5I5IA

Shewanella denitrificans nitrous oxide reductase, app form
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
571
structure length
539
Chain Sequence
b'VHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHMEMRGRMLVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
total genus 170
structure length 539
sequence length 571
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5iA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5iA01
1TYQC 2PP9A 5FKTA 5FLXg 1L9RA 4J82A 1V54B 3GYRA 1RZPA 4J87A 1WA2X 4HDJA 2FT7A 1HAUA 3NJHA 4YSPA 3I7NA 4A08A 3EI2B 4X63B 1N68A 4E9QA 5EAPA 5I6MA 3JPXA 1AAJA 2W88A 2VW7A 4GYBA 1YFQA 1GW0A 1ZIAA 3IJ1A 4GM9A 5KDOB 2XV2A 1TBGA 3UR4A 3CFSB 1L9TA 3OTTA 1GG2B 2GC7C 2CUAA 4AKPA 4YSSA 2H68A 4HCGA 2FQGA 2IH8A 1V55B 2UZYB 2XL3A 3KW7A 3JZHA 3GREA 2XLLA 5HQGA 1ETJA 4ERZA 4X60B 1J5DA 2XU9A 5F7AA 3X2QB 2J55H 2G9AA 2P80A 3AFCA 4TZ4A 3PSCB 4QLWA 2BWIA 3UVOA 3FQ2A 3K27A 4JSVC 1BYPA 5FKRA 4L9OA 1PLAA 4FWWA 1KBWA 4CI3A 3BQVA 2OV0A 3TASA 3V9CA 4JHVA 1B9XA 3UVNA 4YVNA 3AG4B 1BXAA 4W1TA 3U25A 3S8GB 3NJFA 1ASQA 2CBPA 3PSLA 3X1FA 2PM6B 5F7BA 1QHQA 1E30A 2VM4A 2GI0A 3QJUB 5AFAA 2I0RA 2PPAA 3ASNB 3NSDA 4HAKA 4DP1X 3RFHA 2FT8A 2XYBA 3ZIYA 4KOBA 3IN2A 1BQKA 1PLBA 3NVQA 3RN0D 3JAMg 4OZUA 3FSWA 2XV3A 4GXFA 2PCYA 5I5JA 2HKMA 3SCYA 1A4BA 1KDJA 1SFHA 4GQBB 3OKTA 2FQEA 4PBYA 4JT6C 2IDUA 1A4AA 3FM0A 4GY4A 1OCCB 5I6NA 3ZX1A 1F56A 1CYXA 1TKWA 3PCYA 4HCIA 4HHGA 3S8FB 2PPFA 1P22A 3UVKA 1NIBA 3UAEA 2IUPA 4FHLA 3UKUC 4HZ1A 4O1QD 5GXIA 1AACA 3FU9A 4YSTA 5B7EA 2XX0A 1R5MA 4CI8A 1JJUB 4XEIC 4FB1D 1KBVA 2HX8A 2PPEA 2TSAA 3EH5B 3RLMD 4A11B 1PY0A 3QJVB 4BK5C 1ADWA 2HXAA 3MX0B 2OK6A 1SF3A 3BG1A 3JROA 3AL8A 3I7PA 3NJNA 3JRPA 1M57B 3J81g 4A08B 3BG0A 4PXWA 2JXMA 2HYEA 2P80D 4KNTA 1CURA 4XYHA 1JVLA 2HJ4A 4DP5X 3QQXA 1MG2C 2Q9OA 1PZCA 4GM8A 1JVOA 4BWUA 3X1GA 3CZUB 4YVDA 4E54A 4DPBX 1IUZA 1A3ZA 1QNIA 4L3HD 1OE3A 5EMMB 4EWRA 1W8EA 4BWTA 1TEGA 3JZNA 2YNPA 3OD3A 3ABLB 2P9NC 3I7HA 2QXVA 5GMKn 5B1JA 3PLYA 2X87A 4K3JB 2NRDA 2XX1A 1NIFA 1ZDQA 4N8UA 3DIVA 5AFU3 2QT6A 3QPKA 4YVUA 3AL9A 3SHFA 3EH4B 5B1KA 5B3SB 3OKWA 4K3ID 1S4UX 3WG7B 4J8BA 5IC7A 5C2WB 4DPAX 3PVWB 3SJLD 4CY5A 4BL0A 5TEEA 4J86A 4CSPA 2CN3A 5PAZA 1E5ZA 1KGYE 3BVDB 2OVQB 2YXWA 2MTAA 2AVFA 1GS8A 3H4FA 5AZUA 4L1QD 2X88A 1SFDA 3T71A 5FQDA 3T6ZA 4P5RA 2YAFA 2H13A 5IGQA 4WKXA 2DV6A 2IDSA 1PZBA 3QJRB 1AZBA 1XKSA 3PXWD 1RZQA 2B5NA 2CE9A 3SWSD 2QPDB 2CO0C 2B5MA 3IIYA 5CYKA 5A2Qg 1XIPA 4GMBA 2BHFA 3V9EA 1BQ5A 2BP8A 4AKOA 4O45A 1NZRA 2IAAC 1OE1A 4DP2X 4TXVB 2XYIA 4J0WA 2I3TA 1ET5A 2PP7A 3FQ1A 3PAZA 1JOFA 1PBYB 3X1EA 3SLED 5GSAA 3F3FA 4HIPA 2DWTA 3J80g 3VH0A 2R7EA 2AGYA 4BXVA 2FNWA 1ASOA 2AFNA 4QT8A 4NB7A 3AG3B 4ENZA 3C5MA 1AS8A 1PZAA 1OF0A 1JOIA 4GP8B 1AOZA 3QJSB 3IIWA 3N0DA 3FSVA 2Q7QA 3AL8B 3BWSA 3P4FA 2AH0A 4LGNA 4CY1A 4E9TA 4J84A 3S3CB 3L4MD 4J0XA 4Y5RD 2OCCB 2BP0A 2G99A 4YSUA 2AZAA 2RACA 3FPYA 2GC7A 3NVNA 3RFGA 3ULEC 1MZZA 4MFHA 3VGZA 4A09A 5D4IA 2VN3A 2YXVA 3C75A 2AGWA 3KRWB 3CVCA 1BAWA 4LG8A 6PAZA 2YBAA 1SHXA 4YSRA 1GS7A 3UACA 4ESGA 2HESX 1JZFA 2EINB 1E65A 2UX7A 1MG3C 4GP4B 3UABA 4CSZA 3GFCA 1ZDSA 4QQEA 3WIAA 6PCYA 5C2VB 1PNCA 3EH3B 3NP3A 2J5WA 4E9SA 4HALA 4Y7RA 5FKQA 2GB2A 1NWPA 2FQFA 3WI9A 2H3XC 4GQ2P 4M3HA 5A7EA 3RN1D 1NIAA 1ID2A 2DYRB 5EARA 3T6VA 1L9QA 4H5IA 3SBQA 3IKOA 3PVUB 3OW8A 2CJ3A 4E9YA 5HE0B 3EU7A 4OWRA 2B08A 1RCYA 4JXMA 2I0TA 1KCWA 4DP7X 1AQ8A 3FYEB 4N14A 5IT9g 1RKRA 1AZUA 3FU8A 1JMZB 1OMWB 4YSOA 3JZGA 5C9ZB 5EHFA 3NSYA 3FPXA 2TSBA 1DZ0A 3NJKA 2HX9A 3AH8B 3IBOA 3JTBA 1IC0A 4G7RB 5PCYA 3ABGA 4J8GA 5H14A 1OCOB 2HKRA 1ET8A 1L9PA 2QDVA 3K26A 4H5JA 4O9DA 5CYKB 4UF7C 4CZYA 1BXUA 4KNSA 4J78A 2BP8B 5I6OA 4GZ8A 4UANA 3ZDWA 2AGLA 3OMAB 2EILB 1NEXB 1GP2B 3PE7A 3NJJA 3EI4A 2AH1A 2QC5A 5AJAA 2IURA 3UVLA 2MTAH 1ILSA 5I5IA 4GP5B 2WO2B 1NPNA 3I7LA 1NIDA 5TF2A 2GBAA 2ZWNA 3H56A 3OL2A 1OOWA 4O3UB 3N2JA 2H6NA 4AI7A 1JZJA 1J9SA 4KO6A 3FT0A 4BWWA 1WA1X 2BW4A 5TK4A 3SBRA 3SQRA 3E0CA 4X4KA 3SN6B 1JXFA 3KRXB 5FC9A 1RI6A 1B3IA 2XV0A 1MG2A 1UATA 3N0EA 1ERJA 4ZOVA 4A2FA 2BP0B 2XXFA 3X1NA 3I7KA 4PSWB 1OCRB 1NINA 1X9UA 3RYMA 3V5WB 1KDIA 2GNQA 4PC0A 5E9NA 7PAZA 4A09B 2JKWA 2WO3B 3EF4A 3B7FA 4AKQA 2UZXB 3WKQA 3C99A 2Z2NA 4O3TB 1U2VC 4E54B 1GY2A 1TEFA 1CUOA 2GC4C 3FS9A 4YSEA 1ASPA 2H6KA 1N6DA 3AZUA 3U4YA 5FXYA 1N70A 3I7OA 3DWLC 2HRHA 3JT2A 5I26A 3EMHA 1OCZB 5EAMA 1J9QA 1AZCA 2BWDA 1E5YA 3FYIB 3ABMB 5ANHA 1L0QA 2AGZA 2FT6A 3FSAA 2FQDA 4N4YB 5B1AB 5IJ7E 1J9TA 5I28A 2BBKH 4YSQA 3C75H 3DM0A 2UXFA 1BXVA 2P9LC 2W18A 4FAND 1HFUA 3GDCA 3D12B 3CFVA 5EMKB 3CVDA 3NJLA 4PNKB 5D4HA 3OMIB 3F3GA 4A7JA 3AW5A 1V10A 2CO0A 3I89A 4YSDA 3IJ0A 4M4RB 2H47C 1IKOP 1CC3A 2YNOA 3ZWLB 2IDQA 4JKNA 3SBPA 2P9KC 4J79A 1PAZA 2IAAA 4WTQA 1GS6X 3TBBA 5TK2A 1JXGA 2UXTA 2XXGA 2EBSA 3ORVD 4YSCA 3NJGA 1AS6A 3EI4B 3UAAA 4DPCX 2XU7A 4KO7A 2AQ5A 1EZLA 1HAWA 1YLBB 2YB8B 2CNXA 2J57G 4F7KA 3IE9A 1QLEB 3L45A 4RH4A 3OL2B 4CC9A 2PPCA 3CDZA 1XB8A 3CVBA 3ODTA 4ZN4A 1XB3A 3S3DB 2PM7B 2YNNA 1JZEA 4KFMB 3OMNB 2HLEB 2VMJA 3W15A 2VSKB 2PCFA 1PMYA 2OK4A 