4HDJA

Crystal structure of bamb from pseudomonas aeruginosa
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
355
structure length
355
Chain Sequence
PPAELTDFKEEVVLSKQWSRSVGDGQGDLYNLLEPAVDGSTIYAASAEGRVMAIQRETGDVLWKKDLERPVSGGVGVGYGLVLVGTLRGDVIALDEATGKKKWTKRVNSEVLSAPATNGDVVVVQTQDDKLIGLDAASGDQRWIYESTVPVLTLRGTGAPLIAGNMALAGLASGKVVAVDVQRGLPIWEQRVAIPQGRSELDRVVDIDGGLLLSGDTLYVVSYQGRAAALDVNSGRLLWQREASSYVGVAEGFGNIYVSQASGSVEGLDSRGASSLWNNDALARRQLSAPAVFSSNVVVGDLEGYVHLLSQVDGRFVGRERVDSDGVRVRPLVVGSWMYVFGNGGKLVAYTIRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Outer membrane protein assembly factor BamB
publication title Crystal structure of BamB from Pseudomonas aeruginosa and functional evaluation of its conserved structural features.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 88
structure length 355
sequence length 355
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13360 PQQ_2 PQQ-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4hdjA00
4FA4D 3VGZA 4FHLA 2CE8A 4AEZA 4GQ2P 3CFSB 4OZUA 3KRWB 1N6EA 3KRXB 3V9FA 3RLMD 5HE1B 5C9ZB 4JT5C 4O45A 3J81g 2H3XA 3JROA 5HE3B 2Z2NA 5FA5B 3I7NA 1ERJA 3SBQA 5IGQA 2P9IC 4X60B 3J80g 4CY1A 2G99A 3N0DA 3IKOA 4GQ1A 3OW8A 2I0TA 3RFHA 2AH0A 4IMMA 2IUQA 4CC9A 1QNIA 4A08A 3I7LA 4Y7RA 3NVXA 2YB8B 4J8GA 2HJBA 3JPXA 3SBRA 1B9XA 4FB1D 5HQGA 3BG0A 2I0RA 4CI8A 3SVWD 3EI1A 4LGNA 2H6KA 5TEEA 4ERQA 2HESX 4GGCA 2OK4A 2H9LA 3PXWD 3IIWA 5EM2A 3PSLA 3UVKA 4BH6A 5FKSA 5C2VB 3FRXA 4HDJA 3SXTD 3MMYA 2XU7A 5C2WB 2IWKA 4K3JB 3EI4B 5TDHB 2GC4A 3L4OD 2XL3A 5A2Qg 1GP2B 3UVLA 3FM0A 3FGBA 4ESGA 3JRPA 2OK6A 4J0WA 4O3UB 4OWRA 2PM9A 1VYHC 1GG2B 4J86A 2OIZA 2UZXB 4GM8A 3RN0D 3RN1D 4H5JA 2IWFA 3OKTA 1S4UX 5IT9g 5CXBB 5GXIA 3OL2B 3C99A 3EI2A 4A0BA 2HKMA 4O1QD 3UKUC 4J8BA 3CFVA 3IJ0A 4E5ZA 2XL2A 3I8EA 1TYQC 3PE7A 3SWSD 3DWLC 4CZYA 1JMXB 4J78A 4A2LA 1A0RB 2OVQB 5H17A 5EMKB 4J77A 4FA5D 2AGLA 3JB9L 3EI3B 2Q7QA 3NVNA 4A11A 4R7AB 2H14A 2Z2OA 2I3TA 2HKRA 2CO0C 3AFCA 4ZOXA 4CZXA 3EMHA 3PXTD 3OKYB 1K8KC 4JSNC 3MZLA 4GZ8A 5FKQA 2H68A 4A0AA 2AGWA 2B5LA 3UVMA 4PSWB 5IJ7E 4QRJA 4JSXC 3MKSB 2AH1A 1Q47A 1OLZA 4A09A 2AGXA 5H1MA 4O3TB 5I5JA 5EMLB 2CN2A 4PBYA 3DXKC 4A7JA 1NEXB 4X63B 4ERZA 4JSPC 2O9KA 2IURA 1SHYB 4D6VA 1GXRA 4GGAA 3I89A 5CYKB 5CXCB 1JMZB 3U4YA 4JT6C 2W18A 3AL8B 5GMKn 2J55H 4ZOZA 3F3FA 3GREA 4KFMB 5B4WA 3W15A 4QL1A 4PBZA 2HYEA 5HE2B 4D0KA 1SQJA 2H47A 1U2VC 5AJAA 4PC0A 2AQ5A 4NSXA 5EARA 3SHFA 2H9PA 5AMSA 3EG6A 2AGYA 3DSMA 3DXMC 1N6FA 4YVDA 2H6QA 5EAPA 4X3EA 3K27A 3C75H 3PSCB 3F3PA 4L3HD 4ZOVA 5H14A 2PBIB 4K3ID 3CIKB 3OL2A 4CY5A 3I7OA 3SFZA 5FKTA 4Z8LA 4XYHA 2B4EA 2G9AA 2H6NA 2IAAA 3C9CA 3OKWA 4JXMA 4IA9A 4A08B 3F3GA 1NR0A 2P9NC 3PVWB 2YMUA 3PXSD 4L1QD 5TEFA 2CN3A 3ODTA 4E54A 4PXWA 4J0XA 3JAMg 3EI1B 5FQDA 1YFQA 2YBAA 5EALA 2H9NA 1SQ9A 4GGDA 2YNNA 1PBYB 3NVQA 5IC7A 5EM2B 5EMMB 3JZGA 3AL9A 1N6DA 3A0FA 4CI2A 1MG3A 1FWXA 1PEVA 3EWEA 1L0QA 4O9DA 2AGZA 4FAND 4J81A 3EU7A 3I7KA 4GMBA 4U7AA 4JD2C 2H9MA 1XHMA 2YNOA 5AFU3 2HXCA 5HE0B 1B9YA 5K19A 1JOFA 3I7HA 3AH8B 4PSXB 3BWSA 3IIYA 1K32A 2PM9B 4CZVA 2OVPB 4J73A 2IUPA 1MG2A 3V7DB 3I8CA 4L3GD 2HJ4A 5TF2A 4AOWA 4UI9R 3ORVD 2P9LC 3EI2B 4JSVC 2GC7A 3UVNA 4A0BB 3MXXA 3HFQA 5FLXg 2P9SC 4E5ZB 2GNQA 4XYIA 2BCJB 3JZNA 5EAMA 4FA1D 4J87A 3UKRC 3SCYA 4GM9A 5THAA 1OMWB 3OTTA 3SJLD 4ZN4A 5HYNB 1P22A 2XYIA 3RFGA 5IGOA 1R5MA 4A11B 3P4FA 4PNKB 4CY3A 3SBPA 5IJ8E 4A2MA 3ZWLB 3SMRA 2UZYB 2MTAH 1XIPA 