3UVLA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of mll3
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
303
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 99
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvlA00
4U1EI 4FA1D 2H14A 2GC7A 2P9KC 5EAPA 5FKRA 2H6KA 2HXCA 5GXIA 2IWKA 2IURA 5TEFA 4ZOVA 4CY1A 4CY3A 3EI2A 2Z2OA 3ORVD 2YNOA 2P9NC 2OVRB 3I2NA 1NR0A 4D6VA 3ODTA 4GMBA 3JZNA 4A7JA 4E54B 4LG9A 2P9PC 2P9IC 1GG2B 5TEEA 3J80g 2OK6A 4BL0A 3UKUC 2J56H 3RSEC 1U2VC 3EI1A 1JMZB 3L4OD 3EI4A 4I79A 4GGCA 2AGXA 2CE9A 4O1QD 2AGZA 4A09A 1R5MA 3BG1A 4R7AB 1MG2A 1SHYB 2H6QA 4A0AA 2AQ5A 5CXCB 2YNPA 2PM9B 1JJUB 3I89A 3L4MD 1PEVA 3UVOA 1B9YA 3EI3A 2CNXA 3C9CA 5EM2B 4E5ZB 2HJBA 3AL8B 3OKWA 1ERJA 5IGQA 5FXYA 5IT9g 2P9SC 2PM7B 2IUQA 4OZUA 3GREA 4GM8A 4PSXB 1JOFA 4AEZA 4GQ2P 1Q47A 5CYKA 4PSWB 2OK4A 2B4EA 3C99A 3UVKA 1XIPA 4PBYA 3RFGA 3V9FA 4XYIA 4GGDA 2BCJB 4XYHA 3JZGA 5K1CC 2UZXB 3FRXA 5EAMA 2GC4A 1L0QA 5EMKB 1GXRA 3MKSB 1XHMA 4L1QD 3UKRC 3MKQA 2P9LC 3N0EA 3JPXA 4ZOYA 2PBIB 3DWLC 4GM9A 3SN6B 4PXWA 3J81g 3PXWD 5HE1B 1GP2B 2QC5A 3PE7A 4JT6C 5AFU3 2OVPB 4GM3A 4OWRA 4J8BA 3OKYA 2H9LA 5B4WA 4YVDA 2XL3A 5FKQA 2OVQB 5IJ8E 4CY5A 4ERYA 3E0CA 2HESX 3MMYA 2YBAA 4O3TB 4QT8A 2AGWA 4J87A 5C9ZB 4ERZA 2H47A 1MG3A 4G56B 5H1MA 3W15A 3FM0A 4J0WA 1SQ9A 3F3PA 4O45A 3VH0A 4JSPC 4PNKB 3VA6A 4D0KA 3IJ1A 4ZN4A 3V5WB 3JB9L 5FA5B 5C2WB 4FHLA 4FAND 5A2Qg 4QQEA 1RI6A 4HDJA 2H9MA 4TZ4A 3DM0A 3MZLA 5CXBB 5AMSA 4GQ1A 1A0RB 3EI2B 5JWZA 4A08A 3SXTD 1U4CA 3GFCA 4E54A 4L3HD 4H5IA 3I8CA 5GXHA 3AFCA 3CFSB 5H17A 2CN3A 5HQGA 4J73A 2EBSA 1PI6A 3BG0A 4FA9D 1N6DA 2HKMA 3SFZA 3CFVA 5HE3B 3V7DB 4AOWA 2IUPA 3I8EA 1B9XA 2I0TA 1YFQA 4A2LA 4Y7RA 4K3ID 2IAAA 4IMMA 5CXCA 3C75H 4FWWA 3U4YA 3PXTD 1N6FA 3SMRA 4UI9R 3AH8B 3B7FA 2Q7QA 4J86A 3MZKA 3K27A 4Z8LA 5EM2A 4E5ZA 3AL8A 4J79A 3UVNA 3RN1D 1GOTB 3OKTA 5FKSA 4JSNC 2J57G 1VYHC 3JROA 3KRWB 3UVLA 4J0XA 5EMJB 4JXMA 2Z2PA 2B5MA 4FA5D 3UR4A 5IGOA 2AH0A 5SXMA 3JRPA 3PSLA 3VGZA 4ES0A 5HE0B 4BUJC 2P9UC 1SQJA 2MTAH 2QXVA 4A0BB 4A11A 2O9KA 3OL2B 4X3EA 1OLZA 5EARA 2HKRA 3P4FA 2OIZA 1N6EA 2H9NA 4CZVA 2H9PA 5HYNB 4JT5C 2G99A 1S4UX 5H14A 2HJ4A 3I7HA 1OMWB 4O9DA 4QL1A 3DXKC 3UVMA 3A0FA 4LG8A 4X63B 2B5NA 5I5IA 4CZYA 5K19A 5TDHB 3SLED 4U7AA 1FWXA 3K26A 3PVUB 5IJ7E 4L3GD 5KDOB 3C5MA 4FAVD 3RMZD 3I7LA 2YNNA 1PGUA 5I5MA 3SWSD 5FQDA 2HYEA 2H3XA 2XL2A 3NVXA 4CI1A 3PSCB 3EMHA 4L9OA 3IJ0A 2IWFA 5GSAA 3I7NA 3OW8A 4GQBB 4J81A 2I0RA 3PXSD 4EWRA 1NEXB 4FA4D 3SJLD 3IIWA 3SBPA 5THAA 5CXBA 4ESGA 2I0SA 1QNIA 5EMMB 2H13A 2YB8B 4Y5RD 3EG6A 4A08B 3RN0D 3NVNA 5C2VB 2CO0C 2TRCB 3EI1B 3CIKB 3F3FA 3EI4B 2AGYA 3OTTA 2GNQA 4A09B 1XKSA 2Z2NA 2PM9A 4A0AB 4J84A 4X60B 4BH6A 3N0DA 2BBKH 4NSXA 3EI3B 3IJCA 4J77A 4QRJA 5HE2B 3SBRA 3SBQA 3KRXB 3HFQA 4O3UB 3EWEA 4CI3A 3AL9A 4ERQA 3IKOA 3RRMC 3DSMA 5EALA 3PVWB 3SHFA 4JD2C 4PBZA 3SVWD 4GGAA 1JMXB 5CYKB 3ULEC 1TBGA 2XU7A 3IIYA 5I5JA 3MXXA 4J78A 4J82A 2YMUA 4CY2A 4IA9A 3I7KA 1TYQC 2J55H 4PC0A 1K8KC 2UZYB 3JAMg 1P22A 3BWSA 4ZOXA 1K32A 2B5LA 3RFHA 2PM6B 4J8GA 4A0BA 3FGBA 2IUVA 4ZOZA 2H6NA 4CC9A 4A11B 5GMKn 3OL2A 3ZWLB 4FB1D 2XYIA 2I3SA 4H5JA 2CN2A 3SCYA 4CI2A 2W18A 2AH1A 4XEIC 3I7PA 2AGLA 3RLMD 4MK0B 3OKYB 2CO0A 1PBYB 3F3GA 2OJYA 4CZXA 5FKTA 4CI8A 4LGNA 4A2MA 3NVQA 3I7OA 4X61B 2CE8A 4GZ8A 2G9AA 2H68A 5IC7A 4K3JB 3JZHA 2I3TA 3DXMC 4N14A 5TF2A 4JSXC 5FLXg 1MDAH 4JSVC 4KFMB 5EMLB 5AJAA 3EU7A