2UX6A 2IWFA 2AGXA 1Q47A 2UXGA 2IUQA 3AG2B 3EI1A 2H9PA 5HE1B 5H1MA 2WSDA 3FU7A 4J77A 5EM2A 1PI6A 2QPEB 3FQYA 3FRXA 3C9CA 1JZHA 1M56B 3EHBB 1OLZA 4GM3A 4QKTA 3NJMA 2CCWA 2DY2A 1XHMA 1A4CA 1NICA 1MG3A 1NDTA 2H6QA 2YAEA 3IJCA 3SMRA 4CY2A 1CYWA 5SXMA 2FTAA 3AY2A 3HEIB 4E9WA 2O9KA 3QJTB 1L9SA 1SF5A 4K9JA 4F2FA 2H3XA 4D6VA 1X9RA 1SJMA 2B5LA 1NIEA 1PCSA 1VLXA 3FSZA 1ZPUA 4A0BA 4KNUA 3NP4A 4A68A 1AG6A 4U1EI 3UADA 5EMJB 3V7DB 3UKRC 2HX7A 4A67A 5HE2B 2IWKA 2EIKB 3H4HA 5I5MA 3KW8A 5FKSA 3I8CA 4UI9R 2BO0A 4A66A 2VM3A 2A3TA 2OVRB 4CZVA 2AANA 1GXRA 5EALA 4ZOYA 3WNJA 1PF3A 4ES0A 5AKRA 2PP8A 4F2EA 7PCYA 1MZYA 2PPDA 1TU2A 1ZIBA 3NJIA 3UGEA 5FA5B 4AOWA 2GSMB 5TDHB 3EG6A 2IH9A 1PGUA 2PBIB 1A0RB 1VYHC 3MKSB 4G71B 3A0FA 3FGBA 1OV8A 1BEXA 1SQJA 3PAVA 3MZLA 4PCYA 4KO9A 1AZRA 4P5SA 2YAPA 3X1BA 2P9IC 2TRCB 2JFCA 2Z2OA 1W6LA 1OE2A 4X3EA 3SXTD 4YSAA 2QDWA 2J56H 5EMLB 2YAQA 4BUJC 2HZHA 2VSMB 1AZNA 3N55A 4ZK8A 2P9UC 3CG8A 5I6KA 4MK0B 4A2DA 5HE3B 2OIZA 5K1CC 3ABKB 4KO5A 4DP0X 3OQRA 3CDZB 2B4EA 2J57A 1U4CA 2PM9A 3HFQA 5AMSA 3V9FA 3PAUA 2H9MA 3NYKA 1MDAA 1JZIA 3S3BB 4BDVA 1KYAA 4ERYA 4E9XA 2OJ1A 4FA7B 1PEVA 4A2GA 2R7EB 1GOTB 2H9NA 3T9WA 3EI1B 1T5KA 4FA5D 3FU7B 1NPJA 2CAKA 3GXUB 4ERQA 5EM2B 4JSXC 4EF3A 2YAMA 2Y1AA 1WA0X 2OVPB 1J5CA 2P9SC 2PLTA 3I2NA 5CXCA 2GC4A 3TA4D 4JSNC 3ASOB 2I7SA 1SDDA 3SFZA 4E9VA 3PXSD 4G7SB 1KV7A 1NWOA 3DXKC 1L9OA 2CE8A 3PPSA 3MMYA 1KCBA 4KOCA 2BW5A 1URIA 2LLNA 3HB3B 3MKQA 1I53A 4XYIA 2YAHA 5CXBA 5K19A 4A0BB 2DWSA 4GGAA 4A2EA 3DXMC 3ZBMA 1BYOA 3CIKB 4PSXB 2H14A 1AS7A 3JB9L 4JSPC 5I6LA 2Z2PA 4ZOXA 4Z8LA 1JZGA 1WS8A 1ZV2A 4G72B 3OKYA 4ZOZA 2GIMA 4G70B 2BZ7A 2BCJB 1GSKA 3L4OD 5GXHA 1K8KC 2ZXWB 3PXTD 3DKHA 4Q89A 2H47A 2B3IA 2VW6A 4AX3A 2YMUA 1NR0A 2OJYA 9PCYA 1SQ9A 1FFTB 1IBYA 3T6XA 4L3GD 2W8CA 2J56A 3ERXA 4A2HA 2FWLB 2IUVA 2P9PC 4LG9A 4R7AB 2H5UA 4JD2C 4BH6A 4A0AA 1SNRA 1R1CA 2I3SA 5IGOA 4NAJA 2VW4A 4E5ZA 2N0MA 3EI3A 1NTDA 4CI1A 3EWEA 5B1BB 1A8ZA 3T6WA 1AG0A 2J55A 4J73A 1GR7A 1EHKB 5JWZA 4FA1D 4JT5C 2IDFA 3OM3B 4BXSV 4QRJA 4L0PB 2PM9B 4X61B 4DP9X 5B4WA 4G56B 3EI2A 1XB6A 4G7QB 2XL2A 4J81A 4U7AA 1JERA 4BDVB 2YAOA 4DP8X 2CN2A 2HXCA 1BQRA 2ZONA 2GHZA 4AEZA 4D0KA 1SHYB 1M9WA 3QJQB 3RRMC 1ILUA 1ET7A 4A2MA 5HYNB 1PLCA 3PXLA 4IMMA 3TU6A 1N6EA 3RSEC 5LDUA 4AZUA 1FA4A 3NT0A 1AR1B 5CXCB 2I85A 2HRGA 8PAZA 3MXXA 1SDDB 5B1JC 5B7FA 1B9YA 4Q8BA 1MDAH 2H9LA 1A65A 2XUWA 1AANA 4DP4X 4FA4D 4JHUA 4FAVD 4NSXA 1AIZA 2FJSA 3AG1B 4UAHA 2Y69B 5D4JA 2Q5BA 2HJBA 3DTUB 1N6FA 3NSFA 4W9ZA 3WKPA 4A2LA 2EIMB 2BZCA 4QL1A 3WNIA 4GGDA 2E86A 4HHWA 5CXBB 3RMZD 2ZOOA 2XWZA 1SHWA 1IBZA 2IDTA 3UVMA 4FAAB 2YARA 4PBZA 1GYCA 3F3PA 4IA9A 2I0SA 5IJ8E 3SVWD 4GQ1A 1W6WA 5H17A 4CY3A 2XVBA 3NVXA 3IEAA 3I8EA 4GGCA 1WS7A 4E9RA 3OKYB 1JMXB 2DYSB 2UXVA 1GY1A 5THAA 4FA9D 4I79A 2EIJB 2YQBA 1E67A 1JXDA 2IWEA 5TEFA 4DP6X 4CZXA 5IY5B 4A0AB 5I6PA 4PAZA 3MBWB 1PNDA 2I7OA 1J9RA 2CALA 4CI2A 3NSCA 4YL4A 1DYZA 1WAEA 5B7MA 4E5ZB 3IN0A 4NERA 2MRYA 1FWXA 2AZUA 3G5WA 4HCFA 1XMEB 3TBCA 3EI3B 3MZKA 3VA6A 4A11A 1K32A 3DSMA
chains in the Genus database with same CATH superfamily
2XZGA 2XICA 1VAHA 4NBYB 5JDSB 4Y7OC 3HMXH 1G9NH 4YSPA 3COOA 2QKIC 4U1MA 2Q7YA 2GTWB 3LKOA 1HHHB 4E9QA 3POCA 2BY2A 4GYBA 4JNXA 5KDOB 1U8OB 3A4FA 3P73A 4YGAB 3MJ7B 4YHYC 3HPJB 2ZF9A 1D5IH 2IPUK 5E94A 3KCIA 4AKPA 5ID1B 2AXJA 3MTRA 5GS1C 1AVAA 1WSST 3VXRE 2EE0A 2JB6B 5F6IC 2XU9A 3QW9A 4ZMAT 4X60B 2G9AA 2VXSL 4X6CB 2P49B 3MUGB 3DECA 1YEDA 3FQ2A 2WLIA 3TCLA 1P7HL 1RHHA 5KOVC 1TJHL 2CUIA 3G9AB 3TP4A 2EIBA 3H53A 5I66B 4HT1H 4YVNA 5FOBA 4Z77A 4Z18A 3C12A 1CGSH 5KVGH 2P5WB 3E8UL 4JHAH 2DWDB 1L6PA 3ZYJA 3O4LE 4JE4B 3BRFA 1DVQA 4DK6A 2RTTA 2XWEA 5HHVL 2APBA 4Q9RL 4XCNB 2R2EB 5HHOD 2FB4H 1HH9A 4PJXB 5IBTH 5CD3A 2VDRB 1JS4A 5GXBB 2XV3A 2DN7A 4MCZB 5A6MA 5FOJA 1E4XI 1EDQA 3I02A 3MLXH 5D7IA 4PBYA 4WEEA 3DX7B 4HKJA 2BC4B 1G1YA 4NQSA 1RZ8B 3NTCH 3UTZB 5HVFB 4HCIA 4CN6A 1R0AH 1IGCL 4OZHA 2KQNA 4WJ5B 3X11B 4A6YB 3KPLA 1OTTD 5I1AA 3FTSA 1V3LA 3T0AA 4GRLC 2JJSC 1UKTA 1XGQB 4OQTH 2F68X 1DE4A 3FQWB 5GJTH 3I7PA 3KPRE 1LWRA 3QDGB 4MCYA 1JZDC 3FFCB 5LN8A 3CFUA 3G6JF 3JXAA 3ISRA 3BX7C 1VA9A 1WBXA 4LSPH 3DURB 4WWKB 4APQB 1U58A 4YN3A 3ZVVA 2B9BA 3V7AE 2E27L 4P5KB 1TEGA 3SE8H 2MTPA 2M8XA 1BCIA 1MHPH 2WXFA 4GQ9H 3VXSD 3CFNA 3TWCH 3B7UX 4PJFF 4NWUH 3RUGF 1Y18A 3C5ZC 1TZHB 3SEPA 2W9LA 3OKWA 2AEWA 2YQ3A 4JPVH 3T65B 2XXMB 2W0FA 4FTVA 4EO5A 2OM5A 1OAUH 4HEME 1CG9A 5C0CB 5J1AB 4N6QA 5LG1A 3AFLA 4GG6E 2Y1VA 3VXMD 1ZSHA 5CO1A 2F8VA 2NX5B 1SFDA 3BAEH 3TEWA 1S5IH 3EGSB 3SGEI 4OUUA 1OSEA 2V2TB 1HZKA 1G1CA 1E7VA 1RZQA 4FCAA 4LARL 2B5NA 3SWSD 2PW1A 1T1WB 2CO0C 5T3ZL 2CMRL 1H3PL 2OXGA 1TKWB 4PREA 1GKEA 1RZKC 5HP5A 4TTDC 4N2MA 1TZAA 4Z7VA 3BKJL 4NKOA 5D7HA 3IU4L 1B0GB 5F7YC 3F3FA 4YHPB 4PJAB 4QRQA 3S0PA 25C8L 4L9LA 1ASOA 3L3OA 5CS7A 3FBQA 4TVUA 4G6FB 4F37K 4FQHB 3AACA 3N1FC 4WENB 1K8DA 1H6TA 2V9QA 3B5GA 3ROLA 4HEPA 4MAYC 1LP9A 1YYMH 5IFHH 2D2OA 4Y5VA 2O26U 4ODXB 4M7LT 1AHKA 1WZ1H 3BISA 3D25A 4MJ5B 1QASA 1KXVA 2OR9H 4Y1AB 3B3IA 5CZXD 5L2JA 3D0AA 3HI6H 2BIIA 4AE1A 4QIRA 3V8CA 