3N0EA 5JWZA 5KDOB 5FKRA 4A0AB 2H13A 2B5NA 5FXYA 4CY2A 2P9PC 4ES0A 3EI4A 4BUJC 3E0CA 3MZKA 1GOTB 4A09B 1MDAH 4LG8A 3V5WB 2OJYA 3GFCA 3BG1A 4GQBB 4TZ4A 3IJ1A 3VH0A 4L9OA 4X61B 5GXHA 2B5MA 4N14A 4CI1A 5CXBA 5I5MA 1TBGA 2QC5A 3UR4A 1XKSA 4I79A 3ULEC 2J57G 4H5IA 3PVUB 2BBKH 3VA6A 3RSEC 3RRMC 2Z2PA 1U4CA 5SXMA 2IUVA 3EI3A 4XEIC 4J79A 2PM7B 4J84A 3SN6B 5EMJB 2QXVA 2I0SA 3OKYA 2J56H 3MKQA 3RMZD 3I7PA 4CI3A 5I5IA 4FWWA 3C5MA 4LG9A 4FA9D 1PGUA 2OVRB 3UVOA 2PM6B 3I2NA 2I3SA 2TRCB 2CE9A 4E54B 3IJCA 5CYKA 5GSAA 5CXCA 3JZHA 1RI6A 1PI6A 4ZOYA 3B7FA 4ERYA 3AL8A 4J82A 4QQEA 4BL0A 3DM0A 2YNPA 2CO0A 4EWRA 4GM3A 3K26A 5K1CC 4U1EI 4QT8A 4G56B 2CNXA 3SLED 2P9KC 1JJUB 2EBSA 2P9UC 4FAVD 4MK0B 3L4MD 4Y5RD
chains in the Genus database with same CATH superfamily
3VI3A 4FA4D 3VGZA 4FHLA 2CE8A 4AEZA 4GQ2P 1L5GA 3CFSB 4BP9A 4OZUA 2VDRA 3KRWB 5M5TA 1N6EA 3KRXB 3V9FA 3RLMD 5HE1B 5C9ZB 2VZ1A 4JT5C 4O45A 3J81g 2H3XA 3JROA 5HE3B 2Z2NA 2VDKA 2EIDA 2XE4A 5FA5B 3DDUA 3I7NA 1ERJA 3SBQA 5IGQA 4DNVA 1E5TA 2P9IC 5M61A 4X60B 3J80g 4G1MA 4CY1A 2G99A 3N0DA 3IKOA 3ZE1A 4GQ1A 4O02A 3OW8A 4BCCA 2I0TA 3RFHA 2AH0A 4IMMA 2IUQA 3IURA 4MMZA 5C86A 5E6SA 4CC9A 1QNIA 4A08A 3I7LA 3O4IA 4Y7RA 2XDWA 3NVXA 2YB8B 4J8GA 2HJBA 3JPXA 3SBRA 1B9XA 4FB1D 5HQGA 3BG0A 1VE6A 5C92A 2I0RA 4CI8A 3SVWD 3EI1A 4LGNA 2H6KA 5TEEA 4ERQA 4RE5A 2HESX 4GGCA 2WQ8A 2OK4A 1VE7A 2H9LA 3PXWD 3IIWA 5EM2A 3PSLA 3UVKA 3K6SA 4BH6A 5FKSA 4BCBA 5C2VB 3FRXA 4HDJA 3SXTD 3IVMA 3MMYA 2XU7A 3FCUA 5C2WB 2IWKA 4NAAA 4BCDA 4K3JB 3EI4B 1GOGA 5TDHB 2GC4A 3L4OD 2XL3A 5A2Qg 1GP2B 3UVLA 2QZPA 3FM0A 1H2XA 3FGBA 4ESGA 3JRPA 1YR2A 3NIDA 2OK6A 4J0WA 3IUNA 4O3UB 1UOQA 4OWRA 2PM9A 3GD1I 4RE6A 3ZDYA 1VYHC 4IRZA 1GG2B 1O6GA 4J86A 2OIZA 2UZXB 4GM8A 3RN0D 3RN1D 4H5JA 2IWFA 3OKTA 1S4UX 4UM8A 5IT9g 5CXBB 5GXIA 3OL2B 3C99A 3ZE0A 3EI2A 4Z7NA 3QI0A 4A0BA 2HKMA 4O1QD 3UKUC 4J8BA 2HU5A 3CFVA 3IJ0A 4E5ZA 2XL2A 3I8EA 1GOHA 1TYQC 3PE7A 3SWSD 3DWLC 4L1MA 4CZYA 1JMXB 4J78A 4A2LA 1UOPA 1A0RB 2OVQB 5H17A 5EMKB 3KCIA 4J77A 4FA5D 2AGLA 2VDLA 3JB9L 3EI3B 2Q7QA 3NVNA 4A11A 4R7AB 2H14A 2Z2OA 4WK0A 4AN0A 2I3TA 2HKRA 2CO0C 3ZDZA 1T2XA 3AFCA 3IULA 5M5SA 4ZOXA 4CZXA 3EMHA 3PXTD 5E6UA 3OKYB 1K8KC 4JSNC 3MZLA 4GZ8A 3NIFA 5FKQA 2H68A 4A0AA 2AGWA 2B5LA 3UVMA 4PSWB 3O4JA 3ZDXA 5IJ7E 4QRJA 4JSXC 3MKSB 2AH1A 1Q47A 1OLZA 4A09A 2AGXA 3QHYB 5H1MA 4O3TB 5I5JA 5EMLB 2CN2A 4PBYA 3DXKC 4A7JA 1NEXB 4X63B 1M1XA 4ERZA 4JSPC 2O9KA 2IURA 1SHYB 4D6VA 1GXRA 4GGAA 5M5VA 3I89A 3IUQA 5CYKB 4D9SA 5CXCB 2VC2A 2VDQA 1JMZB 1E8MA 3U4YA 1H2ZA 4JT6C 2W18A 3AL8B 5GMKn 2J55H 4ZOZA 3F3FA 3GREA 4KFMB 5B4WA 3W15A 3K71A 2JKXA 4QL1A 4PBZA 2HYEA 5HE2B 3MUNA 4D0KA 1SQJA 2H47A 1QFSA 1U2VC 5AJAA 4PC0A 3EQ7A 4NC4A 2AQ5A 4NSXA 5EARA 3SHFA 2H9PA 5AMSA 3EG6A 2VDOA 2AGYA 2HU7A 3DSMA 4O2WA 4BP8A 3DXMC 1N6FA 1VZ2A 4YVDA 2XZGA 2H6QA 5EAPA 4X3EA 3K27A 3C75H 3PSCB 3F3PA 5M5UA 4L3HD 4ZOVA 5H14A 1I2MB 2PBIB 4K3ID 3CIKB 3ZE2A 3OL2A 4CY5A 3I7OA 3SFZA 5FKTA 4Z8LA 4AMYA 4XYHA 2B4EA 2HU8A 2G9AA 5M5RA 2H6NA 2IAAA 3C9CA 4MMXA 3VI4A 3OKWA 4IA9A 4JXMA 4A08B 3F3GA 1NR0A 2P9NC 3PVWB 2YMUA 3PXSD 4L1QD 5TEFA 2CN3A 3ODTA 4E54A 4PXWA 4J0XA 3JAMg 3EI1B 5FQDA 4AX4A 1YFQA 4NBMA 2YBAA 5EALA 2H9NA 1SQ9A 4GGDA 2YNNA 1PBYB 3NVQA 5IC7A 5EM2B 5EMMB 3JZGA 3AL9A 1N6DA 3A0FA 4CI2A 1MG3A 1FWXA 1PEVA 3EWEA 1L0QA 2EIBA 2AGZA 4O9DA 4J81A 4FAND 3EU7A 3I7KA 4G55A 4GMBA 4U7AA 4JD2C 2H9MA 1XHMA 2YNOA 5AFU3 2HXCA 5HE0B 1B9YA 2VZ3A 5K19A 1JOFA 3I7HA 