3FM0A

Crystal structure of wd40 protein ciao1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
332
structure length
328
Chain Sequence
SLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Protein CIAO1
publication title Structure and function of WD40 domain proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 328
sequence length 332
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3fm0A00
1JJUB 3V7DB 1ERJA 2GC4A 3EI3A 4R7AB 4BL0A 2AGXA 1PEVA 4A0BA 4O45A 3W15A 5FA5B 1Q47A 4PNKB 1S4UX 3IJ1A 3OL2A 2XL2A 5EM2A 4KFMB 4A08A 2H9PA 1MG3A 5C2WB 4OWRA 3RLMD 3DSMA 5HQGA 5FQDA 4XYHA 5FXYA 4N14A 2UZXB 3PSLA 2YNOA 4YVDA 3IKOA 4GQBB 2I0TA 4QT8A 4OZUA 5EMMB 3UVNA 5AMSA 3PSCB 4GMBA 2BBKH 2P9UC 3OTTA 3C5MA 2PM9B 4GM8A 3JZGA 3EI4A 5HE3B 2B5NA 2IUQA 4H5JA 4UI9R 1MDAH 3JB9L 1TYQC 3EI1A 5EMJB 1XHMA 1P22A 3U4YA 4A7JA 2HJ4A 3SHFA 3F3GA 3I7NA 3BWSA 5EALA 5FKRA 3KRXB 2PM6B 1XKSA 4QQEA 2H9MA 4AOWA 2AGZA 2CNXA 1N6FA 2OIZA 4AEZA 4JSPC 4GQ1A 3PE7A 4ZOVA 5FKSA 3RFGA 4TZ4A 4ZOYA 4BUJC 4GGCA 1N6EA 3GFCA 5HYNB 4EWRA 2XL3A 1PBYB 3F3FA 2H6NA 3KRWB 5FLXg 3SN6B 2AGYA 2I0RA 2YNNA 4PSWB 3I8CA 4G56B 3MXXA 1GOTB 2P9IC 2H3XA 2OVPB 2CO0C 1YFQA 1U2VC 5H17A 3HFQA 4PSXB 2TRCB 4J0XA 1TBGA 1OLZA 4IA9A 4A0AB 4CI2A 3UVKA 3ZWLB 1MG2A 2CN2A 2UZYB 3SBQA 4ZN4A 2CO0A 5IGQA 2H14A 3MMYA 3EI2B 1A0RB 3C75H 3MZLA 2H6KA 3I8EA 4XEIC 2CN3A 3RSEC 4GGAA 2Q7QA 2YNPA 3SMRA 3NVNA 1B9XA 2O9KA 1GP2B 4CY2A 4ERYA 4A09A 3UKRC 4JSXC 4ZOZA 3SWSD 5AFU3 2AH0A 2HJBA 5IC7A 3OW8A 2CE8A 5IJ7E 3EWEA 5CXBA 2I3SA 4MK0B 4PC0A 5C2VB 3IJ0A 1PI6A 5CXCB 1NR0A 4I79A 4GM9A 4X3EA 5TEEA 4J73A 3OKYB 2HESX 4X60B 3EMHA 2IURA 2P9KC 2PBIB 2IUVA 1B9YA 2OK6A 2YB8B 3SCYA 2H13A 3DXMC 3AL9A 4L3GD 3I89A 3V5WB 3CIKB 4LG9A 3AFCA 3UVMA 4E5ZA 3UR4A 4K3JB 5TEFA 3J80g 4L1QD 2BCJB 2QXVA 4J86A 4J8BA 3IJCA 4J78A 1JOFA 2G99A 3MZKA 1JMZB 5CYKB 5EMLB 4E54B 4A11A 3UVOA 3CFVA 1XIPA 4A0AA 2HKRA 5FKTA 2AH1A 5GMKn 1VYHC 3UKUC 4A0BB 2H68A 3FRXA 5B4WA 4FA4D 5GXHA 3OL2B 4A08B 3C99A 1K32A 3AL8A 4NSXA 2H6QA 2MTAH 2CE9A 5EAMA 3JPXA 4Z8LA 3K27A 4U1EI 3DWLC 2PM7B 4HDJA 3AH8B 4JT6C 4XYIA 1QNIA 3L4OD 3NVXA 4CY5A 4CY3A 3I2NA 3UVLA 1JMXB 4JSNC 4IMMA 3J81g 4GM3A 1GG2B 3VGZA 3PXSD 2IAAA 3N0EA 5H14A 5SXMA 4J8GA 3I7KA 4CZVA 5GSAA 2YBAA 3A0FA 3EI4B 4J77A 5TDHB 2P9LC 3VA6A 3ORVD 4LGNA 3SBRA 5HE1B 4JT5C 5KDOB 4QL1A 1SHYB 2YMUA 2IUPA 2AGWA 4J79A 4J82A 3I7HA 4FA1D 3IIWA 4FA5D 2PM9A 3I7PA 5IGOA 3V9FA 3P4FA 4JSVC 4FB1D 2W18A 4PXWA 4X63B 3RN1D 3SLED 3EU7A 2OVRB 4Y5RD 3MKSB 2H47A 5HE2B 4D6VA 2B4EA 3C9CA 3PVWB 1FWXA 2OVQB 5THAA 3I7OA 2GNQA 1U4CA 3RRMC 4A2LA 5I5JA 4O3UB 2AGLA 3NVQA 2IWKA 5EARA 3SFZA 3K26A 3SBPA 5H1MA 4X61B 3JZHA 4J87A 3BG1A 4J0WA 5HE0B 3N0DA 3GREA 2Z2OA 5I5MA 4ZOXA 4L3HD 4Y7RA 3EG6A 4D0KA 2GC7A 3CFSB 3OKTA 2Z2NA 4GQ2P 2AQ5A 2B5MA 5TF2A 3B7FA 2XU7A 3EI3B 3SVWD 4O3TB 4FWWA 3PXWD 4K3ID 2HKMA 1N6DA 5IT9g 4A09B 5EM2B 4JD2C 2OJYA 3EI2A 4JXMA 3DXKC 4CI3A 1GXRA 3PVUB 5AJAA 5CXBB 4ERQA 3OKWA 4QRJA 3VH0A 3PXTD 3SXTD 3RMZD 2G9AA 4PBYA 2J55H 3MKQA 2XYIA 4CI1A 3RN0D 1SQJA 3JZNA 3JROA 2H9NA 2EBSA 4H5IA 4O1QD 5GXIA 4CZYA 4BH6A 1R5MA 2QC5A 4GZ8A 4U7AA 4CC9A 2P9NC 4O9DA 5C9ZB 4CY1A 3SJLD 3BG0A 5CXCA 4E5ZB 2H9LA 4FAVD 1L0QA 3EI1B 2B5LA 1PGUA 5IJ8E 5FKQA 4J84A 2P9PC 3OKYA 3ULEC 5I5IA 2HYEA 1OMWB 4ERZA 2IWFA 4A11B 3IIYA 3L4MD 4CI8A 3E0CA 2J57G 4LG8A 2OK4A 3ODTA 4GGDA 4L9OA 2I3TA 4PBZA 3I7LA 5EMKB 5A2Qg 2J56H 2HXCA 4CZXA 1RI6A 4FAND 3DM0A 4A2MA 2I0SA 4ES0A 3F3PA 3FM0A 2Z2PA 5K1CC 1K8KC 2P9SC 4J81A 3JAMg 3AL8B 5EAPA 3JRPA 5CYKA 3FGBA 5JWZA 4E54A 4FA9D 4FHLA 1SQ9A 1NEXB 3RFHA 5K19A 4ESGA
