 2Y3AA 2BSBA 4R9HA 1TOXA 3MOAH 2VDKL 3ZE0A 3OHMB 4S1QH 4KXZI 4B9IA 5KANI 2FQGA 5EOCH 1R24A 4AQ8C 4WIQA 1UM5L 4AC2A 4Y5YB 5I6XB 2APWA 4C4KO 1VF5C 1A1OB 2DEYX 4JFXB 1TQCC 2ZP9A 1MW0A 3HS0C 3H9HB 5B7FA 2WBWB 4WI8A 2X3AA 5I1DA 4I18A 2NY2B 2IPTL 1IRAY 1NAKL 1OAZL 3EYQC 3CZJA 1W8EA 4LQFL 1NCCH 1EHLL 4A63A 4LSRL 3OKNA 4UQCA 5EF3A 3MNZA 4P8QA 3NZHL 4TLSA 4FI8A 2VLRE 4IDJL 2XQBH 5C0AB 5IV2A 3RJQB 4JQIH 3TM6A 3OSKA 4IMKA 4LSSH 4YNYB 3WIFB 4HS8L 2IAMD 3JUYA 4HIJA 3C2AL 3MRHA 3EI1A 2YWZA 2A9NL 4RX4D 5ANMA 3X12B 2WK2A 4D9RD 2N0KA 3EGXB 4FQLH 4OF0A 1MUJB 4NKDA 2VDMH 4UQ3A 4FCHA 2EUXA 2IEPA 2ALWA 1I4FA 4PJGA 2CIIA 3ARGB 2ATAA 4HU8A 3QUYC 4P07A 3ZRFC 1F56A 1U8QA 1KCUH 4H8VA 1D2PA 1WUNT 3RX9A 4XPBH 1S4IA 3IMBA 4PJ8D 2VN5A 5EBWA 4R7XA 3SKMA 3O9WD 1J9SA 1TNNA 3QWNA 4WKXA 3GHPA 2CH8A 5IBLC 5IW6A 1R75A 2E6QA 3NSDA 1LILA 2IBZY 3HEIB 4PRNA 1ZK5A 3N04A 1AZUA 1E90A 5I6MA 5INDB 3DIFB 1EFXD 1VFMA 2JELL 4S0TD 5T3XL 1KGWA 4CDGC 1QAWA 3CSTA 4JPSA 4YDLB 3VFPB 1FVEB 3OJDA 4YHNA 1L9RA 3V0AC 2GC7A 3DRTB 2E7HA 4ODVL 3FFOA 4A09A 1BZ9A 2K6ZA 5KEZA 4P06A 4EI5D 5DMGD 1YG9A 2PP9A 3MZKA 3BPCA 4XB8A 1B4TA 2N1KA 3MA9H 3W11C 4PCTA 3P3YA 1D5BB 4WEBH 1NCWH 4D9LH 4XCNB 5EC1A 4YXLL 3BVDB 1U91B 3GI8H 4PWJA 5HDLA 3R1GL 3MRDB 3W9EA 3NA4A 1L5GA 1RFDH 1MRFL 3B1TA 3DVNA 3MZTA 4NO3B 4NQCD 2VN3A 3H0TB 4PSRA 1PTZA 5HHQB 2ZOUA 5ITFA 3UBXA 1NL0L 4DVBB 2P5ED 5FV2A 2J4WL 3MXVL 3WJJA 1NAKH 1OAZH 1E28B 2XV6B 1E9PB 1HOCB 2YQ3A 4LSRH 1SMAA 3GJEA 3GSVB 2ICWI 1OE3A 3AWGA 3L7EB 3LD8B 4ELMA 3WUWA 5JW5A 4TSAL 1XR8A 1RMFH 1DSYA 4HS8H 1OAYH 3MREB 1ZLWH 2VUOA 3FRUB 3UBFA 1ROCA 3OWEA 4NAAA 1C5DB 2X5PA 1O6TA 4M62H 5SX4I 2VXTL 