3AH8B 1U8CA 4PSXB 3BWSA 3IIYA 1K32A 2PM9B 4CZVA 4Z7OA 2OVPB 4AN1A 3O4GA 4J73A 2IUPA 1MG2A 3V7DB 2VDMA 3I8CA 4L3GD 2HJ4A 5TF2A 4AOWA 4DNWA 4UI9R 1H2YA 3ORVD 2P9LC 3NIGA 3T3MA 4JSVC 2GC7A 3UVNA 3EI2B 4A0BB 4QAMA 3MXXA 3HFQA 5FLXg 2P9SC 4E5ZB 2GNQA 3OF7A 4XYIA 2BCJB 3JZNA 5EAMA 4FA1D 4J87A 3UKRC 3SCYA 1C9LA 2VDPA 3EQ8A 4GM9A 5THAA 1OMWB 3OTTA 3SJLD 4ZN4A 5HYNB 1P22A 4WK4A 2XYIA 3RFGA 5IGOA 1R5MA 4A11B 3P4FA 3MUOA 4PNKB 4CY3A 3SBPA 1UTCA 5IJ8E 4A2MA 1O6FA 3ZWLB 3SMRA 2UZYB 1JV2A 4DNUA 2MTAH 1XIPA 3N0EA 5JWZA 5KDOB 5FKRA 4A0AB 1QFMA 2H13A 2B5NA 5FXYA 4CY2A 2P9PC 4ES0A 3EI4A 3EQ9A 4BUJC 3E0CA 3MZKA 1GOTB 4A09B 1MDAH 1K3IA 4LG8A 3V5WB 2OJYA 3GFCA 3BG1A 4GQBB 4TZ4A 3IJ1A 3VH0A 4L9OA 4X61B 5GXHA 3V4PA 1UOOA 2B5MA 4N14A 4CI1A 5CXBA 5I5MA 1TYEA 1TBGA 1A12A 2QC5A 1VZ3A 1E8NA 3T3PA 3UR4A 1XKSA 4I79A 3ULEC 2J57G 4H5IA 2VDNA 4MMYA 1C9IA 3PVUB 5FFGA 2BBKH 3VA6A 3RSEC 3RRMC 2Z2PA 1U4CA 5SXMA 2IUVA 3EI3A 3GC3B 4Z7QA 4XEIC 4J79A 2PM7B 4J84A 4JHPC 3SN6B 4JHNA 5EMJB 2QXVA 4AMZA 2I0SA 3OKYA 5FFOA 2J56H 3MKQA 3RMZD 3I7PA 4CI3A 5I5IA 4FWWA 3C5MA 4LG9A 4FA9D 4G1EA 3K72A 1PGUA 2BKLA 2EICA 3MVDK 2QR5A 2OVRB 5HDBA 3UVOA 2PM6B 4WK2A 3I2NA 2I3SA 3IUJA 3IUMA 4WJKA 2TRCB 1H2WA 2CE9A 5E6RA 3IJEA 4E54B 3IJCA 3O4HA 5CYKA 2EIEA 5GSAA 5CXCA 3JZHA 1RI6A 1PI6A 4UM9A 4ZOYA 3B7FA 4NENA 4ERYA 3V4VA 3AL8A 3FCSA 4J82A 1BPOA 4QQEA 4BL0A 3DM0A 2YNPA 2CO0A 4EWRA 4GM3A 3K26A 5K1CC 4U1EI 4QT8A 4G56B 2CNXA 3SLED 2P9KC 1JJUB 2EBSA 1JTDB 2P9UC 4MK0B 4FAVD 3L4MD 4Y5RD 1GOFA
chains in the Genus database with same CATH topology
4FA4D 3VGZA 4FHLA 2CE8A 4AEZA 4GQ2P 3CFSB 4OZUA 3KRWB 1N6EA 3KRXB 3V9FA 3RLMD 5HE1B 5C9ZB 4JT5C 4O45A 3J81g 2H3XA 3JROA 5HE3B 2Z2NA 5FA5B 3I7NA 1ERJA 3SBQA 5IGQA 2P9IC 4X60B 3J80g 4CY1A 2G99A 3N0DA 3IKOA 4GQ1A 3OW8A 2I0TA 3RFHA 2AH0A 4IMMA 2IUQA 4CC9A 1QNIA 4A08A 3I7LA 4Y7RA 3NVXA 2YB8B 4J8GA 2HJBA 3JPXA 3SBRA 1B9XA 4FB1D 5HQGA 3BG0A 2I0RA 4CI8A 3SVWD 3EI1A 4LGNA 2H6KA 5TEEA 4ERQA 2HESX 4GGCA 2OK4A 2H9LA 3PXWD 3IIWA 5EM2A 3PSLA 3UVKA 4BH6A 5FKSA 5C2VB 3FRXA 4HDJA 3SXTD 3MMYA 2XU7A 5C2WB 2IWKA 4K3JB 3EI4B 5TDHB 2GC4A 3L4OD 2XL3A 5A2Qg 1GP2B 3UVLA 3FM0A 3FGBA 4ESGA 3JRPA 2OK6A 4J0WA 4O3UB 4OWRA 2PM9A 1VYHC 1GG2B 4J86A 2OIZA 2UZXB 4GM8A 3RN0D 3RN1D 4H5JA 2IWFA 3OKTA 1S4UX 5IT9g 5CXBB 5GXIA 3OL2B 3C99A 3EI2A 4A0BA 2HKMA 4O1QD 3UKUC 4J8BA 3CFVA 3IJ0A 4E5ZA 2XL2A 3I8EA 1TYQC 3PE7A 3SWSD 3DWLC 4CZYA 1JMXB 4J78A 4A2LA 1A0RB 2OVQB 5H17A 5EMKB 4J77A 4FA5D 2AGLA 3JB9L 3EI3B 2Q7QA 3NVNA 4A11A 4R7AB 2H14A 2Z2OA 2I3TA 2HKRA 2CO0C 3AFCA 4ZOXA 4CZXA 3EMHA 3PXTD 3OKYB 1K8KC 4JSNC 3MZLA 4GZ8A 5FKQA 2H68A 4A0AA 2AGWA 2B5LA 3UVMA 4PSWB 5IJ7E 4QRJA 4JSXC 3MKSB 2AH1A 1Q47A 1OLZA 4A09A 2AGXA 5H1MA 4O3TB 5I5JA 5EMLB 2CN2A 4PBYA 3DXKC 4A7JA 1NEXB 4X63B 4ERZA 4JSPC 2O9KA 2IURA 1SHYB 4D6VA 1GXRA 4GGAA 3I89A 5CYKB 5CXCB 1JMZB 3U4YA 4JT6C 2W18A 3AL8B 5GMKn 2J55H 4ZOZA 3F3FA 3GREA 4KFMB 5B4WA 3W15A 4QL1A 4PBZA 2HYEA 5HE2B 4D0KA 1SQJA 2H47A 1U2VC 5AJAA 4PC0A 2AQ5A 4NSXA 5EARA 3SHFA 2H9PA 5AMSA 3EG6A 2AGYA 3DSMA 3DXMC 1N6FA 4YVDA 2H6QA 5EAPA 4X3EA 3K27A 3C75H 3PSCB 3F3PA 4L3HD 4ZOVA 5H14A 2PBIB 4K3ID 3CIKB 3OL2A 4CY5A 3I7OA 3SFZA 5FKTA 4Z8LA 4XYHA 2B4EA 2G9AA 2H6NA 2IAAA 3C9CA 3OKWA 4JXMA 4IA9A 4A08B 3F3GA 1NR0A 2P9NC 3PVWB 2YMUA 3PXSD 4L1QD 5TEFA 2CN3A 3ODTA 4E54A 4PXWA 4J0XA 3JAMg 3EI1B 5FQDA 1YFQA 2YBAA 5EALA 2H9NA 1SQ9A 4GGDA 2YNNA 1PBYB 3NVQA 5IC7A 5EM2B 5EMMB 3JZGA 3AL9A 1N6DA 3A0FA 