chains in the Genus database with same CATH superfamily
1JJUB 3V7DB 1ERJA 2GC4A 3EI3A 4DNVA 4R7AB 4BL0A 2AGXA 1PEVA 4A0BA 4O45A 3W15A 5FA5B 1Q47A 4PNKB 1S4UX 4D9SA 3IJ1A 3OL2A 2XL2A 5EM2A 4KFMB 4A08A 2H9PA 1MG3A 5E6UA 5C2WB 4OWRA 3RLMD 3ZDXA 3DSMA 5HQGA 5FQDA 4NENA 3IJEA 2VDKA 4XYHA 5FXYA 4N14A 2UZXB 3PSLA 2YNOA 4YVDA 3IKOA 4GQBB 2I0TA 4QT8A 3MVDK 4OZUA 5EMMB 3UVNA 5AMSA 3PSCB 5M61A 4GMBA 2BBKH 2P9UC 3GD1I 3OTTA 3C5MA 2PM9B 4GM8A 3JZGA 4NBMA 3EI4A 5HE3B 2B5NA 2IUQA 4H5JA 4UI9R 1MDAH 3JB9L 1TYQC 2VDRA 3EI1A 5EMJB 1XHMA 1P22A 3U4YA 4A7JA 2VC2A 4WK4A 2HJ4A 3SHFA 3F3GA 3I7NA 4BCBA 3DDUA 3K6SA 3BWSA 5EALA 3IURA 5FKRA 4RE5A 3KRXB 2PM6B 1XKSA 1C9IA 4QQEA 2H9MA 5FFGA 1M1XA 4AOWA 2AGZA 2CNXA 1N6FA 3ZE2A 2OIZA 4AEZA 1T2XA 4JSPC 4GQ1A 3PE7A 4ZOVA 5FKSA 3RFGA 4TZ4A 4ZOYA 4BUJC 4GGCA 3O4GA 1N6EA 3GFCA 5HYNB 4EWRA 2XL3A 1PBYB 3F3FA 2H6NA 3KRWB 5FLXg 4QAMA 2EIEA 1JV2A 3SN6B 2AGYA 2I0RA 2YNNA 4Z7OA 4PSWB 3I8CA 4G56B 3NIDA 1I2MB 3MXXA 1GOTB 2P9IC 1UOQA 2H3XA 2OVPB 2CO0C 1YFQA 1C9LA 1U2VC 5H17A 4Z7QA 3HFQA 2XZGA 4PSXB 2TRCB 3ZE0A 4J0XA 1TBGA 1OLZA 4IA9A 4A0AB 4CI2A 1H2WA 3UVKA 3ZWLB 2VDLA 1MG2A 4MMZA 2CN2A 2UZYB 3SBQA 4ZN4A 2CO0A 3FCSA 5IGQA 2H14A 3MMYA 2XE4A 3IUMA 3EI2B 5C92A 4BP9A 1A0RB 3C75H 3MZLA 2H6KA 3I8EA 4XEIC 2CN3A 3RSEC 4GGAA 2Q7QA 1VE6A 2HU7A 1QFSA 2YNPA 4NC4A 2JKXA 3SMRA 3NVNA 1B9XA 2O9KA 1GP2B 4RE6A 4CY2A 4WK2A 4ERYA 4A09A 3UKRC 4JSXC 4ZOZA 3SWSD 5AFU3 5M5UA 3MUOA 4G55A 2AH0A 2HJBA 5IC7A 3OW8A 2CE8A 5IJ7E 3EQ8A 3EWEA 4WJKA 2I3SA 5CXBA 4MK0B 4PC0A 5C2VB 3IJ0A 4JHNA 1PI6A 5CXCB 1NR0A 4I79A 3ZDZA 4GM9A 2BKLA 4X3EA 4AN0A 5TEEA 3KCIA 4J73A 3OKYB 2HESX 4X60B 3EMHA 2IURA 2P9KC 2PBIB 2IUVA 1B9YA 2OK6A 2YB8B 3SCYA 2H13A 4AMYA 3DXMC 3AL9A 4L3GD 3I89A 3K71A 3V5WB 3CIKB 1UOOA 4LG9A 3AFCA 3UVMA 3IUJA 4MMXA 4E5ZA 3UR4A 4K3JB 3IUQA 5TEFA 3J80g 4L1QD 2BCJB 2QXVA 4J86A 4J8BA 3IJCA 3V4VA 4J78A 1JOFA 2G99A 3MZKA 1JMZB 5CYKB 5EMLB 4E54B 4A11A 3UVOA 3CFVA 1XIPA 4A0AA 2HKRA 5FKTA 2VDNA 3O4JA 2VZ3A 2AH1A 5GMKn 1VYHC 3UKUC 4A0BB 2H68A 3FRXA 5B4WA 3T3MA 4FA4D 5GXHA 3OL2B 4A08B 3C99A 1K32A 4JHPC 3AL8A 4NSXA 4UM9A 1E5TA 1O6GA 2H6QA 2MTAH 2CE9A 5EAMA 4DNWA 3JPXA 3IULA 4Z8LA 3K27A 4U1EI 4AMZA 3DWLC 2PM7B 4HDJA 3AH8B 4JT6C 4XYIA 1QNIA 3L4OD 3NVXA 1O6FA 1K3IA 4CY5A 1E8NA 2XDWA 4CY3A 3I2NA 3UVLA 1JMXB 4JSNC 1VZ2A 4IMMA 3J81g 4GM3A 1GG2B 1H2YA 1L5GA 3VGZA 3PXSD 2IAAA 3N0EA 5H14A 3V4PA 5SXMA 4J8GA 2HU5A 4AX4A 3I7KA 4CZVA 2VDPA 5GSAA 2YBAA 3A0FA 3EI4B 4J77A 5TDHB 2P9LC 3VA6A 4L1MA 3IUNA 3ORVD 3K72A 4LGNA 3SBRA 5HE1B 4Z7NA 4JT5C 5KDOB 4QL1A 1SHYB 3VI4A 2YMUA 1QFMA 2IUPA 2AGWA 4J79A 4J82A 3I7HA 4AN1A 3QHYB 4FA1D 3IIWA 1VE7A 4FA5D 2PM9A 3I7PA 5IGOA 3V9FA 3P4FA 2EICA 4JSVC 2W18A 4FB1D 4PXWA 2EIBA 3FCUA 4X63B 3QI0A 3RN1D 3SLED 5HDBA 3EU7A 2OVRB 4Y5RD 3MKSB 2H47A 5HE2B 4D6VA 1H2XA 2B4EA 3C9CA 3PVWB 1FWXA 1A12A 2OVQB 5E6SA 5THAA 1E8MA 2VDOA 3I7OA 2GNQA 1U4CA 3RRMC 4WK0A 5I5JA 4A2LA 4O3UB 4UM8A 2AGLA 3NVQA 2QZPA 2IWKA 5EARA 3MUNA 3SFZA 3K26A 3SBPA 5H1MA 4X61B 3JZHA 4J87A 3BG1A 1VZ3A 4J0WA 5HE0B 3GC3B 3N0DA 3GREA 4NAAA 2Z2OA 3O4HA 5I5MA 4ZOXA 1U8CA 4L3HD 3O4IA 2HU8A 4Y7RA 3EG6A 5M5RA 4D0KA 2GC7A 1GOHA 3CFSB 