chains in the Genus database with same CATH superfamily
4G55A 4G1MA 4U1EI 4FA1D 2H14A 5M5SA 2GC7A 2P9KC 5EAPA 5FKRA 2H6KA 2HXCA 3GD1I 5GXIA 1H2ZA 2IWKA 2IURA 5TEFA 4ZOVA 4CY1A 4CY3A 4Z7OA 3EI2A 3MVDK 2Z2OA 3ORVD 2YNOA 2P9NC 4DNWA 2OVRB 3I2NA 1NR0A 4D6VA 3ODTA 3OF7A 4GMBA 3JZNA 4A7JA 4E54B 4LG9A 2P9PC 2VZ1A 3IUNA 2P9IC 1GG2B 4AN1A 5TEEA 1H2WA 3J80g 2OK6A 4BL0A 3UKUC 2J56H 3RSEC 1U2VC 3EI1A 1JMZB 3L4OD 3EI4A 4I79A 4GGCA 2AGXA 1L5GA 2CE9A 2AGZA 4O1QD 1R5MA 4A09A 2VDMA 3BG1A 4R7AB 1MG2A 1SHYB 2H6QA 4A0AA 2AQ5A 5CXCB 2YNPA 2PM9B 3O4GA 1JJUB 3I89A 3IURA 3L4MD 1PEVA 3UVOA 1B9YA 3EI3A 2CNXA 3C9CA 5EM2B 4E5ZB 2HJBA 3AL8B 3OKWA 1ERJA 5IGQA 2XE4A 3IULA 3IUJA 1H2XA 5FXYA 5M5TA 3IUMA 3ZDXA 2P9SC 5IT9g 2PM7B 2IUQA 4OZUA 3GREA 4GM8A 1U8CA 4PSXB 3MUOA 1JOFA 4AEZA 4GQ2P 1M1XA 1Q47A 4WK4A 5CYKA 4PSWB 3NIDA 2OK4A 1E8MA 2B4EA 3ZE1A 3C99A 3IUQA 3UVKA 1XIPA 4PBYA 3RFGA 3V9FA 1YR2A 4XYIA 4GGDA 2BCJB 4XYHA 3JZGA 1GOHA 5K1CC 2UZXB 3FRXA 5EAMA 2GC4A 3FCUA 1L0QA 5EMKB 3EQ8A 1GXRA 3MKSB 1XHMA 4L1QD 4JHNA 1I2MB 3KCIA 3UKRC 3MKQA 2P9LC 3N0EA 3JPXA 4ZOYA 2PBIB 3DWLC 4GM9A 3SN6B 4PXWA 3J81g 3PXWD 4JHPC 2VDPA 2XDWA 5HE1B 1GP2B 2QC5A 3PE7A 4JT6C 5AFU3 3K71A 2OVPB 4GM3A 4OWRA 2VDLA 4J8BA 3OKYA 2H9LA 5B4WA 4YVDA 2XL3A 5FKQA 2OVQB 5IJ8E 4CY5A 3O4HA 1K3IA 3E0CA 4ERYA 2HESX 3MMYA 2YBAA 4O3TB 5M5VA 4QT8A 2AGWA 4J87A 5C9ZB 2EICA 2H47A 1MG3A 4WJKA 4ERZA 4G56B 3K6SA 5H1MA 3W15A 3FM0A 4J0WA 1SQ9A 3F3PA 4O45A 5FFGA 3VH0A 4JSPC 4PNKB 3VA6A 3T3PA 4D0KA 3IJ1A 4ZN4A 3V5WB 3JB9L 4WK0A 3V4VA 5FA5B 3VI4A 5C2WB 5E6UA 4FHLA 4NC4A 4FAND 5A2Qg 4QQEA 3MUNA 1RI6A 1VZ3A 4HDJA 2H9MA 4TZ4A 3DM0A 3MZLA 5CXBB 5AMSA 4GQ1A 1A0RB 3EI2B 5JWZA 1C9IA 2HU8A 4A08A 4NENA 3SXTD 1U4CA 2JKXA 3GFCA 4E54A 4L3HD 1O6GA 4H5IA 3I8CA 4BCBA 3AFCA 3CFSB 5H17A 5GXHA 1VE7A 2CN3A 5HQGA 4J73A 1O6FA 2EBSA 5C92A 1PI6A 3BG0A 4FA9D 1N6DA 5FFOA 2HKMA 3QI0A 4DNVA 3SFZA 3CFVA 5HE3B 3V7DB 4AOWA 2IUPA 3I8EA 1B9XA 2I0TA 1YFQA 1JV2A 4A2LA 4Y7RA 4K3ID 2VZ3A 2IAAA 4IMMA 5CXCA 3C75H 4FWWA 4IRZA 4MMYA 3PXTD 3U4YA 1N6FA 1E5TA 3SMRA 4UI9R 3AH8B 3B7FA 2Q7QA 4J86A 3MZKA 1VZ2A 3K27A 3VI3A 4Z8LA 5EM2A 4E5ZA 3AL8A 4J79A 1UOQA 3UVNA 3RN1D 1GOTB 3OKTA 4RE5A 5M61A 5FKSA 4JSNC 2J57G 4BCDA 3T3MA 1VYHC 3JROA 3KRWB 3UVLA 2EIDA 4J0XA 2VDQA 1A12A 5EMJB 3V4PA 1JTDB 4JXMA 1QFSA 2Z2PA 2B5MA 4FA5D 3K72A 3UR4A 5IGOA 2AH0A 5SXMA 3JRPA 3PSLA 3VGZA 4L1MA 4ES0A 5HE0B 4BUJC 2P9UC 1SQJA 2MTAH 2QXVA 4A0BB 4MMZA 4A11A 3NIFA 5M5RA 2O9KA 3OL2B 4X3EA 1OLZA 5EARA 2HKRA 3P4FA 2OIZA 1N6EA 2H9NA 4CZVA 2H9PA 5HYNB 4JT5C 2G99A 1S4UX 1TYEA 5H14A 2HJ4A 3I7HA 1OMWB 4O9DA 4QL1A 3DXKC 3UVMA 3A0FA 4LG8A 2QR5A 4X63B 5C86A 2B5NA 5I5IA 4CZYA 3IJEA 5K19A 3NIGA 1VE6A 5TDHB 3SLED 2VDNA 4U7AA 1FWXA 3K26A 3PVUB 5IJ7E 4L3GD 5KDOB 3C5MA 4FAVD 3RMZD 4AN0A 3I7LA 2VDRA 2YNNA 1PGUA 4UM8A 5I5MA 3SWSD 5FQDA 2HYEA 2VDKA 2H3XA 2XL2A 3NVXA 2VDOA 3PSCB 4CI1A 3EMHA 4L9OA 3IJ0A 2IWFA 2VC2A 5GSAA 4AMZA 3I7NA 3OW8A 4GQBB 4QAMA 2HU7A 4J81A 2I0RA 3EQ7A 3PXSD 4EWRA 1NEXB 4FA4D 3SJLD 4BP8A 3IIWA 4AX4A 3SBPA 5THAA 5CXBA 4ESGA 2I0SA 1QNIA 3ZE0A 5E6RA 5EMMB 2H13A 2YB8B 4Y5RD 3EG6A 4A08B 3RN0D 3FCSA 3NVNA 5C2VB 2CO0C 2TRCB 1T2XA 3EI1B 3CIKB 5M5UA 3F3FA 1UOPA 2AGYA 3EI4B 1UOOA 3OTTA 2GNQA 4A09B 1XKSA 3GC3B 2Z2NA 1E8NA 4WK2A 2PM9A 4A0AB 2QZPA 4J84A 4X60B 4BH6A 