4CI2A 1MG3A 1FWXA 1PEVA 3EWEA 1L0QA 4O9DA 2AGZA 4FAND 4J81A 3EU7A 3I7KA 4GMBA 4U7AA 4JD2C 2H9MA 1XHMA 2YNOA 5AFU3 2HXCA 5HE0B 1B9YA 5K19A 1JOFA 3I7HA 3AH8B 4PSXB 3BWSA 3IIYA 1K32A 2PM9B 4CZVA 2OVPB 4J73A 2IUPA 1MG2A 3V7DB 3I8CA 4L3GD 2HJ4A 5TF2A 4AOWA 4UI9R 3ORVD 2P9LC 3EI2B 4JSVC 2GC7A 3UVNA 4A0BB 3MXXA 3HFQA 5FLXg 2P9SC 4E5ZB 2GNQA 4XYIA 2BCJB 3JZNA 5EAMA 4FA1D 4J87A 3UKRC 3SCYA 4GM9A 5THAA 1OMWB 3OTTA 3SJLD 4ZN4A 5HYNB 1P22A 2XYIA 3RFGA 5IGOA 1R5MA 4A11B 3P4FA 4PNKB 4CY3A 3SBPA 5IJ8E 4A2MA 3ZWLB 3SMRA 2UZYB 2MTAH 1XIPA 3N0EA 5JWZA 5KDOB 5FKRA 4A0AB 2H13A 2B5NA 5FXYA 4CY2A 2P9PC 4ES0A 3EI4A 4BUJC 3E0CA 3MZKA 1GOTB 4A09B 1MDAH 4LG8A 3V5WB 2OJYA 3GFCA 3BG1A 4GQBB 4TZ4A 3IJ1A 3VH0A 4L9OA 4X61B 5GXHA 2B5MA 4N14A 4CI1A 5CXBA 5I5MA 1TBGA 2QC5A 3UR4A 1XKSA 4I79A 3ULEC 2J57G 4H5IA 3PVUB 2BBKH 3VA6A 3RSEC 3RRMC 2Z2PA 1U4CA 5SXMA 2IUVA 3EI3A 4XEIC 4J79A 2PM7B 4J84A 3SN6B 5EMJB 2QXVA 2I0SA 3OKYA 2J56H 3MKQA 3RMZD 3I7PA 4CI3A 5I5IA 4FWWA 3C5MA 4LG9A 4FA9D 1PGUA 2OVRB 3UVOA 2PM6B 3I2NA 2I3SA 2TRCB 2CE9A 4E54B 3IJCA 5CYKA 5GSAA 5CXCA 3JZHA 1RI6A 1PI6A 4ZOYA 3B7FA 4ERYA 3AL8A 4J82A 4QQEA 4BL0A 3DM0A 2YNPA 2CO0A 4EWRA 4GM3A 3K26A 5K1CC 4U1EI 4QT8A 4G56B 2CNXA 3SLED 2P9KC 1JJUB 2EBSA 2P9UC 4FAVD 4MK0B 3L4MD 4Y5RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 D;  3VGZ A;  4FHL A;  2CE8 A;  4AEZ A;  4GQ2 P;  3CFS B;  4OZU A;  3KRW B;  1N6E A;  3KRX B;  3V9F A;  3RLM D;  5HE1 B;  5C9Z B;  4JT5 C;  4O45 A;  3J81 g;  2H3X A;  3JRO A;  5HE3 B;  2Z2N A;  5FA5 B;  3I7N A;  1ERJ A;  3SBQ A;  5IGQ A;  2P9I C;  4X60 B;  3J80 g;  4CY1 A;  2G99 A;  3N0D A;  3IKO A;  4GQ1 A;  3OW8 A;  2I0T A;  3RFH A;  2AH0 A;  4IMM A;  2IUQ A;  4CC9 A;  1QNI A;  4A08 A;  3I7L A;  4Y7R A;  3NVX A;  2YB8 B;  4J8G A;  2HJB A;  3JPX A;  3SBR A;  1B9X A;  4FB1 D;  5HQG A;  3BG0 A;  2I0R A;  4CI8 A;  3SVW D;  3EI1 A;  4LGN A;  2H6K A;  5TEE A;  4ERQ A;  2HES X;  4GGC A;  2OK4 A;  2H9L A;  3PXW D;  3IIW A;  5EM2 A;  3PSL A;  3UVK A;  4BH6 A;  5FKS A;  5C2V B;  3FRX A;  4HDJ A;  3SXT D;  3MMY A;  2XU7 A;  5C2W B;  2IWK A;  4K3J B;  3EI4 B;  5TDH B;  2GC4 A;  3L4O D;  2XL3 A;  5A2Q g;  1GP2 B;  3UVL A;  3FM0 A;  3FGB A;  4ESG A;  3JRP A;  2OK6 A;  4J0W A;  4O3U B;  4OWR A;  2PM9 A;  1VYH C;  1GG2 B;  4J86 A;  2OIZ A;  2UZX B;  4GM8 A;  3RN0 D;  3RN1 D;  4H5J A;  2IWF A;  3OKT A;  1S4U X;  5IT9 g;  5CXB B;  5GXI A;  3OL2 B;  3C99 A;  3EI2 A;  4A0B A;  2HKM A;  4O1Q D;  3UKU C;  4J8B A;  3CFV A;  3IJ0 A;  4E5Z A;  2XL2 A;  3I8E A;  1TYQ C;  3PE7 A;  3SWS D;  3DWL C;  4CZY A;  1JMX B;  4J78 A;  4A2L A;  1A0R B;  2OVQ B;  5H17 A;  5EMK B;  4J77 A;  4FA5 D;  2AGL A;  3JB9 L;  3EI3 B;  2Q7Q A;  3NVN A;  4A11 A;  4R7A B;  2H14 A;  2Z2O A;  2I3T A;  2HKR A;  2CO0 C;  3AFC A;  4ZOX A;  4CZX A;  3EMH A;  3PXT D;  3OKY B;  1K8K C;  4JSN C;  3MZL A;  4GZ8 A;  5FKQ A;  2H68 A;  4A0A A;  2AGW A;  2B5L A;  3UVM A;  4PSW B;  5IJ7 E;  4QRJ A;  4JSX C;  3MKS B;  2AH1 A;  1Q47 A;  1OLZ A;  4A09 A;  2AGX A;  5H1M A;  4O3T B;  5I5J A;  5EML B;  2CN2 A;  4PBY A;  3DXK C;  4A7J A;  1NEX B;  4X63 B;  4ERZ A;  4JSP C;  2O9K A;  2IUR A;  1SHY B;  4D6V A;  1GXR A;  4GGA A;  3I89 A;  5CYK B;  5CXC B;  1JMZ B;  3U4Y A;  4JT6 C;  2W18 A;  3AL8 B;  5GMK n;  2J55 H;  4ZOZ A;  3F3F A;  3GRE A;  4KFM B;  5B4W A;  3W15 A;  4QL1 A;  4PBZ A;  2HYE A;  5HE2 B;  4D0K A;  1SQJ A;  2H47 A;  1U2V C;  5AJA A;  