3OKTA 2Z2NA 4GQ2P 2AQ5A 5C86A 4G1EA 2B5MA 2EIDA 5TF2A 3B7FA 2XU7A 4BCDA 3EI3B 3SVWD 4BP8A 1JTDB 4O3TB 4FWWA 3PXWD 4K3ID 1GOGA 2HKMA 1N6DA 5IT9g 4A09B 5EM2B 4JD2C 2OJYA 3EI2A 4JXMA 3DXKC 4CI3A 3ZDYA 1GXRA 3PVUB 5AJAA 1UTCA 5CXBB 4ERQA 3OKWA 4O2WA 4BCCA 3EQ7A 4QRJA 3VH0A 3PXTD 3SXTD 3RMZD 1H2ZA 2G9AA 2J55H 4PBYA 3MKQA 2XYIA 4CI1A 3RN0D 5M5VA 1SQJA 3JZNA 3JROA 4MMYA 2H9NA 3NIGA 2EBSA 3ZE1A 5FFOA 4H5IA 4O1QD 3IVMA 5GXIA 4IRZA 4CZYA 4BH6A 1R5MA 2QC5A 2VZ1A 4GZ8A 4U7AA 4CC9A 1GOFA 2P9NC 4O9DA 5C9ZB 4CY1A 3SJLD 3BG0A 5CXCA 4DNUA 4E5ZB 1TYEA 2H9LA 3T3PA 4FAVD 1L0QA 2WQ8A 3EI1B 2B5LA 2QR5A 1PGUA 5IJ8E 5FKQA 3EQ9A 4J84A 2P9PC 3OKYA 1BPOA 1UOPA 3ULEC 5I5IA 2HYEA 1OMWB 4G1MA 4ERZA 3NIFA 3VI3A 2IWFA 4A11B 3IIYA 3L4MD 4CI8A 3E0CA 2J57G 4LG8A 2OK4A 3ODTA 4GGDA 4L9OA 2I3TA 4PBZA 3I7LA 5E6RA 5EMKB 5A2Qg 2J56H 2HXCA 3OF7A 1RI6A 4CZXA 4FAND 3DM0A 4A2MA 2I0SA 4ES0A 2VDQA 3F3PA 5M5TA 3FM0A 2Z2PA 5K1CC 1K8KC 1YR2A 2P9SC 4J81A 3JAMg 5M5SA 3AL8B 5EAPA 3JRPA 5CYKA 3FGBA 5JWZA 4E54A 4FA9D 4FHLA 4O02A 1SQ9A 1NEXB 3RFHA 5K19A 2VDMA 4ESGA
chains in the Genus database with same CATH topology
1JJUB 3V7DB 1ERJA 2GC4A 3EI3A 4R7AB 4BL0A 2AGXA 1PEVA 4A0BA 4O45A 3W15A 5FA5B 1Q47A 4PNKB 1S4UX 3IJ1A 3OL2A 2XL2A 5EM2A 4KFMB 4A08A 2H9PA 1MG3A 5C2WB 4OWRA 3RLMD 3DSMA 5HQGA 5FQDA 4XYHA 5FXYA 4N14A 2UZXB 3PSLA 2YNOA 4YVDA 3IKOA 4GQBB 2I0TA 4QT8A 4OZUA 5EMMB 3UVNA 5AMSA 3PSCB 4GMBA 2BBKH 2P9UC 3OTTA 3C5MA 2PM9B 4GM8A 3JZGA 3EI4A 5HE3B 2B5NA 2IUQA 4H5JA 4UI9R 1MDAH 3JB9L 1TYQC 3EI1A 5EMJB 1XHMA 1P22A 3U4YA 4A7JA 2HJ4A 3SHFA 3F3GA 3I7NA 3BWSA 5EALA 5FKRA 3KRXB 2PM6B 1XKSA 4QQEA 2H9MA 4AOWA 2AGZA 2CNXA 1N6FA 2OIZA 4AEZA 4JSPC 4GQ1A 3PE7A 4ZOVA 5FKSA 3RFGA 4TZ4A 4ZOYA 4BUJC 4GGCA 1N6EA 3GFCA 5HYNB 4EWRA 2XL3A 1PBYB 3F3FA 2H6NA 3KRWB 5FLXg 3SN6B 2AGYA 2I0RA 2YNNA 4PSWB 3I8CA 4G56B 3MXXA 1GOTB 2P9IC 2H3XA 2OVPB 2CO0C 1YFQA 1U2VC 5H17A 3HFQA 4PSXB 2TRCB 4J0XA 1TBGA 1OLZA 4IA9A 4A0AB 4CI2A 3UVKA 3ZWLB 1MG2A 2CN2A 2UZYB 3SBQA 4ZN4A 2CO0A 5IGQA 2H14A 3MMYA 3EI2B 1A0RB 3C75H 3MZLA 2H6KA 3I8EA 4XEIC 2CN3A 3RSEC 4GGAA 2Q7QA 2YNPA 3SMRA 3NVNA 1B9XA 2O9KA 1GP2B 4CY2A 4ERYA 4A09A 3UKRC 4JSXC 4ZOZA 3SWSD 5AFU3 2AH0A 2HJBA 5IC7A 3OW8A 2CE8A 5IJ7E 3EWEA 5CXBA 2I3SA 4MK0B 4PC0A 5C2VB 3IJ0A 1PI6A 5CXCB 1NR0A 4I79A 4GM9A 4X3EA 5TEEA 4J73A 3OKYB 2HESX 4X60B 3EMHA 2IURA 2P9KC 2PBIB 2IUVA 1B9YA 2OK6A 2YB8B 3SCYA 2H13A 3DXMC 3AL9A 4L3GD 3I89A 3V5WB 3CIKB 4LG9A 3AFCA 3UVMA 4E5ZA 3UR4A 4K3JB 5TEFA 3J80g 4L1QD 2BCJB 2QXVA 4J86A 4J8BA 3IJCA 4J78A 1JOFA 2G99A 3MZKA 1JMZB 5CYKB 5EMLB 4E54B 4A11A 3UVOA 3CFVA 1XIPA 4A0AA 2HKRA 5FKTA 2AH1A 5GMKn 1VYHC 3UKUC 4A0BB 2H68A 3FRXA 5B4WA 4FA4D 5GXHA 3OL2B 4A08B 3C99A 1K32A 3AL8A 4NSXA 2H6QA 2MTAH 2CE9A 5EAMA 3JPXA 4Z8LA 3K27A 4U1EI 3DWLC 2PM7B 4HDJA 3AH8B 4JT6C 4XYIA 1QNIA 3L4OD 3NVXA 4CY5A 4CY3A 3I2NA 3UVLA 1JMXB 4JSNC 4IMMA 3J81g 4GM3A 1GG2B 3VGZA 3PXSD 2IAAA 3N0EA 5H14A 5SXMA 4J8GA 3I7KA 4CZVA 5GSAA 2YBAA 3A0FA 3EI4B 4J77A 5TDHB 2P9LC 3VA6A 3ORVD 4LGNA 3SBRA 5HE1B 4JT5C 5KDOB 4QL1A 1SHYB 2YMUA 2IUPA 2AGWA 4J79A 4J82A 3I7HA 4FA1D 3IIWA 4FA5D 2PM9A 3I7PA 5IGOA 3V9FA 3P4FA 4JSVC 4FB1D 2W18A 4PXWA 4X63B 3RN1D 3SLED 3EU7A 2OVRB 4Y5RD 3MKSB 2H47A 5HE2B 4D6VA 2B4EA 3C9CA 3PVWB 1FWXA 2OVQB 5THAA 3I7OA 2GNQA 1U4CA 3RRMC 4A2LA 5I5JA 4O3UB 2AGLA 3NVQA 2IWKA 5EARA 3SFZA 3K26A 3SBPA 5H1MA 4X61B 3JZHA 