3UVLA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of mll3
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
303
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvlA00
3IIYA 2AGWA 4EWRA 5HE0B 3KRWB 4OZUA 3RN1D 4L9OA 2Z2PA 2AH0A 1GP2B 3JZHA 3CFVA 3ORVD 5IJ7E 1FWXA 4JSVC 3J81g 4FWWA 5EMLB 4JXMA 2YMUA 3UVOA 1R5MA 4K3ID 2OVQB 3EMHA 3SJLD 4GGCA 1XKSA 4J79A 4CY3A 3I7NA 3A0FA 3SN6B 3HFQA 4JD2C 4NSXA 3NVXA 3EI1B 5HE3B 3V9FA 4PNKB 5EAMA 2P9PC 2XU7A 5FKSA 4H5IA 3VH0A 2HJBA 2AGLA 3UVNA 2H9PA 4BL0A 5THAA 3UVKA 3K26A 3EI1A 4A09B 3J80g 4CI3A 2P9UC 4GM9A 5IJ8E 4J8BA 2J57G 5IGOA 4TZ4A 4A09A 4J8GA 3RSEC 3VGZA 2HKRA 2PM9B 4E54B 3ULEC 3OKYB 3SBRA 2IWFA 2OK4A 2HXCA 4D0KA 3PSLA 5TF2A 2CE9A 2UZYB 3SHFA 1L0QA 3L4OD 4PSWB 2PM9A 4E54A 3OKYA 5KDOB 3PVWB 2UZXB 3MZLA 4MK0B 3DM0A 2GC7A 3JPXA 3N0EA 3L4MD 3DXKC 3MZKA 1TYQC 5B4WA 5FQDA 1SQ9A 3GFCA 5GXHA 1ERJA 4CZXA 4AEZA 2BBKH 4JSPC 4X61B 4ZN4A 1U2VC 2QC5A 1SHYB 4E5ZB 2H3XA 5EMKB 3AL9A 2OIZA 3NVNA 1JOFA 5CYKB 3K27A 2Z2NA 3V7DB 4E5ZA 3BG1A 5HQGA 4ESGA 2XYIA 4GGDA 2YBAA 2EBSA 4PSXB 4A0AB 2YB8B 5CYKA 3I7OA 2BCJB 4HDJA 5FKRA 5FKTA 1MG3A 5EARA 4X3EA 5C9ZB 1TBGA 4JT6C 3E0CA 2GC4A 3SXTD 4J81A 3MMYA 4FB1D 5C2VB 3RRMC 3PSCB 4D6VA 4GQ2P 2IAAA 3JZGA 5TDHB 5GSAA 4XEIC 5EAPA 4GQBB 4FAVD 4A11B 2YNPA 2AGZA 4JSNC 5A2Qg 5JWZA 5IC7A 4CI2A 3IJ0A 4CZVA 4IA9A 3I2NA 5I5MA 3ODTA 4JSXC 5AJAA 4A11A 4X60B 4Z8LA 4AOWA 1PI6A 2J55H 4G56B 3ZWLB 3PXTD 4J0XA 2OVPB 2G9AA 1P22A 5CXBB 3C5MA 2IUPA 1B9XA 4PC0A 4J78A 1VYHC 2Q7QA 2I3SA 3EI2B 1YFQA 2TRCB 4CC9A 1XHMA 5CXBA 3OW8A 2HJ4A 2B4EA 5SXMA 4CY2A 4N14A 2XL3A 3EI2A 2I0SA 5TEEA 3AH8B 4XYIA 5CXCB 5FA5B 2H14A 2MTAH 3SCYA 2P9LC 4CY1A 4X63B 3I7HA 4A08B 3IKOA 3UVLA 3AL8B 4L3GD 1NEXB 4LG9A 5CXCA 2CE8A 5K1CC 2HYEA 3VA6A 3I7LA 3B7FA 4FA5D 4ERZA 2H9NA 3P4FA 5FXYA 4A08A 3AL8A 4O45A 4ZOYA 1QNIA 3NVQA 2H47A 4Y5RD 3I7KA 2I3TA 4FA9D 1RI6A 4XYHA 4O9DA 1PBYB 1B9YA 4J73A 4FA1D 3GREA 4J86A 1N6FA 4CI8A 4J77A 3SMRA 4GM3A 5H17A 2IUVA 2CN2A 1PEVA 2I0TA 3F3PA 4L3HD 1N6EA 3RFGA 2OVRB 2P9SC 2AGXA 3W15A 4O1QD 4GGAA 3EI3B 3KRXB 3SVWD 5IT9g 3PXSD 4YVDA 2YNOA 2P9IC 5HE2B 2CN3A 3UKRC 3EI3A 4ES0A 4QQEA 2H6NA 4J82A 4A0AA 3JROA 3DWLC 2Z2OA 4GM8A 2B5NA 3F3FA 4U7AA 5GXIA 3U4YA 3OKTA 1MDAH 3V5WB 4A2MA 2P9KC 4PBYA 5AMSA 1XIPA 2YNNA 3PXWD 2IUQA 4J87A 4A2LA 1GOTB 1A0RB 4R7AB 4UI9R 4FA4D 4BUJC 3N0DA 2W18A 4CZYA 5I5JA 1OMWB 4ZOXA 4JT5C 5GMKn 3IIWA 1JJUB 1JMZB 1JMXB 4QL1A 2I0RA 2H9MA 4OWRA 5I5IA 4U1EI 2QXVA 1PGUA 4BH6A 4FHLA 1S4UX 2B5LA 5HE1B 3RMZD 4A0BB 2AH1A 2AQ5A 3C75H 4ERQA 3JZNA 3SFZA 3JAMg 4QT8A 2CNXA 3SLED 2IURA 3RN0D 3MXXA 4A0BA 2J56H 4QRJA 3SBPA 4CY5A 3BWSA 4LG8A 5EMJB 5EMMB 3RLMD 3SBQA 2CO0A 1GG2B 4CI1A 1N6DA 5H14A 4O3TB 3FM0A 4FAND 2H6KA 3BG0A 4GQ1A 5EM2B 3CIKB 2OJYA 3MKQA 1Q47A 4K3JB 3SWSD 3UR4A 3PVUB 2H9LA 3JB9L 5FKQA 4LGNA 3UVMA 5EM2A 3UKUC 3CFSB 2H68A 3OTTA 3PE7A 5AFU3 4ZOVA 2B5MA 3I7PA 5H1MA 3OKWA 2XL2A 3I89A 4I79A 2AGYA 2O9KA 5HYNB 3DXMC 3EG6A 2H6QA 5TEFA 4GZ8A 3JRPA 5EALA 4IMMA 3OL2B 1U4CA 1NR0A 4O3UB 1SQJA 4L1QD 2HKMA 3RFHA 4J84A 3I8EA 3EI4B 3FGBA 5IGQA 3F3GA 3OL2A 4H5JA 4J0WA 3DSMA 2HESX 4ZOZA 1K8KC 3EI4A 3IJ1A 3IJCA 3C9CA 4ERYA 4GMBA 2GNQA 3C99A 2G99A 3MKSB 3AFCA 4PXWA 1MG2A 5K19A 1K32A 2P9NC 1GXRA 3I8CA 1OLZA 3EWEA 5C2WB 3EU7A 3FRXA 2H13A 4Y7RA 2PM7B 4KFMB 2IWKA 2PBIB 2CO0C 5FLXg 2OK6A 4A7JA 4PBZA 2PM6B