3SGJA 4F2MA 2DLIA 3MLWL 1DP0A 3ZT6A 2BJMH 4UDTA 4E54A 4ZUSA 2UX7A 1ZSDB 1XEUA 4KRPB 4QQEA 3E3QE 3WGVB 1DEDA 3LIZL 4JO1H 4QHLA 4DAGL 3RDJA 4X8GA 3RBSA 1GOHA 3LPGA 3HG3A 3W5MA 2F54E 3GTNA 1D5MB 2DPKA 4H8WC 5F44A 3RIKA 5IJKA 4X9FA 2NXYC 3E3QC 4MB5A 3EDKA 4X4ZA 3KVPA 1C12B 3AITA 1A7OL 4JXMA 4Q6YA 3BUIA 3QFDA 1DSYA 3BAIA 1YG9A 1NCDL 1RFDH 4PJ7B 3WS6C 3QIBA 1JCVA 1EH9A 4OF8A 2RFXB 5HHNA 2HX9A 2NNFA 5E9DB 5JZ7C 3AH8B 1IC7L 3P4OA 4BH7A 5I0XA 2J6WA 4POZD 3DV6B 1BG9A 3NQIA 2BSED 4KNSA 1VB9A 4PJHB 4JHWL 1JE6A 4W81A 1I3GH 2H6OA 1ACYL 3LRMA 4Q56A 4NZTL 4U6VL 5KS9E 2ZCKH 2AH1A 1XF4A 4H1LA 3VXTB 4GP5B 5C9KA 3BO8A 1I8UA 2GT9B 4XX1E 2X0UA 4YBQC 3ZE1F 3LY6A 5DD1L 4BWWA 4Q7DA 2FBJH 1MIML 3VFRB 1SJXA 5M5UA 3Q1SL 4FG2A 2XV0A 2I9LA 4PGZA 1T2JA 2CWRA 5EUOB 1X9UA 4ZW3A 1L0YA 3EADA 1WCBA 1XR9A 3WHXA 1OT4A 1NLBH 5KVMC 3HE7B 4ORZC 4LOEA 3HAEH 1AR1C 3FT1A 3G5YB 3FS9A 1CUOA 1UVQB 2VOTA 4GMSH 1CQYA 3IRZA 4LCWD 2Q76A 3TH4T 4DZBB 2PWGA 3GSNB 4QKXB 5A6IA 3F00A 2BH0A 4HSAC 4NO3B 1FCGA 1CL7I 3FCTA 3DMMD 1EGJH 4XP4L 1KNOA 1UOWA 3ZDZE 4DN3L 3VFGH 1H3WM 1GZPA 4TSCH 5FEBA 1TUPA 2BBKH 2RD0A 4Y2DC 3D39E 4NQVB 4ZO9A 5T5NF 4UQDA 5F89A 3C75H 4I7ZC 2BIMA 5IFJB 4J8RB 3H8NA 5LHDA 4DFIA 1LO2L 4YSDA 2H47C 5K93A 4DSYA 2X40A 4JKNA 4KHTH 3MCKA 3GXIA 3GI9H 3TM6A 1JXGA 4OTXL 5G4MA 5GRVL 2BSSB 4PJ5A 4ZSOE 2DWYA 5KUMA 2XU7A 2AQ5A 2OW7A 1YLBB 4JGJA 4F24A 2XFGB 3HZMB 5D1QE 4K71C 3EIFA 3OL2B 3AS3A 5E2WH 2WXOA 5CGTA 1I7TA 3CDZA 1VACA 2QMKA 5JIKA 5HI4D 4EZJA 4XWOC 2W9EH 4HVBA 4MA1C 3U4BL 2XNAA 3BYYA 5KSAB 4MXVF 5D1QC 2XN2A 2I07B 2X89D 3OKNB 5ENWA 3K71B 2XBTA 2FR4B 3FU6A 3THMH 2CLZB 2N1TE 2WXRA 3QSKB 2X6AA 1KJ2B 4TSBL 2XWXA 5HYIA 2EUXA 3LZQA 2R9HC 3DROA 5CJ5A 2X1QA 1LE9A 4G43A 5I1KH 2I27N 2JNZA 1FCCA 3BWAB 4FQLL 1RZJH 3BZEB 3F3HA 4OLEA 1T7VA 4AQEB 4MS8D 3UJTL 2DKSA 2IWKA 4P2CG 5D6CB 4PRHB 1A14H 2F8XC 1MWAA 3BE1H 4W9HC 2R69A 3E6FA 2BO0A 3HFML 2OVRB 1JTDB 3CZGA 4ZOYA 4OCRH 4JLRB 2PP8A 1N12A 4L8BB 1Z9LA 3VI4E 5C2BL 1A1NB 3LQMA 4JW3A 1TU2A 2P1YA 4LOVA 3D5OF 4FZEL 4PC0A 2QADB 1A21A 5I15H 4XB3A 2WC7A 5E5UB 2TRCB 3TVMC 1S3KH 1MREH 3QZPA 5HD8C 4E9LA 4N2EA 1Q90A 1F58H 3MNZA 5KZCB 1HQ4A 4FA1D 3OAUL 4WI9A 4OCXH 4UILH 4GW4A 1NL0H 2VLJA 2GTZA 3M8OL 4B9KC 2P8MB 4EIZC 1BLNB 4HJEA 2BCKA 3MFFB 1MVFA 5DQ9A 1SOXA 4ZAKD 1G9ML 4FA7B 3EJZD 4KBPA 1FYTE 3EBGA 2R0KL 3GHEH 4U6HB 5CBAA 4WWNA 2ZPKH 5EU6B 1GIGL 1RP8A 3PNWA 4EF3A 3TT3L 2X9ZA 2DRUA 4Q9BA 3SO5A 4EVNB 3RX7A 2XIBA 3WFBL 3BKMH 3SDYH 3GSRA 4L3CB 4NJ9H 1AFVL 3SKMA 5DK2B 5C0IB 1I1AD 5DRZA 3TA3D 4W6XB 1SDYA 3O2WL 3MMYA 4PLJC 3FU5A 3RVWC 1JYWA 3T1WA 1URIA 4AMKL 3JUYA 2AGJL 3W1ZA 4G8GA 5D1XB 4A0BB 3QNZB 6CGTA 4B50A 4LHUB 1FC2D 1BYOA 5BZWA 2XN9D 3WJJA 2QLVB 2H14A 3JB9L 1TJIH 2EEFA 4K3HA 3VXRB 3LEXB 4L1HA 3B2MA 3L95B 2V2XB 4YFLF 2MNWA 3IF1B 3WOVA 1YN6A 1FL3B 1UA7A 3KMDA 3O6LH 2VLRA 4OLUH 5E1IA 2OJYA 3STBA 3EO0B 3ZRFC 4KMLB 1XIWD 4BKSC 2P9PC 2FWLB 3ATAA 1X4XA 5JUEL 1INDH 1NCCL 5D93B 2CHWA 4J3TA 5DMYA 1K5WA 1UADC 4FMFA 4TUUA 3B9DA 5F21B 1UWYA 4C47A 4NKQB 4P2OD 1BPLB 4Z95L 1VDGA 5B1BB 4A55A 1VE7A 3VG0H 3EFFA 1G6VK 5AQ0A 5GHWL 4WQOA 3OJ2C 5C0BB 1VZGA 3AT0A 2YMXL 1KCLA 1P7BA 2DICA 2Z92A 4WO0A 5GGRA 1JHTA 5AVQB 1YPZE 3HN3A 1AI1H 4JG1L 4DP8X 2BMKA 2CNYA 4OSUH 2C3VA 1JZ6A 1C5CH 3UTPD 3PP4L 2CKBA 4IBVA 2PCPA 3BVTA 1G6RH 1CICC 5BCAA 3IFLL 2X70B 3OKOA 4JO3H 4W9JC 3PFQA 4JVWA 1J88A 4Q8BA 4DGUA 4FAVD 4YZWA 4MNQD 5KTEL 5FYLD 1IQDB 2HJBA 4A2LA 4IOIB 3ESMA 4WI3A 2HJKA 1IBFA 4AH2B 2Z91B 5IW3A 4PG9A 1EJFA 5CM1A 2HJLB 4LLDA 4N8CH 2G2NA 5D7IF 5ESAA 2F1BA 4Y0GA 2A38A 4RFOH 4Y7MA 2YMOA 4OZHF 2XWCA 4P2RE 3I8EA 3MV8A 1AKJB 3Q2WA 4RIRA 5AOZA 5SWSE 3WEAA 5IWLC 1S7XA 5FB8B 1A7PL 1IC5H 4HZAA 2ZAGA 1SHMA 5IT2L 3IJYB 1TQVA 2F9BT 4ZFOA 3D0LB 1JN6B 4IU3B 4LEOA 4U3SB 2ORBH 4G6ML 2R4SL 3BLPX 3K6OA 3V5DA 4F7EB 4X6DB 2NYYC 4TS6A 4LLVB 4YXHL 1FWXA 2NW2B 5A2LH 1S4IA 1XMEB 4WGWB 4GG6B 4WTWA 4Z5RA 1GOFA 4OZGE 1FN4A 3O6MH 5E8PA 4L29B 3MUZ1 1TZGH 4M6MH 5F9OL 4N2OA 4O58L 2XACC 4J87A 2IOMA 3MLPA 4IW4C 4QRSB 5IB2A 2XZAL 4U1IB 2Z4TA 4QRPE 4BFKA 1DANT 4K23L 4PJ9B 3T0DA 5DHMC 3TYFB 1IARB 2ITCB 5EO0A 3TBWA 4U1JA 5EMLB 3FXIC 3GBML 2XL3A 5AYUH 3M17A 2ZP8A 3ULVD 1TQTA 2AQSA 2RJMA 3S34L 4GJTB 3FULA 1OSZB 2Q3AA 4H20L 4I77H 4M7LL 5T33H 4TOYH 1F3RB 5E8DH 4TZ4A 4TUJB 5BS0D 1VGEL 5DQDH 5L7XH 5F7EH 4HKZA 1QKZH 4OLWH 2HTLC 4XN4A 1FNAA 4WUUD 1XF2A 3D9AL 1E27B 1H5BA 2Q2LA 4QUOA 3X1FA 3LPOA 3QUYA 1NCNA 4UINL 3F64A 1NGWB 3TFKC 2A6JB 1DJXA 2A9AA 4RAHA 5AL8A 2LAAA 3W0WD 5HDRA 1ONQB 2IOOA 1DSFL 2J6EH 2DZEA 4GIAA 4Z7VF 1UHVA 2JKSA 3QNYB 3D3VD 1KDJA 1P7QD 3L5WB 3QA3B 4NT6A 3K6IA 4X6EB 1B4JL 2F0CA 5SV3A 1CLZL 2VGLM 4H26A 1MFUA 3MUJA 4KKRA 4PJGA 5B39A 2F54B 2EECA 5HHOB 4I1NB 2Q20A 1CDGA 3T3PE 1Q8MA 4HFUH 1LP9F 4CSTA 2ZXGA 4MZIA 4U1LB 4GH7B 2WXQA 2WBWB 4HK3J 4DERA 3OHXC 3W5NA 4J6RH 2A6DB 1C9LA 1M57B 1DBAH 3IAPA 3MNWA 1IEBB 1CVSC 3PGCB 4GKSB 1PTZA 4KNTA 4JY5L 4OFKA 4IGBD 1AC6A 1BP3B 3KGRA 1W8OA 3N41B 3ZL1A 2Q9OA 3FO2B 4DEWA 4QNPF 4PIBA 3FF8A 5B8CC 4L3HD 1A3ZA 1QNIA 2NY0C 4JFUA 5DD5L 1W8EA 4L8DB 5CEZH 1MKFA 1A6AA 2O5ZL 1BF2A 1T66C 