4J87A 3BG1A 4J0WA 5HE0B 3N0DA 3GREA 2Z2OA 5I5MA 4ZOXA 4L3HD 4Y7RA 3EG6A 4D0KA 2GC7A 3CFSB 3OKTA 2Z2NA 4GQ2P 2AQ5A 2B5MA 5TF2A 3B7FA 2XU7A 3EI3B 3SVWD 4O3TB 4FWWA 3PXWD 4K3ID 2HKMA 1N6DA 5IT9g 4A09B 5EM2B 4JD2C 2OJYA 3EI2A 4JXMA 3DXKC 4CI3A 1GXRA 3PVUB 5AJAA 5CXBB 4ERQA 3OKWA 4QRJA 3VH0A 3PXTD 3SXTD 3RMZD 2G9AA 4PBYA 2J55H 3MKQA 2XYIA 4CI1A 3RN0D 1SQJA 3JZNA 3JROA 2H9NA 2EBSA 4H5IA 4O1QD 5GXIA 4CZYA 4BH6A 1R5MA 2QC5A 4GZ8A 4U7AA 4CC9A 2P9NC 4O9DA 5C9ZB 4CY1A 3SJLD 3BG0A 5CXCA 4E5ZB 2H9LA 4FAVD 1L0QA 3EI1B 2B5LA 1PGUA 5IJ8E 5FKQA 4J84A 2P9PC 3OKYA 3ULEC 5I5IA 2HYEA 1OMWB 4ERZA 2IWFA 4A11B 3IIYA 3L4MD 4CI8A 3E0CA 2J57G 4LG8A 2OK4A 3ODTA 4GGDA 4L9OA 2I3TA 4PBZA 3I7LA 5EMKB 5A2Qg 2J56H 2HXCA 4CZXA 1RI6A 4FAND 3DM0A 4A2MA 2I0SA 4ES0A 3F3PA 3FM0A 2Z2PA 5K1CC 1K8KC 2P9SC 4J81A 3JAMg 3AL8B 5EAPA 3JRPA 5CYKA 3FGBA 5JWZA 4E54A 4FA9D 4FHLA 1SQ9A 1NEXB 3RFHA 5K19A 4ESGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJU B;  3V7D B;  1ERJ A;  2GC4 A;  3EI3 A;  4R7A B;  4BL0 A;  2AGX A;  1PEV A;  4A0B A;  4O45 A;  3W15 A;  5FA5 B;  1Q47 A;  4PNK B;  1S4U X;  3IJ1 A;  3OL2 A;  2XL2 A;  5EM2 A;  4KFM B;  4A08 A;  2H9P A;  1MG3 A;  5C2W B;  4OWR A;  3RLM D;  3DSM A;  5HQG A;  5FQD A;  4XYH A;  5FXY A;  4N14 A;  2UZX B;  3PSL A;  2YNO A;  4YVD A;  3IKO A;  4GQB B;  2I0T A;  4QT8 A;  4OZU A;  5EMM B;  3UVN A;  5AMS A;  3PSC B;  4GMB A;  2BBK H;  2P9U C;  3OTT A;  3C5M A;  2PM9 B;  4GM8 A;  3JZG A;  3EI4 A;  5HE3 B;  2B5N A;  2IUQ A;  4H5J A;  4UI9 R;  1MDA H;  3JB9 L;  1TYQ C;  3EI1 A;  5EMJ B;  1XHM A;  1P22 A;  3U4Y A;  4A7J A;  2HJ4 A;  3SHF A;  3F3G A;  3I7N A;  3BWS A;  5EAL A;  5FKR A;  3KRX B;  2PM6 B;  1XKS A;  4QQE A;  2H9M A;  4AOW A;  2AGZ A;  2CNX A;  1N6F A;  2OIZ A;  4AEZ A;  4JSP C;  4GQ1 A;  3PE7 A;  4ZOV A;  5FKS A;  3RFG A;  4TZ4 A;  4ZOY A;  4BUJ C;  4GGC A;  1N6E A;  3GFC A;  5HYN B;  4EWR A;  2XL3 A;  1PBY B;  3F3F A;  2H6N A;  3KRW B;  5FLX g;  3SN6 B;  2AGY A;  2I0R A;  2YNN A;  4PSW B;  3I8C A;  4G56 B;  3MXX A;  1GOT B;  2P9I C;  2H3X A;  2OVP B;  2CO0 C;  1YFQ A;  1U2V C;  5H17 A;  3HFQ A;  4PSX B;  2TRC B;  4J0X A;  1TBG A;  1OLZ A;  4IA9 A;  4A0A B;  4CI2 A;  3UVK A;  3ZWL B;  1MG2 A;  2CN2 A;  2UZY B;  3SBQ A;  4ZN4 A;  2CO0 A;  5IGQ A;  2H14 A;  3MMY A;  3EI2 B;  1A0R B;  3C75 H;  3MZL A;  2H6K A;  3I8E A;  4XEI C;  2CN3 A;  3RSE C;  4GGA A;  2Q7Q A;  2YNP A;  3SMR A;  3NVN A;  1B9X A;  2O9K A;  1GP2 B;  4CY2 A;  4ERY A;  4A09 A;  3UKR C;  4JSX C;  4ZOZ A;  3SWS D;  5AFU 3;  2AH0 A;  2HJB A;  5IC7 A;  3OW8 A;  2CE8 A;  5IJ7 E;  3EWE A;  5CXB A;  2I3S A;  4MK0 B;  4PC0 A;  5C2V B;  3IJ0 A;  1PI6 A;  5CXC B;  1NR0 A;  4I79 A;  4GM9 A;  4X3E A;  5TEE A;  4J73 A;  3OKY B;  2HES X;  4X60 B;  3EMH A;  2IUR A;  2P9K C;  2PBI B;  2IUV A;  1B9Y A;  2OK6 A;  2YB8 B;  3SCY A;  2H13 A;  3DXM C;  3AL9 A;  4L3G D;  3I89 A;  3V5W B;  3CIK B;  4LG9 A;  3AFC A;  3UVM A;  4E5Z A;  3UR4 A;  4K3J B;  5TEF A;  3J80 g;  4L1Q D;  2BCJ B;  2QXV A;  4J86 A;  4J8B A;  3IJC A;  4J78 A;  1JOF A;  2G99 A;  3MZK A;  1JMZ B;  5CYK B;  5EML B;  4E54 B;  4A11 A;  3UVO A;  3CFV A;  1XIP A;  4A0A A;  2HKR A;  5FKT A;  2AH1 A;  5GMK n;  1VYH C;  3UKU C;  4A0B B;  2H68 A;  3FRX A;  5B4W A;  4FA4 D;  5GXH A;  3OL2 B;  4A08 B;  3C99 A;  1K32 A;  3AL8 A;  4NSX A;  2H6Q A;  2MTA H;  