chains in the Genus database with same CATH superfamily
5M61A 3IIYA 2AGWA 4EWRA 1K3IA 5HE0B 3NIDA 3KRWB 4OZUA 2HU8A 3RN1D 4L9OA 4DNWA 2Z2PA 2AH0A 1GP2B 3JZHA 3CFVA 3ORVD 5IJ7E 1FWXA 3DDUA 3ZDZA 3ZE2A 4JSVC 3J81g 4FWWA 1QFMA 3IUQA 5EMLB 4JXMA 2YMUA 3UVOA 1R5MA 4K3ID 2OVQB 2VDNA 3EMHA 4BP8A 4UM9A 3SJLD 4GGCA 4NBMA 1XKSA 4J79A 4CY3A 3I7NA 3A0FA 3SN6B 4WJKA 3HFQA 4JD2C 4BP9A 4NSXA 3NVXA 3OF7A 3EI1B 5HE3B 3V9FA 4PNKB 5EAMA 2P9PC 2XU7A 4WK0A 4H5IA 5FKSA 5E6UA 3VH0A 2HJBA 2AGLA 3UVNA 2H9PA 3IUJA 5THAA 4BL0A 5M5RA 3UVKA 3K26A 3EI1A 1UOQA 4A09B 3J80g 4CI3A 2P9UC 4GM9A 4DNVA 5IJ8E 4J8BA 2J57G 5IGOA 2VC2A 4TZ4A 4A09A 4J8GA 3RSEC 3VGZA 2HKRA 2PM9B 4E54B 1E8MA 3ULEC 3OKYB 3SBRA 2IWFA 2OK4A 2HXCA 2VDOA 4D0KA 5M5UA 3PSLA 5TF2A 2CE9A 2UZYB 4AN0A 3SHFA 1L0QA 3L4OD 4PSWB 2PM9A 4E54A 3OKYA 5KDOB 3PVWB 2UZXB 3MZLA 4MK0B 3DM0A 2GC7A 3N0EA 3JPXA 3L4MD 3DXKC 1UOOA 3FCUA 4RE5A 3MZKA 1TYQC 3V4VA 5B4WA 5FQDA 1SQ9A 4L1MA 3GFCA 5GXHA 1ERJA 3EQ9A 4CZXA 4AEZA 3EQ7A 4O2WA 2BBKH 4JSPC 4X61B 4BCBA 4ZN4A 1U2VC 2QC5A 1SHYB 4E5ZB 2H3XA 1H2YA 5EMKB 3AL9A 2OIZA 3NVNA 1JOFA 2JKXA 5CYKB 2EIEA 1H2XA 2Z2NA 3K27A 3K72A 3V7DB 4E5ZA 3BG1A 3VI3A 4JHNA 5HQGA 4ESGA 2XYIA 4GGDA 2YBAA 2EBSA 1VZ3A 3O4IA 2YB8B 3O4GA 4PSXB 5CYKA 4A0AB 3I7OA 4AN1A 1UOPA 2BCJB 4HDJA 5FKRA 4MMYA 1MG3A 5FKTA 5EARA 1C9LA 4X3EA 5C9ZB 3MUNA 1TBGA 3QI0A 4JT6C 3E0CA 2GC4A 3SXTD 4J81A 3MMYA 4FB1D 5C2VB 1GOFA 3RRMC 3PSCB 4D6VA 4GQ2P 2IAAA 3JZGA 4G1MA 5TDHB 5GSAA 4XEIC 5EAPA 4GQBB 4FAVD 4A11B 2YNPA 2AGZA 4JSNC 5A2Qg 5C86A 5JWZA 2VZ3A 5IC7A 4CI2A 3IJ0A 3NIGA 4CZVA 4IA9A 3I2NA 5I5MA 3ODTA 4JSXC 5AJAA 4Z7QA 1E8NA 4A11A 4X60B 4Z8LA 4AOWA 1PI6A 2J55H 4G56B 3ZWLB 3PXTD 4J0XA 2OVPB 2G9AA 1P22A 5E6RA 2VDMA 5CXBB 3C5MA 2IUPA 1B9XA 4PC0A 4J78A 1VYHC 2Q7QA 2I3SA 2VZ1A 2VDPA 3EI2B 1YFQA 2TRCB 1GOGA 4CC9A 4UM8A 1XHMA 5CXBA 3OW8A 2HJ4A 2B4EA 5SXMA 4CY2A 1UTCA 4N14A 2XL3A 3EI2A 4O02A 2VDRA 1YR2A 2VDLA 2I0SA 5TEEA 3AH8B 3IULA 4XYIA 5CXCB 5FA5B 2H14A 2MTAH 4G55A 3SCYA 3T3MA 2P9LC 4CY1A 4X63B 3I7HA 4A08B 3IKOA 3MUOA 3UVLA 3AL8B 2XZGA 4L3GD 1NEXB 4LG9A 5CXCA 2CE8A 5K1CC 2HYEA 3VA6A 3MVDK 3I7LA 3B7FA 4FA5D 4ERZA 2H9NA 3P4FA 5FXYA 4A08A 3AL8A 4O45A 4ZOYA 1VE7A 1QNIA 5M5SA 3NVQA 2H47A 4Y5RD 1O6FA 3I7KA 2I3TA 4FA9D 5HDBA 1RI6A 4XYHA 4O9DA 1L5GA 1C9IA 1PBYB 1B9YA 4J73A 4FA1D 3GREA 4J86A 3IUMA 1N6FA 4CI8A 4J77A 3SMRA 4GM3A 5H17A 1VE6A 2IUVA 2CN2A 1PEVA 2I0TA 3F3PA 4L3HD 1VZ2A 2BKLA 4WK2A 1N6EA 3RFGA 2OVRB 2P9SC 2AGXA 3W15A 3IURA 4O1QD 4GGAA 3EI3B 5M5TA 3VI4A 3KRXB 2XDWA 3SVWD 1H2ZA 5IT9g 3PXSD 4YVDA 2YNOA 2P9IC 5HE2B 2CN3A 2WQ8A 3UKRC 3EI3A 4ES0A 4QQEA 5FFOA 2H6NA 1T2XA 1E5TA 4NAAA 4J82A 4A0AA 3JROA 2EIBA 2Z2OA 3DWLC 4GM8A 4MMZA 2B5NA 3F3FA 4U7AA 5E6SA 3ZDXA 5GXIA 3U4YA 3OKTA 1MDAH 3V5WB 4A2MA 4Z7OA 2P9KC 4PBYA 5AMSA 1XIPA 5FFGA 4MMXA 4Z7NA 2YNNA 3GC3B 2IUQA 3PXWD 4J87A 4A2LA 4QAMA 1GOTB 3KCIA 2HU7A 1A0RB 4AMYA 4BCDA 4R7AB 4UI9R 4AMZA 4FA4D 4BUJC 3N0DA 2W18A 4CZYA 1BPOA 5I5JA 2EIDA 1OMWB 4ZOXA 4JT5C 5GMKn 3IIWA 1JJUB 4JHPC 1JMZB 1JMXB 4QL1A 4AX4A 2I0RA 2H9MA 4OWRA 5I5IA 4U1EI 2QXVA 1PGUA 5C92A 2QZPA 4BH6A 4NENA 4FHLA 1S4UX 3GD1I 3ZE0A 2B5LA 5HE1B 3RMZD 4IRZA 4A0BB 3FCSA 2VDQA 3IUNA 2AH1A 2AQ5A 3C75H 4ERQA 3JZNA 3SFZA 3JAMg 4QT8A 2CNXA 1I2MB 3SLED 2IURA 3RN0D 3ZE1A 3MXXA 4A0BA 2J56H 4QRJA 3SBPA 4CY5A 3BWSA 4LG8A 5M5VA 5EMJB 1QFSA 