4HDJA

Crystal structure of bamb from pseudomonas aeruginosa
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
355
structure length
355
Chain Sequence
b'PPAELTDFKEEVVLSKQWSRSVGDGQGDLYNLLEPAVDGSTIYAASAEGRVMAIQRETGDVLWKKDLERPVSGGVGVGYGLVLVGTLRGDVIALDEATGKKKWTKRVNSEVLSAPATNGDVVVVQTQDDKLIGLDAASGDQRWIYESTVPVLTLRGTGAPLIAGNMALAGLASGKVVAVDVQRGLPIWEQRVAIPQGRSELDRVVDIDGGLLLSGDTLYVVSYQGRAAALDVNSGRLLWQREASSYVGVAEGFGNIYVSQASGSVEGLDSRGASSLWNNDALARRQLSAPAVFSSNVVVGDLEGYVHLLSQVDGRFVGRERVDSDGVRVRPLVVGSWMYVFGNGGKLVAYTIRPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamB
publication title Crystal structure of BamB from Pseudomonas aeruginosa and functional evaluation of its conserved structural features.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein binding
total genus 88
structure length 355
sequence length 355
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13360 PQQ_2 PQQ-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4hdjA00
3SBQA 2CE8A 1GOTB 3OKYA 4IMMA 4A08B 4PBZA 4E5ZB 3F3GA 3I2NA 5THAA 4ERYA 3OKWA 2H9PA 3C9CA 5GXIA 1JMZB 3N0DA 3MXXA 3UR4A 3DWLC 3AL9A 4GGDA 2CN3A 2YNOA 3JRPA 4GM3A 1N6FA 1PGUA 5H14A 1TYQC 2B5NA 4N14A 3OKTA 3OTTA 4R7AB 5TEEA 5IT9g 3EU7A 2CNXA 4O45A 1U2VC 5TDHB 2P9NC 5TEFA 1K32A 1MG3A 4L3GD 3EI4A 3JZHA 5FA5B 3EI2B 1N6EA 4JXMA 4O9DA 4H5JA 2IUQA 2AGWA 3E0CA 1S4UX 2YNNA 4GZ8A 4FAND 2P9PC 2CE9A 4QQEA 3L4OD 2HESX 1QNIA 1JOFA 3IKOA 3SN6B 3I8CA 2P9UC 4CZXA 2CN2A 5EARA 4UI9R 5H1MA 3C75H 5EM2B 3I7HA 4MK0B 2B5LA 2P9SC 2OVQB 3KRXB 4J0WA 5CXBA 2IUVA 3DM0A 4JSNC 2Z2PA 4JD2C 3UVOA 3EI1A 3GREA 1VYHC 3FM0A 4XYHA 2H13A 3RLMD 4L9OA 3EWEA 3AL8B 5IC7A 3F3FA 3I8EA 1NEXB 2W18A 4JT5C 4LGNA 3IJ1A 3V7DB 1OMWB 4J84A 1YFQA 4PBYA 2P9LC 5A2Qg 3UVMA 2AH1A 4PXWA 4XEIC 2BCJB 2H6KA 4ES0A 3KRWB 5CXCA 5EMJB 3SXTD 4PC0A 1PBYB 4A0AB 4A09B 4JT6C 4ERQA 3FGBA 4X61B 3AH8B 5HQGA 2I0SA 4E54B 4ERZA 3RSEC 3EG6A 4QT8A 3RFHA 1N6DA 3MZKA 4GM8A 5IGQA 5I5IA 3BG0A 4D6VA 2AH0A 4J79A 2HXCA 3PVWB 4FA1D 3J80g 