5BQ7B 2DW5A 3P4NB 2YPKB 4OR1A 3UJIL 2BRQA 4E5XB 2AQNA 4K8RH 4X4XA 3TNMA 5C7XL 3SDXB 1Z9SA 3VXNA 1JGDA 1EVUA 3MBEA 1AO7E 4XPAL 1QYGH 4P46D 5B3SB 2BVOB 2C9AA 3CHQA 1Q1PA 3MLZH 1BBDL 4FD0A 4I89A 2NY3D 2HLFD 1S4UX 4PBWD 2QQQA 2IAND 4AQAB 1OO2A 1IILE 1TLMA 4JZJB 3VXSB 5BUGA 4HS6B 1MFEL 2MHAA 1DFBL 4K3GA 4OFYA 5ID0A 4MHHI 4PJ8A 3KXFE 1DQLL 3I2CH 3BW9A 4Z3HA 5ADOL 2VDPA 1YQ2A 2GIYA 3FAXA 3B8YA 3P02A 2ZWLT 2G30A 3ARBA 4ODBD 4ETYA 2XWTA 3KM1A 4B96A 2FIRT 3S37H 4LCUA 3T8MA 2M2DA 5FKAA 4EAEA 1T1ZB 3DUUA 1C5DB 3TBVB 1D5XA 5L4JA 3VFOA 1DUYB 3VXMB 3BUTA 3JWOL 1Q1JH 3PAZA 4H2AA 3RDTA 4B9PA 5BRZE 3DSNB 1JTPA 1S9WA 3VH0A 1XGPB 1IBGL 5AOKA 4F33B 2OP4L 4QT8A 4NB7A 3A4EA 4PGEA 1H19A 4M6AA 1MFBH 3QFGA 3FSVA 3OJDA 4PRBB 1KEMH 4E9TA 4EN3C 2BS9A 3W39A 4EDXA 5IW1B 1EZUA 1WQVT 1BQLL 2E6JA 4AG4H 1NBQA 3TONA 3OAYK 1UQSA 4FJYA 4KXAA 2JKLA 2QR0A 4XWGL 4A09A 4ZFZB 1I85A 1N0XL 2CGRL 4EZKA 3T0EE 4YSRA 32C2B 2IGFL 4HJGB 1LEKB 4O4YL 1KN4L 1UWEH 1U8PB 4FQXA 6PCYA 4TLTA 5EOQH 4NUGL 1DVFC 4KTEL 1E4XH 4LSRL 3T0EC 4GAFB 2J8UE 4ZX3A 2J8HA 4JJ5B 3RN1D 4UT6A 5FW6A 2WAQA 4XOEA 5DC0A 5HGBB 3W9DA 3ZZQA 1BZ9A 1LDPH 2Q86B 1S9XB 3NK4A 1AQ8A 4NM8H 4QYOB 3T0VA 3UBGA 3FU8A 3OPUA 3PY9A 3B2UC 1JMZB 2SODB 1N0LB 1FJ1A 2A4EA 3U6RA 3O4JA 4KTDH 4ALAL 2TAAA 2FATH 1ET8A 4N2HA 3V10A 1RHFA 2BP8B 3FRUB 5AKTA 3ZDWA 1GHFL 4QRAA 3CFKA 3EI4A 1IE5A 1EZSA 3WDIA 5HJ3A 2WUCL 3EOAA 2AEOA 1I1RA 3GSXB 5FGRA 3G5XA 3II1A 1J9SA 3QIUC 2X6CA 1E50A 3L4TA 4U2YA 4YDVB 1UZ8B 5DURD 3SQRA 4F80A 1JXFA 1SN5A 1Q0YH 1RIVH 2GABA 1UATA 5ALBH 1KCRH 4R4NC 1GZQB 3SO3B 3WJMA 2BP0B 3X1NA 1J9CT 3WLWC 3IM1A 4I4WA 3KJ6L 2Z64C 4GQQA 1X7QA 4JL2A 5ANMA 3V95A 3VNZA 3KLHD 2BNQA 2VXTH 2WXMA 1NMCB 2MCPL 2OKMA 1TYEA 4KC3B 3EFDL 4LF3B 3AU1A 1DUZA 4FI6A 5FA4B 2IMMA 3P9MB 5DSCB 1IB5A 5FXYA 2DMKA 1KLFA 4LHUG 1HHKB 3WJLA 2VDLB 4YGVB 4NQED 4KAQH 4IBZA 2WMPB 2XTSA 4TKWA 3FYIB 3RX5A 5ANHA 2H2SD 5HHQB 5KVDH 1DQJA 5ICZB 2OTUB 2R0LL 5B1AB 5INDA 4Y4HA 5JA8B 1F4HA 4ONHB 3LMJH 4LCWB 1JXKA 4LP4A 2UXFA 2IPKA 3FOMB 1IVLA 3D85D 4FAND 4LPUA 3T8XB 3DMMB 3D69B 1KXTA 4PBXA 5DXWA 3ILPA 3IRPX 3SCMA 3VI3E 2CDEA 4FLSA 3UTQA 3SKOA 2IDQA 2JLPA 1TDQA 3P30L 3L3DB 3OXSB 3QI9A 2UZIH 5FGCE 3UC0L 4YPGB 3NIGA 1AC0A 3H3PH 4KKAD 1S7SA 3ZUNC 4ZOBA 4Q6IC 2AJSH 4LRIA 1RZGA 3RAJL 5BJTB 1H9DA 5TDNB 2VMEA 4OIFA 3BEWA 3IFOB 1HQRA 1FG2A 4MMXA 1KTDA 1CFSA 2NXZD 3P1VA 1I9JL 5IB4B 4DEPC 5HHXL 1H0DA 4NAQA 2YGPA 4FNLL 4IU2B 1CTOA 3RVVD 4F1ZA 5MHSE 2WQUA 1O6VA 12E8L 4H1LH 2NR6D 4XB8A 1OLZA 1EFXA 5EFIA 5AYQA 4PRDA 2A99A 5MP6L 1ZVHA 2WJ7A 1A7RH 2H6QA 1RMFL 4ZTOL 5DO2D 1MQ8A 1MI5D 2H26A 3N9GL 5SXMA 5A40E 2OMVB 5T3ZE 1AJ7H 1TTFA 3QXDB 1D6EA 3P9LA 4J28A 1TQUA 2KDGA 4N2IA 5CSGA 2IXQB 1C1EH 4WFED 1YPZB 3O9WD 3PL6D 3ZKXB 2YPLE 2DIJA 3F7VB 4U4BA 5E4EB 3H4HA 2EIKB 4D7BA 1AKPA 3T09A 3RFZA 2GK0B 1MJJB 3O3AA 4JCWA 3MOQA 4RFNB 2A3TA 1NAKH 3MREB 1G5GA 5F9JA 3ETSA 5CR1A 3C87A 4BK4A 1MF2L 4UOW1 1OAJA 1KYOJ 1XZ0A 5F7DA 1TTRA 3IULA 1XL4A 2CJSA 4ZW5A 3ROOB 3PAVA 4KO9A 4P5SA 3I6LE 4P2QE 3ZO9A 2J1YA 5TDOB 2BNUA 1NBZA 4LRNH 4UQ9A 4JZOA 1AZNA 5BO1H 2ARJA 1WC7A 3FFOA 3L5IA 4MK0B 1NUNB 4OB5L 4FFVC 4OIIH 2ZUQC 3KVQA 2R1WB 1ITCA 4HPHA 2BVPB 1NEZB 3LSOB 5KAQG 3S3BB 3BP5B 1UT2A 1CU4H 15C8L 4ERYA 4I5BA 2XVGA 3R4RA 5DT1L 3BDYH 1NPJA 5TQ0L 1NFIB 4PB9L 2DQEL 1OD7A 4C59B 2P43B 5ESVB 1DZBA 2GC4A 1UD2A 4KXZH 4RE5A 2XKNA 4ZAKB 3SFZA 5DYOB 4A38A 3K6SA 4L0ZA 1WISA 2EACA 4IRSC 5C08E 4S1RH 4G83A 3S4SA 2KKQA 5EB9A 3UC2A 5JW3L 1OL0A 3EUDA 3F58H 4WU5A 3AY4C 1OEZW 4B9IA 1DQQB 2V8LA 1QW9A 3CLWA 1JSYA 3EG9B 3QO1A 4U7SA 2ZOKB 1OZUA 2VMCA 1I1AB 1TIUA 4G6KH 4XAWH 3KYMA 3TA3B 4DETA 1MHEA 3PV6A 3DGDA 4G72B 3LKRB 4QRRA 1FIGL 1J0JA 2YSSA 3IFNL 1V7NH 4NFCA 1YEHH 3T6XA 2XN9B 1OGPA 3WTWA 4A2HA 1AXTL 1YEKL 1T04A 4P3CH 4BH6A 5IMKB 4H25B 2C1PB 2CDFB 3EYFB 3ZDYB 5CLWA 1DLFH 1MWAH 4Z7IA 3APNA 2R69H 4CI1A 2MMXA 1PG7X 1I9IL 1XIWB 4DGVL 3D0VA 4R5XA 5BZDB 1AHMA 3MYJB 2G75B 2R1XA 4G56B 5D1ZC 1YO4A 4AIZA 1G4RA 1LO5B 3N43F 4NFDA 4JQVC 2QHRL 4NQDE 4ZPTA 5DGRA 4P2OB 1HESA 5IQ9B 2ATAA 3IUQA 4E5XG 1S8DB 1JZ4A 4NZRL 1N6EA 1ZLEA 4KHXL 3ZXAC 2AEIT 2LLGA 3US1A 3CZFB 3VYPA 2CLRA 4WCYL 2ZZUT 3U7WL 5A7BA 3F6IA 1USZA 4TQIA 3IK2A 3WE6B 1QWNA 3B9KB 2FJSA 4HIQA 1WPCA 2R0WL 3NN8B 3QH3A 3FH5A 4ESKA 1UM5H 5D6DA 1J8HA 3WNIA 2XWJA 3ZTEA 2DEXX 5KG9B 4D9RD 5G2NA 1MCFA 3MGOA 4FAAB 1P1ZB 5FUOH 4PJGF 5DK3A 5M5SA 4AL8L 4GRWE 4PY7A 3WXVH 3NVXA 1QVOB 4HIXH 4UNVA 4MNQB 1XBDA 1JNHA 5J6HB 4AEIL 2DAVA 4AJYV 3EJCA 3L13A 2V7HA 3WFEL 2VXUL 4I85A 5KJRL 1HOCA 3IFPB 4BSWA 3X3FH 3T4AB 5EIQA 4PAZA 3W38A 3VQLA 4JO4L 2I7OA 2TRHA 1SN0A 2BERA 4EDWH 5I1GL 1IGFL 1O9ZA 4LP5A 4A11A 3MRCB 4IS6A 5D72H 3BFWA 4P9MH 5TF1L 4KDTA 1B0IA 3GB7A 1CE6B 4QLRA 4Y4KA 5K9OA 3GUFA 1HEZA 4WEBL 2YD7A 4MQ7A 3PP3K 1MFAH 1AHWC 1YY8A 1OSPL 3D2TA 4WI8A 2PNDA 5DUPL 3QXWA 4UCFA 2AV7B 3LIUA 4LLYA 1UT1A 1M2OA 1INQA 3ARFC 2ZJSH 4ODWB 4EN3B 5DZVA 3QUXC 2AJYH 2HVBA 5ELIA 5KYWB 3BFOA 3F62A 2L7QA 4K3JL 4LQFL 1LXMA 3FZUD 4HLZH 3V9CA 1JRHH 2B5IC 3NJFA 2ZOLB 1KJMB 3KS0J 4CVZA 3S35L 2CKBH 3C6EA 3B9AA 5E2VL 4M5YH 4YLQT 5BS0B 