5EMMB 3RLMD 3SBQA 2CO0A 1GG2B 4CI1A 3K6SA 1N6DA 5H14A 4G1EA 4O3TB 3FM0A 2EICA 4FAND 2H6KA 2QR5A 3BG0A 4GQ1A 5EM2B 3V4PA 3CIKB 4NC4A 2OJYA 3O4HA 2HU5A 3MKQA 1Q47A 3IVMA 4K3JB 3SWSD 3EQ8A 3UR4A 3PVUB 1TYEA 2H9LA 3JB9L 5FKQA 4RE6A 4LGNA 3UVMA 5EM2A 3UKUC 1H2WA 3CFSB 1M1XA 2H68A 3OTTA 3PE7A 5AFU3 4ZOVA 2B5MA 4D9SA 3I7PA 5H1MA 3OKWA 2XL2A 3I89A 4I79A 2AGYA 2O9KA 5HYNB 3DXMC 3EG6A 2H6QA 3ZDYA 4BCCA 4WK4A 5TEFA 4GZ8A 3JRPA 5EALA 4IMMA 3OL2B 1U4CA 1NR0A 1A12A 4O3UB 1O6GA 1SQJA 3QHYB 1JTDB 4L1QD 2HKMA 3RFHA 3I8EA 4J84A 3EI4B 3FGBA 5IGQA 1JV2A 3F3GA 3OL2A 3IJEA 4H5JA 4J0WA 3DSMA 2HESX 4ZOZA 1K8KC 3EI4A 3K71A 3IJ1A 3IJCA 3C9CA 4ERYA 4GMBA 2GNQA 3C99A 2G99A 3MKSB 3AFCA 4PXWA 1MG2A 5K19A 1K32A 2P9NC 1GXRA 1GOHA 3I8CA 1OLZA 3EWEA 5C2WB 3EU7A 3FRXA 2H13A 2VDKA 1U8CA 4Y7RA 2PM7B 3NIFA 3T3PA 4KFMB 2IWKA 2PBIB 2CO0C 4DNUA 3O4JA 5FLXg 2XE4A 2OK6A 4A7JA 4PBZA 2PM6B
chains in the Genus database with same CATH topology
3IIYA 2AGWA 4EWRA 5HE0B 3KRWB 4OZUA 3RN1D 4L9OA 2Z2PA 2AH0A 1GP2B 3JZHA 3CFVA 3ORVD 5IJ7E 1FWXA 4JSVC 3J81g 4FWWA 5EMLB 4JXMA 2YMUA 3UVOA 1R5MA 4K3ID 2OVQB 3EMHA 3SJLD 4GGCA 1XKSA 4J79A 4CY3A 3I7NA 3A0FA 3SN6B 3HFQA 4JD2C 4NSXA 3NVXA 3EI1B 5HE3B 3V9FA 4PNKB 5EAMA 2P9PC 2XU7A 5FKSA 4H5IA 3VH0A 2HJBA 2AGLA 3UVNA 2H9PA 4BL0A 5THAA 3UVKA 3K26A 3EI1A 4A09B 3J80g 4CI3A 2P9UC 4GM9A 5IJ8E 4J8BA 2J57G 5IGOA 4TZ4A 4A09A 4J8GA 3RSEC 3VGZA 2HKRA 2PM9B 4E54B 3ULEC 3OKYB 3SBRA 2IWFA 2OK4A 2HXCA 4D0KA 3PSLA 5TF2A 2CE9A 2UZYB 3SHFA 1L0QA 3L4OD 4PSWB 2PM9A 4E54A 3OKYA 5KDOB 3PVWB 2UZXB 3MZLA 4MK0B 3DM0A 2GC7A 3JPXA 3N0EA 3L4MD 3DXKC 3MZKA 1TYQC 5B4WA 5FQDA 1SQ9A 3GFCA 5GXHA 1ERJA 4CZXA 4AEZA 2BBKH 4JSPC 4X61B 4ZN4A 1U2VC 2QC5A 1SHYB 4E5ZB 2H3XA 5EMKB 3AL9A 2OIZA 3NVNA 1JOFA 5CYKB 3K27A 2Z2NA 3V7DB 4E5ZA 3BG1A 5HQGA 4ESGA 2XYIA 4GGDA 2YBAA 2EBSA 4PSXB 4A0AB 2YB8B 5CYKA 3I7OA 2BCJB 4HDJA 5FKRA 5FKTA 1MG3A 5EARA 4X3EA 5C9ZB 1TBGA 4JT6C 3E0CA 2GC4A 3SXTD 4J81A 3MMYA 4FB1D 5C2VB 3RRMC 3PSCB 4D6VA 4GQ2P 2IAAA 3JZGA 5TDHB 5GSAA 4XEIC 5EAPA 4GQBB 4FAVD 4A11B 2YNPA 2AGZA 4JSNC 5A2Qg 5JWZA 5IC7A 4CI2A 3IJ0A 4CZVA 4IA9A 3I2NA 5I5MA 3ODTA 4JSXC 5AJAA 4A11A 4X60B 4Z8LA 4AOWA 1PI6A 2J55H 4G56B 3ZWLB 3PXTD 4J0XA 2OVPB 2G9AA 1P22A 5CXBB 3C5MA 2IUPA 1B9XA 4PC0A 4J78A 1VYHC 2Q7QA 2I3SA 3EI2B 1YFQA 2TRCB 4CC9A 1XHMA 5CXBA 3OW8A 2HJ4A 2B4EA 5SXMA 4CY2A 4N14A 2XL3A 3EI2A 2I0SA 5TEEA 3AH8B 4XYIA 5CXCB 5FA5B 2H14A 2MTAH 3SCYA 2P9LC 4CY1A 4X63B 3I7HA 4A08B 3IKOA 3UVLA 3AL8B 4L3GD 1NEXB 4LG9A 5CXCA 2CE8A 5K1CC 2HYEA 3VA6A 3I7LA 3B7FA 4FA5D 4ERZA 2H9NA 3P4FA 5FXYA 4A08A 3AL8A 4O45A 4ZOYA 1QNIA 3NVQA 2H47A 4Y5RD 3I7KA 2I3TA 4FA9D 1RI6A 4XYHA 4O9DA 1PBYB 1B9YA 4J73A 4FA1D 3GREA 4J86A 1N6FA 4CI8A 4J77A 3SMRA 4GM3A 5H17A 2IUVA 2CN2A 1PEVA 2I0TA 3F3PA 4L3HD 1N6EA 3RFGA 2OVRB 2P9SC 2AGXA 3W15A 4O1QD 4GGAA 3EI3B 3KRXB 3SVWD 5IT9g 3PXSD 4YVDA 2YNOA 2P9IC 5HE2B 2CN3A 3UKRC 3EI3A 4ES0A 4QQEA 2H6NA 4J82A 4A0AA 3JROA 3DWLC 2Z2OA 4GM8A 2B5NA 3F3FA 4U7AA 5GXIA 3U4YA 3OKTA 1MDAH 3V5WB 4A2MA 2P9KC 4PBYA 5AMSA 1XIPA 2YNNA 3PXWD 2IUQA 4J87A 4A2LA 1GOTB 1A0RB 4R7AB 4UI9R 4FA4D 4BUJC 3N0DA 2W18A 4CZYA 5I5JA 1OMWB 4ZOXA 4JT5C 5GMKn 3IIWA 1JJUB 1JMZB 1JMXB 4QL1A 2I0RA 2H9MA 4OWRA 5I5IA 4U1EI 2QXVA 1PGUA 4BH6A 4FHLA 1S4UX 2B5LA 5HE1B 3RMZD 4A0BB 2AH1A 2AQ5A 3C75H 4ERQA 3JZNA 3SFZA 3JAMg 4QT8A 2CNXA 