3N0DA 2BBKH 4NSXA 3EI3B 3IJCA 4J77A 3O4JA 4QRJA 5HE2B 3SBRA 3SBQA 3KRXB 3HFQA 4O3UB 5HDBA 3IVMA 3EWEA 4CI3A 3AL9A 4ERQA 4AMYA 3IKOA 3ZDZA 1UTCA 3EQ9A 3RRMC 3DSMA 5EALA 3PVWB 3SHFA 4JD2C 4PBZA 4Z7NA 3SVWD 4GGAA 1JMXB 4O2WA 5CYKB 3ULEC 3ZDYA 1TBGA 2XU7A 3IIYA 5I5JA 3MXXA 4J78A 4J82A 2WQ8A 2YMUA 4BP9A 4IA9A 4CY2A 3I7KA 1TYQC 2J55H 3ZE2A 4PC0A 1K8KC 2UZYB 2EIEA 3JAMg 1GOFA 1P22A 3BWSA 2HU5A 4ZOXA 1K32A 2B5LA 1H2YA 4MMXA 3RFHA 2PM6B 1BPOA 4RE6A 4J8GA 4NAAA 4A0BA 3FGBA 2IUVA 4ZOZA 1C9LA 2H6NA 5AJAA 4CC9A 4A11B 4DNUA 5GMKn 3OL2A 3ZWLB 4FB1D 2XYIA 4G1EA 2I3SA 4H5JA 2CN2A 3SCYA 4Z7QA 4CI2A 2W18A 2AH1A 4XEIC 3I7PA 2AGLA 3RLMD 4MK0B 3OKYB 2CO0A 1PBYB 3F3GA 5E6SA 2OJYA 4CZXA 3DDUA 5FKTA 4CI8A 4BCCA 4LGNA 4UM9A 4A2MA 3NVQA 3I7OA 4X61B 2CE8A 3O4IA 4GZ8A 2G9AA 2H68A 5IC7A 1GOGA 2EIBA 2BKLA 4K3JB 3JZHA 2XZGA 2I3TA 3DXMC 4N14A 5TF2A 4JSXC 5FLXg 4D9SA 3QHYB 4NBMA 1MDAH 4O02A 4JSVC 4KFMB 5EMLB 1QFMA 3EU7A
chains in the Genus database with same CATH topology
4U1EI 4FA1D 2H14A 2GC7A 2P9KC 5EAPA 5FKRA 2H6KA 2HXCA 5GXIA 2IWKA 2IURA 5TEFA 4ZOVA 4CY1A 4CY3A 3EI2A 2Z2OA 3ORVD 2YNOA 2P9NC 2OVRB 3I2NA 1NR0A 4D6VA 3ODTA 4GMBA 3JZNA 4A7JA 4E54B 4LG9A 2P9PC 2P9IC 1GG2B 5TEEA 3J80g 2OK6A 4BL0A 3UKUC 2J56H 3RSEC 1U2VC 3EI1A 1JMZB 3L4OD 3EI4A 4I79A 4GGCA 2AGXA 2CE9A 4O1QD 2AGZA 4A09A 1R5MA 3BG1A 4R7AB 1MG2A 1SHYB 2H6QA 4A0AA 2AQ5A 5CXCB 2YNPA 2PM9B 1JJUB 3I89A 3L4MD 1PEVA 3UVOA 1B9YA 3EI3A 2CNXA 3C9CA 5EM2B 4E5ZB 2HJBA 3AL8B 3OKWA 1ERJA 5IGQA 5FXYA 5IT9g 2P9SC 2PM7B 2IUQA 4OZUA 3GREA 4GM8A 4PSXB 1JOFA 4AEZA 4GQ2P 1Q47A 5CYKA 4PSWB 2OK4A 2B4EA 3C99A 3UVKA 1XIPA 4PBYA 3RFGA 3V9FA 4XYIA 4GGDA 2BCJB 4XYHA 3JZGA 5K1CC 2UZXB 3FRXA 5EAMA 2GC4A 1L0QA 5EMKB 1GXRA 3MKSB 1XHMA 4L1QD 3UKRC 3MKQA 2P9LC 3N0EA 3JPXA 4ZOYA 2PBIB 3DWLC 4GM9A 3SN6B 4PXWA 3J81g 3PXWD 5HE1B 1GP2B 2QC5A 3PE7A 4JT6C 5AFU3 2OVPB 4GM3A 4OWRA 4J8BA 3OKYA 2H9LA 5B4WA 4YVDA 2XL3A 5FKQA 2OVQB 5IJ8E 4CY5A 4ERYA 3E0CA 2HESX 3MMYA 2YBAA 4O3TB 4QT8A 2AGWA 4J87A 5C9ZB 4ERZA 2H47A 1MG3A 4G56B 5H1MA 3W15A 3FM0A 4J0WA 1SQ9A 3F3PA 4O45A 3VH0A 4JSPC 4PNKB 3VA6A 4D0KA 3IJ1A 4ZN4A 3V5WB 3JB9L 5FA5B 5C2WB 4FHLA 4FAND 5A2Qg 4QQEA 1RI6A 4HDJA 2H9MA 4TZ4A 3DM0A 3MZLA 5CXBB 5AMSA 4GQ1A 1A0RB 3EI2B 5JWZA 4A08A 3SXTD 1U4CA 3GFCA 4E54A 4L3HD 4H5IA 3I8CA 5GXHA 3AFCA 3CFSB 5H17A 2CN3A 5HQGA 4J73A 2EBSA 1PI6A 3BG0A 4FA9D 1N6DA 2HKMA 3SFZA 3CFVA 5HE3B 3V7DB 4AOWA 2IUPA 3I8EA 1B9XA 2I0TA 1YFQA 4A2LA 4Y7RA 4K3ID 2IAAA 4IMMA 5CXCA 3C75H 4FWWA 3U4YA 3PXTD 1N6FA 3SMRA 4UI9R 3AH8B 3B7FA 2Q7QA 4J86A 3MZKA 3K27A 4Z8LA 5EM2A 4E5ZA 3AL8A 4J79A 3UVNA 3RN1D 1GOTB 3OKTA 5FKSA 4JSNC 2J57G 1VYHC 3JROA 3KRWB 3UVLA 4J0XA 5EMJB 4JXMA 2Z2PA 2B5MA 4FA5D 3UR4A 5IGOA 2AH0A 5SXMA 3JRPA 3PSLA 3VGZA 4ES0A 5HE0B 4BUJC 2P9UC 1SQJA 2MTAH 2QXVA 4A0BB 4A11A 2O9KA 3OL2B 4X3EA 1OLZA 5EARA 2HKRA 3P4FA 2OIZA 1N6EA 2H9NA 4CZVA 2H9PA 5HYNB 4JT5C 2G99A 1S4UX 5H14A 2HJ4A 3I7HA 1OMWB 4O9DA 4QL1A 3DXKC 3UVMA 3A0FA 4LG8A 4X63B 2B5NA 5I5IA 4CZYA 5K19A 5TDHB 3SLED 4U7AA 1FWXA 3K26A 3PVUB 5IJ7E 4L3GD 5KDOB 3C5MA 4FAVD 3RMZD 3I7LA 2YNNA 1PGUA 5I5MA 3SWSD 5FQDA 2HYEA 2H3XA 2XL2A 3NVXA 4CI1A 3PSCB 3EMHA 4L9OA 3IJ0A 2IWFA 5GSAA 3I7NA 3OW8A 4GQBB 4J81A 2I0RA 3PXSD 4EWRA 1NEXB 4FA4D 3SJLD 3IIWA 3SBPA 5THAA 5CXBA 4ESGA 2I0SA 1QNIA 5EMMB 2H13A 2YB8B 4Y5RD 3EG6A 4A08B 3RN0D 3NVNA 5C2VB 2CO0C 