1ERJA 2TRCB 4FWWA 5I5MA 2G99A 4J8GA 3OL2A 1MG2A 4AOWA 2OJYA 3B7FA 4GM9A 4ZOYA 2UZXB 2H47A 3C5MA 4J87A 3UKUC 2AGYA 5CYKA 5EALA 4CY3A 3JPXA 2PM9B 3F3PA 2MTAH 4BH6A 4EWRA 4A0BA 3NVQA 4CI1A 3U4YA 2XYIA 3K26A 3IJCA 2AGXA 2AGLA 3V9FA 3CIKB 1JMXB 3EI3A 3J81g 2Z2NA 5KDOB 3GFCA 4J77A 4GGAA 2HYEA 4A11B 3NVNA 4CY1A 4FA5D 3SBPA 2GC4A 2H6QA 5HE0B 3ULEC 5EMMB 2I3TA 4CI8A 3IIYA 2OVPB 2P9IC 2J55H 3IJ0A 2YMUA 4A2MA 2HKMA 3PXSD 3OW8A 4O1QD 5HYNB 3SJLD 5C2VB 4JSPC 3OKYB 2HJ4A 4I79A 5JWZA 1NR0A 3SHFA 1R5MA 4K3ID 3I7LA 4FHLA 2GC7A 5I5JA 5H17A 2PBIB 3PVUB 3OL2B 5C2WB 4YVDA 4ESGA 4J73A 2B4EA 2B5MA 5FQDA 5C9ZB 4JSXC 3DXMC 4CZVA 5GXHA 4O3UB 2QXVA 2I0TA 4IA9A 4CC9A 4CY2A 2XU7A 4KFMB 1GXRA 4OZUA 5EAMA 3BG1A 3I7OA 5FKQA 3UVLA 5GSAA 2IUPA 3FRXA 4A08A 4L1QD 3CFVA 4E5ZA 3EI4B 3DXKC 4J8BA 1XIPA 2UZYB 5TF2A 5FLXg 4QL1A 4BL0A 5AFU3 1SQ9A 5FXYA 2YNPA 3JAMg 4FA9D 3ORVD 4FB1D 3IIWA 1U4CA 4GQ2P 5HE2B 4PSXB 3VA6A 3UKRC 5EMKB 4GQ1A 1XHMA 2BBKH 1JJUB 3PXTD 1K8KC 4PNKB 1MDAH 5AMSA 4CY5A 1TBGA 4TZ4A 5CXBB 3EMHA 3NVXA 2IWFA 3SCYA 3EI1B 3EI2A 1SQJA 4K3JB 2OK4A 2GNQA 1FWXA 2EBSA 2J57G 3MZLA 4D0KA 5K1CC 4U1EI 3N0EA 5IGOA 3CFSB 4Y5RD 1PI6A 2HJBA 3ODTA 1PEVA 2H14A 3RFGA 3HFQA 4O3TB 2XL2A 4X60B 2Z2OA 4CZYA 1OLZA 5FKRA 5B4WA 3PSCB 5EM2A 4CI3A 4FAVD 5SXMA 5K19A 1Q47A 4J86A 2QC5A 3MMYA 4U7AA 3SBRA 2CO0A 3AFCA 3SVWD 3PE7A 3DSMA 4ZOZA 5CXCB 3I89A 2YB8B 4FA4D 5FKSA 4X63B 5EMLB 3VH0A 3AL8A 3RMZD 2PM6B 2H9NA 3SLED 2H3XA 2YBAA 1XKSA 4QRJA 4JSVC 4ZOXA 2P9KC 4Y7RA 4Z8LA 4AEZA 3PXWD 3L4MD 1B9YA 2H9LA 1L0QA 3RN1D 3MKQA 3V5WB 5IJ8E 2CO0C 3MKSB 3I7KA 5CYKB 4A0AA 4A09A 1GP2B 2PM7B 4LG8A 5HE1B 2H6NA 4A7JA 2AQ5A 2IWKA 4A0BB 2OVRB 1P22A 3I7NA 4E54A 3SWSD 2Q7QA 4CI2A 3UVNA 3EI3B 4G56B 4X3EA 4H5IA 5GMKn 3I7PA 4J82A 5IJ7E 3JZGA 4OWRA 4HDJA 3RN0D 2I3SA 2AGZA 5EAPA 4GMBA 4LG9A 4GQBB 2HKRA 2H9MA 2OIZA 1SHYB 4PSWB 3JROA 3K27A 2J56H 3VGZA 3SMRA 2PM9A 5HE3B 3W15A 4J81A 4L3HD 3JZNA 4A2LA 3P4FA 3UVKA 2I0RA 2XL3A 3BWSA 5AJAA 2IAAA 2G9AA 4NSXA 4XYIA 3ZWLB 5FKTA 1A0RB 4A11A 3PSLA 4J78A 3RRMC 3JB9L 1B9XA 2IURA 2O9KA 2H68A 4ZOVA 2OK6A 3A0FA 3SFZA 1GG2B 3C99A 1RI6A 4GGCA 4ZN4A 4J0XA 4BUJC