2CE9 A;  5EAM A;  3JPX A;  4Z8L A;  3K27 A;  4U1E I;  3DWL C;  2PM7 B;  4HDJ A;  3AH8 B;  4JT6 C;  4XYI A;  1QNI A;  3L4O D;  3NVX A;  4CY5 A;  4CY3 A;  3I2N A;  3UVL A;  1JMX B;  4JSN C;  4IMM A;  3J81 g;  4GM3 A;  1GG2 B;  3VGZ A;  3PXS D;  2IAA A;  3N0E A;  5H14 A;  5SXM A;  4J8G A;  3I7K A;  4CZV A;  5GSA A;  2YBA A;  3A0F A;  3EI4 B;  4J77 A;  5TDH B;  2P9L C;  3VA6 A;  3ORV D;  4LGN A;  3SBR A;  5HE1 B;  4JT5 C;  5KDO B;  4QL1 A;  1SHY B;  2YMU A;  2IUP A;  2AGW A;  4J79 A;  4J82 A;  3I7H A;  4FA1 D;  3IIW A;  4FA5 D;  2PM9 A;  3I7P A;  5IGO A;  3V9F A;  3P4F A;  4JSV C;  4FB1 D;  2W18 A;  4PXW A;  4X63 B;  3RN1 D;  3SLE D;  3EU7 A;  2OVR B;  4Y5R D;  3MKS B;  2H47 A;  5HE2 B;  4D6V A;  2B4E A;  3C9C A;  3PVW B;  1FWX A;  2OVQ B;  5THA A;  3I7O A;  2GNQ A;  1U4C A;  3RRM C;  4A2L A;  5I5J A;  4O3U B;  2AGL A;  3NVQ A;  2IWK A;  5EAR A;  3SFZ A;  3K26 A;  3SBP A;  5H1M A;  4X61 B;  3JZH A;  4J87 A;  3BG1 A;  4J0W A;  5HE0 B;  3N0D A;  3GRE A;  2Z2O A;  5I5M A;  4ZOX A;  4L3H D;  4Y7R A;  3EG6 A;  4D0K A;  2GC7 A;  3CFS B;  3OKT A;  2Z2N A;  4GQ2 P;  2AQ5 A;  2B5M A;  5TF2 A;  3B7F A;  2XU7 A;  3EI3 B;  3SVW D;  4O3T B;  4FWW A;  3PXW D;  4K3I D;  2HKM A;  1N6D A;  5IT9 g;  4A09 B;  5EM2 B;  4JD2 C;  2OJY A;  3EI2 A;  4JXM A;  3DXK C;  4CI3 A;  1GXR A;  3PVU B;  5AJA A;  5CXB B;  4ERQ A;  3OKW A;  4QRJ A;  3VH0 A;  3PXT D;  3SXT D;  3RMZ D;  2G9A A;  4PBY A;  2J55 H;  3MKQ A;  2XYI A;  4CI1 A;  3RN0 D;  1SQJ A;  3JZN A;  3JRO A;  2H9N A;  2EBS A;  4H5I A;  4O1Q D;  5GXI A;  4CZY A;  4BH6 A;  1R5M A;  2QC5 A;  4GZ8 A;  4U7A A;  4CC9 A;  2P9N C;  4O9D A;  5C9Z B;  4CY1 A;  3SJL D;  3BG0 A;  5CXC A;  4E5Z B;  2H9L A;  4FAV D;  1L0Q A;  3EI1 B;  2B5L A;  1PGU A;  5IJ8 E;  5FKQ A;  4J84 A;  2P9P C;  3OKY A;  3ULE C;  5I5I A;  2HYE A;  1OMW B;  4ERZ A;  2IWF A;  4A11 B;  3IIY A;  3L4M D;  4CI8 A;  3E0C A;  2J57 G;  4LG8 A;  2OK4 A;  3ODT A;  4GGD A;  4L9O A;  2I3T A;  4PBZ A;  3I7L A;  5EMK B;  5A2Q g;  2J56 H;  2HXC A;  4CZX A;  1RI6 A;  4FAN D;  3DM0 A;  4A2M A;  2I0S A;  4ES0 A;  3F3P A;  3FM0 A;  2Z2P A;  5K1C C;  1K8K C;  2P9S C;  4J81 A;  3JAM g;  3AL8 B;  5EAP A;  3JRP A;  5CYK A;  3FGB A;  5JWZ A;  4E54 A;  4FA9 D;  4FHL A;  1SQ9 A;  1NEX B;  3RFH A;  5K19 A;  4ESG A; 
#chains in the Genus database with same CATH topology
 1JJU B;  3V7D B;  1ERJ A;  2GC4 A;  3EI3 A;  4DNV A;  4R7A B;  4BL0 A;  2AGX A;  1PEV A;  4A0B A;  4O45 A;  3W15 A;  5FA5 B;  1Q47 A;  4PNK B;  1S4U X;  4D9S A;  3IJ1 A;  3OL2 A;  2XL2 A;  5EM2 A;  4KFM B;  4A08 A;  2H9P A;  1MG3 A;  5E6U A;  5C2W B;  4OWR A;  3RLM D;  3ZDX A;  3DSM A;  5HQG A;  5FQD A;  4NEN A;  3IJE A;  2VDK A;  4XYH A;  5FXY A;  4N14 A;  2UZX B;  3PSL A;  2YNO A;  4YVD A;  3IKO A;  4GQB B;  2I0T A;  4QT8 A;  3MVD K;  4OZU A;  5EMM B;  3UVN A;  5AMS A;  3PSC B;  5M61 A;  4GMB A;  2BBK H;  2P9U C;  3GD1 I;  3OTT A;  3C5M A;  2PM9 B;  4GM8 A;  3JZG A;  4NBM A;  3EI4 A;  5HE3 B;  2B5N A;  2IUQ A;  4H5J A;  4UI9 R;  1MDA H;  3JB9 L;  1TYQ C;  2VDR A;  3EI1 A;  5EMJ B;  1XHM A;  1P22 A;  3U4Y A;  4A7J A;  2VC2 A;  4WK4 A;  2HJ4 A;  3SHF A;  3F3G A;  3I7N A;  4BCB A;  3DDU A;  3K6S A;  3BWS A;  5EAL A;  3IUR A;  5FKR A;  4RE5 A;  3KRX B;  2PM6 B;  1XKS A;  1C9I A;  4QQE A;  2H9M A;  5FFG A;  1M1X A;  4AOW A;  2AGZ A;  