2TRCB 3EI1B 3CIKB 3F3FA 3EI4B 2AGYA 3OTTA 2GNQA 4A09B 1XKSA 2Z2NA 2PM9A 4A0AB 4J84A 4X60B 4BH6A 3N0DA 2BBKH 4NSXA 3EI3B 3IJCA 4J77A 4QRJA 5HE2B 3SBRA 3SBQA 3KRXB 3HFQA 4O3UB 3EWEA 4CI3A 3AL9A 4ERQA 3IKOA 3RRMC 3DSMA 5EALA 3PVWB 3SHFA 4JD2C 4PBZA 3SVWD 4GGAA 1JMXB 5CYKB 3ULEC 1TBGA 2XU7A 3IIYA 5I5JA 3MXXA 4J78A 4J82A 2YMUA 4CY2A 4IA9A 3I7KA 1TYQC 2J55H 4PC0A 1K8KC 2UZYB 3JAMg 1P22A 3BWSA 4ZOXA 1K32A 2B5LA 3RFHA 2PM6B 4J8GA 4A0BA 3FGBA 2IUVA 4ZOZA 2H6NA 4CC9A 4A11B 5GMKn 3OL2A 3ZWLB 4FB1D 2XYIA 2I3SA 4H5JA 2CN2A 3SCYA 4CI2A 2W18A 2AH1A 4XEIC 3I7PA 2AGLA 3RLMD 4MK0B 3OKYB 2CO0A 1PBYB 3F3GA 2OJYA 4CZXA 5FKTA 4CI8A 4LGNA 4A2MA 3NVQA 3I7OA 4X61B 2CE8A 4GZ8A 2G9AA 2H68A 5IC7A 4K3JB 3JZHA 2I3TA 3DXMC 4N14A 5TF2A 4JSXC 5FLXg 1MDAH 4JSVC 4KFMB 5EMLB 5AJAA 3EU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U1E I;  4FA1 D;  2H14 A;  2GC7 A;  2P9K C;  5EAP A;  5FKR A;  2H6K A;  2HXC A;  5GXI A;  2IWK A;  2IUR A;  5TEF A;  4ZOV A;  4CY1 A;  4CY3 A;  3EI2 A;  2Z2O A;  3ORV D;  2YNO A;  2P9N C;  2OVR B;  3I2N A;  1NR0 A;  4D6V A;  3ODT A;  4GMB A;  3JZN A;  4A7J A;  4E54 B;  4LG9 A;  2P9P C;  2P9I C;  1GG2 B;  5TEE A;  3J80 g;  2OK6 A;  4BL0 A;  3UKU C;  2J56 H;  3RSE C;  1U2V C;  3EI1 A;  1JMZ B;  3L4O D;  3EI4 A;  4I79 A;  4GGC A;  2AGX A;  2CE9 A;  4O1Q D;  2AGZ A;  4A09 A;  1R5M A;  3BG1 A;  4R7A B;  1MG2 A;  1SHY B;  2H6Q A;  4A0A A;  2AQ5 A;  5CXC B;  2YNP A;  2PM9 B;  1JJU B;  3I89 A;  3L4M D;  1PEV A;  3UVO A;  1B9Y A;  3EI3 A;  2CNX A;  3C9C A;  5EM2 B;  4E5Z B;  2HJB A;  3AL8 B;  3OKW A;  1ERJ A;  5IGQ A;  5FXY A;  5IT9 g;  2P9S C;  2PM7 B;  2IUQ A;  4OZU A;  3GRE A;  4GM8 A;  4PSX B;  1JOF A;  4AEZ A;  4GQ2 P;  1Q47 A;  5CYK A;  4PSW B;  2OK4 A;  2B4E A;  3C99 A;  3UVK A;  1XIP A;  4PBY A;  3RFG A;  3V9F A;  4XYI A;  4GGD A;  2BCJ B;  4XYH A;  3JZG A;  5K1C C;  2UZX B;  3FRX A;  5EAM A;  2GC4 A;  1L0Q A;  5EMK B;  1GXR A;  3MKS B;  1XHM A;  4L1Q D;  3UKR C;  3MKQ A;  2P9L C;  3N0E A;  3JPX A;  4ZOY A;  2PBI B;  3DWL C;  4GM9 A;  3SN6 B;  4PXW A;  3J81 g;  3PXW D;  5HE1 B;  1GP2 B;  2QC5 A;  3PE7 A;  4JT6 C;  5AFU 3;  2OVP B;  4GM3 A;  4OWR A;  4J8B A;  3OKY A;  2H9L A;  5B4W A;  4YVD A;  2XL3 A;  5FKQ A;  2OVQ B;  5IJ8 E;  4CY5 A;  4ERY A;  3E0C A;  2HES X;  3MMY A;  2YBA A;  4O3T B;  4QT8 A;  2AGW A;  4J87 A;  5C9Z B;  4ERZ A;  2H47 A;  1MG3 A;  4G56 B;  5H1M A;  3W15 A;  3FM0 A;  4J0W A;  1SQ9 A;  3F3P A;  4O45 A;  3VH0 A;  4JSP C;  4PNK B;  3VA6 A;  4D0K A;  3IJ1 A;  4ZN4 A;  3V5W B;  3JB9 L;  5FA5 B;  5C2W B;  4FHL A;  4FAN D;  5A2Q g;  4QQE A;  1RI6 A;  4HDJ A;  2H9M A;  4TZ4 A;  3DM0 A;  3MZL A;  5CXB B;  5AMS A;  4GQ1 A;  1A0R B;  3EI2 B;  5JWZ A;  4A08 A;  3SXT D;  1U4C A;  3GFC A;  4E54 A;  4L3H D;  4H5I A;  3I8C A;  5GXH A;  3AFC A;  3CFS B;  5H17 A;  2CN3 A;  5HQG A;  4J73 A;  2EBS A;  1PI6 A;  3BG0 A;  4FA9 D;  1N6D A;  2HKM A;  3SFZ A;  3CFV A;  5HE3 B;  3V7D B;  4AOW A;  2IUP A;  3I8E A;  1B9X A;  2I0T A;  1YFQ A;  4A2L A;  4Y7R A;  4K3I D;  2IAA A;  4IMM A;  5CXC A;  3C75 H;  4FWW A;  3U4Y A;  3PXT D;  1N6F A;  3SMR A;  4UI9 R;  3AH8 B;  3B7F A;  2Q7Q A;  4J86 A;  3MZK A;  3K27 A;  4Z8L A;  5EM2 A;  4E5Z A;  3AL8 A;  4J79 A;  3UVN A;  3RN1 D;  1GOT B;  3OKT A;  5FKS A;  4JSN C;  2J57 G;  1VYH C;  3JRO A;  3KRW B;  3UVL