2E9BA 2J20A 5JR1L 4J3VA 2IFFH 4KOBA 1DVFB 3MRLB 1IAOB 4HIIB 4MTMA 5EA0L 3LKQB 1N7ML 1T83A 1YMHB 4TVPH 5BVPL 2R23A 2E7DA 4JRXE 5C9JB 5ITFA 2IDUA 1A4AA 2OZNA 2IQ9L 3ZX1A 4KJQD 4HHGA 1CYXA 4D0BB 3S8FB 1P22A 2JCCF 3W0WB 1CI3M 2GEQA 4GBXA 4YDKL 5IROA 1TVBB 1TVDA 1ZT1A 3KWUA 5B7EA 4N6RA 1G9MC 3H6AA 2R2CA 1T0MB 3BAWA 3D3VB 3M1BA 4G1MB 1P7QB 4X42A 3PDOA 4ZZKA 3KEHA 1PY0A 3DX3A 1ADWA 3MRDB 3IJHA 4RBPK 3HMXL 4M6NH 4N20A 1G9NL 1T89A 2NY2D 1LK2B 3BESR 4DGIH 3OXRA 1BMGA 4FXGA 3HZKA 3AL8A 1X5KA 1FFNA 2J1ZA 3R8BB 4JFFE 4ZMOA 2J1WA 4ZS6D 1H8OA 5JHDD 1PZCA 1KCUH 2VLMD 2AQPA 2EXWC 2BSRA 2X4PB 2YNPA 2Q3XA 4OLYH 3GMMB 2EE2A 2QXVA 2YKLH 3CX5J 2NRDA 2HT2C 4IGBB 3ZK0A 1LMKA 5AFU3 3QPKA 4LCVA 3MRNB 2FL5B 4HT1L 4JAMA 1FAKT 4K3ID 5KVGL 3NGBC 4JHAL 3ALWA 4AV5A 5DJDB 4DPAX 4FA8A 4CY5A 3DDFA 1ITBB 5CJOH 4AZ8B 2B3RA 2R0ZL 3ILQD 4A39A 1UWXK 3FB8B 2FB4L 5D7JA 5AOMA 1R24B 2NCEA 4JJOA 5E1AB 3Q3GB 4P46B 4W9EC 3IB4A 3NCJH 4MA3A 4NLAA 3TN0C 2NUPB 3ECBA 2IANB 5DGQA 2ZP0T 3CFEB 3R1GH 3GD1C 1YNKH 1HDMA 3NTCL 5FW7A 5GGUB 3QUZB 3IIYA 4MNHB 1TETL 1R0AL 5CYKA 5SWQB 5EF3A 2H0PA 4YDIH 2ZYSA 2KHAA 4PSRA 4H4NA 4L4TE 4WLCA 3X1EA 5IMMA 1UJTA 4O2WA 4OQTL 4LPXA 2AK1H 1ACZA 3U36A 1KTLB 1R3KB 4ENZA 5GJTL 1OQOA 5C0GB 4NN7C 1KIQB 2P48B 5C3IA 3IIWA 5F7FA 4A1RA 4NI6A 2NQ3A 3V0DA 3PHSA 4QHNB 2ICWI 3MV7A 1FNEA 5H8DA 3OWRA 5B3JE 3EYSH 5MENA 2AZAA 3FPYA 4CVXA 3VXUA 4PJDA 1VZHA 5BMFH 2E7LA 1X44A 2P5ED 2Z4QB 3SHSA 5D4IA 4FDWA 2H7WA 4ZUWA 1R3JA 3SE8L 4D8PB 1MHPL 4G7VH 4FA6A 1M05A 1E8WA 2V5SA 2C9SA 1GZHC 3TWCL 3UTSE 4KTGA 1CD1A 1E6JH 3I85A 4B6ZA 2DWEB 3B3BA 4CSZA 1CK0H 1Z5LB 4G1EA 3V4LA 3VXOA 2K0RA 2FO1A 4ZMWA 4PWGA 5E6YA 2WKOA 1JWSB 3V4VB 2ICEB 3N44B 4FQ2L 4LE8A 1RUMH 2DYRB 3JZYA 3QYNA 2ICWA 4FXKA 3NABH 1WF5A 2B08A 3J7HA 3BAEL 5C71A 1WT5C 3FYEB 3O11B 1ZCRA 1F2QA 4R0LB 1ZJAA 3QFJA 4HG4J 1J1OH 3HRZA 1IAKB 3NSYA 1P6AB 4GLRI 2HWZH 3OAZK 3JTBA 4M4RA 1IC0A 5AVWB 1OAZH 5PCYA 3VWJA 1GC1C 3GJFB 4GZ8A 3AAZB 5GGVY 4IRZA 5HPMB 2ZX8A 1JF6A 1M7IA 3L16A 4WFFE 3CFDB 3L7EB 4PRAA 4YNYB 5CKGA 2WO2B 1M3IA 1NPNA 2VDPH 5IW6B 5TF2A 1NEZG 2ZWNA 4MMYA 4WV1C 4XHJC 3B7RL 2OL3A 1O6GA 2G5UA 3ENEA 3E2HB 3IJEA 1ULVA 5D2NE 2WZ0A 4KJPD 3HVDA 1E8NA 1YYML 4DCQA 2C9XA 2FVNA 1G7MA 3I7KA 1IM3D 2F7QA 4WFGE 3IDNB 3L7FA 5D2NC 3V4UL 4APXB 4RISL 3HI6L 3DDUA 5D8JH 5DURB 1J11A 3WUWA 2J8OA 2GJZA 5EZOH 2BJML 3DVGA 4P99A 3WGUB 1S7RA 3G5VB 1DQML 2F74A 4NOBA 2R83A 1KN2L 1CD8A 3CSYB 4JO1L 2NTSP 1UCTA 3B5HA 4K3DH 3E6HA 3WO4C 4P23A 1JK8B 3VTAA 2Y6SD 1AZCA 4U7KA 4Y9GA 4Z8FH 1A2YB 5HDBA 3KZ8A 1RP9A 3MXVH 1NC4D 5AWNH 1J9TA 1QFHA 1SLVA 1JPSH 2ATKA 2FUTA 1FSKB 3GLZA 1RFDL 4JFHD 2D7QA 4LOFA 2CO3A 4IBQA 2F18A 5IJBC 3K2MC 1MFCL 5LXGH 4XZUB 4AQ8A 4PRPA 1BBJB 5CINH 4NBMA 5IMLB 3ZWLB 3BXNB 4PWIA 2IAAA 1FO0L 2PWFA 4UT6H 1BVOA 1HYSD 3SD2A 5LXVA 2ZCKL 4KY1H 3WMPA 3DV4A 3GTVA 3D85B 2Y9RT 3JTSB 4PLKC 1UOQA 3LXBA 1BVNT 1KT2B 3BVVA 5EEXA 2ED8A 1YN7B 2F53A 2VN7A 3CMGA 3SBWA 1ZANH 4GRMB 2UY6A 3ZU8A 2FBJL 5ESQB 3U0PA 5DC9B 4EN2A 3QJZA 2BOCA 2W1NA 2HLEB 4LAQH 4IKJA 4FFYA 3WKNA 2X1OA 3NCMA 5I0DA 1FNGB 5T1DL 4U6YA 4DZ8B 4JPQA 4FQ1L 3II2A 4I0PD 1X5GA 4UQEA 1NLBL 5F9AC 3GC3B 3GMNA 4FNTA 1EEYA 2D0HA 4N68A 3LEVH 3IU3B 4MJID 3EDJA 2NXZB 1IJ9A 2VR9A 2EC8A 4R96A 1RIHH 4GMSL 1T5XB 3V0WH 1LNUB 4I3SH 4RLDA 2PWHA 3MUY1 4E41A 4XNQA 4E9WA 1K6QH 1OWRM 1EGJL 1QSEE 1AXSB 5LNDA 2C3XA 5D2LA 5TFSL 3P4MA 3ESNA 2GITB 1NPUA 2CO6A 1AE6L 2BNRD 2ID5A 4TSCL 2PYED 1YR2A 3LNHA 3WY4A 1MI5B 2IALB 2MFNA 1KB5A 3BFQG 4UI9R 3HS0A 2Y3NA 1XGUB 3OLGA 4LESA 3FJTA 3VM7A 4A66A 4BUQA 5IG7A 1F42A 3QCVL 4R2GD 1ZXQA 2WKLA 4H0LC 4JFDA 3O9WB 2YKKA 3OX8A 3PL6B 4AK2A 1U92A 3GI9L 3TF4A 4IMLB 3GSUB 1PGUA 3U2SA 2Y7MA 3PWLB 5ACMA 2ZXCA 2J71A 3QEUB 1W6LA 3ESPA 3FO9B 4L3EA 4WHCA 3UYPA 2J56H 2FJGB 1NGXA 4KFZC 5I75B 1MVYA 1VADB 4O2EA 4CJ0A 5E2WL 4V1DE 4OKVB 1JNLH 1Q9WA 3T2OA 4JFEA 2OJEB 3SY0B 4NAAA 1OXYA 1RLBA 2WTRB 5AKSA 1JP5A 2PM9A 4JDZB 1SEBA 1SXNA 1JZIA 5DZ9A 4FLHA 2PO6C 1GGTA 3H9YA 2O61B 4HDIA 2AJVH 5JDJA 1T5KA 2ADFH 5KBDA 3NCWA 1A5FH 4GG8A 2P9SC 3O4HA 1UURA 1THCA 3HHSA 3OJVC 1PSKL 2RA1A 4L05A 5DO8A 4NNYB 1I7UB 3MGTB 1ZE3H 4OQ1A 4Y5XC 1K4DB 4LLWA 4HK0A 5I1KL 1RZJL 1JUFA 3PXHA 2UWEA 3WAJA 1W0WA 4Q9QH 5K19A 4PJIE 4PTUB 3BE1L 1ED3A 4JFOB 2GJ6A 2WXHA 3MV9E 3CHOA 1UB6B 2BIQA 4KROB 3LB6C 3TX4A 3MRQA 2B4CH 3OKYA 3KYKH 1FBIH 3MRMB 3KJ4B 4ZUUB 3PRZA 4F7MA 2E76C 2GCYA 2DI9A 1BX2B 3REWB 4MWFB 2YMUA 5L6YH 5I15L 5C70A 4NO0A 2O6CA 1S3KL 1MREL 2LHAA 2EIZB 2CBQA 5IGOA 1F58L 4YMPA 1MCCA 2VDQB 4CJ1A 1HT6A 2XZCH 4JRYA 4OCXL 1NL0L 4HH9A 1E8MA 2VLKE 4AYMC 1Z9NA 3ME0A 4Q2ZA 1ZLDA 4JRXB 2Y7SA 3EDFA 4Q6KA 1YJDH 3PHOA 3OLEA 4PIRF 1ZAGA 1H8LA 1UYWL 5HVHB 1JERA 3T3MA 2Y72A 4Z3GA 3QUMA 4AEZA 1N18A 2X28A 1TVHA 4JCLA 3HUJB 2X0VA 3PXLA 4UOQA 4IBSA 3BKML 3F05A 3ARUA 1TQBC 1XO8A 3SDYL 5DQJB 4NJ9L 5FFGA 4A7VA 5CXCB 3FTVA 1L9MA 3VFTB 4X7CC 3L3IB 3QEQD 4FJZA 1KXHA 4ZXBA 2VQUA 1II4E 1B9YA 3QR0A 2H32B 5EU5A 4WK4A 3CQQA 4R7DA 1T0OA 2HVKB 5K1CC 5KSBA 3FNKA 2BZCA 4QL1A 1CFTB 3X14B 5EG6C 1AGBB 2ZE0A 2FGWL 2AXGB 2QZ5A 3GXMA 4JGMA 1EEQA 2I0SA 4NRYB 