4UQ2A 1R0AL 2IUPA 3OXRA 1OOAA 3WDJA 4BFGA 4WU5B 3RWCA 4I85A 1F3DH 2F68X 4OGXH 4PRHE 2FR4B 1RK0B 4O1QD 4RDQG 4LNRA 1EBPA 3X17A 3V8OA 4E41A 1MJUL 1R6VA 3J07A 3U2SA 3N1QC 1KB5A 3BPNC 2X9WA 2EAEA 3CQFA 3NN8B 1CDHA 1K9TA 4R83A 1EHKB 2EILB 4QRUA 5E23A 3PGFL 3NCEB 1SOSA 5T3XH 1BXAA 3PJLA 5DJYA 1SMDA 2DWTA 1XD1A 4IOSA 2P5WA 5G4MA 2XQYK 4ODVH 3G5ZA 5EZIL 4GS7C 4ZMYA 1PZSA 2VR3A 5JNYA 2F19H 3ZMEA 1G9MC 2APBA 2ZXEB 2H3NA 4HUMB 3HZMB 1F13A 1X3DA 4LVOC 5HGBB 1BQKA 4YXLH 3ECVA 3STLA 3O4LB 2JB5L 3R1GH 4Y1AB 3U0WL 3ZSSA 1TKWA 1MRFH 3MJ8A 3AB0B 2Z35B 3HG1A 4PJDF 2YEQA 4KKAC 5F71A 2OA9A 4PR5B 4W9EC 3D87B 3FU7B 1A9EB 4DO4A 1J8HE 4P3DA 1E6JH 4UTBA 2WXFA 1UACH 1XX9C 2WBJD 2FJFB 3ZHLA 1FL6A 1BGXH 2J4WH 1ZPLA 4L0ZA 4AIXA 4OZHE 4ETQB 1XCQB 3GSNB 4PWEA 5DQJB 4TSAH 4M93C 3NYKA 3HE7D 4EUPG 3KWUA 4G8GA 4HV8A 4IOFC 5I24A 2ZXCA 1TZOA 1JGLH 3WKYA 4R97B 1R47A 4LVEA 1E8MA 2B59A 3LEXB 5I74C 4N28A 4N6RA 1SHSA 1V7NL 1R0AH 4FG0A 2OK6A 3KWXA 4E68A 3IJHB 3MHZA 1SPDA 3BUBA 5TFSH 5F6IC 4NWTL 3EI3B 3CUPB 1S7RB 4D0CB 2VKXA 2FIKA 4HGMA 1JGVL 4OLVH 2PWDA 2Y23A 3EH1A 3UX9B 2J5LB 4CW1A 4NUQA 2QXVA 4BSWB 4N2CA 5IJ7E 2YGOA 2GJJA 3MJWA 1U2YA 5TEEA 1F90H 4XMUA 2FIRT 1UENA 4L5FE 5J57B 2V2WA 3PGFH 4DNLA 4OCSL 3VXUA 4Z7OE 2NW3B 5DK3A 2DIAA 1DBKH 3A5VA 3C5JB 3T3MF 3OAUL 4LCYA 4LASL 4LKCB 4MMYB 1GY1A 1A25A 3LRSB 5EZIH 3AL8B 5SWSE 3IKOA 2C1OA 4KZEL 2GJZA 1U92B 4JO4L 2FRGP 3CDFA 3N50A 3QQ9D 1HNFA 1MOEA 1BA9A 3QUXA 2IDFA 4DK6A 2ZQKA 2NTFA 3DROB 2OYPA 2YEZA 1BZDA 3WNMA 3GFCA 3ISYA 2JB5H 4FHJA 2AS5M 1AZZC 2C9RA 2ADFL 1XF3A 4B3EA 1OSZA 1W80A 4G43A 4OUUA 4YSCA 3QUHA 2DJUA 3NRQA 4IIQA 2FH8A 1ZHLA 2ERJB 1CQYA 1I1AB 3GLAA 