3SLED 2IURA 3RN0D 3MXXA 4A0BA 2J56H 4QRJA 3SBPA 4CY5A 3BWSA 4LG8A 5EMJB 5EMMB 3RLMD 3SBQA 2CO0A 1GG2B 4CI1A 1N6DA 5H14A 4O3TB 3FM0A 4FAND 2H6KA 3BG0A 4GQ1A 5EM2B 3CIKB 2OJYA 3MKQA 1Q47A 4K3JB 3SWSD 3UR4A 3PVUB 2H9LA 3JB9L 5FKQA 4LGNA 3UVMA 5EM2A 3UKUC 3CFSB 2H68A 3OTTA 3PE7A 5AFU3 4ZOVA 2B5MA 3I7PA 5H1MA 3OKWA 2XL2A 3I89A 4I79A 2AGYA 2O9KA 5HYNB 3DXMC 3EG6A 2H6QA 5TEFA 4GZ8A 3JRPA 5EALA 4IMMA 3OL2B 1U4CA 1NR0A 4O3UB 1SQJA 4L1QD 2HKMA 3RFHA 4J84A 3I8EA 3EI4B 3FGBA 5IGQA 3F3GA 3OL2A 4H5JA 4J0WA 3DSMA 2HESX 4ZOZA 1K8KC 3EI4A 3IJ1A 3IJCA 3C9CA 4ERYA 4GMBA 2GNQA 3C99A 2G99A 3MKSB 3AFCA 4PXWA 1MG2A 5K19A 1K32A 2P9NC 1GXRA 3I8CA 1OLZA 3EWEA 5C2WB 3EU7A 3FRXA 2H13A 4Y7RA 2PM7B 4KFMB 2IWKA 2PBIB 2CO0C 5FLXg 2OK6A 4A7JA 4PBZA 2PM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIY A;  2AGW A;  4EWR A;  5HE0 B;  3KRW B;  4OZU A;  3RN1 D;  4L9O A;  2Z2P A;  2AH0 A;  1GP2 B;  3JZH A;  3CFV A;  3ORV D;  5IJ7 E;  1FWX A;  4JSV C;  3J81 g;  4FWW A;  5EML B;  4JXM A;  2YMU A;  3UVO A;  1R5M A;  4K3I D;  2OVQ B;  3EMH A;  3SJL D;  4GGC A;  1XKS A;  4J79 A;  4CY3 A;  3I7N A;  3A0F A;  3SN6 B;  3HFQ A;  4JD2 C;  4NSX A;  3NVX A;  3EI1 B;  5HE3 B;  3V9F A;  4PNK B;  5EAM A;  2P9P C;  2XU7 A;  5FKS A;  4H5I A;  3VH0 A;  2HJB A;  2AGL A;  3UVN A;  2H9P A;  4BL0 A;  5THA A;  3UVK A;  3K26 A;  3EI1 A;  4A09 B;  3J80 g;  4CI3 A;  2P9U C;  4GM9 A;  5IJ8 E;  4J8B A;  2J57 G;  5IGO A;  4TZ4 A;  4A09 A;  4J8G A;  3RSE C;  3VGZ A;  2HKR A;  2PM9 B;  4E54 B;  3ULE C;  3OKY B;  3SBR A;  2IWF A;  2OK4 A;  2HXC A;  4D0K A;  3PSL A;  5TF2 A;  2CE9 A;  2UZY B;  3SHF A;  1L0Q A;  3L4O D;  4PSW B;  2PM9 A;  4E54 A;  3OKY A;  5KDO B;  3PVW B;  2UZX B;  3MZL A;  4MK0 B;  3DM0 A;  2GC7 A;  3JPX A;  3N0E A;  3L4M D;  3DXK C;  3MZK A;  1TYQ C;  5B4W A;  5FQD A;  1SQ9 A;  3GFC A;  5GXH A;  1ERJ A;  4CZX A;  4AEZ A;  2BBK H;  4JSP C;  4X61 B;  4ZN4 A;  1U2V C;  2QC5 A;  1SHY B;  4E5Z B;  2H3X A;  5EMK B;  3AL9 A;  2OIZ A;  3NVN A;  1JOF A;  5CYK B;  3K27 A;  2Z2N A;  3V7D B;  4E5Z A;  3BG1 A;  5HQG A;  4ESG A;  2XYI A;  4GGD A;  2YBA A;  2EBS A;  4PSX B;  4A0A B;  2YB8 B;  5CYK A;  3I7O A;  2BCJ B;  4HDJ A;  5FKR A;  5FKT A;  1MG3 A;  5EAR A;  4X3E A;  5C9Z B;  1TBG A;  4JT6 C;  3E0C A;  2GC4 A;  3SXT D;  4J81 A;  3MMY A;  4FB1 D;  5C2V B;  3RRM C;  3PSC B;  4D6V A;  4GQ2 P;  2IAA A;  3JZG A;  5TDH B;  5GSA A;  4XEI C;  5EAP A;  4GQB B;  4FAV D;  4A11 B;  2YNP A;  2AGZ A;  4JSN C;  5A2Q g;  5JWZ A;  5IC7 A;  4CI2 A;  3IJ0 A;  4CZV A;  4IA9 A;  3I2N A;  5I5M A;  3ODT A;  4JSX C;  5AJA A;  4A11 A;  4X60 B;  4Z8L A;  4AOW A;  1PI6 A;  2J55 H;  4G56 B;  3ZWL B;  3PXT D;  4J0X A;  2OVP B;  2G9A A;  1P22 A;  5CXB B;  3C5M A;  2IUP A;  1B9X A;  4PC0 A;  4J78 A;  1VYH C;  2Q7Q A;  2I3S A;  3EI2 B;  1YFQ A;  2TRC B;  4CC9 A;  1XHM A;  5CXB A;  3OW8 A;  2HJ4 A;  2B4E A;  5SXM A;  4CY2 A;  4N14 A;  2XL3 A;  3EI2 A;  2I0S A;  5TEE A;  3AH8 B;  4XYI A;  5CXC B;  5FA5 B;  2H14 A;  2MTA H;  3SCY A;  2P9L C;  4CY1 A;  4X63 B;  3I7H A;  4A08 B;  3IKO A;  3UVL A;  3AL8 B;  4L3G D;  1NEX B;  4LG9 A;  5CXC A;  2CE8 A;  5K1C C;  2HYE A;  3VA6 A;  3I7L A;  3B7F A;  4FA5 D;  4ERZ A;  2H9N A;  3P4F A;  5FXY A;  4A08 A;  3AL8 A;  4O45 A;  4ZOY A;  1QNI A;  3NVQ A;  2H47 A;  4Y5R D;  3I7K A;  2I3T