5B3NA 4RZCA 4ZT1A 1RUAH 2H3NA 2LFGA 3PWNA 2G3MA 2EEDA 3GMQB 1YMME 3UG3A 1NDGB 4RMQA 1XF3A 3GMLB 1G84A 1INDL 1HI6B 1WFJA 4DO6A 3DWTA 1J5OH 2OFQA 3VH8B 4PP2A 1W91A 4PQXA 5C97A 4YL4A 2ZAIA 4L1TA 1FORH 4S1SH 1EBAA 3QUGA 4KI5E 3GS0A 2IC2A 3UTTA 4CW1A 3WHE1 2F5BH 3QJFB 4KKCD 2OR7A 1V54B 1YDPA 2FT7A 3KYOB 3ZZ1A 3I7NA 4KI5C 2OSLB 4XNXH 2LABA 4OSUL 2VCOA 3IDJB 4A7GA 5BW7C 4IBWA 2QQLH 2WSPA 1C5CL 2YWZA 3A6OA 3G7TA 2CLVA 4BSJA 3OKMB 4PV9A 2AV1A 4NSKA 3JZHA 3GXNA 3KW7A 2IWGA 1TO4A 4X4MA 3ZOAA 5CGMA 3OZ9L 4Z7QA 3FB7A 3HNSH 4QLWA 4GB9A 3CPUA 2FO4A 3RWCA 3VNYA 1QRKA 4XGZA 4Z7UE 2B0SH 3VWKA 3CDFA 4FXTA 4MNGE 1OAXH 2WYTA 5BV7H 4W1TA 3RDTD 4Z7NB 4HGWB 4QAMB 2DEWX 4N8CL 5E4OA 4QTHB 5I8OH 4TUOB 2I0RA 1PYWA 1OCWL 1VRSA 5CGYD 2XYBA 4ZW8A 1ZEAH 1IGMH 3B9VA 1JGLH 3BP6A 3U9PH 4KK8D 2ZSVB 3WMSA 1UB5A 5D7LA 3S9DB 3SCYA 4ABUA 5I1HH 1MXDA 5E6IA 4GQBB 2OMYA 2ORBL 4TQHA 1VKXA 1MVUB 3PWPE 3PCYA 1S7TA 3FTGB 2B1HH 1NIBA 1WHOA 3MMEA 3DBXA 1S7QB 4L1DA 1D7FA 5LJYH 4N0FA 1IEAA 3U6XS 4CI8A 1YUHA 3L9BA 1JJUB 1PKQE 1QBBA 2MH4A 4FFTA 5F7MC 4FJ6A 1LK3H 3O6ML 1A3RH 1X3DA 4PJDF 4XXDB 5EIIB 4M6ML 1UOLA 3RNKA 2GAZB 4NQCE 4PH8A 3UAJA 4P5TC 2SEBB 3NJNA 5K1VA 3LVTA 5E00B 5DK0B 1G7HA 2C4FU 1WAPA 2JXMA 2WUBL 2X7LB 1NQBA 1CURA 3VX0A 3V6OC 3VFNA 1KOAA 2CO2A 2W0LA 3LKSA 3EDEA 3X1GA 4PWJA 5AYUL 3EGXA 2XE4A 1HS6A 2WKOF 4R7XA 2YMTA 5H94B 4TOYL 5T33L 3IXTB 5E8DL 3LRGA 5LWYL 1Q9LB 5DQDL 2E46A 4AGLA 3BI9X 4ZMNA 5L7XL 5E7BA 5F7EL 4Y16C 3OKDB 5JHDB 3N42F 4JK0D 3EH4B 4WUKH 2QVIA 1SMOA 1VSCA 2R29A 5J57B 1UM4L 3NIDE 2HU5A 3PVWB 4BL0A 1X6LA 5IB3A 1XR8B 3GJFK 1OALA 1P5UC 2OVQB 2O30A 1AZVA 2WXLA 3EQ8A 2H6PA 1GS8A 3ZTJH 4Z3TA 3RRQA 3L3GA 3T6ZA 4B9CA 4WKXA 4I1RA 4KQ3H 2ED9A 4M43L 5DEGA 4ILDA 4QO1A 3SKNA 2B5MA 1HCZA 3Q8EA 2KERA 1XIPA 5C07D 4R3SA 1HC1A 1CXIA 3C09C 4UIMA 4ABQA 5CZVL 4XVUC 2VDKH 3CV5A 4KJWD 5DS8A 4HFUL 5HYJD 4Q4IA 5GSAA 1NCHA 2NPLX 2VDOB 1QBMH 2DWTA 4JO2L 5KSVA 2GJPA 2A73B 3Q6GL 4J6RL 2WQ8A 3C5MA 2B16A 1LVEA 1DBAL 4L8SA 2C1OB 3GUTA 4P4RA 4U0QB 4LGNA 4IBYA 2YD2A 1UUNA 3EYUL 3I3EA 3L81A 1SJHB 2YEZA 5C0ND 3O8XD 4NRXA 3WFZA 3LRLA 4WO4D 3RFGA 2X42A 4RGND 5IQ7L 1AY1H 2OTPA 5CEZL 3E38A 4U1SB 1ZHKA 4EZLA 3CSBA 3L1FA 4P9HL 1A8JH 4JREB 5F3BA 5HDBF 1BAWA 3ZGHA 5FKPA 1JZ3A 1E65A 2X5PA 5T1LA 1QYGL 2FAUA 4AL8C 3VRLE 3MLZL 5TJWK 1RSYA 2JI2A 4Y7RA 5LAXA 2UVEA 1NGQL 1F3JA 2P5EB 2PTVA 3WFHA 3SQBA 3VB8A 1FP5A 1XGTB 5LBSL 1G1OA 2APTA 5HE0B 4EXPX 2CJTA 1SYSB 2WYIA 1ORSA 1IKNC 2JJTC 1OMWB 4PG2A 3A6CH 4LOUD 3ZE2E 2V5YA 3S37L 1NEPA 4G7YH 4I2XE 3MLVL 5JORA 1SXBA 1MPAH 4Z7OF 1RIUH 1WWWX 1A22B 3BGMA 3MKGA 5DHYB 1H2YA 1Q1JL 4UANA 4Z0XB 3WCYA 2V2WA 3BPNC 2IURA 4NP9A 2BDNH 2WGXA 4JFWA 4BK5A 3AROA 5TE4H 5ICUA 1FZMA 2XQBH 5TQ2H 4W93A 3HB3D 4KO6A 1ZT4B 2XCMC 4L48A 4YXLH 3SE3C 5CMAA 4W9GC 5C09D 2YRZA 4AG4L 3IMSA 4RAUA 3ARTA 4HGMA 2YA0A 4KDVA 2Y2WA 4KPHL 4FYRA 2LAGB 4KKLC 1K5NA 3CVIL 3EXLA 3V5WB 4Z7WE 5IHBA 5D2LF 4D3CH 4K5PA 4GXUM 5E8OB 2J2ZB 2GSIB 4LEXH 5DJAB 3JTTB 1IM9B 4ICWA 2KT6A 3SGKC 5LGHH 3E1ZA 3L2LA 3LNIA 2QPFA 5L4MA 1VGKB 1E4XL 3GZKA 4MD0A 2FJHA 5LB1A 3UH8A 5EAMA 2BWDA 3C60A 2OZ4A 2D03H 3SYPA 4AYID 3DRTA 1VHPA 1NGZB 4I18C 4R4BB 3ZDXE 3SQOL 1ZWIA 2YRLA 5IVZB 4LCCA 5SX5K 3CHSA 5GRVK 5FX3A 1P4BH 4K5OA 1BXVA 1IC1A 5DJCA 3D12B 2EH8H 5GS0H 2OYPA 5JPNA 2L4OA 2FE0A 2FATL 1AD9A 1V10A 4AYFB 1NC4B 2WQVA 1IFRA 4WU7A 3SBPA 1G9NC 4HWBA 3TZVD 1BF8A 3J07A 2XXGA 1UA3A 4DNVA 2W60A 4P4KC 4R97C 2H2PD 4GKNB 2KLRA 4N5EC 3P3YA 2HT4C 3KWWA 3WN5B 4CRPA 1YQVH 4NKDB 4PVMA 2GHWB 2WQWA 2OX5A 3WKMH 3QDMA 2VIRA 4ZTEA 3NFPA 3LXUX 3TNNB 4EI6A 5E8NB 5KVGE 1ZA6A 1Q0YL 4L4VE 4JFYB 5ALBL 1KCRL 2VSKB 5B4MC 1JGUL 3BSGA 4IRZH 1L6ZA 3E8VA 2IAMA 3FKUS 1T2QH 4X80L 3ZYIA 3ECUA 5CP7B 1IZKA 4GKZA 3QJOA 1INEH 4MBRA 2VXTL 3SPJA 2B59B 2UWEF 5I1LA 1NICA 2WBXA 2OL3H 5AKVA 1DBBH 1L3NA 4CGTA 1G0DA 4YEEA 5FFLA 1E9OA 4MA8L 4KAQL 2APFA 4I0PB 4YWGH 1BZ7A 1O5DT 2EP6A 4PGCB 3VMNA 2W07B 3NFNA 4MJ2A 4PSPA 1XGYH 2RGSA 3U2SB 2FNBA 2X4SA 4MJIB 5FYKH 2BSTB 4ABWA 4WW2A 4JG9A 5FGSA 3QQDA 3LMJL 4LCIH 3S3PA 4A67A 5IK3A 2NNAA 4JFQA 5DVOA 3AADB 3T2NH 3CZKA 2XN1A 1QOKA 4MMZA 9CGTA 1YY9C 2YQGA 2BNRB 4Y5YA 1MZYA 2OBGA 2PYEB 1YRKA 3WEOA 1XF5B 3MLTA 2VKXA 3VH8G 5LQBH 3OC5A 2UZIL 3MRJA 4FABH 4U33A 3GK8L 3S88H 3EG6A 3FGBA 4OY9A 2LLLA 1DJSA 1B0RB 3ELAT 4KDWA 4NZFA 1KXQA 5HDOA 3H3PL 1OK8A 4XC3L 4OVVA 1D2OA 3EJUA 4R2GB 2X2YA 3FUDA 3H2WA 4KX8A 2HZHA 2P9UC 2AJSL 4JMXA 4OZ4A 3O4OB 4IHBA 2PKDA 3IJSB 4WNSA 4JDEA 4P07A 2FIKB 3HI1A 3QORC 2MOVA 3FCUA 4QOKA 2FEDD 5D96C 3GBLA 4FKKA 3BKYH 4FI7A 5FF6A 3T9WA 2B1AL 3DOIA 5AVRB 4LLMA 3OZLA 5JOPE 4KK6C 1JPGB 4G2AA 3MRPB 2HU8A 1KB9K 5KSBF 5EV7A 3NCFB 3JWNH 1T5WB 4BZ1A 1RD6A 1T80A 3NAAH 2FDBP 1A9BB 4J12A 1L9OA 1C1EL 3NZ8A 4FFYH 5D1ZI 1KCBA 1VEMA 2VC2A 3LDBB 4R7NA 3CH1B 3CX5K 1MCLA 5IEKB 4MXWL 2CJUH 4LLQB 5FWQA 1LO0H 3ILDA 5L8LB 3GWJA 3MRHA 5DJYA 3LPWA 4PSXB 1E9PB 4F9LC 3SODB 2CR0A 1M7DA 2LVCA 4ZOXA 1OB1A 3LN5A 4P5MB 5DUJA 4ZOZA 1OTSD 4QMEA 2ESVA 4OBRA 2D7PA 3L3JB 4OZGF 4OV6F 1CI5A 3L4OD 1DJWA 1A4KA 3H6JA 3IJ7A 4YHMH 1PG7L 2V9UA 5LCVA 4Z6AT 2B2XH 2B39A 