2CNX A;  1N6F A;  3ZE2 A;  2OIZ A;  4AEZ A;  1T2X A;  4JSP C;  4GQ1 A;  3PE7 A;  4ZOV A;  5FKS A;  3RFG A;  4TZ4 A;  4ZOY A;  4BUJ C;  4GGC A;  3O4G A;  1N6E A;  3GFC A;  5HYN B;  4EWR A;  2XL3 A;  1PBY B;  3F3F A;  2H6N A;  3KRW B;  5FLX g;  4QAM A;  2EIE A;  1JV2 A;  3SN6 B;  2AGY A;  2I0R A;  2YNN A;  4Z7O A;  4PSW B;  3I8C A;  4G56 B;  3NID A;  1I2M B;  3MXX A;  1GOT B;  2P9I C;  1UOQ A;  2H3X A;  2OVP B;  2CO0 C;  1YFQ A;  1C9L A;  1U2V C;  5H17 A;  4Z7Q A;  3HFQ A;  2XZG A;  4PSX B;  2TRC B;  3ZE0 A;  4J0X A;  1TBG A;  1OLZ A;  4IA9 A;  4A0A B;  4CI2 A;  1H2W A;  3UVK A;  3ZWL B;  2VDL A;  1MG2 A;  4MMZ A;  2CN2 A;  2UZY B;  3SBQ A;  4ZN4 A;  2CO0 A;  3FCS A;  5IGQ A;  2H14 A;  3MMY A;  2XE4 A;  3IUM A;  3EI2 B;  5C92 A;  4BP9 A;  1A0R B;  3C75 H;  3MZL A;  2H6K A;  3I8E A;  4XEI C;  2CN3 A;  3RSE C;  4GGA A;  2Q7Q A;  1VE6 A;  2HU7 A;  1QFS A;  2YNP A;  4NC4 A;  2JKX A;  3SMR A;  3NVN A;  1B9X A;  2O9K A;  1GP2 B;  4RE6 A;  4CY2 A;  4WK2 A;  4ERY A;  4A09 A;  3UKR C;  4JSX C;  4ZOZ A;  3SWS D;  5AFU 3;  5M5U A;  3MUO A;  4G55 A;  2AH0 A;  2HJB A;  5IC7 A;  3OW8 A;  2CE8 A;  5IJ7 E;  3EQ8 A;  3EWE A;  4WJK A;  2I3S A;  5CXB A;  4MK0 B;  4PC0 A;  5C2V B;  3IJ0 A;  4JHN A;  1PI6 A;  5CXC B;  1NR0 A;  4I79 A;  3ZDZ A;  4GM9 A;  2BKL A;  4X3E A;  4AN0 A;  5TEE A;  3KCI A;  4J73 A;  3OKY B;  2HES X;  4X60 B;  3EMH A;  2IUR A;  2P9K C;  2PBI B;  2IUV A;  1B9Y A;  2OK6 A;  2YB8 B;  3SCY A;  2H13 A;  4AMY A;  3DXM C;  3AL9 A;  4L3G D;  3I89 A;  3K71 A;  3V5W B;  3CIK B;  1UOO A;  4LG9 A;  3AFC A;  3UVM A;  3IUJ A;  4MMX A;  4E5Z A;  3UR4 A;  4K3J B;  3IUQ A;  5TEF A;  3J80 g;  4L1Q D;  2BCJ B;  2QXV A;  4J86 A;  4J8B A;  3IJC A;  3V4V A;  4J78 A;  1JOF A;  2G99 A;  3MZK A;  1JMZ B;  5CYK B;  5EML B;  4E54 B;  4A11 A;  3UVO A;  3CFV A;  1XIP A;  4A0A A;  2HKR A;  5FKT A;  2VDN A;  3O4J A;  2VZ3 A;  2AH1 A;  5GMK n;  1VYH C;  3UKU C;  4A0B B;  2H68 A;  3FRX A;  5B4W A;  3T3M A;  4FA4 D;  5GXH A;  3OL2 B;  4A08 B;  3C99 A;  1K32 A;  4JHP C;  3AL8 A;  4NSX A;  4UM9 A;  1E5T A;  1O6G A;  2H6Q A;  2MTA H;  2CE9 A;  5EAM A;  4DNW A;  3JPX A;  3IUL A;  4Z8L A;  3K27 A;  4U1E I;  4AMZ A;  3DWL C;  2PM7 B;  4HDJ A;  3AH8 B;  4JT6 C;  4XYI A;  1QNI A;  3L4O D;  3NVX A;  1O6F A;  1K3I A;  4CY5 A;  1E8N A;  2XDW A;  4CY3 A;  3I2N A;  3UVL A;  1JMX B;  4JSN C;  1VZ2 A;  4IMM A;  3J81 g;  4GM3 A;  1GG2 B;  1H2Y A;  1L5G A;  3VGZ A;  3PXS D;  2IAA A;  3N0E A;  5H14 A;  3V4P A;  5SXM A;  4J8G A;  2HU5 A;  4AX4 A;  3I7K A;  4CZV A;  2VDP A;  5GSA A;  2YBA A;  3A0F A;  3EI4 B;  4J77 A;  5TDH B;  2P9L C;  3VA6 A;  4L1M A;  3IUN A;  3ORV D;  3K72 A;  4LGN A;  3SBR A;  5HE1 B;  4Z7N A;  4JT5 C;  5KDO B;  4QL1 A;  1SHY B;  3VI4 A;  2YMU A;  1QFM A;  2IUP A;  2AGW A;  4J79 A;  4J82 A;  3I7H A;  4AN1 A;  3QHY B;  4FA1 D;  3IIW A;  1VE7 A;  4FA5 D;  2PM9 A;  3I7P A;  5IGO A;  3V9F A;  3P4F A;  2EIC A;  4JSV C;  2W18 A;  4FB1 D;  4PXW A;  2EIB A;  3FCU A;  4X63 B;  3QI0 A;  3RN1 D;  3SLE D;  5HDB A;  3EU7 A;  2OVR B;  4Y5R D;  3MKS B;  2H47 A;  5HE2 B;  4D6V A;  1H2X A;  2B4E A;  3C9C A;  3PVW B;  1FWX A;  1A12 A;  2OVQ B;  5E6S A;  5THA A;  1E8M A;  2VDO A;  3I7O A;  2GNQ A;  1U4C A;  3RRM C;  4WK0 A;  5I5J A;  4A2L A;  4O3U B;  4UM8 A;  2AGL A;  3NVQ A;  2QZP A;  2IWK A;  5EAR A;  3MUN