A;  4FA9 D;  1RI6 A;  4XYH A;  4O9D A;  1PBY B;  1B9Y A;  4J73 A;  4FA1 D;  3GRE A;  4J86 A;  1N6F A;  4CI8 A;  4J77 A;  3SMR A;  4GM3 A;  5H17 A;  2IUV A;  2CN2 A;  1PEV A;  2I0T A;  3F3P A;  4L3H D;  1N6E A;  3RFG A;  2OVR B;  2P9S C;  2AGX A;  3W15 A;  4O1Q D;  4GGA A;  3EI3 B;  3KRX B;  3SVW D;  5IT9 g;  3PXS D;  4YVD A;  2YNO A;  2P9I C;  5HE2 B;  2CN3 A;  3UKR C;  3EI3 A;  4ES0 A;  4QQE A;  2H6N A;  4J82 A;  4A0A A;  3JRO A;  3DWL C;  2Z2O A;  4GM8 A;  2B5N A;  3F3F A;  4U7A A;  5GXI A;  3U4Y A;  3OKT A;  1MDA H;  3V5W B;  4A2M A;  2P9K C;  4PBY A;  5AMS A;  1XIP A;  2YNN A;  3PXW D;  2IUQ A;  4J87 A;  4A2L A;  1GOT B;  1A0R B;  4R7A B;  4UI9 R;  4FA4 D;  4BUJ C;  3N0D A;  2W18 A;  4CZY A;  5I5J A;  1OMW B;  4ZOX A;  4JT5 C;  5GMK n;  3IIW A;  1JJU B;  1JMZ B;  1JMX B;  4QL1 A;  2I0R A;  2H9M A;  4OWR A;  5I5I A;  4U1E I;  2QXV A;  1PGU A;  4BH6 A;  4FHL A;  1S4U X;  2B5L A;  5HE1 B;  3RMZ D;  4A0B B;  2AH1 A;  2AQ5 A;  3C75 H;  4ERQ A;  3JZN A;  3SFZ A;  3JAM g;  4QT8 A;  2CNX A;  3SLE D;  2IUR A;  3RN0 D;  3MXX A;  4A0B A;  2J56 H;  4QRJ A;  3SBP A;  4CY5 A;  3BWS A;  4LG8 A;  5EMJ B;  5EMM B;  3RLM D;  3SBQ A;  2CO0 A;  1GG2 B;  4CI1 A;  1N6D A;  5H14 A;  4O3T B;  3FM0 A;  4FAN D;  2H6K A;  3BG0 A;  4GQ1 A;  5EM2 B;  3CIK B;  2OJY A;  3MKQ A;  1Q47 A;  4K3J B;  3SWS D;  3UR4 A;  3PVU B;  2H9L A;  3JB9 L;  5FKQ A;  4LGN A;  3UVM A;  5EM2 A;  3UKU C;  3CFS B;  2H68 A;  3OTT A;  3PE7 A;  5AFU 3;  4ZOV A;  2B5M A;  3I7P A;  5H1M A;  3OKW A;  2XL2 A;  3I89 A;  4I79 A;  2AGY A;  2O9K A;  5HYN B;  3DXM C;  3EG6 A;  2H6Q A;  5TEF A;  4GZ8 A;  3JRP A;  5EAL A;  4IMM A;  3OL2 B;  1U4C A;  1NR0 A;  4O3U B;  1SQJ A;  4L1Q D;  2HKM A;  3RFH A;  4J84 A;  3I8E A;  3EI4 B;  3FGB A;  5IGQ A;  3F3G A;  3OL2 A;  4H5J A;  4J0W A;  3DSM A;  2HES X;  4ZOZ A;  1K8K C;  3EI4 A;  3IJ1 A;  3IJC A;  3C9C A;  4ERY A;  4GMB A;  2GNQ A;  3C99 A;  2G99 A;  3MKS B;  3AFC A;  4PXW A;  1MG2 A;  5K19 A;  1K32 A;  2P9N C;  1GXR A;  3I8C A;  1OLZ A;  3EWE A;  5C2W B;  3EU7 A;  3FRX A;  2H13 A;  4Y7R A;  2PM7 B;  4KFM B;  2IWK A;  2PBI B;  2CO0 C;  5FLX g;  2OK6 A;  4A7J A;  4PBZ A;  2PM6 B; 
#chains in the Genus database with same CATH topology
 5M61 A;  3IIY A;  2AGW A;  4EWR A;  1K3I A;  5HE0 B;  3NID A;  3KRW B;  4OZU A;  2HU8 A;  3RN1 D;  4L9O A;  4DNW A;  2Z2P A;  2AH0 A;  1GP2 B;  3JZH A;  3CFV A;  3ORV D;  5IJ7 E;  1FWX A;  3DDU A;  3ZDZ A;  3ZE2 A;  4JSV C;  3J81 g;  4FWW A;  1QFM A;  3IUQ A;  5EML B;  4JXM A;  2YMU A;  3UVO A;  1R5M A;  4K3I D;  2OVQ B;  2VDN A;  3EMH A;  4BP8 A;  4UM9 A;  3SJL D;  4GGC A;  4NBM A;  1XKS A;  4J79 A;  4CY3 A;  3I7N A;  3A0F A;  3SN6 B;  4WJK A;  3HFQ A;  4JD2 C;  4BP9 A;  4NSX A;  3NVX A;  3OF7 A;  3EI1 B;  5HE3 B;  3V9F A;  4PNK B;  5EAM A;  2P9P C;  2XU7 A;  4WK0 A;  4H5I A;  5FKS A;  5E6U A;  3VH0 A;  2HJB A;  2AGL A;  3UVN A;  2H9P A;  3IUJ A;  5THA A;  4BL0 A;  5M5R A;  3UVK A;  3K26 A;  3EI1 A;  1UOQ A;  4A09 B;  3J80 g;  4CI3 A;  2P9U C;  4GM9 A;  4DNV A;  5IJ8 E;  4J8B A;  2J57 G;  5IGO A;  2VC2 A;  4TZ4 A;  4A09 A;  4J8G A;  3RSE C;  3VGZ A;  2HKR A;  2PM9 B;  4E54 B;  1E8M A;  3ULE C;  3OKY B;  3SBR A;  2IWF A;  2OK4 A;  2HXC A;  2VDO A;  4D0K A;  5M5U A;  3PSL A;  5TF2 A;  2CE9 A;  2UZY B;  4AN0 A;  3SHF