A;  4J0X A;  5EMJ B;  4JXM A;  2Z2P A;  2B5M A;  4FA5 D;  3UR4 A;  5IGO A;  2AH0 A;  5SXM A;  3JRP A;  3PSL A;  3VGZ A;  4ES0 A;  5HE0 B;  4BUJ C;  2P9U C;  1SQJ A;  2MTA H;  2QXV A;  4A0B B;  4A11 A;  2O9K A;  3OL2 B;  4X3E A;  1OLZ A;  5EAR A;  2HKR A;  3P4F A;  2OIZ A;  1N6E A;  2H9N A;  4CZV A;  2H9P A;  5HYN B;  4JT5 C;  2G99 A;  1S4U X;  5H14 A;  2HJ4 A;  3I7H A;  1OMW B;  4O9D A;  4QL1 A;  3DXK C;  3UVM A;  3A0F A;  4LG8 A;  4X63 B;  2B5N A;  5I5I A;  4CZY A;  5K19 A;  5TDH B;  3SLE D;  4U7A A;  1FWX A;  3K26 A;  3PVU B;  5IJ7 E;  4L3G D;  5KDO B;  3C5M A;  4FAV D;  3RMZ D;  3I7L A;  2YNN A;  1PGU A;  5I5M A;  3SWS D;  5FQD A;  2HYE A;  2H3X A;  2XL2 A;  3NVX A;  4CI1 A;  3PSC B;  3EMH A;  4L9O A;  3IJ0 A;  2IWF A;  5GSA A;  3I7N A;  3OW8 A;  4GQB B;  4J81 A;  2I0R A;  3PXS D;  4EWR A;  1NEX B;  4FA4 D;  3SJL D;  3IIW A;  3SBP A;  5THA A;  5CXB A;  4ESG A;  2I0S A;  1QNI A;  5EMM B;  2H13 A;  2YB8 B;  4Y5R D;  3EG6 A;  4A08 B;  3RN0 D;  3NVN A;  5C2V B;  2CO0 C;  2TRC B;  3EI1 B;  3CIK B;  3F3F A;  3EI4 B;  2AGY A;  3OTT A;  2GNQ A;  4A09 B;  1XKS A;  2Z2N A;  2PM9 A;  4A0A B;  4J84 A;  4X60 B;  4BH6 A;  3N0D A;  2BBK H;  4NSX A;  3EI3 B;  3IJC A;  4J77 A;  4QRJ A;  5HE2 B;  3SBR A;  3SBQ A;  3KRX B;  3HFQ A;  4O3U B;  3EWE A;  4CI3 A;  3AL9 A;  4ERQ A;  3IKO A;  3RRM C;  3DSM A;  5EAL A;  3PVW B;  3SHF A;  4JD2 C;  4PBZ A;  3SVW D;  4GGA A;  1JMX B;  5CYK B;  3ULE C;  1TBG A;  2XU7 A;  3IIY A;  5I5J A;  3MXX A;  4J78 A;  4J82 A;  2YMU A;  4CY2 A;  4IA9 A;  3I7K A;  1TYQ C;  2J55 H;  4PC0 A;  1K8K C;  2UZY B;  3JAM g;  1P22 A;  3BWS A;  4ZOX A;  1K32 A;  2B5L A;  3RFH A;  2PM6 B;  4J8G A;  4A0B A;  3FGB A;  2IUV A;  4ZOZ A;  2H6N A;  4CC9 A;  4A11 B;  5GMK n;  3OL2 A;  3ZWL B;  4FB1 D;  2XYI A;  2I3S A;  4H5J A;  2CN2 A;  3SCY A;  4CI2 A;  2W18 A;  2AH1 A;  4XEI C;  3I7P A;  2AGL A;  3RLM D;  4MK0 B;  3OKY B;  2CO0 A;  1PBY B;  3F3G A;  2OJY A;  4CZX A;  5FKT A;  4CI8 A;  4LGN A;  4A2M A;  3NVQ A;  3I7O A;  4X61 B;  2CE8 A;  4GZ8 A;  2G9A A;  2H68 A;  5IC7 A;  4K3J B;  3JZH A;  2I3T A;  3DXM C;  4N14 A;  5TF2 A;  4JSX C;  5FLX g;  1MDA H;  4JSV C;  4KFM B;  5EML B;  5AJA A;  3EU7 A; 
#chains in the Genus database with same CATH topology
 4G55 A;  4G1M A;  4U1E I;  4FA1 D;  2H14 A;  5M5S A;  2GC7 A;  2P9K C;  5EAP A;  5FKR A;  2H6K A;  2HXC A;  3GD1 I;  5GXI A;  1H2Z A;  2IWK A;  2IUR A;  5TEF A;  4ZOV A;  4CY1 A;  4CY3 A;  4Z7O A;  3EI2 A;  3MVD K;  2Z2O A;  3ORV D;  2YNO A;  2P9N C;  4DNW A;  2OVR B;  3I2N A;  1NR0 A;  4D6V A;  3ODT A;  3OF7 A;  4GMB A;  3JZN A;  4A7J A;  4E54 B;  4LG9 A;  2P9P C;  2VZ1 A;  3IUN A;  2P9I C;  1GG2 B;  4AN1 A;  5TEE A;  1H2W A;  3J80 g;  2OK6 A;  4BL0 A;  3UKU C;  2J56 H;  3RSE C;  1U2V C;  3EI1 A;  1JMZ B;  3L4O D;  3EI4 A;  4I79 A;  4GGC A;  2AGX A;  1L5G A;  2CE9 A;  2AGZ A;  4O1Q D;  1R5M A;  4A09 A;  2VDM A;  3BG1 A;  4R7A B;  1MG2 A;  1SHY B;  2H6Q A;  4A0A A;  2AQ5 A;  5CXC B;  2YNP A;  2PM9 B;  3O4G A;  1JJU B;  3I89 A;  3IUR A;  3L4M D;  1PEV A;  3UVO A;  1B9Y A;  3EI3 A;  2CNX A;  3C9C A;  5EM2 B;  4E5Z B;  2HJB A;  3AL8 B;  3OKW A;  1ERJ A;  5IGQ A;  2XE4 A;  3IUL A;  3IUJ A;  1H2X A;  5FXY A;  5M5T A;  3IUM A;  3ZDX A;  2P9S C;  5IT9 g;  2PM7 B;  2IUQ A;  4OZU A;  3GRE A;  4GM8 A;  