4PC0 A;  2AQ5 A;  4NSX A;  5EAR A;  3SHF A;  2H9P A;  5AMS A;  3EG6 A;  2AGY A;  3DSM A;  3DXM C;  1N6F A;  4YVD A;  2H6Q A;  5EAP A;  4X3E A;  3K27 A;  3C75 H;  3PSC B;  3F3P A;  4L3H D;  4ZOV A;  5H14 A;  2PBI B;  4K3I D;  3CIK B;  3OL2 A;  4CY5 A;  3I7O A;  3SFZ A;  5FKT A;  4Z8L A;  4XYH A;  2B4E A;  2G9A A;  2H6N A;  2IAA A;  3C9C A;  3OKW A;  4JXM A;  4IA9 A;  4A08 B;  3F3G A;  1NR0 A;  2P9N C;  3PVW B;  2YMU A;  3PXS D;  4L1Q D;  5TEF A;  2CN3 A;  3ODT A;  4E54 A;  4PXW A;  4J0X A;  3JAM g;  3EI1 B;  5FQD A;  1YFQ A;  2YBA A;  5EAL A;  2H9N A;  1SQ9 A;  4GGD A;  2YNN A;  1PBY B;  3NVQ A;  5IC7 A;  5EM2 B;  5EMM B;  3JZG A;  3AL9 A;  1N6D A;  3A0F A;  4CI2 A;  1MG3 A;  1FWX A;  1PEV A;  3EWE A;  1L0Q A;  4O9D A;  2AGZ A;  4FAN D;  4J81 A;  3EU7 A;  3I7K A;  4GMB A;  4U7A A;  4JD2 C;  2H9M A;  1XHM A;  2YNO A;  5AFU 3;  2HXC A;  5HE0 B;  1B9Y A;  5K19 A;  1JOF A;  3I7H A;  3AH8 B;  4PSX B;  3BWS A;  3IIY A;  1K32 A;  2PM9 B;  4CZV A;  2OVP B;  4J73 A;  2IUP A;  1MG2 A;  3V7D B;  3I8C A;  4L3G D;  2HJ4 A;  5TF2 A;  4AOW A;  4UI9 R;  3ORV D;  2P9L C;  3EI2 B;  4JSV C;  2GC7 A;  3UVN A;  4A0B B;  3MXX A;  3HFQ A;  5FLX g;  2P9S C;  4E5Z B;  2GNQ A;  4XYI A;  2BCJ B;  3JZN A;  5EAM A;  4FA1 D;  4J87 A;  3UKR C;  3SCY A;  4GM9 A;  5THA A;  1OMW B;  3OTT A;  3SJL D;  4ZN4 A;  5HYN B;  1P22 A;  2XYI A;  3RFG A;  5IGO A;  1R5M A;  4A11 B;  3P4F A;  4PNK B;  4CY3 A;  3SBP A;  5IJ8 E;  4A2M A;  3ZWL B;  3SMR A;  2UZY B;  2MTA H;  1XIP A;  3N0E A;  5JWZ A;  5KDO B;  5FKR A;  4A0A B;  2H13 A;  2B5N A;  5FXY A;  4CY2 A;  2P9P C;  4ES0 A;  3EI4 A;  4BUJ C;  3E0C A;  3MZK A;  1GOT B;  4A09 B;  1MDA H;  4LG8 A;  3V5W B;  2OJY A;  3GFC A;  3BG1 A;  4GQB B;  4TZ4 A;  3IJ1 A;  3VH0 A;  4L9O A;  4X61 B;  5GXH A;  2B5M A;  4N14 A;  4CI1 A;  5CXB A;  5I5M A;  1TBG A;  2QC5 A;  3UR4 A;  1XKS A;  4I79 A;  3ULE C;  2J57 G;  4H5I A;  3PVU B;  2BBK H;  3VA6 A;  3RSE C;  3RRM C;  2Z2P A;  1U4C A;  5SXM A;  2IUV A;  3EI3 A;  4XEI C;  4J79 A;  2PM7 B;  4J84 A;  3SN6 B;  5EMJ B;  2QXV A;  2I0S A;  3OKY A;  2J56 H;  3MKQ A;  3RMZ D;  3I7P A;  4CI3 A;  5I5I A;  4FWW A;  3C5M A;  4LG9 A;  4FA9 D;  1PGU A;  2OVR B;  3UVO A;  2PM6 B;  3I2N A;  2I3S A;  2TRC B;  2CE9 A;  4E54 B;  3IJC A;  5CYK A;  5GSA A;  5CXC A;  3JZH A;  1RI6 A;  1PI6 A;  4ZOY A;  3B7F A;  4ERY A;  3AL8 A;  4J82 A;  4QQE A;  4BL0 A;  3DM0 A;  2YNP A;  2CO0 A;  4EWR A;  4GM3 A;  3K26 A;  5K1C C;  4U1E I;  4QT8 A;  4G56 B;  2CNX A;  3SLE D;  2P9K C;  1JJU B;  2EBS A;  2P9U C;  4FAV D;  4MK0 B;  3L4M D;  4Y5R D; 
#chains in the Genus database with same CATH topology
 3VI3 A;  4FA4 D;  3VGZ A;  4FHL A;  2CE8 A;  4AEZ A;  4GQ2 P;  1L5G A;  3CFS B;  4BP9 A;  4OZU A;  2VDR A;  3KRW B;  5M5T A;  1N6E A;  3KRX B;  3V9F A;  3RLM D;  5HE1 B;  5C9Z B;  2VZ1 A;  4JT5 C;  4O45 A;  3J81 g;  2H3X A;  3JRO A;  5HE3 B;  2Z2N A;  2VDK A;  2EID A;  2XE4 A;  5FA5 B;  3DDU A;  3I7N A;  1ERJ A;  3SBQ A;  5IGQ A;  4DNV A;  1E5T A;  2P9I C;  5M61 A;  4X60 B;  3J80 g;  4G1M A;  4CY1 A;  2G99 A;  3N0D A;  3IKO A;  3ZE1 A;  4GQ1 A;  4O02 A;  3OW8 A;  4BCC A;  2I0T A;  3RFH A;  2AH0 A;  4IMM A;  2IUQ A;  3IUR A;  4MMZ A;  5C86 A;  5E6S A;  4CC9 A;  1QNI A;  4A08 A;  3I7L A;  3O4I A;  4Y7R A;  2XDW A;  3NVX A;  2YB8 B;  4J8G A;  2HJB A;  3JPX A;  3SBR A;  1B9X A;  4FB1 D;  5HQG A;  3BG0 A;  1VE6 A;  5C92 A;  2I0R A;  