A;  1L0Q A;  3L4O D;  4PSW B;  2PM9 A;  4E54 A;  3OKY A;  5KDO B;  3PVW B;  2UZX B;  3MZL A;  4MK0 B;  3DM0 A;  2GC7 A;  3N0E A;  3JPX A;  3L4M D;  3DXK C;  1UOO A;  3FCU A;  4RE5 A;  3MZK A;  1TYQ C;  3V4V A;  5B4W A;  5FQD A;  1SQ9 A;  4L1M A;  3GFC A;  5GXH A;  1ERJ A;  3EQ9 A;  4CZX A;  4AEZ A;  3EQ7 A;  4O2W A;  2BBK H;  4JSP C;  4X61 B;  4BCB A;  4ZN4 A;  1U2V C;  2QC5 A;  1SHY B;  4E5Z B;  2H3X A;  1H2Y A;  5EMK B;  3AL9 A;  2OIZ A;  3NVN A;  1JOF A;  2JKX A;  5CYK B;  2EIE A;  1H2X A;  2Z2N A;  3K27 A;  3K72 A;  3V7D B;  4E5Z A;  3BG1 A;  3VI3 A;  4JHN A;  5HQG A;  4ESG A;  2XYI A;  4GGD A;  2YBA A;  2EBS A;  1VZ3 A;  3O4I A;  2YB8 B;  3O4G A;  4PSX B;  5CYK A;  4A0A B;  3I7O A;  4AN1 A;  1UOP A;  2BCJ B;  4HDJ A;  5FKR A;  4MMY A;  1MG3 A;  5FKT A;  5EAR A;  1C9L A;  4X3E A;  5C9Z B;  3MUN A;  1TBG A;  3QI0 A;  4JT6 C;  3E0C A;  2GC4 A;  3SXT D;  4J81 A;  3MMY A;  4FB1 D;  5C2V B;  1GOF A;  3RRM C;  3PSC B;  4D6V A;  4GQ2 P;  2IAA A;  3JZG A;  4G1M A;  5TDH B;  5GSA A;  4XEI C;  5EAP A;  4GQB B;  4FAV D;  4A11 B;  2YNP A;  2AGZ A;  4JSN C;  5A2Q g;  5C86 A;  5JWZ A;  2VZ3 A;  5IC7 A;  4CI2 A;  3IJ0 A;  3NIG A;  4CZV A;  4IA9 A;  3I2N A;  5I5M A;  3ODT A;  4JSX C;  5AJA A;  4Z7Q A;  1E8N A;  4A11 A;  4X60 B;  4Z8L A;  4AOW A;  1PI6 A;  2J55 H;  4G56 B;  3ZWL B;  3PXT D;  4J0X A;  2OVP B;  2G9A A;  1P22 A;  5E6R A;  2VDM A;  5CXB B;  3C5M A;  2IUP A;  1B9X A;  4PC0 A;  4J78 A;  1VYH C;  2Q7Q A;  2I3S A;  2VZ1 A;  2VDP A;  3EI2 B;  1YFQ A;  2TRC B;  1GOG A;  4CC9 A;  4UM8 A;  1XHM A;  5CXB A;  3OW8 A;  2HJ4 A;  2B4E A;  5SXM A;  4CY2 A;  1UTC A;  4N14 A;  2XL3 A;  3EI2 A;  4O02 A;  2VDR A;  1YR2 A;  2VDL A;  2I0S A;  5TEE A;  3AH8 B;  3IUL A;  4XYI A;  5CXC B;  5FA5 B;  2H14 A;  2MTA H;  4G55 A;  3SCY A;  3T3M A;  2P9L C;  4CY1 A;  4X63 B;  3I7H A;  4A08 B;  3IKO A;  3MUO A;  3UVL A;  3AL8 B;  2XZG A;  4L3G D;  1NEX B;  4LG9 A;  5CXC A;  2CE8 A;  5K1C C;  2HYE A;  3VA6 A;  3MVD K;  3I7L A;  3B7F A;  4FA5 D;  4ERZ A;  2H9N A;  3P4F A;  5FXY A;  4A08 A;  3AL8 A;  4O45 A;  4ZOY A;  1VE7 A;  1QNI A;  5M5S A;  3NVQ A;  2H47 A;  4Y5R D;  1O6F A;  3I7K A;  2I3T A;  4FA9 D;  5HDB A;  1RI6 A;  4XYH A;  4O9D A;  1L5G A;  1C9I A;  1PBY B;  1B9Y A;  4J73 A;  4FA1 D;  3GRE A;  4J86 A;  3IUM A;  1N6F A;  4CI8 A;  4J77 A;  3SMR A;  4GM3 A;  5H17 A;  1VE6 A;  2IUV A;  2CN2 A;  1PEV A;  2I0T A;  3F3P A;  4L3H D;  1VZ2 A;  2BKL A;  4WK2 A;  1N6E A;  3RFG A;  2OVR B;  2P9S C;  2AGX A;  3W15 A;  3IUR A;  4O1Q D;  4GGA A;  3EI3 B;  5M5T A;  3VI4 A;  3KRX B;  2XDW A;  3SVW D;  1H2Z A;  5IT9 g;  3PXS D;  4YVD A;  2YNO A;  2P9I C;  5HE2 B;  2CN3 A;  2WQ8 A;  3UKR C;  3EI3 A;  4ES0 A;  4QQE A;  5FFO A;  2H6N A;  1T2X A;  1E5T A;  4NAA A;  4J82 A;  4A0A A;  3JRO A;  2EIB A;  2Z2O A;  3DWL C;  4GM8 A;  4MMZ A;  2B5N A;  3F3F A;  4U7A A;  5E6S A;  3ZDX A;  5GXI A;  3U4Y A;  3OKT A;  1MDA H;  3V5W B;  4A2M A;  4Z7O A;  2P9K C;  4PBY A;  5AMS A;  1XIP A;  5FFG A;  4MMX A;  4Z7N A;  2YNN A;  3GC3 B;  2IUQ A;  3PXW D;  4J87 A;  4A2L A;  4QAM A;  1GOT B;  3KCI A;  2HU7 A;  1A0R B;  4AMY A;  4BCD A;  4R7A B;  4UI9 R;  4AMZ A;  4FA4 D;  4BUJ C;  3N0D A;  2W18 A;  4CZY A;  1BPO A;  5I5J A;  2EID A;  1OMW B;  4ZOX A;  4JT5 C;  5GMK n;  3IIW A;  1JJU B;  4JHP