1U8C A;  4PSX B;  3MUO A;  1JOF A;  4AEZ A;  4GQ2 P;  1M1X A;  1Q47 A;  4WK4 A;  5CYK A;  4PSW B;  3NID A;  2OK4 A;  1E8M A;  2B4E A;  3ZE1 A;  3C99 A;  3IUQ A;  3UVK A;  1XIP A;  4PBY A;  3RFG A;  3V9F A;  1YR2 A;  4XYI A;  4GGD A;  2BCJ B;  4XYH A;  3JZG A;  1GOH A;  5K1C C;  2UZX B;  3FRX A;  5EAM A;  2GC4 A;  3FCU A;  1L0Q A;  5EMK B;  3EQ8 A;  1GXR A;  3MKS B;  1XHM A;  4L1Q D;  4JHN A;  1I2M B;  3KCI A;  3UKR C;  3MKQ A;  2P9L C;  3N0E A;  3JPX A;  4ZOY A;  2PBI B;  3DWL C;  4GM9 A;  3SN6 B;  4PXW A;  3J81 g;  3PXW D;  4JHP C;  2VDP A;  2XDW A;  5HE1 B;  1GP2 B;  2QC5 A;  3PE7 A;  4JT6 C;  5AFU 3;  3K71 A;  2OVP B;  4GM3 A;  4OWR A;  2VDL A;  4J8B A;  3OKY A;  2H9L A;  5B4W A;  4YVD A;  2XL3 A;  5FKQ A;  2OVQ B;  5IJ8 E;  4CY5 A;  3O4H A;  1K3I A;  3E0C A;  4ERY A;  2HES X;  3MMY A;  2YBA A;  4O3T B;  5M5V A;  4QT8 A;  2AGW A;  4J87 A;  5C9Z B;  2EIC A;  2H47 A;  1MG3 A;  4WJK A;  4ERZ A;  4G56 B;  3K6S A;  5H1M A;  3W15 A;  3FM0 A;  4J0W A;  1SQ9 A;  3F3P A;  4O45 A;  5FFG A;  3VH0 A;  4JSP C;  4PNK B;  3VA6 A;  3T3P A;  4D0K A;  3IJ1 A;  4ZN4 A;  3V5W B;  3JB9 L;  4WK0 A;  3V4V A;  5FA5 B;  3VI4 A;  5C2W B;  5E6U A;  4FHL A;  4NC4 A;  4FAN D;  5A2Q g;  4QQE A;  3MUN A;  1RI6 A;  1VZ3 A;  4HDJ A;  2H9M A;  4TZ4 A;  3DM0 A;  3MZL A;  5CXB B;  5AMS A;  4GQ1 A;  1A0R B;  3EI2 B;  5JWZ A;  1C9I A;  2HU8 A;  4A08 A;  4NEN A;  3SXT D;  1U4C A;  2JKX A;  3GFC A;  4E54 A;  4L3H D;  1O6G A;  4H5I A;  3I8C A;  4BCB A;  3AFC A;  3CFS B;  5H17 A;  5GXH A;  1VE7 A;  2CN3 A;  5HQG A;  4J73 A;  1O6F A;  2EBS A;  5C92 A;  1PI6 A;  3BG0 A;  4FA9 D;  1N6D A;  5FFO A;  2HKM A;  3QI0 A;  4DNV A;  3SFZ A;  3CFV A;  5HE3 B;  3V7D B;  4AOW A;  2IUP A;  3I8E A;  1B9X A;  2I0T A;  1YFQ A;  1JV2 A;  4A2L A;  4Y7R A;  4K3I D;  2VZ3 A;  2IAA A;  4IMM A;  5CXC A;  3C75 H;  4FWW A;  4IRZ A;  4MMY A;  3PXT D;  3U4Y A;  1N6F A;  1E5T A;  3SMR A;  4UI9 R;  3AH8 B;  3B7F A;  2Q7Q A;  4J86 A;  3MZK A;  1VZ2 A;  3K27 A;  3VI3 A;  4Z8L A;  5EM2 A;  4E5Z A;  3AL8 A;  4J79 A;  1UOQ A;  3UVN A;  3RN1 D;  1GOT B;  3OKT A;  4RE5 A;  5M61 A;  5FKS A;  4JSN C;  2J57 G;  4BCD A;  3T3M A;  1VYH C;  3JRO A;  3KRW B;  3UVL A;  2EID A;  4J0X A;  2VDQ A;  1A12 A;  5EMJ B;  3V4P A;  1JTD B;  4JXM A;  1QFS A;  2Z2P A;  2B5M A;  4FA5 D;  3K72 A;  3UR4 A;  5IGO A;  2AH0 A;  5SXM A;  3JRP A;  3PSL A;  3VGZ A;  4L1M A;  4ES0 A;  5HE0 B;  4BUJ C;  2P9U C;  1SQJ A;  2MTA H;  2QXV A;  4A0B B;  4MMZ A;  4A11 A;  3NIF A;  5M5R A;  2O9K A;  3OL2 B;  4X3E A;  1OLZ A;  5EAR A;  2HKR A;  3P4F A;  2OIZ A;  1N6E A;  2H9N A;  4CZV A;  2H9P A;  5HYN B;  4JT5 C;  2G99 A;  1S4U X;  1TYE A;  5H14 A;  2HJ4 A;  3I7H A;  1OMW B;  4O9D A;  4QL1 A;  3DXK C;  3UVM A;  3A0F A;  4LG8 A;  2QR5 A;  4X63 B;  5C86 A;  2B5N A;  5I5I A;  4CZY A;  3IJE A;  5K19 A;  3NIG A;  1VE6 A;  5TDH B;  3SLE D;  2VDN A;  4U7A A;  1FWX A;  3K26 A;  3PVU B;  5IJ7 E;  4L3G D;  5KDO B;  3C5M A;  4FAV D;  3RMZ D;  4AN0 A;  3I7L A;  2VDR A;  2YNN A;  1PGU A;  4UM8 A;  5I5M A;  3SWS D;  5FQD A;  2HYE A;  2VDK A;  2H3X A;  2XL2 A;  3NVX A;  2VDO A;  3PSC B;  4CI1 A;  3EMH A;  4L9O A;  3IJ0 A;  2IWF A;  2VC2 A;  5GSA A;  4AMZ A;  3I7N A;  3OW8 A;  4GQB B;  4QAM A;  2HU7 A;  4J81 A;  2I0R A;  3EQ7 A;  3PXS D;  4EWR A;  1NEX B;  4FA4 D;  