3ZUCA 4ZDHA 2XT1B 4X7TA 3DARA 2VNCA 4HEPG 3W81A 1JIBA 1ZHLA 4LRNL 3H9SE 5DR5L 1KB5H 4A7GF 2ADJA 2OMXB 5BO1L 3I74A 4MJJA 3NIFE 2X2UA 4M8QB 1IGJB 4J73A 1GR7A 3SYQA 2JJWA 2Z9TA 1ZPLA 4UB0H 5JDSA 3HBZA 4FQPA 1P84J 2GTWA 4Z7QF 1HHHA 2WXIA 3CFBA 2FYYB 3RZCC 4OV5A 4U7AA 2BVEA 1U8OA 2FWUA 4R7LA 3ULUF 3MJ7A 2OYLA 5AW4B 2BP5M 3HPJA 3BDYL 1CDBA 3CAFA 5ID1A 2XY2A 5GZNA 4P5TB 4G5ZH 1FG9C 2JB6A 2BIOA 3ZTNH 3AJ7A 3KL3A 4JHBA 4X6CA 5DVPA 1SLUA 3RE0A 4GW5B 1WAAA 2G5BB 3CNKA 5DJ8B 1ZJBA 4S1RL 3FQTB 2Q2EB 5EEWA 1ZA3B 1JPST 5I66A 4JHUA 1E3FA 2G2RB 2WLYA 5GRUH 3F58L 2LTQC 4C56E 5D4JA 2P5WA 1N8OE 2DWDA 3NSFA 5H2BB 5CD5C 5GIRB 2NDGA 2XWZA 2A0LC 3QEQB 4XCNA 4XAWL 4G6KL 2R2EA 1F00I 4PJXA 3ZE0B 1QLRA 2WBJD 1VERA 2CA3A 2DBLL 4EI5B 1NANH 1DBKL 2VDRA 1KCKA 1ZGLB 3V52H 4MCZA 2AC0A 4OI9A 3ZLQC 1BGXL 1B4LA 1YEHL 2AKRB 4HWZA 1ZLUK 3TJHC 3GLDA 2VDML 3G6AB 3DX7A 3FRPB 2BC4A 2X4TB 3QXAB 1RZ8A 2HG0A 1PFOA 3M86A 4FQJH 4PVLA 2WCGA 4KV5F 3UTZA 4HG4K 5JXEA 4AM0Q 1DLFL 2HMIC 1CDJA 4WJ5A 3X11A 4A6YA 2R69L 3T77A 1E9QB 2QV4A 3BPLB 4L8CB 3K91A 2MRYA 3TBCA 4JKLA 3EI3B 1XGQA 5F1NB 1U8IB 4M8UA 3FQWA 3SOBH 3VRJB 3BD5A 4HV8B 4JVUA 4NCC1 4XRCB 3ARDD 5F9WB 4N90E 1WA2X 5IHHA 3QDGA 3FFCA 2DQUL 1GW0A 1RK1B 4BGDA 1ND0B 3ZR6A 1LGVA 1N6UA 3DURA 4WWKA 4APQA 1XH2A 4GI6A 4YDLC 4NXSA 1V55B 3IDMB 4OGYH 4P5KA 2ENSA 3HLAB 4PBDA 5BOZG 4ERZA 1T1XB 4XBEH 5IHWA 1N64H 3SPHA 4V11A 1KGJA 2EDHA 4WK2B 4N3UA 4ODSH 2BWIA 6FABH 1RI8A 2CBMA 4FL4B 4JPKH 3GGWB 1TZIB 3DPBB 8FABB 1TZHA 4MRBA 1KBWA 4P3DA 5AW0B 4JHVA 2DQHH 1UM5L 3T65A 3NA9H 1BXAA 3S8GB 3RL2A 1MNNA 3QUMH 4PJFE 2FK9A 3RUGE 3I3BA 3OPZH 4ODVH 4NOFA 4X5PA 2GY7B 2LQRA 4BCYA 5AFAA 5FUOL 5C0CA 4JN2B 2PPAA 5J1AA 2XY1A 1EK3A 3WXVL 4HIXL 1O7VA 1K4CB 3Q2CA 4FHBD 5DWPA 2NX5A 1BQKA 3EGSA 4O02L 1IGIH 2V2TA 3BSZA 4J7RA 3CMOH 4ODHL 3AB0B 4G55A 3X3FL 5FUCE 2B77A 3Q48A 3PNRB 1F02I 1BDYA 1TKWA 5GGQH 1OZTG 2EKJA 4H0HB 4FHLA 3GBNH 2PABA 1B0GA 5IVXE 5FUCC 4YHPA 4PJAA 4UOW0 2HX8A 4EIUA 4P9ML 1SJEB 1NCBH 1I9RH 2QR5A 1UWFA 4FQHA 2Y06H 3ZE2B 3ISYA 1MFAL 4XP5H 4N2CA 1A6UH 3GD1I 1UG9A 1N6QL 4LSDA 4ODXA 1S5HB 4LIQH 2C4XA 4MJ5A 5F7LB 4GM8A 4LPYA 3CZUB 4Y1AA 4S10A 3EUUA 1OE3A 2J88H 5FYJH 5A2IH 1D5ZA 4UM9D 4EWRA 3U4KA 3EHBC 2AJYL 1CXLA 5GRZA 3IDGA 1ZSDA 4K3JB 1L6XA 3TOPA 4Y19E 4LQ1A 2KZBA 1JRHL 2C7FA 1UWGH 3NFSH 4HSQA 3UROR 4E42B 5C92A 1R46A 3K80A 4HIJB 2CKBL 1D5MA 1TTCA 3B7TA 4M5YL 1VZ3A 5IMOB 5TEEA 4NNPH 1C12A 3QULB 2IFFL 2VQTA 1E5ZA 3KVDD 1PDKB 4UTAL 4YDJB 3AM8C 4TVPL 1U8LB 2EKSB 3ULUH 5TPWH 4PJ7A 2H13A 4ZPVB 2RFXA 1B6UA 3OR6B 2WD0A 5E9DA 4GNKB 3CN1A 2NOYA 5EO9B 3DV6A 2VAJA 2GIXA 3BUYB 4O45A 3LQZB 4PJHA 4ES9A 2OSWA 4MDJA 1N5AB 4YHOL 1ZV9A 2BY3A 3S36X 3VXTA 3OQ3B 1CWVA 1F11B 8CGTA 1UM6H 2AJ3B 2GT9A 4HISA 3E80A 4M6NL 1OD9A 4OBSA 4DGIL 1VE6A 3DYPA 5I8EB 1DL7L 1WCQA 4G42A 1WP6A 4HWUA 4ZFOL 5AALA 2L0DA 4R97B 3VFRA 3GINA 5HYJB 3IGKA 4J0XA 4Y5RD 3JROA 4GUCA 4HXBH 4F20A 1KCUL 3AWFA 1M71B 5EUOA 3S7GA 1EX0A 3ULEC 3QARA 5F96H 4F92B 3HE7A 4OLYL 4G3YL 2HUHA 4J3OD 2ARJQ 3G5YA 2YKLL 4EUPH 2AK4D 3QEGH 4YS4A 3S8WA 1W8NA 1UVQA 2BHUA 2Q1EA 4H5SB 2VXQL 3O8XB 3ARGC 4RAVB 4WO4B 1PNCA 3GSNA 4XP6L 4RGNB 3WIAA 3JWDH 4DZBA 4ZZFA 4NO3A 4JM2C 2GB2A 1E4JA 1QUPA 3HPLB 1TTUA 5CCJA 4XNDA 2D3NA 1L9QA 1GJUA 2X4NB 2CJ3A 4E9YA 4NQVA 4S1DC 2CO7A 3NCJL 5IFJA 4J8RA 1AZUA 4OM0H 2X4OB 4ERSH 1QRNE 3G5ZB 3R1GL 1EUTA 3ZKQD 4UV7H 5DZLA 1PD0A 2R29H 1OCOB 3K26A 1HNFA 1CT8B 4GKLA 3QHYB 4KGLA 4ZMPA 2BSSA 2WIMA 3RGVC 2QC5A 1YNLH 1AGDB 2AK1L 4FFWC 3UAFA 5CLXA 1O6TA 3HZMA 4JY6B 3HZ3A 3DX1A 3OL2A 5ABAA 4C57C 4E41D 1S7VB 4EKXA 3EO1B 4N1CA 3RTQC 3VW3H 5TK4A 3R06B 4NQQA 4TNFA 4UQIM 1OSYA 4XXWC 5KSAA 1XX9C 3EYSL 3OKEA 2I07A 2XXFA 3OKNA 1JFHA 3CZSA 3WFCH 4PJBE 3K71A 4MXVE 3TO2B 4G7VL 4QF1B 2ZCHH 4ZX4A 2FR4A 3QQ3B 5GQBA 1SVZA 1E6JL 5C09B 3MZGB 3ES6B 4YK4B 3C99A 2CLZA 4WW2F 1CK0L 3CSPA 4IEFB 4PYHA 2XKSA 3HIZA 1KJ2A 1U8JB 3A22A 1MCKA 4MVBC 5ISZE 1TCRB 2VDNB 4G9FE 5HDLA 1RUML 3QISA 5BXFB 3BWAA 1I8LC 2Y5EA 1R5VB 3PIQB 1L0QA 3NABL 1T7YA 3FSAA 3GI8H 4AQEA 4F9PC 3BZEA 4PYGA 4AITA 5D6CA 4PRHA 5D71H 1U3HC 1IC4L 4FNQA 3UDWC 3PS6A 4UTBA 2HCZX 1N59B 4DHLA 1CBVH 2HWZL 3B7YA 4JLRA 2FH8A 4L8BA 1OAZL 1PQZB 4HJSA 4JFZH 1A1NA 4EKJA 4FZ8H 3L9EA 2EJ1A 3V6ZB 2XPGB 1YECH 1A12A 2DL9A 4EMZA 4D0CB 1WIPA 1NLDH 1OAKH 3NJGA 1AS6A 1X9QA 1PGRB 2E7BA 2VDPL 3TYGH 5I9QB 3BQUD 1IAII 4KU1A 4RH4A 2XZQH 4JKKA 5T8IA 2VE6B 2G3ZA 2P8MA 2HRLA 4J4PA 1BLNA 1XB3A 1EHAA 4ONFH 1G9EA 3OMNB 3MFFA 3ZR5A 1U8CB 4ZUVB 1JZ7A 2DQ6A 2EDTA 2VABB 4LKCB 4MQXC 3QZBA 1NMBL 4U6HA 5ETUB 3LV3B 5EU6A 1V5JA 1HJBC 5EZOL 4B0MM 5JPMC 1QLEH 4QKTA 3ORJA 1YVLA 1DQTA 2DY2A 4EVNA 4PCSA 2ADYA 4L3CA 2EZ0C 2WP3O 5DK2A 2EDNA 5C0IA 3P9WB 1SF5A 4N0UB 3AT9A 4D6VA 3BPOB 5I71C 5IZ7A 1JHKH 3FONB 4QHUB 3FSZA 2EIDA 5D1XA 1F4YH 3MXVL 3QNZA 5AWNL 4A0BA 2X2IA 2D31B 4LHUA 3H7BB 2I60H 2K9FB 4JRYD 3MRRB 3WFDH 2P47B 3A67H 1JPSL 1FUNA 2YJQA 2K4WA 2IGLA 3VXRA 1R5WB 4K94H 3SY6A 3LEXA 4JL1A 5JW4Q 4DJMA 3L95A 2V2XA 3FRPG 4HMEA 4TVSa 1FL3A 4F2EA 1ZK5A 3DO4A 5CINL 5FM5M 5IBLD 1FO0B 1ZIBA 1JPFB 4UT6L 3UGEA 3HE6D 4C56B 