4MQ7B 4WJKA 3HS0B 5AYQA 6PAZA 4L1LA 5BNXD 4LGRB 2Q10A 5D7EA 1EHNA 4N9OB 2FT6A 1QFWL 2R29L 4K3DL 3KYOA 4FFVC 3U2IA 2OVRB 3NZ8B 1Z5HA 2EDWA 4JO5A 3QZPA 1JZFA 2E8ZA 2HJLB 1W9XA 1D5MA 1Q9LB 1KT2B 2C7UA 1NBZB 1MREL 2JTYA 3ILDA 1J1XL 3BG1A 1SJXA 2ZKXA 4W9CC 5CYKA 4HXBH 1QRKA 3ETSA 1SN2A 3GSRA 3SZ6A 3TCXA 3FAXA 1R9FA 4BQCA 1GG2B 1V7NH 4JPIA 2EXWC 3LN4A 4OKVB 4ZUWB 3KYMB 5T5NF 3RVVD 2A9CA 1YNLH 1KMGA 4BH7B 1KEGL 2QKSA 3OXSA 4NWTH 1NCJA 3KLSA 2YNOA 1M71A 4P46C 1G4RA 4H8PA 4QNPF 5BZZA 1RJZA 2GFBB 5CCJA 4DKDC 5M5SA 2OK0H 4PV8A 3SJVB 3TO4A 1JGVH 5CCGE 5FO7A 4U0RC 1C8PA 2XWRA 5T1DH 1ZEAH 4P3CH 4GO9A 4PG9A 3TNNB 3UZVB 3HKZA 3SQBB 3QC6X 5AVXB 2IOOA 4H0GA 3SDCC 5AWNL 1B0WA 5IKCA 5I1CL 3AADB 4OCSH 3W2DL 3ZYOA 1YUHB 1UWXH 1MEXL 1KF9B 1IGYA 3EBAA 4LARL 5FF6B 4LASH 3ZE1F 4TS6A 5DS8A 4B7LA 5FOBB 5KS9F 2Y7QA 4J7RA 2G75A 3GM8A 3QWRD 3RKPA 3ZDZB 5JHLA 3OGCA 2QSCL 5D93C 4BGLA 3DGGA 3QHFL 4UT9A 5MENA 5IR1B 2E8YA 4JO4H 4S1DC 4HGKC 1T7WA 4FA8A 2C3HA 2CXKA 3EI2A 2JXMA 4MJIA 2C9QA 3CU7A 5E2TL 1AHWC 5KSAC 5GRVL 1EJFA 3APCA 1QYGL 1WUZA 4ZFFA 2ADFH 1FNGA 1JV2B 1Q9WA 3VD5A 1N2RB 4K7FA 5LHDA 3B2UC 3RVXD 1IZKA 1MDAA 3KWTA 3VSTA 1Y6NR 5E70A 2WXQA 4HCRA 4WI2A 3T09A 2VTFA 2P9PC 2PWFA 4S11A 3Q1SH 2BFVH 3K7UA 4N0UB 1CE6B 3KXFA 1TEYA 1QFWH 2JLLA 4G1EB 2D9QB 3FT1A 3FMGL 3X11B 5KBDA 4WVRA 4XWOD 3BHBA 4S2SB 3QEUA 1MHHB 5GGSB 3SGJC 1B6UA 4P23B 5F1IA 3DGCR 3DXMC 1YUKB 2BHYA 2GY5A 3X1NA 5DHXB 1MREH 1SLWA 1J1XH 1PFOA 1UM6L 3GRBA 1L0PA 1S7XB 2AJVL 2QZ5A 4LLAA 4XAKE 4L4TD 1HKLL 1TTBA 1RI8A 1HKFA 4A55A 1UJ3B 2DQTH 4LQ1A 1XF2B 1T1YA 4B9YA 1OK0A 4ZZFA 4PP1C 2PR9A 4XH2B 4JRYA 3ARDA 5BS0B 3X13B 2UV3A 1J8SA 2W92A 