4CI8 A;  3SVW D;  3EI1 A;  4LGN A;  2H6K A;  5TEE A;  4ERQ A;  4RE5 A;  2HES X;  4GGC A;  2WQ8 A;  2OK4 A;  1VE7 A;  2H9L A;  3PXW D;  3IIW A;  5EM2 A;  3PSL A;  3UVK A;  3K6S A;  4BH6 A;  5FKS A;  4BCB A;  5C2V B;  3FRX A;  4HDJ A;  3SXT D;  3IVM A;  3MMY A;  2XU7 A;  3FCU A;  5C2W B;  2IWK A;  4NAA A;  4BCD A;  4K3J B;  3EI4 B;  1GOG A;  5TDH B;  2GC4 A;  3L4O D;  2XL3 A;  5A2Q g;  1GP2 B;  3UVL A;  2QZP A;  3FM0 A;  1H2X A;  3FGB A;  4ESG A;  3JRP A;  1YR2 A;  3NID A;  2OK6 A;  4J0W A;  3IUN A;  4O3U B;  1UOQ A;  4OWR A;  2PM9 A;  3GD1 I;  4RE6 A;  3ZDY A;  1VYH C;  4IRZ A;  1GG2 B;  1O6G A;  4J86 A;  2OIZ A;  2UZX B;  4GM8 A;  3RN0 D;  3RN1 D;  4H5J A;  2IWF A;  3OKT A;  1S4U X;  4UM8 A;  5IT9 g;  5CXB B;  5GXI A;  3OL2 B;  3C99 A;  3ZE0 A;  3EI2 A;  4Z7N A;  3QI0 A;  4A0B A;  2HKM A;  4O1Q D;  3UKU C;  4J8B A;  2HU5 A;  3CFV A;  3IJ0 A;  4E5Z A;  2XL2 A;  3I8E A;  1GOH A;  1TYQ C;  3PE7 A;  3SWS D;  3DWL C;  4L1M A;  4CZY A;  1JMX B;  4J78 A;  4A2L A;  1UOP A;  1A0R B;  2OVQ B;  5H17 A;  5EMK B;  3KCI A;  4J77 A;  4FA5 D;  2AGL A;  2VDL A;  3JB9 L;  3EI3 B;  2Q7Q A;  3NVN A;  4A11 A;  4R7A B;  2H14 A;  2Z2O A;  4WK0 A;  4AN0 A;  2I3T A;  2HKR A;  2CO0 C;  3ZDZ A;  1T2X A;  3AFC A;  3IUL A;  5M5S A;  4ZOX A;  4CZX A;  3EMH A;  3PXT D;  5E6U A;  3OKY B;  1K8K C;  4JSN C;  3MZL A;  4GZ8 A;  3NIF A;  5FKQ A;  2H68 A;  4A0A A;  2AGW A;  2B5L A;  3UVM A;  4PSW B;  3O4J A;  3ZDX A;  5IJ7 E;  4QRJ A;  4JSX C;  3MKS B;  2AH1 A;  1Q47 A;  1OLZ A;  4A09 A;  2AGX A;  3QHY B;  5H1M A;  4O3T B;  5I5J A;  5EML B;  2CN2 A;  4PBY A;  3DXK C;  4A7J A;  1NEX B;  4X63 B;  1M1X A;  4ERZ A;  4JSP C;  2O9K A;  2IUR A;  1SHY B;  4D6V A;  1GXR A;  4GGA A;  5M5V A;  3I89 A;  3IUQ A;  5CYK B;  4D9S A;  5CXC B;  2VC2 A;  2VDQ A;  1JMZ B;  1E8M A;  3U4Y A;  1H2Z A;  4JT6 C;  2W18 A;  3AL8 B;  5GMK n;  2J55 H;  4ZOZ A;  3F3F A;  3GRE A;  4KFM B;  5B4W A;  3W15 A;  3K71 A;  2JKX A;  4QL1 A;  4PBZ A;  2HYE A;  5HE2 B;  3MUN A;  4D0K A;  1SQJ A;  2H47 A;  1QFS A;  1U2V C;  5AJA A;  4PC0 A;  3EQ7 A;  4NC4 A;  2AQ5 A;  4NSX A;  5EAR A;  3SHF A;  2H9P A;  5AMS A;  3EG6 A;  2VDO A;  2AGY A;  2HU7 A;  3DSM A;  4O2W A;  4BP8 A;  3DXM C;  1N6F A;  1VZ2 A;  4YVD A;  2XZG A;  2H6Q A;  5EAP A;  4X3E A;  3K27 A;  3C75 H;  3PSC B;  3F3P A;  5M5U A;  4L3H D;  4ZOV A;  5H14 A;  1I2M B;  2PBI B;  4K3I D;  3CIK B;  3ZE2 A;  3OL2 A;  4CY5 A;  3I7O A;  3SFZ A;  5FKT A;  4Z8L A;  4AMY A;  4XYH A;  2B4E A;  2HU8 A;  2G9A A;  5M5R A;  2H6N A;  2IAA A;  3C9C A;  4MMX A;  3VI4 A;  3OKW A;  4IA9 A;  4JXM A;  4A08 B;  3F3G A;  1NR0 A;  2P9N C;  3PVW B;  2YMU A;  3PXS D;  4L1Q D;  5TEF A;  2CN3 A;  3ODT A;  4E54 A;  4PXW A;  4J0X A;  3JAM g;  3EI1 B;  5FQD A;  4AX4 A;  1YFQ A;  4NBM A;  2YBA A;  5EAL A;  2H9N A;  1SQ9 A;  4GGD A;  2YNN A;  1PBY B;  3NVQ A;  5IC7 A;  5EM2 B;  5EMM B;  3JZG A;  3AL9 A;  1N6D A;  3A0F A;  4CI2 A;  1MG3 A;  1FWX A;  1PEV A;  3EWE A;  1L0Q A;  2EIB A;  2AGZ A;  4O9D A;  4J81 A;  4FAN D;  3EU7 A;  3I7K A;  4G55 A;  4GMB A;  4U7A A;  4JD2 C;  2H9M A;  1XHM A;  2YNO A;  5AFU 3;  2HXC A;  5HE0 B;  1B9Y A;  2VZ3 A;  5K19 A;  1JOF A;  3I7H A;  3AH8 B;  1U8C A;  4PSX B;  3BWS A;  3IIY A;  1K32 A;  2PM9 B;  4CZV A;  4Z7O A;  2OVP B;  4AN1 A;  3O4G A;  4J73 A;  2IUP A;  1MG2 A;  3V7D B;  2VDM A;  3I8C A;  4L3G D;  2HJ4 A;  5TF2 A;  4AOW A;  4DNW A;  4UI9 R;  