C;  1JMZ B;  1JMX B;  4QL1 A;  4AX4 A;  2I0R A;  2H9M A;  4OWR A;  5I5I A;  4U1E I;  2QXV A;  1PGU A;  5C92 A;  2QZP A;  4BH6 A;  4NEN A;  4FHL A;  1S4U X;  3GD1 I;  3ZE0 A;  2B5L A;  5HE1 B;  3RMZ D;  4IRZ A;  4A0B B;  3FCS A;  2VDQ A;  3IUN A;  2AH1 A;  2AQ5 A;  3C75 H;  4ERQ A;  3JZN A;  3SFZ A;  3JAM g;  4QT8 A;  2CNX A;  1I2M B;  3SLE D;  2IUR A;  3RN0 D;  3ZE1 A;  3MXX A;  4A0B A;  2J56 H;  4QRJ A;  3SBP A;  4CY5 A;  3BWS A;  4LG8 A;  5M5V A;  5EMJ B;  1QFS A;  5EMM B;  3RLM D;  3SBQ A;  2CO0 A;  1GG2 B;  4CI1 A;  3K6S A;  1N6D A;  5H14 A;  4G1E A;  4O3T B;  3FM0 A;  2EIC A;  4FAN D;  2H6K A;  2QR5 A;  3BG0 A;  4GQ1 A;  5EM2 B;  3V4P A;  3CIK B;  4NC4 A;  2OJY A;  3O4H A;  2HU5 A;  3MKQ A;  1Q47 A;  3IVM A;  4K3J B;  3SWS D;  3EQ8 A;  3UR4 A;  3PVU B;  1TYE A;  2H9L A;  3JB9 L;  5FKQ A;  4RE6 A;  4LGN A;  3UVM A;  5EM2 A;  3UKU C;  1H2W A;  3CFS B;  1M1X A;  2H68 A;  3OTT A;  3PE7 A;  5AFU 3;  4ZOV A;  2B5M A;  4D9S A;  3I7P A;  5H1M A;  3OKW A;  2XL2 A;  3I89 A;  4I79 A;  2AGY A;  2O9K A;  5HYN B;  3DXM C;  3EG6 A;  2H6Q A;  3ZDY A;  4BCC A;  4WK4 A;  5TEF A;  4GZ8 A;  3JRP A;  5EAL A;  4IMM A;  3OL2 B;  1U4C A;  1NR0 A;  1A12 A;  4O3U B;  1O6G A;  1SQJ A;  3QHY B;  1JTD B;  4L1Q D;  2HKM A;  3RFH A;  3I8E A;  4J84 A;  3EI4 B;  3FGB A;  5IGQ A;  1JV2 A;  3F3G A;  3OL2 A;  3IJE A;  4H5J A;  4J0W A;  3DSM A;  2HES X;  4ZOZ A;  1K8K C;  3EI4 A;  3K71 A;  3IJ1 A;  3IJC A;  3C9C A;  4ERY A;  4GMB A;  2GNQ A;  3C99 A;  2G99 A;  3MKS B;  3AFC A;  4PXW A;  1MG2 A;  5K19 A;  1K32 A;  2P9N C;  1GXR A;  1GOH A;  3I8C A;  1OLZ A;  3EWE A;  5C2W B;  3EU7 A;  3FRX A;  2H13 A;  2VDK A;  1U8C A;  4Y7R A;  2PM7 B;  3NIF A;  3T3P A;  4KFM B;  2IWK A;  2PBI B;  2CO0 C;  4DNU A;  3O4J A;  5FLX g;  2XE4 A;  2OK6 A;  4A7J A;  4PBZ A;  2PM6 B; 
#chains in the Genus database with same CATH homology
 3IIY A;  2AGW A;  4EWR A;  5HE0 B;  3KRW B;  4OZU A;  3RN1 D;  4L9O A;  2Z2P A;  2AH0 A;  1GP2 B;  3JZH A;  3CFV A;  3ORV D;  5IJ7 E;  1FWX A;  4JSV C;  3J81 g;  4FWW A;  5EML B;  4JXM A;  2YMU A;  3UVO A;  1R5M A;  4K3I D;  2OVQ B;  3EMH A;  3SJL D;  4GGC A;  1XKS A;  4J79 A;  4CY3 A;  3I7N A;  3A0F A;  3SN6 B;  3HFQ A;  4JD2 C;  4NSX A;  3NVX A;  3EI1 B;  5HE3 B;  3V9F A;  4PNK B;  5EAM A;  2P9P C;  2XU7 A;  5FKS A;  4H5I A;  3VH0 A;  2HJB A;  2AGL A;  3UVN A;  2H9P A;  4BL0 A;  5THA A;  3UVK A;  3K26 A;  3EI1 A;  4A09 B;  3J80 g;  4CI3 A;  2P9U C;  4GM9 A;  5IJ8 E;  4J8B A;  2J57 G;  5IGO A;  4TZ4 A;  4A09 A;  4J8G A;  3RSE C;  3VGZ A;  2HKR A;  2PM9 B;  4E54 B;  3ULE C;  3OKY B;  3SBR A;  2IWF A;  2OK4 A;  2HXC A;  4D0K A;  3PSL A;  5TF2 A;  2CE9 A;  2UZY B;  3SHF A;  1L0Q A;  3L4O D;  4PSW B;  2PM9 A;  4E54 A;  3OKY A;  5KDO B;  3PVW B;  2UZX B;  3MZL A;  4MK0 B;  3DM0 A;  2GC7 A;  3JPX A;  3N0E A;  3L4M D;  3DXK C;  3MZK A;  1TYQ C;  5B4W A;  5FQD A;  1SQ9 A;  3GFC A;  5GXH A;  1ERJ A;  4CZX A;  4AEZ A;  2BBK H;  4JSP C;  4X61 B;  4ZN4 A;  1U2V C;  2QC5 A;  1SHY B;  4E5Z B;  2H3X A;  5EMK B;  3AL9 A;  2OIZ A;  3NVN A;  1JOF A;  5CYK B;  3K27 A;  2Z2N A;  3V7D B;  4E5Z A;  3BG1 A;  5HQG A;  4ESG A;  2XYI A;  4GGD A;  2YBA A;  2EBS A;  4PSX B;  4A0A B;  2YB8 B;  5CYK A;  3I7O A;  2BCJ B;  4HDJ A;  5FKR A;  5FKT A;  1MG3 A;  5EAR A;  4X3E A;  5C9Z