1FBIH 4Y16B 32C2B 1KEGH 3B37A 2FJGB 2Z4QB 1NGYA 1PIGA 3BXNB 3MV7E 4LLMB 3KLDA 2B0SL 3ZL4L 2BY0A 5I5MA 3IAGC 2HJKA 3FUNA 3WS3B 2AABL 1I1RA 1NKGA 4ADIA 4W9KC 5F2FA 2D9CA 1GPOL 2DOCA 4Y5XC 1NCNA 2CCVA 2EDLA 5D1QA 3K6SB 3H3KA 4HIIB 2DWDA 5AWNH 2AGLA 5I1CH 4N4YB 3OB8A 3ZTNL 3WMQA 2VYRE 4K94H 2B15A 4N87A 3UH8A 1D7BA 4LARH 1F11B 3I9AA 4NZ8A 1YMME 1ZOXA 1N7ML 1WWCA 4LHQB 1Z0MA 4BDVA 3TYFB 3RLSA 2WO2B 2XXFA 3QHFH 5IHLB 3WV0A 3PWNA 5T3XE 2VLLB 5CIPA 2IALB 2CJ3A 1I9JL 2Q3ZA 2P46B 3EUDA 1P7QD 1D7FA 1PY4A 5D2NC 5EFIB 3W0WD 4AQ1A 3I7LA 2NY5C 4ZMNA 4KNUA 2VABA 4LVOB 3ARBC 3SDXB 3VMOA 5D4QA 1QYGH 4ODWB 1M1XA 4L29A 4PJIB 2WZPD 4UNTA 4BELD 1XSIA 3NCFB 2E7CA 3MCYA 5F3BA 1D3CA 1M7IB 1N5AA 2NYKA 2WAQA 3HAEG 1MFMA 3S2AA 1ORQB 2WO4A 5AOJA 5DI8B 5E5MA 5KN5A 4J87A 1DBML 2VC2B 4MCMA 3FMGH 3JTTA 3EGSB 5EZLA 1U3HB 1S78C 2I5YH 4APXB 5J3HD 4AEFA 1TXKA 1KBGL 2CJSA 3H7BB 3BKCL 2Q7AA 4Z5RA 1M7XA 5I76A 3QQ3B 2LLNA 4AZ8B 1YVLA 3BP5B 3S96B 3UAJA 2QSVA 3IUJA 4GXUM 1JF6A 5AJAA 1UM6H 2PETA 1V3JA 3TZVD 4TUKL 1HKLH 3RB7A 3EO1A 1FNFA 3WS6C 1IBGL 2YPLA 1ADQH 1LWHA 2DJSA 4G9FE 4DUWA 3B2DC 3I02A 5F1NB 4JM2F 5AAMC 2YQBA 2UY7B 4ZOVA 1DJHA 1NM4A 4E9TA 1HJCA 3MUNA 1J9TA 5F6IB 4KKNA 5LGJB 5AYUL 3NJFA 5L2KA 2R27A 1VKXA 1D6EA 3RPIB 5FA4A 4JT6C 3K6IA 3EOTL 1XGTA 2CBOA 2ZX9A 3C60A 1JNNL 3FBKA 1CDCA 1L9SA 1VEOA 3TBYA 1XR9B 1ZT4B 1RKRA 1INEH 3G5WA 3OKYA 2OR7A 4Y5VC 2FHFA 5ETUA 4CI1A 5F9JB 3FF7A 1OP4A 5FA5B 4Z7NF 4UNUA 4XPTH 3RRMC 1YNTB 4OLUL 4NGHL 3SLED 3ZTNH 2BIIA 1ZK9A 3D1MC 3FU0A 1A12A 2XWJB 3DX0A 2XV0A 2Q6WB 2HP4A 1COBA 2AQSA 1GSKA 4FQCL 3OWRA 3WNIA 2VQTA 2H68A 4PJDA 3GGWB 1OVZA 4J0XA 2BY3A 1DJYA 3FTXA 