A;  3SFZ A;  3K26 A;  3SBP A;  5H1M A;  4X61 B;  3JZH A;  4J87 A;  3BG1 A;  1VZ3 A;  4J0W A;  5HE0 B;  3GC3 B;  3N0D A;  3GRE A;  4NAA A;  2Z2O A;  3O4H A;  5I5M A;  4ZOX A;  1U8C A;  4L3H D;  3O4I A;  2HU8 A;  4Y7R A;  3EG6 A;  5M5R A;  4D0K A;  2GC7 A;  1GOH A;  3CFS B;  3OKT A;  2Z2N A;  4GQ2 P;  2AQ5 A;  5C86 A;  4G1E A;  2B5M A;  2EID A;  5TF2 A;  3B7F A;  2XU7 A;  4BCD A;  3EI3 B;  3SVW D;  4BP8 A;  1JTD B;  4O3T B;  4FWW A;  3PXW D;  4K3I D;  1GOG A;  2HKM A;  1N6D A;  5IT9 g;  4A09 B;  5EM2 B;  4JD2 C;  2OJY A;  3EI2 A;  4JXM A;  3DXK C;  4CI3 A;  3ZDY A;  1GXR A;  3PVU B;  5AJA A;  1UTC A;  5CXB B;  4ERQ A;  3OKW A;  4O2W A;  4BCC A;  3EQ7 A;  4QRJ A;  3VH0 A;  3PXT D;  3SXT D;  3RMZ D;  1H2Z A;  2G9A A;  2J55 H;  4PBY A;  3MKQ A;  2XYI A;  4CI1 A;  3RN0 D;  5M5V A;  1SQJ A;  3JZN A;  3JRO A;  4MMY A;  2H9N A;  3NIG A;  2EBS A;  3ZE1 A;  5FFO A;  4H5I A;  4O1Q D;  3IVM A;  5GXI A;  4IRZ A;  4CZY A;  4BH6 A;  1R5M A;  2QC5 A;  2VZ1 A;  4GZ8 A;  4U7A A;  4CC9 A;  1GOF A;  2P9N C;  4O9D A;  5C9Z B;  4CY1 A;  3SJL D;  3BG0 A;  5CXC A;  4DNU A;  4E5Z B;  1TYE A;  2H9L A;  3T3P A;  4FAV D;  1L0Q A;  2WQ8 A;  3EI1 B;  2B5L A;  2QR5 A;  1PGU A;  5IJ8 E;  5FKQ A;  3EQ9 A;  4J84 A;  2P9P C;  3OKY A;  1BPO A;  1UOP A;  3ULE C;  5I5I A;  2HYE A;  1OMW B;  4G1M A;  4ERZ A;  3NIF A;  3VI3 A;  2IWF A;  4A11 B;  3IIY A;  3L4M D;  4CI8 A;  3E0C A;  2J57 G;  4LG8 A;  2OK4 A;  3ODT A;  4GGD A;  4L9O A;  2I3T A;  4PBZ A;  3I7L A;  5E6R A;  5EMK B;  5A2Q g;  2J56 H;  2HXC A;  3OF7 A;  1RI6 A;  4CZX A;  4FAN D;  3DM0 A;  4A2M A;  2I0S A;  4ES0 A;  2VDQ A;  3F3P A;  5M5T A;  3FM0 A;  2Z2P A;  5K1C C;  1K8K C;  1YR2 A;  2P9S C;  4J81 A;  3JAM g;  5M5S A;  3AL8 B;  5EAP A;  3JRP A;  5CYK A;  3FGB A;  5JWZ A;  4E54 A;  4FA9 D;  4FHL A;  4O02 A;  1SQ9 A;  1NEX B;  3RFH A;  5K19 A;  2VDM A;  4ESG A; 
#chains in the Genus database with same CATH homology
 1JJU B;  3V7D B;  1ERJ A;  2GC4 A;  3EI3 A;  4R7A B;  4BL0 A;  2AGX A;  1PEV A;  4A0B A;  4O45 A;  3W15 A;  5FA5 B;  1Q47 A;  4PNK B;  1S4U X;  3IJ1 A;  3OL2 A;  2XL2 A;  5EM2 A;  4KFM B;  4A08 A;  2H9P A;  1MG3 A;  5C2W B;  4OWR A;  3RLM D;  3DSM A;  5HQG A;  5FQD A;  4XYH A;  5FXY A;  4N14 A;  2UZX B;  3PSL A;  2YNO A;  4YVD A;  3IKO A;  4GQB B;  2I0T A;  4QT8 A;  4OZU A;  5EMM B;  3UVN A;  5AMS A;  3PSC B;  4GMB A;  2BBK H;  2P9U C;  3OTT A;  3C5M A;  2PM9 B;  4GM8 A;  3JZG A;  3EI4 A;  5HE3 B;  2B5N A;  2IUQ A;  4H5J A;  4UI9 R;  1MDA H;  3JB9 L;  1TYQ C;  3EI1 A;  5EMJ B;  1XHM A;  1P22 A;  3U4Y A;  4A7J A;  2HJ4 A;  3SHF A;  3F3G A;  3I7N A;  3BWS A;  5EAL A;  5FKR A;  3KRX B;  2PM6 B;  1XKS A;  4QQE A;  2H9M A;  4AOW A;  2AGZ A;  2CNX A;  1N6F A;  2OIZ A;  4AEZ A;  4JSP C;  4GQ1 A;  3PE7 A;  4ZOV A;  5FKS A;  3RFG A;  4TZ4 A;  4ZOY A;  4BUJ C;  4GGC A;  1N6E A;  3GFC A;  5HYN B;  4EWR A;  2XL3 A;  1PBY B;  3F3F A;  2H6N A;  3KRW B;  5FLX g;  3SN6 B;  2AGY A;  2I0R A;  2YNN A;  4PSW B;  3I8C A;  4G56 B;  3MXX A;  1GOT B;  2P9I C;  2H3X A;  2OVP B;  2CO0 C;  1YFQ A;  1U2V C;  5H17 A;  3HFQ A;  4PSX B;  2TRC B;  4J0X A;  1TBG A;  1OLZ A;  4IA9 A;  4A0A B;  4CI2 A;  3UVK A;  3ZWL B;  1MG2 A;  2CN2 A;  2UZY B;  3SBQ A;  4ZN4 A;  2CO0 A;  5IGQ A;  2H14 A;  3MMY A;  3EI2 B;  1A0R B;  3C75 H;  3MZL A;  2H6K A;  3I8E A;  4XEI