3SJL D;  4BP8 A;  3IIW A;  4AX4 A;  3SBP A;  5THA A;  5CXB A;  4ESG A;  2I0S A;  1QNI A;  3ZE0 A;  5E6R A;  5EMM B;  2H13 A;  2YB8 B;  4Y5R D;  3EG6 A;  4A08 B;  3RN0 D;  3FCS A;  3NVN A;  5C2V B;  2CO0 C;  2TRC B;  1T2X A;  3EI1 B;  3CIK B;  5M5U A;  3F3F A;  1UOP A;  2AGY A;  3EI4 B;  1UOO A;  3OTT A;  2GNQ A;  4A09 B;  1XKS A;  3GC3 B;  2Z2N A;  1E8N A;  4WK2 A;  2PM9 A;  4A0A B;  2QZP A;  4J84 A;  4X60 B;  4BH6 A;  3N0D A;  2BBK H;  4NSX A;  3EI3 B;  3IJC A;  4J77 A;  3O4J A;  4QRJ A;  5HE2 B;  3SBR A;  3SBQ A;  3KRX B;  3HFQ A;  4O3U B;  5HDB A;  3IVM A;  3EWE A;  4CI3 A;  3AL9 A;  4ERQ A;  4AMY A;  3IKO A;  3ZDZ A;  1UTC A;  3EQ9 A;  3RRM C;  3DSM A;  5EAL A;  3PVW B;  3SHF A;  4JD2 C;  4PBZ A;  4Z7N A;  3SVW D;  4GGA A;  1JMX B;  4O2W A;  5CYK B;  3ULE C;  3ZDY A;  1TBG A;  2XU7 A;  3IIY A;  5I5J A;  3MXX A;  4J78 A;  4J82 A;  2WQ8 A;  2YMU A;  4BP9 A;  4IA9 A;  4CY2 A;  3I7K A;  1TYQ C;  2J55 H;  3ZE2 A;  4PC0 A;  1K8K C;  2UZY B;  2EIE A;  3JAM g;  1GOF A;  1P22 A;  3BWS A;  2HU5 A;  4ZOX A;  1K32 A;  2B5L A;  1H2Y A;  4MMX A;  3RFH A;  2PM6 B;  1BPO A;  4RE6 A;  4J8G A;  4NAA A;  4A0B A;  3FGB A;  2IUV A;  4ZOZ A;  1C9L A;  2H6N A;  5AJA A;  4CC9 A;  4A11 B;  4DNU A;  5GMK n;  3OL2 A;  3ZWL B;  4FB1 D;  2XYI A;  4G1E A;  2I3S A;  4H5J A;  2CN2 A;  3SCY A;  4Z7Q A;  4CI2 A;  2W18 A;  2AH1 A;  4XEI C;  3I7P A;  2AGL A;  3RLM D;  4MK0 B;  3OKY B;  2CO0 A;  1PBY B;  3F3G A;  5E6S A;  2OJY A;  4CZX A;  3DDU A;  5FKT A;  4CI8 A;  4BCC A;  4LGN A;  4UM9 A;  4A2M A;  3NVQ A;  3I7O A;  4X61 B;  2CE8 A;  3O4I A;  4GZ8 A;  2G9A A;  2H68 A;  5IC7 A;  1GOG A;  2EIB A;  2BKL A;  4K3J B;  3JZH A;  2XZG A;  2I3T A;  3DXM C;  4N14 A;  5TF2 A;  4JSX C;  5FLX g;  4D9S A;  3QHY B;  4NBM A;  1MDA H;  4O02 A;  4JSV C;  4KFM B;  5EML B;  1QFM A;  3EU7 A; 
#chains in the Genus database with same CATH homology
 4U1E I;  4FA1 D;  2H14 A;  2GC7 A;  2P9K C;  5EAP A;  5FKR A;  2H6K A;  2HXC A;  5GXI A;  2IWK A;  2IUR A;  5TEF A;  4ZOV A;  4CY1 A;  4CY3 A;  3EI2 A;  2Z2O A;  3ORV D;  2YNO A;  2P9N C;  2OVR B;  3I2N A;  1NR0 A;  4D6V A;  3ODT A;  4GMB A;  3JZN A;  4A7J A;  4E54 B;  4LG9 A;  2P9P C;  2P9I C;  1GG2 B;  5TEE A;  3J80 g;  2OK6 A;  4BL0 A;  3UKU C;  2J56 H;  3RSE C;  1U2V C;  3EI1 A;  1JMZ B;  3L4O D;  3EI4 A;  4I79 A;  4GGC A;  2AGX A;  2CE9 A;  4O1Q D;  2AGZ A;  4A09 A;  1R5M A;  3BG1 A;  4R7A B;  1MG2 A;  1SHY B;  2H6Q A;  4A0A A;  2AQ5 A;  5CXC B;  2YNP A;  2PM9 B;  1JJU B;  3I89 A;  3L4M D;  1PEV A;  3UVO A;  1B9Y A;  3EI3 A;  2CNX A;  3C9C A;  5EM2 B;  4E5Z B;  2HJB A;  3AL8 B;  3OKW A;  1ERJ A;  5IGQ A;  5FXY A;  5IT9 g;  2P9S C;  2PM7 B;  2IUQ A;  4OZU A;  3GRE A;  4GM8 A;  4PSX B;  1JOF A;  4AEZ A;  4GQ2 P;  1Q47 A;  5CYK A;  4PSW B;  2OK4 A;  2B4E A;  3C99 A;  3UVK A;  1XIP A;  4PBY A;  3RFG A;  3V9F A;  4XYI A;  4GGD A;  2BCJ B;  4XYH A;  3JZG A;  5K1C C;  2UZX B;  3FRX A;  5EAM A;  2GC4 A;  1L0Q A;  5EMK B;  1GXR A;  3MKS B;  1XHM A;  4L1Q D;  3UKR C;  3MKQ A;  2P9L C;  3N0E A;  3JPX A;  4ZOY A;  2PBI B;  3DWL C;  4GM9 A;  3SN6 B;  4PXW A;  3J81 g;  3PXW D;  5HE1 B;  1GP2 B;  2QC5 A;  3PE7 A;  4JT6 C;  5AFU 3;  2OVP B;  4GM3 A;  4OWR A;  4J8B A;  3OKY A;  2H9L A;  5B4W A;  4YVD A;  2XL3 A;  5FKQ A;  2OVQ B;  5IJ8 E;  4CY5 A;  4ERY