1H2Y A;  3ORV D;  2P9L C;  3NIG A;  3T3M A;  4JSV C;  2GC7 A;  3UVN A;  3EI2 B;  4A0B B;  4QAM A;  3MXX A;  3HFQ A;  5FLX g;  2P9S C;  4E5Z B;  2GNQ A;  3OF7 A;  4XYI A;  2BCJ B;  3JZN A;  5EAM A;  4FA1 D;  4J87 A;  3UKR C;  3SCY A;  1C9L A;  2VDP A;  3EQ8 A;  4GM9 A;  5THA A;  1OMW B;  3OTT A;  3SJL D;  4ZN4 A;  5HYN B;  1P22 A;  4WK4 A;  2XYI A;  3RFG A;  5IGO A;  1R5M A;  4A11 B;  3P4F A;  3MUO A;  4PNK B;  4CY3 A;  3SBP A;  1UTC A;  5IJ8 E;  4A2M A;  1O6F A;  3ZWL B;  3SMR A;  2UZY B;  1JV2 A;  4DNU A;  2MTA H;  1XIP A;  3N0E A;  5JWZ A;  5KDO B;  5FKR A;  4A0A B;  1QFM A;  2H13 A;  2B5N A;  5FXY A;  4CY2 A;  2P9P C;  4ES0 A;  3EI4 A;  3EQ9 A;  4BUJ C;  3E0C A;  3MZK A;  1GOT B;  4A09 B;  1MDA H;  1K3I A;  4LG8 A;  3V5W B;  2OJY A;  3GFC A;  3BG1 A;  4GQB B;  4TZ4 A;  3IJ1 A;  3VH0 A;  4L9O A;  4X61 B;  5GXH A;  3V4P A;  1UOO A;  2B5M A;  4N14 A;  4CI1 A;  5CXB A;  5I5M A;  1TYE A;  1TBG A;  1A12 A;  2QC5 A;  1VZ3 A;  1E8N A;  3T3P A;  3UR4 A;  1XKS A;  4I79 A;  3ULE C;  2J57 G;  4H5I A;  2VDN A;  4MMY A;  1C9I A;  3PVU B;  5FFG A;  2BBK H;  3VA6 A;  3RSE C;  3RRM C;  2Z2P A;  1U4C A;  5SXM A;  2IUV A;  3EI3 A;  3GC3 B;  4Z7Q A;  4XEI C;  4J79 A;  2PM7 B;  4J84 A;  4JHP C;  3SN6 B;  4JHN A;  5EMJ B;  2QXV A;  4AMZ A;  2I0S A;  3OKY A;  5FFO A;  2J56 H;  3MKQ A;  3RMZ D;  3I7P A;  4CI3 A;  5I5I A;  4FWW A;  3C5M A;  4LG9 A;  4FA9 D;  4G1E A;  3K72 A;  1PGU A;  2BKL A;  2EIC A;  3MVD K;  2QR5 A;  2OVR B;  5HDB A;  3UVO A;  2PM6 B;  4WK2 A;  3I2N A;  2I3S A;  3IUJ A;  3IUM A;  4WJK A;  2TRC B;  1H2W A;  2CE9 A;  5E6R A;  3IJE A;  4E54 B;  3IJC A;  3O4H A;  5CYK A;  2EIE A;  5GSA A;  5CXC A;  3JZH A;  1RI6 A;  1PI6 A;  4UM9 A;  4ZOY A;  3B7F A;  4NEN A;  4ERY A;  3V4V A;  3AL8 A;  3FCS A;  4J82 A;  1BPO A;  4QQE A;  4BL0 A;  3DM0 A;  2YNP A;  2CO0 A;  4EWR A;  4GM3 A;  3K26 A;  5K1C C;  4U1E I;  4QT8 A;  4G56 B;  2CNX A;  3SLE D;  2P9K C;  1JJU B;  2EBS A;  1JTD B;  2P9U C;  4MK0 B;  4FAV D;  3L4M D;  4Y5R D;  1GOF A; 
#chains in the Genus database with same CATH homology
 4FA4 D;  3VGZ A;  4FHL A;  2CE8 A;  4AEZ A;  4GQ2 P;  3CFS B;  4OZU A;  3KRW B;  1N6E A;  3KRX B;  3V9F A;  3RLM D;  5HE1 B;  5C9Z B;  4JT5 C;  4O45 A;  3J81 g;  2H3X A;  3JRO A;  5HE3 B;  2Z2N A;  5FA5 B;  3I7N A;  1ERJ A;  3SBQ A;  5IGQ A;  2P9I C;  4X60 B;  3J80 g;  4CY1 A;  2G99 A;  3N0D A;  3IKO A;  4GQ1 A;  3OW8 A;  2I0T A;  3RFH A;  2AH0 A;  4IMM A;  2IUQ A;  4CC9 A;  1QNI A;  4A08 A;  3I7L A;  4Y7R A;  3NVX A;  2YB8 B;  4J8G A;  2HJB A;  3JPX A;  3SBR A;  1B9X A;  4FB1 D;  5HQG A;  3BG0 A;  2I0R A;  4CI8 A;  3SVW D;  3EI1 A;  4LGN A;  2H6K A;  5TEE A;  4ERQ A;  2HES X;  4GGC A;  2OK4 A;  2H9L A;  3PXW D;  3IIW A;  5EM2 A;  3PSL A;  3UVK A;  4BH6 A;  5FKS A;  5C2V B;  3FRX A;  4HDJ A;  3SXT D;  3MMY A;  2XU7 A;  5C2W B;  2IWK A;  4K3J B;  3EI4 B;  5TDH B;  2GC4 A;  3L4O D;  2XL3 A;  5A2Q g;  1GP2 B;  3UVL A;  3FM0 A;  3FGB A;  4ESG A;  3JRP A;  2OK6 A;  4J0W A;  4O3U B;  4OWR A;  2PM9 A;  1VYH C;  1GG2 B;  4J86 A;  2OIZ A;  2UZX B;  4GM8 A;  3RN0 D;  3RN1 D;  4H5J A;  2IWF A;  3OKT A;  1S4U X;  5IT9 g;  5CXB B;  5GXI A;  3OL2 B;  3C99 A;  3EI2 A;  4A0B A;  2HKM A;  4O1Q D;  3UKU C;  4J8B A;  3CFV A;  3IJ0 A;  4E5Z A;  2XL2 A;  3I8E A;  1TYQ C;  3PE7 A;  3SWS D;  3DWL C;  4CZY A;  1JMX B;  4J78 A;  4A2L A;  1A0R B;  2OVQ B;  5H17 A;  5EMK B;  4J77 