C;  2CN3 A;  3RSE C;  4GGA A;  2Q7Q A;  2YNP A;  3SMR A;  3NVN A;  1B9X A;  2O9K A;  1GP2 B;  4CY2 A;  4ERY A;  4A09 A;  3UKR C;  4JSX C;  4ZOZ A;  3SWS D;  5AFU 3;  2AH0 A;  2HJB A;  5IC7 A;  3OW8 A;  2CE8 A;  5IJ7 E;  3EWE A;  5CXB A;  2I3S A;  4MK0 B;  4PC0 A;  5C2V B;  3IJ0 A;  1PI6 A;  5CXC B;  1NR0 A;  4I79 A;  4GM9 A;  4X3E A;  5TEE A;  4J73 A;  3OKY B;  2HES X;  4X60 B;  3EMH A;  2IUR A;  2P9K C;  2PBI B;  2IUV A;  1B9Y A;  2OK6 A;  2YB8 B;  3SCY A;  2H13 A;  3DXM C;  3AL9 A;  4L3G D;  3I89 A;  3V5W B;  3CIK B;  4LG9 A;  3AFC A;  3UVM A;  4E5Z A;  3UR4 A;  4K3J B;  5TEF A;  3J80 g;  4L1Q D;  2BCJ B;  2QXV A;  4J86 A;  4J8B A;  3IJC A;  4J78 A;  1JOF A;  2G99 A;  3MZK A;  1JMZ B;  5CYK B;  5EML B;  4E54 B;  4A11 A;  3UVO A;  3CFV A;  1XIP A;  4A0A A;  2HKR A;  5FKT A;  2AH1 A;  5GMK n;  1VYH C;  3UKU C;  4A0B B;  2H68 A;  3FRX A;  5B4W A;  4FA4 D;  5GXH A;  3OL2 B;  4A08 B;  3C99 A;  1K32 A;  3AL8 A;  4NSX A;  2H6Q A;  2MTA H;  2CE9 A;  5EAM A;  3JPX A;  4Z8L A;  3K27 A;  4U1E I;  3DWL C;  2PM7 B;  4HDJ A;  3AH8 B;  4JT6 C;  4XYI A;  1QNI A;  3L4O D;  3NVX A;  4CY5 A;  4CY3 A;  3I2N A;  3UVL A;  1JMX B;  4JSN C;  4IMM A;  3J81 g;  4GM3 A;  1GG2 B;  3VGZ A;  3PXS D;  2IAA A;  3N0E A;  5H14 A;  5SXM A;  4J8G A;  3I7K A;  4CZV A;  5GSA A;  2YBA A;  3A0F A;  3EI4 B;  4J77 A;  5TDH B;  2P9L C;  3VA6 A;  3ORV D;  4LGN A;  3SBR A;  5HE1 B;  4JT5 C;  5KDO B;  4QL1 A;  1SHY B;  2YMU A;  2IUP A;  2AGW A;  4J79 A;  4J82 A;  3I7H A;  4FA1 D;  3IIW A;  4FA5 D;  2PM9 A;  3I7P A;  5IGO A;  3V9F A;  3P4F A;  4JSV C;  4FB1 D;  2W18 A;  4PXW A;  4X63 B;  3RN1 D;  3SLE D;  3EU7 A;  2OVR B;  4Y5R D;  3MKS B;  2H47 A;  5HE2 B;  4D6V A;  2B4E A;  3C9C A;  3PVW B;  1FWX A;  2OVQ B;  5THA A;  3I7O A;  2GNQ A;  1U4C A;  3RRM C;  4A2L A;  5I5J A;  4O3U B;  2AGL A;  3NVQ A;  2IWK A;  5EAR A;  3SFZ A;  3K26 A;  3SBP A;  5H1M A;  4X61 B;  3JZH A;  4J87 A;  3BG1 A;  4J0W A;  5HE0 B;  3N0D A;  3GRE A;  2Z2O A;  5I5M A;  4ZOX A;  4L3H D;  4Y7R A;  3EG6 A;  4D0K A;  2GC7 A;  3CFS B;  3OKT A;  2Z2N A;  4GQ2 P;  2AQ5 A;  2B5M A;  5TF2 A;  3B7F A;  2XU7 A;  3EI3 B;  3SVW D;  4O3T B;  4FWW A;  3PXW D;  4K3I D;  2HKM A;  1N6D A;  5IT9 g;  4A09 B;  5EM2 B;  4JD2 C;  2OJY A;  3EI2 A;  4JXM A;  3DXK C;  4CI3 A;  1GXR A;  3PVU B;  5AJA A;  5CXB B;  4ERQ A;  3OKW A;  4QRJ A;  3VH0 A;  3PXT D;  3SXT D;  3RMZ D;  2G9A A;  4PBY A;  2J55 H;  3MKQ A;  2XYI A;  4CI1 A;  3RN0 D;  1SQJ A;  3JZN A;  3JRO A;  2H9N A;  2EBS A;  4H5I A;  4O1Q D;  5GXI A;  4CZY A;  4BH6 A;  1R5M A;  2QC5 A;  4GZ8 A;  4U7A A;  4CC9 A;  2P9N C;  4O9D A;  5C9Z B;  4CY1 A;  3SJL D;  3BG0 A;  5CXC A;  4E5Z B;  2H9L A;  4FAV D;  1L0Q A;  3EI1 B;  2B5L A;  1PGU A;  5IJ8 E;  5FKQ A;  4J84 A;  2P9P C;  3OKY A;  3ULE C;  5I5I A;  2HYE A;  1OMW B;  4ERZ A;  2IWF A;  4A11 B;  3IIY A;  3L4M D;  4CI8 A;  3E0C A;  2J57 G;  4LG8 A;  2OK4 A;  3ODT A;  4GGD A;  4L9O A;  2I3T A;  4PBZ A;  3I7L A;  5EMK B;  5A2Q g;  2J56 H;  2HXC A;  4CZX A;  1RI6 A;  4FAN D;  3DM0 A;  4A2M A;  2I0S A;  4ES0 A;  3F3P A;  3FM0 A;  2Z2P A;  5K1C C;  1K8K C;  2P9S C;  4J81 A;  3JAM g;  3AL8 B;  5EAP A;  3JRP A;  5CYK A;  3FGB A;  5JWZ A;  4E54 A;  4FA9 D;  4FHL A;  1SQ9 A;  1NEX B;  3RFH A;  5K19 A;  4ESG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...