1LO2H 1PX3A 2QVMA 4U7MA 5FECA 5IROA 3ULUC 1NIBA 4A6YL 2W0LA 1ZPUA 1EH9A 1KYOJ 4F91B 1XB8A 3SPGA 3NIDB 3VFTA 2J1KA 3W5MA 2R4SH 4BBWA 4W70A 5DC0A 4E9RA 5TF1L 3A22A 1OP3H 1DLFL 5ADPH 4OCLC 1H2WA 1ZMYA 4JDVB 1MI5B 3GBDA 3MRBA 3GHEL 4J84A 4JDZA 3GT6A 2EC8A 3QARA 3GS7A 4BUJC 5JW4N 3AFCA 1LK3H 4R0LA 2Z6FA 3O8XB 2X6CA 5IQ7L 2FBOJ 1W0WB 1S9XB 3ARFC 3CN1A 1PI6A 5TJWK 2GPZA 3GUTB 2FWLB 1CI5A 3BKCH 1LO5B 3ILQD 1QSEA 1WIOA 4F2EA 3IDGB 3NJKA 5JA9A 4XVSH 5LAXA 4AL8C 1UZGA 5C07E 4JPQA 5FHAL 1R24B 4BYHA 4BZ2A 2BRRL 5I6NA 3VTMA 2OULB 1IBGH 3TCLB 1H9DA 1UKTA 2E7LA 4MD0A 3K71A 1QUPA 1G6RH 1QW9A 1KIPA 2GK0B 3I6GB 4FA5D 1JHKL 3IVKB 4N2KA 1T1ZB 1IM3D 3FQ1A 3L16A 4NKIL 3LKSB 4LGNA 4BWTA 2UX6A 2W07A 3MNZB 5ALCL 4FQXD 4LAQL 3U1QA 1Z9NA 2OJEA 3QFJA 5BQ7B 1N10A 1NH6A 3EOTH 2AQ3A 3JQOB 3BQVA 4N2IA 1JNNH 4BRVA 3M45A 5ICYA 1YPZB 5LB1A 5EB9A 3MRHB 3EI1B 4G8FB 4I1PA 5JPNC 3P30L 1FWXA 1EZUA 4JFDD 4PQXA 2EIZA 4UQ3B 5BUAA 2MPAL 4NGHH 4K9EH 3SBRA 2QEJA 3T04D 3QZBA 5E5RB 3EYFB 3MJ9L 2G5UA 4HHGA 4HJ0D 4PJ7E 3B2VL 3QIBA 2R7EA 2F1BA 3IPBA 2WQSA 5D93B 2CD0A 1KDIA 3WUWG 1TQWA 1RHHA 3EQ9A 1JXDA 2BPBA 3I9PA 1PX4A 3L9YA 3DX8A 1G7MB 5HHOA 4OZFH 1LO3L 3MNDA 3SKMB 2X40A 4A6YH 1B2YA 1AHWB 1ZCRA 4OFVA 5IW6B 4R8WH 1MLCA 3Q2VA 4XXCC 3CFNA 1KYDA 4PG2A 4MNQA 5TF1H 3N44B 4KRPC 1DLFH 1CGUA 4NZTH 2QVIA 1RZGB 5CAYB 3GHEH 3OJDB 1DQQA 1QWNA 5FPIA 3PXTD 1BZ9B 1FGVL 1I3VA 1DQML 3O4OC 2EUVA 3BPCB 5IQ7H 2VDNL 5GRZA 1QG3A 4YHML 3WTSA 3VXPA 3BWZA 3IS1X 3DDGA 1CICD 3QUZD 4QRRD 5IJVB 4TNEA 1FFNB 3FFCE 4NQUA 1HE8A 4HEMA 4ZFGH 2BOCB 3SEPA 5FHAH 1UCBH 3DX9A 4XHQA 1A6WH 4BH6A 2BRRH 4ZXBD 2ZCKL 4KK9C 4G9DB 2FO4A 4BE6A 3OKLA 4OM0L 