B;  1TBG A;  4JT6 C;  3E0C A;  2GC4 A;  3SXT D;  4J81 A;  3MMY A;  4FB1 D;  5C2V B;  3RRM C;  3PSC B;  4D6V A;  4GQ2 P;  2IAA A;  3JZG A;  5TDH B;  5GSA A;  4XEI C;  5EAP A;  4GQB B;  4FAV D;  4A11 B;  2YNP A;  2AGZ A;  4JSN C;  5A2Q g;  5JWZ A;  5IC7 A;  4CI2 A;  3IJ0 A;  4CZV A;  4IA9 A;  3I2N A;  5I5M A;  3ODT A;  4JSX C;  5AJA A;  4A11 A;  4X60 B;  4Z8L A;  4AOW A;  1PI6 A;  2J55 H;  4G56 B;  3ZWL B;  3PXT D;  4J0X A;  2OVP B;  2G9A A;  1P22 A;  5CXB B;  3C5M A;  2IUP A;  1B9X A;  4PC0 A;  4J78 A;  1VYH C;  2Q7Q A;  2I3S A;  3EI2 B;  1YFQ A;  2TRC B;  4CC9 A;  1XHM A;  5CXB A;  3OW8 A;  2HJ4 A;  2B4E A;  5SXM A;  4CY2 A;  4N14 A;  2XL3 A;  3EI2 A;  2I0S A;  5TEE A;  3AH8 B;  4XYI A;  5CXC B;  5FA5 B;  2H14 A;  2MTA H;  3SCY A;  2P9L C;  4CY1 A;  4X63 B;  3I7H A;  4A08 B;  3IKO A;  3UVL A;  3AL8 B;  4L3G D;  1NEX B;  4LG9 A;  5CXC A;  2CE8 A;  5K1C C;  2HYE A;  3VA6 A;  3I7L A;  3B7F A;  4FA5 D;  4ERZ A;  2H9N A;  3P4F A;  5FXY A;  4A08 A;  3AL8 A;  4O45 A;  4ZOY A;  1QNI A;  3NVQ A;  2H47 A;  4Y5R D;  3I7K A;  2I3T A;  4FA9 D;  1RI6 A;  4XYH A;  4O9D A;  1PBY B;  1B9Y A;  4J73 A;  4FA1 D;  3GRE A;  4J86 A;  1N6F A;  4CI8 A;  4J77 A;  3SMR A;  4GM3 A;  5H17 A;  2IUV A;  2CN2 A;  1PEV A;  2I0T A;  3F3P A;  4L3H D;  1N6E A;  3RFG A;  2OVR B;  2P9S C;  2AGX A;  3W15 A;  4O1Q D;  4GGA A;  3EI3 B;  3KRX B;  3SVW D;  5IT9 g;  3PXS D;  4YVD A;  2YNO A;  2P9I C;  5HE2 B;  2CN3 A;  3UKR C;  3EI3 A;  4ES0 A;  4QQE A;  2H6N A;  4J82 A;  4A0A A;  3JRO A;  3DWL C;  2Z2O A;  4GM8 A;  2B5N A;  3F3F A;  4U7A A;  5GXI A;  3U4Y A;  3OKT A;  1MDA H;  3V5W B;  4A2M A;  2P9K C;  4PBY A;  5AMS A;  1XIP A;  2YNN A;  3PXW D;  2IUQ A;  4J87 A;  4A2L A;  1GOT B;  1A0R B;  4R7A B;  4UI9 R;  4FA4 D;  4BUJ C;  3N0D A;  2W18 A;  4CZY A;  5I5J A;  1OMW B;  4ZOX A;  4JT5 C;  5GMK n;  3IIW A;  1JJU B;  1JMZ B;  1JMX B;  4QL1 A;  2I0R A;  2H9M A;  4OWR A;  5I5I A;  4U1E I;  2QXV A;  1PGU A;  4BH6 A;  4FHL A;  1S4U X;  2B5L A;  5HE1 B;  3RMZ D;  4A0B B;  2AH1 A;  2AQ5 A;  3C75 H;  4ERQ A;  3JZN A;  3SFZ A;  3JAM g;  4QT8 A;  2CNX A;  3SLE D;  2IUR A;  3RN0 D;  3MXX A;  4A0B A;  2J56 H;  4QRJ A;  3SBP A;  4CY5 A;  3BWS A;  4LG8 A;  5EMJ B;  5EMM B;  3RLM D;  3SBQ A;  2CO0 A;  1GG2 B;  4CI1 A;  1N6D A;  5H14 A;  4O3T B;  3FM0 A;  4FAN D;  2H6K A;  3BG0 A;  4GQ1 A;  5EM2 B;  3CIK B;  2OJY A;  3MKQ A;  1Q47 A;  4K3J B;  3SWS D;  3UR4 A;  3PVU B;  2H9L A;  3JB9 L;  5FKQ A;  4LGN A;  3UVM A;  5EM2 A;  3UKU C;  3CFS B;  2H68 A;  3OTT A;  3PE7 A;  5AFU 3;  4ZOV A;  2B5M A;  3I7P A;  5H1M A;  3OKW A;  2XL2 A;  3I89 A;  4I79 A;  2AGY A;  2O9K A;  5HYN B;  3DXM C;  3EG6 A;  2H6Q A;  5TEF A;  4GZ8 A;  3JRP A;  5EAL A;  4IMM A;  3OL2 B;  1U4C A;  1NR0 A;  4O3U B;  1SQJ A;  4L1Q D;  2HKM A;  3RFH A;  4J84 A;  3I8E A;  3EI4 B;  3FGB A;  5IGQ A;  3F3G A;  3OL2 A;  4H5J A;  4J0W A;  3DSM A;  2HES X;  4ZOZ A;  1K8K C;  3EI4 A;  3IJ1 A;  3IJC A;  3C9C A;  4ERY A;  4GMB A;  2GNQ A;  3C99 A;  2G99 A;  3MKS B;  3AFC A;  4PXW A;  1MG2 A;  5K19 A;  1K32 A;  2P9N C;  1GXR A;  3I8C A;  1OLZ A;  3EWE A;  5C2W B;  3EU7 A;  3FRX A;  2H13 A;  4Y7R A;  2PM7 B;  4KFM B;  2IWK A;  2PBI B;  2CO0 C;  5FLX g;  2OK6 A;  4A7J A;  4PBZ A;  2PM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...