A;  3E0C A;  2HES X;  3MMY A;  2YBA A;  4O3T B;  4QT8 A;  2AGW A;  4J87 A;  5C9Z B;  4ERZ A;  2H47 A;  1MG3 A;  4G56 B;  5H1M A;  3W15 A;  3FM0 A;  4J0W A;  1SQ9 A;  3F3P A;  4O45 A;  3VH0 A;  4JSP C;  4PNK B;  3VA6 A;  4D0K A;  3IJ1 A;  4ZN4 A;  3V5W B;  3JB9 L;  5FA5 B;  5C2W B;  4FHL A;  4FAN D;  5A2Q g;  4QQE A;  1RI6 A;  4HDJ A;  2H9M A;  4TZ4 A;  3DM0 A;  3MZL A;  5CXB B;  5AMS A;  4GQ1 A;  1A0R B;  3EI2 B;  5JWZ A;  4A08 A;  3SXT D;  1U4C A;  3GFC A;  4E54 A;  4L3H D;  4H5I A;  3I8C A;  5GXH A;  3AFC A;  3CFS B;  5H17 A;  2CN3 A;  5HQG A;  4J73 A;  2EBS A;  1PI6 A;  3BG0 A;  4FA9 D;  1N6D A;  2HKM A;  3SFZ A;  3CFV A;  5HE3 B;  3V7D B;  4AOW A;  2IUP A;  3I8E A;  1B9X A;  2I0T A;  1YFQ A;  4A2L A;  4Y7R A;  4K3I D;  2IAA A;  4IMM A;  5CXC A;  3C75 H;  4FWW A;  3U4Y A;  3PXT D;  1N6F A;  3SMR A;  4UI9 R;  3AH8 B;  3B7F A;  2Q7Q A;  4J86 A;  3MZK A;  3K27 A;  4Z8L A;  5EM2 A;  4E5Z A;  3AL8 A;  4J79 A;  3UVN A;  3RN1 D;  1GOT B;  3OKT A;  5FKS A;  4JSN C;  2J57 G;  1VYH C;  3JRO A;  3KRW B;  3UVL A;  4J0X A;  5EMJ B;  4JXM A;  2Z2P A;  2B5M A;  4FA5 D;  3UR4 A;  5IGO A;  2AH0 A;  5SXM A;  3JRP A;  3PSL A;  3VGZ A;  4ES0 A;  5HE0 B;  4BUJ C;  2P9U C;  1SQJ A;  2MTA H;  2QXV A;  4A0B B;  4A11 A;  2O9K A;  3OL2 B;  4X3E A;  1OLZ A;  5EAR A;  2HKR A;  3P4F A;  2OIZ A;  1N6E A;  2H9N A;  4CZV A;  2H9P A;  5HYN B;  4JT5 C;  2G99 A;  1S4U X;  5H14 A;  2HJ4 A;  3I7H A;  1OMW B;  4O9D A;  4QL1 A;  3DXK C;  3UVM A;  3A0F A;  4LG8 A;  4X63 B;  2B5N A;  5I5I A;  4CZY A;  5K19 A;  5TDH B;  3SLE D;  4U7A A;  1FWX A;  3K26 A;  3PVU B;  5IJ7 E;  4L3G D;  5KDO B;  3C5M A;  4FAV D;  3RMZ D;  3I7L A;  2YNN A;  1PGU A;  5I5M A;  3SWS D;  5FQD A;  2HYE A;  2H3X A;  2XL2 A;  3NVX A;  4CI1 A;  3PSC B;  3EMH A;  4L9O A;  3IJ0 A;  2IWF A;  5GSA A;  3I7N A;  3OW8 A;  4GQB B;  4J81 A;  2I0R A;  3PXS D;  4EWR A;  1NEX B;  4FA4 D;  3SJL D;  3IIW A;  3SBP A;  5THA A;  5CXB A;  4ESG A;  2I0S A;  1QNI A;  5EMM B;  2H13 A;  2YB8 B;  4Y5R D;  3EG6 A;  4A08 B;  3RN0 D;  3NVN A;  5C2V B;  2CO0 C;  2TRC B;  3EI1 B;  3CIK B;  3F3F A;  3EI4 B;  2AGY A;  3OTT A;  2GNQ A;  4A09 B;  1XKS A;  2Z2N A;  2PM9 A;  4A0A B;  4J84 A;  4X60 B;  4BH6 A;  3N0D A;  2BBK H;  4NSX A;  3EI3 B;  3IJC A;  4J77 A;  4QRJ A;  5HE2 B;  3SBR A;  3SBQ A;  3KRX B;  3HFQ A;  4O3U B;  3EWE A;  4CI3 A;  3AL9 A;  4ERQ A;  3IKO A;  3RRM C;  3DSM A;  5EAL A;  3PVW B;  3SHF A;  4JD2 C;  4PBZ A;  3SVW D;  4GGA A;  1JMX B;  5CYK B;  3ULE C;  1TBG A;  2XU7 A;  3IIY A;  5I5J A;  3MXX A;  4J78 A;  4J82 A;  2YMU A;  4CY2 A;  4IA9 A;  3I7K A;  1TYQ C;  2J55 H;  4PC0 A;  1K8K C;  2UZY B;  3JAM g;  1P22 A;  3BWS A;  4ZOX A;  1K32 A;  2B5L A;  3RFH A;  2PM6 B;  4J8G A;  4A0B A;  3FGB A;  2IUV A;  4ZOZ A;  2H6N A;  4CC9 A;  4A11 B;  5GMK n;  3OL2 A;  3ZWL B;  4FB1 D;  2XYI A;  2I3S A;  4H5J A;  2CN2 A;  3SCY A;  4CI2 A;  2W18 A;  2AH1 A;  4XEI C;  3I7P A;  2AGL A;  3RLM D;  4MK0 B;  3OKY B;  2CO0 A;  1PBY B;  3F3G A;  2OJY A;  4CZX A;  5FKT A;  4CI8 A;  4LGN A;  4A2M A;  3NVQ A;  3I7O A;  4X61 B;  2CE8 A;  4GZ8 A;  2G9A A;  2H68 A;  5IC7 A;  4K3J B;  3JZH A;  2I3T A;  3DXM C;  4N14 A;  5TF2 A;  4JSX C;  5FLX g;  1MDA H;  4JSV C;  4KFM B;  5EML B;  5AJA A;  3EU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...