A;  4FA5 D;  2AGL A;  3JB9 L;  3EI3 B;  2Q7Q A;  3NVN A;  4A11 A;  4R7A B;  2H14 A;  2Z2O A;  2I3T A;  2HKR A;  2CO0 C;  3AFC A;  4ZOX A;  4CZX A;  3EMH A;  3PXT D;  3OKY B;  1K8K C;  4JSN C;  3MZL A;  4GZ8 A;  5FKQ A;  2H68 A;  4A0A A;  2AGW A;  2B5L A;  3UVM A;  4PSW B;  5IJ7 E;  4QRJ A;  4JSX C;  3MKS B;  2AH1 A;  1Q47 A;  1OLZ A;  4A09 A;  2AGX A;  5H1M A;  4O3T B;  5I5J A;  5EML B;  2CN2 A;  4PBY A;  3DXK C;  4A7J A;  1NEX B;  4X63 B;  4ERZ A;  4JSP C;  2O9K A;  2IUR A;  1SHY B;  4D6V A;  1GXR A;  4GGA A;  3I89 A;  5CYK B;  5CXC B;  1JMZ B;  3U4Y A;  4JT6 C;  2W18 A;  3AL8 B;  5GMK n;  2J55 H;  4ZOZ A;  3F3F A;  3GRE A;  4KFM B;  5B4W A;  3W15 A;  4QL1 A;  4PBZ A;  2HYE A;  5HE2 B;  4D0K A;  1SQJ A;  2H47 A;  1U2V C;  5AJA A;  4PC0 A;  2AQ5 A;  4NSX A;  5EAR A;  3SHF A;  2H9P A;  5AMS A;  3EG6 A;  2AGY A;  3DSM A;  3DXM C;  1N6F A;  4YVD A;  2H6Q A;  5EAP A;  4X3E A;  3K27 A;  3C75 H;  3PSC B;  3F3P A;  4L3H D;  4ZOV A;  5H14 A;  2PBI B;  4K3I D;  3CIK B;  3OL2 A;  4CY5 A;  3I7O A;  3SFZ A;  5FKT A;  4Z8L A;  4XYH A;  2B4E A;  2G9A A;  2H6N A;  2IAA A;  3C9C A;  3OKW A;  4JXM A;  4IA9 A;  4A08 B;  3F3G A;  1NR0 A;  2P9N C;  3PVW B;  2YMU A;  3PXS D;  4L1Q D;  5TEF A;  2CN3 A;  3ODT A;  4E54 A;  4PXW A;  4J0X A;  3JAM g;  3EI1 B;  5FQD A;  1YFQ A;  2YBA A;  5EAL A;  2H9N A;  1SQ9 A;  4GGD A;  2YNN A;  1PBY B;  3NVQ A;  5IC7 A;  5EM2 B;  5EMM B;  3JZG A;  3AL9 A;  1N6D A;  3A0F A;  4CI2 A;  1MG3 A;  1FWX A;  1PEV A;  3EWE A;  1L0Q A;  4O9D A;  2AGZ A;  4FAN D;  4J81 A;  3EU7 A;  3I7K A;  4GMB A;  4U7A A;  4JD2 C;  2H9M A;  1XHM A;  2YNO A;  5AFU 3;  2HXC A;  5HE0 B;  1B9Y A;  5K19 A;  1JOF A;  3I7H A;  3AH8 B;  4PSX B;  3BWS A;  3IIY A;  1K32 A;  2PM9 B;  4CZV A;  2OVP B;  4J73 A;  2IUP A;  1MG2 A;  3V7D B;  3I8C A;  4L3G D;  2HJ4 A;  5TF2 A;  4AOW A;  4UI9 R;  3ORV D;  2P9L C;  3EI2 B;  4JSV C;  2GC7 A;  3UVN A;  4A0B B;  3MXX A;  3HFQ A;  5FLX g;  2P9S C;  4E5Z B;  2GNQ A;  4XYI A;  2BCJ B;  3JZN A;  5EAM A;  4FA1 D;  4J87 A;  3UKR C;  3SCY A;  4GM9 A;  5THA A;  1OMW B;  3OTT A;  3SJL D;  4ZN4 A;  5HYN B;  1P22 A;  2XYI A;  3RFG A;  5IGO A;  1R5M A;  4A11 B;  3P4F A;  4PNK B;  4CY3 A;  3SBP A;  5IJ8 E;  4A2M A;  3ZWL B;  3SMR A;  2UZY B;  2MTA H;  1XIP A;  3N0E A;  5JWZ A;  5KDO B;  5FKR A;  4A0A B;  2H13 A;  2B5N A;  5FXY A;  4CY2 A;  2P9P C;  4ES0 A;  3EI4 A;  4BUJ C;  3E0C A;  3MZK A;  1GOT B;  4A09 B;  1MDA H;  4LG8 A;  3V5W B;  2OJY A;  3GFC A;  3BG1 A;  4GQB B;  4TZ4 A;  3IJ1 A;  3VH0 A;  4L9O A;  4X61 B;  5GXH A;  2B5M A;  4N14 A;  4CI1 A;  5CXB A;  5I5M A;  1TBG A;  2QC5 A;  3UR4 A;  1XKS A;  4I79 A;  3ULE C;  2J57 G;  4H5I A;  3PVU B;  2BBK H;  3VA6 A;  3RSE C;  3RRM C;  2Z2P A;  1U4C A;  5SXM A;  2IUV A;  3EI3 A;  4XEI C;  4J79 A;  2PM7 B;  4J84 A;  3SN6 B;  5EMJ B;  2QXV A;  2I0S A;  3OKY A;  2J56 H;  3MKQ A;  3RMZ D;  3I7P A;  4CI3 A;  5I5I A;  4FWW A;  3C5M A;  4LG9 A;  4FA9 D;  1PGU A;  2OVR B;  3UVO A;  2PM6 B;  3I2N A;  2I3S A;  2TRC B;  2CE9 A;  4E54 B;  3IJC A;  5CYK A;  5GSA A;  5CXC A;  3JZH A;  1RI6 A;  1PI6 A;  4ZOY A;  3B7F A;  4ERY A;  3AL8 A;  4J82 A;  4QQE A;  4BL0 A;  3DM0 A;  2YNP A;  2CO0 A;  4EWR A;  4GM3 A;  3K26 A;  5K1C C;  4U1E I;  4QT8 A;  4G56 B;  2CNX A;  3SLE D;  2P9K C;  1JJU B;  2EBS A;  2P9U C;  4FAV D;  4MK0 B;  3L4M D;  4Y5R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...