2EDXA 4JDTH 5KBKA 3D39A 1DZBA 1BZ7B 2LABA 3KVPA 3QR1A 4Q52A 5HDBE 3AWFA 2A99A 2BM3A 3OL2A 1JHKH 4HAGA 5SV3A 4NKIH 5DQDL 2IFFL 5FR3A 2KUTA 5TF2A 2JCCB 5T1KB 4P3WA 3FNKA 4X6DE 5ALCH 4LPXA 3GJEB 4ELMB 1WWBX 3QZLA 4LAQH 4QJ5B 5A2CA 2RQ8A 1MCWM 3EJZC 4TQEL 1K32A 1D9KB 1UB6B 5TK4A 2ZSVB 4WHCA 4QOKA 3ZE1A 1PIFA 4TYUA 1TTGA 5KS9A 1TQSA 5DURD 3PNWB 1J0KA 2BIHA 4I0PA 5TE6L 3RWDB 3SN6N 1IL1A 1JYNA 3EHBC 4PRPE 3UTSE 5ACMA 4A11B 4GJTB 3O45B 4I3SL 4L8CA 3NVXA 3P30H 5DZAA 2OIZA 1C12B 2XN9D 1ZXKA 1MW2A 4FG6D 2C9PA 1SEBB 3H4FA 4DPRA 4X6CF 3FGBA 1FIGL 5DEJA 2XZAL 5DEFB 5ECJE 3BH8B 1FAKT 4HJTA 1QOKA 2I9LA 1NFKA 2GCYA 3B2VH 1YEHL 3TFKD 2Z93A 2EABA 1GL4B 4IBTA 3FAWA 4JSVC 2R2EA 3G08A 3ZUCA 4KDTC 4GP5B 5C0GB 1E2VA 3BO8B 1LO3H 1ORSA 4OY9A 4QF1B 3TA3A 3TN0A 2JKTM 4IBUA 4N5ED 5D2LE 4UMGA 1QLRA 5TQ0L 4LRIC 5GXBB 1TU2A 4KU1A 3UBXI 4NN7B 2PXYB 1VFBA 3WXWL 2WXGA 4L8SC 2XWEA 4KO7A 5IGOA 3H2QA 1AGCA 4RDBA 2MQCA 3VXMD 3QDGD 4F8NA 2XN2A 5T3ZD 5HYEA 2FECL 3D25B 4G7QB 8FABA 3UG4A 3DBXB 5DJZA 2IDQA 2GC4C 3LNEA 3WE1A 2P26A 1QRNA 4HS3A 1FGVH 4F20A 4ELDA 1DQMH 4U6TA 3KLKA 2K6WA 2RFXA 4LCVA 4ONHA 4W68A 4X99B 3U6RA 4YHMH 3WFDL 4BKTC 3ZGIA 3PPSA 3ZIMA 3SKOA 4WK2A 1PW3A 3MUJA 4FD0A 1N64L 3ZK0A 1BFVL 2CJUL 2K45A 3STLB 2K8MA 5A6IA 1AC0A 5AB2A 1TEGA 1JJUA 3KPSD 4YSRA 4N5UA 2OBGA 1TKWB 3MRGA 2CHNA 1FVDB 2DQHH 2PYEA 4LCWA 4NAQA 2R4RL 5EH1A 1B9KA 5DK2A 3MLYL 4H8QA 2ZCKH 1BAWA 1D7DA 3PV6A 3RIFK 1FH2A 3ATAA 4FE9A 2P80D 4OM0H 2YJQA 1YA5A 1JWMB 1U95B 2WVVB 4P2QB 4Y4HC 5AW6B 1TO4A 4C55A 3EYVA 4GRWF 1QR1A 5EULV 5AAWA 1W0VA 4G7YL 2BVTA 3VDCA 5DQDH 2BCJB 1X9RA 5C0IB 1E67A 3TBVA 5CEYA 2EE6A 3KYNB 4ES9A 3ATFA 3ASNB