4OFIA 2OZ4H 5K9JH 4KY1L 1GCYA 1OV8A 5CEZE 3H54A 1NSNL 4J39A 2M26A 5C0EB 2FHBA 2YBRB 4MXQD 3FCBA 3T2PA 5AEAA 3EZJB 4ES8A 4AQ1B 1KJ3H 2ZAHA 5C0BA 4K8RC 4LAQL 5KYUB 1BIHA 5IVNA 3NYKA 2OA9A 1NGPH 4XE5B 4X6CF 3NPZB 4HWBH 1F4XL 4P2AA 5CILH 4ANXA 5C6WH 3APDA 2JJSA 2PCFB 4F57H 1ZVNA 4XPGH 3WTSA 4KQ0A 4E0RB 2W59A 2MOQA 3LEVL 1F13A 3O3DB 4G6AC 5MI0C 1WA0X 1RIHL 3I2NA 3V0WL 2NY4D 2ZSWB 2X70A 4I3SL 2VSCA 4F8TA 3OKLB 1JWUB 2P24B 4AW4A 4X7FC 4DVRL 1K6QL 5CN1A 2P45B 3CFCH 4NZUH 4PJXF 5IOPB 3FOLB 1IQDA 4KOCA 3MKQA 2EDXA 4IOIA 4XHQA 4X5LA 2YAHA 2Z91A 2HJLA 3REVB 2ZUXA 5GS2D 1T21B 5H35B 3G6JB 4OZFH 1TCMA 4JY4B 2G4GA 5FM4A 2WSKA 3DHMA 3AS2A 5D7IE 1MCDA 2AJUH 1AKJA 5GPRA 3I6KB 3EXJA 4G5AA 5FB8A 2FWOB 4BFBD 1WJ3A 4HXAH 3IJYA 1IL1B 4OZHE 4R5TA 5HYQB 1QNZL 1JN6A 3D0LA 4IU3A 4U3SA 2K6ZA 3RUGB 5EORL 1ZLSH 4ZG1A 1R1CA 1WICA 4F7EA 2BVTA 4X6DA 3IMTA 4LLVA 1GKOA 2Q0ZX 1YYLH 2NW2A 2XVKA 4GG6A 5J12B 3MRKB 1FFQA 2X9YA 4L29A 1RZIB 4YJZL 5L0QB 2HRPH 4QRJA 4NWTH 5GZOA 4U1IA 5E2UH 1J0HA 4J81A 4F7CB 1BEYH 2AJVL 1L7TH 2YAOA 4PJ9A 4YBLC 3I84A 2ADFL 1VFMA 2WINB 2ITCA 3RHWK 5AZEH 3TYFA 1QSZA 3UXFA 3QJQB 4JUSA 4A2MA 5A16B 1QBLH 1T3FB 1PLCA 3VGHA 4CC4A 2CRYA 4KJYB 1OSZA 1CFBA 3C5JB 4TUJA 3EOTH 1E4WL 3QHZH 4YE4L 5TE6L 4FTVE 2K3HA 3L4XA 4FA4D 1AIZA 4UAHA 5AUMA 4Z76B 4KGJA 4HS3B 2EIMB 3PAYA 2PXYD 3W11C 1NGWA 4AEFA 2A6JA 3P0YH 2B4CL 1P4IH 3KYKL 1ONQA 2XVBA 3FH7A 5E95B 4BZ1H 1BXXA 3C6LB 4K07A 4R5VA 5CR8A 3QNYA 2KZKA 5EULV 4HHAB 3SGDI 3E9UA 3QA3A 5SWZD 5L6YL 4OCYH 4X6EA 4Z7VE 2DLEA 2VC2H 4LBEB 1KPRB 4M29A 5DMIH 2F54A 5KJ4A 5A2FA 5HHOA 2Q6WB 5F72S 2WBJB 1FNLA 4AWJC 3V6FB 1X7TA 2H3KA 1B9ZA 2XZCL 3HG1D 1EJOH 2JF1A 3IN0A 4NERA 1NDMB 3EOBB 4L9LC 4U1LA 4F15C 1TYQC 3L3OC 1LP9E 3P2DA 1NFDA 2NLJB 2A6DA 1YJDL 2LVEA 3EDDA 3GYRA 3VQ1C 5LCVH 1HAUA 3NJHA 3PGCA 1IEBA 5F88B 3W57A 4GKSA 4XCYB 5KVDE 1YFQA 3IJ1A 1ZIAA 4CMHB 4F2ME 4WGVB 3ATDA 2CHDA 4Y5VC 4F5CA 3DXAD 2XFXB 4HIEB 1A6VL 2OJZH 1IJNA 1HCYA 2IH8A 4L8DA 3B1UA 3ARDB 1KXVC 3UO1H 3W2DH 2AF2A 5ILTH 5BQ7A 4QNPE 3P4NA 2YPKA 3ZTCC 4E5XA 1I7ZB 5D70H 3SGJC 4BINA 3RKPA 2XYCA 3SDXA 2Z3FA 4WK0B 4LVHB 4QWWC 1PLAA 1MRFL 3IKCB 4NIKB 2BVOA 3K4AA 4PU2A 2MKLC 1N9PA 1YC8A 2HKFL 3U25A 2ZWYA 3ZE1B 2OI9C 4IBTA 4AQAA 2NY2C 4JZJA 3JVGA 3UZQB 3VXSA 4HS6A 3RKDC 5IJKC 1KENH 3MNMA 3N0AA 3ASNB 4PJHF 1Z0MA 5K1JA 5E8EB 3I75B 1EAPB 4QXTB 2V33A 2WLLB 4O2FB 2ROXA 2Z31D 3QIBC 5F70A 1AZZC 3IMRA 1T1ZA 2NSXA 4JT6C 1C5DA 1EEZB 3TBVA 3RNQB 3MR9B 5F0MB 2H8PA 2OMZB 3HG0A 3LH8A 1DUYA 4M8RA 3VXMA 2IVFC 2O5XH 1HHJB 1FORL 3D87B 2FZ3B 3DSNA 4S1SL 5GXIA 2KZWA 2XX0A 4PJEA 3SN6N 2VZ3A 1E3XA 1XGPA 4F33A 2F5BL 3GMPB 2VDRH 5C8JB 3BVNB 3CPLB 3O4GA 4YHNB 3LZRA 1UTDA 3GM8A 3JRPA 3BEVB 4XNXL 4HF5H 4A08B 2DMBA 2QQLL 4ZQKB 1BF5A 4JPSA 4ORGB 3F5WB 2K9UA 1UXMA 4A6YH 4M61B 5I19H 1ZS8A 4ZFZA 4KK9C 2BCMA 5EMMB 2FWSA 5E0QA 1JTOA 4RGOH 3HNSL 5DMJB 1XH1A 1VJSA 2ZYIA 32C2A 4HJGA 2F8OA 3KWVA 5H37G 2B0SL 1LEKA 3T1FB 4DK5A 1UKQA 1U8PA 1OAXL 3CVHA 5HGDB 4N8UA 3QIWD 1JI2A 3WTUA 4KUCD 3JYBA 5BV7L 4X83A 3V79C 3ZL4L 4JJ5A 4UM9B 1MRCH 2DI7A 4TUKH 5HGBA 3EAKA 3FQNB 1OF2B 1AQDB 1ZEAL 2Q86A 2Z8SA 3HG5A 1S9XA 5AB1A 3U9PL 4IBUA 4QYOA 5EF0A 3RWEB 3PQYD 1JMZA 4H8UA 4BBWA 2O1AA 2XG4B 5I1HL 1N0LA 2AQRA 4PJ5E 5T3XD 1U36A 3WUZA 2IGTA 2B1HL 4HS8L 2BP8A 1DQIA 4ANKA 4MA7L 1OPOA 2I3TA 1BSIA 1NAMB 2WPGA 4PRNB 1LL1A 3AABA 4HIPA 1A3RL 4AUJA 3CTTA 1YEEL 3GSXA 3BSZH 1T03H 3VA2C 2BSEA 1G9HA 4YDVA 5I1DB 1UZ8A 2A4ZA 3UEZA 2VN6A 4HFWB 1J10A 4A04A 3F01A 5BOJA 1GZQA 4R84A 1NKRA 2BP0A 2G99A 1G7PA 3VCLB 4TL5A 4KZDL 4RNRB 1HXYB 1QFPA 4S1QL 2YXVA 2GFBB 4M1DH 5M7QA 1IZJA 5JHLA 2V7NB 2M83A 4LF3A 5C0FA 3C8KA 5CCGE 2A6KB 3P9MA 5FA4A 1KSRA 4WUKL 4HJIA 2H41A 1I3RB 2YO3A 1HHKA 4X99B 4YGVA 2VDLA 3IAQA 2WMPA 2D8KA 5HHQA 5ICZA 1NFAA 2NZ9C 2OTUA 3GEFA 1XT5A 5DJ2B 2AK4B 2WNKA 4LCWA 3L5XH 2FLBT 4ONHA 1CCZA 2I0TA 1TQSA 5DA4A 3FOMA 1OP5H 4WJG3 1RKRA 1RULL 2ENQA 3DMMA 4KQ3L 3GIZH 1JGEB 3T8XA 3D69A 4PS7A 2RHEA 5C9ZB 3FPXA 1EHNA 2VN4A 1MIEH 3SDAD 3BUPA 4HYTB 2IAMD 3C5XA 4O9DA 3L3DA 1TSRA 3OXSA 1LD9B 4RCAA 2VDKL 5AW2B 4YPGA 1DJHA 1QBML 4ZOAA 4JQIA 2VLJE 5DHVB 2CXKA 3WLBB 4OD2B 3TT1L 5BJTA 4MAUH 5TDNA 3UBXB 1JL8A 3IFOA 3K1KC 2V17H 2WIIB 1WGVA 5IB4A 3CH8A 3NESA 1P7KB 4DKEL 1L3WA 4IU2A 3EYQC 3WHE0 1R47A 2OYKA 1QMUA 1P84K 3N06B 1CN4A 2XJLA 4ICXA 4JRWA 1U2CA 3DX6B 3ML8A 3UGXA 5I2IB 2YRBA 2VSDA 2Z2NA 5BPPA 1IGTB 4YSEA 1FVDA 2OMVA 1WTLA 2X89A 3P73B 4G8GE 4CNIB 1N6DA 2D0GA 4QTFA 3KGTA 3QXDA 4HLEA 4MCNA 2GBUA 4H13C 2IXQA 1UOOA 4UM8B 1FHGA 1O0VA 1UACH 3F7VA 2A5UA 3IETB 4FNPA 3DUSB 3NEOA 5DWUH 4YSQA 2GK0A 1KGWA 2E59A 4QEGA 1TO5A 4N2BA 4OJFH 3SZKC 1F6FB 1MJJA 2GI7A 3FK3A 2VLRE 4UIKH 2D3VA 3WJJC 3FF7A 3MREA 5HVGB 3A6CL 4Z77B 3KDMB 3GZQA 3GSNH 1OARH 5LBVA 1KFGA 1MPAL 1RIUL 4KVCH 1GAFL 1KELL 4YX2L 1PAZA 1GRWA 5EN2B 3ROOA 4AE0A 2J4WL 2J5LB 5CJ8A 1RZKL 4U1KB 4BKTC 4ZW7A 5TDOA 1YNTB 2BDNL 4OZIB 4OVUA 1BMZA 2CK0L 3QWNA 1D3CA 1XGZA 1Z3RA 5E24E 3BKCH 3LNFA 1J7VR 2XQBL 4YXLL 2R1WA 2BVPA 1NEZA 3LSOA 1B4TA 2YNNA 4OZHB 2H9GB 3BP5A 4LSUH 1C16B 4CC0A 5I1AB 1J8KA 4R8WH 1QI4A 3BQUB