chains in the Genus database with same CATH superfamily
4BCBA 3SBQA 4G1MA 2CE8A 1GOTB 3OKYA 4IMMA 4A08B 4PBZA 4E5ZB 3F3GA 3I2NA 5THAA 4ERYA 3OKWA 2VDQA 2H9PA 3C9CA 5GXIA 1JMZB 3N0DA 4BP9A 1O6GA 3MXXA 3UR4A 3DWLC 3AL9A 1TYEA 4GGDA 2CN3A 2YNOA 3JRPA 3EQ8A 2VDLA 4GM3A 1H2ZA 1N6FA 1PGUA 3IULA 2VDNA 4NENA 5H14A 1TYQC 2B5NA 4N14A 4MMZA 1GOFA 3OKTA 3OTTA 4R7AB 5TEEA 3K72A 3VI4A 5IT9g 3EU7A 1YR2A 2CNXA 4O45A 1U2VC 5TDHB 2P9NC 4BP8A 5TEFA 1K32A 1MG3A 4L3GD 3QI0A 4NC4A 3EI4A 3V4PA 3JZHA 5FA5B 3EI2B 1N6EA 4JXMA 4O9DA 4H5JA 2IUQA 2AGWA 2VDKA 1S4UX 3E0CA 4DNVA 2YNNA 4GZ8A 4FAND 2P9PC 1I2MB 2CE9A 4QQEA 3L4OD 2HESX 1QNIA 3GD1I 1JOFA 3IKOA 3SN6B 3I8CA 2P9UC 4CZXA 2CN2A 5EARA 1JV2A 1A12A 4UI9R 5H1MA 3C75H 5EM2B 3I7HA 4MK0B 2B5LA 2P9SC 2OVQB 3NIFA 3KRXB 4J0WA 2VDMA 5CXBA 2IUVA 3DM0A 4JSNC 2Z2PA 4JD2C 1K3IA 2EICA 3UVOA 3EI1A 4UM8A 3GREA 1VYHC 3FM0A 4MMXA 1U8CA 4XYHA 3IUJA 2H13A 5FFGA 4JHPC 2HU5A 3RLMD 4L9OA 3EQ7A 3EWEA 3AL8B 5IC7A 3F3FA 3I8EA 5C92A 4O2WA 1NEXB 4D9SA 2W18A 4JT5C 4LGNA 1T2XA 3IJ1A 3V7DB 1OMWB 4J84A 1YFQA 4PBYA 2P9LC 4BCCA 5A2Qg 3UVMA 4IRZA 2AH1A 4PXWA 4XEIC 2BCJB 3IUMA 2H6KA 4ES0A 3KRWB 5CXCA 5EMJB 3SXTD 4PC0A 3IJEA 1PBYB 4A0AB 4A09B 4JT6C 4ERQA 3FGBA 4AN0A 4X61B 2XE4A 2EIBA 3AH8B 1E8MA 5HQGA 2I0SA 3EQ9A 4E54B 4AMYA 4ERZA 3RSEC 3EG6A 4QT8A 3RFHA 5M5VA 1N6DA 2VDOA 3MZKA 4GM8A 5IGQA 5I5IA 3BG0A 4D6VA 2AH0A 4J79A 1VZ3A 2HXCA 3MUOA 3PVWB 4FA1D 3J80g 1ERJA 5C86A 2TRCB 4FWWA 5I5MA 2G99A 4J8GA 3OL2A 1MG2A 4AOWA 2OJYA 1GOHA 3B7FA 4GM9A 4ZOYA 2UZXB 4L1MA 2H47A 3C5MA 4J87A 3UKUC 4Z7QA 2AGYA 5CYKA 5M5RA 3ZDXA 5EALA 4CY3A 3JPXA 2PM9B 3F3PA 2MTAH 4BH6A 4EWRA 1VE7A 4A0BA 3NVQA 4RE5A 4CI1A 3U4YA 2XYIA 3K26A 3IJCA 2AGXA 1VZ2A 2AGLA 3V9FA 3CIKB 1JMXB 4BCDA 4JHNA 3EI3A 1VE6A 3J81g 1H2XA 4MMYA 2Z2NA 5KDOB 3GFCA 1L5GA 4J77A 4GGAA 2HYEA 4A11B 3NVNA 4AX4A 4CY1A 4FA5D 3SBPA 2GC4A 2H6QA 3FCUA 2EIDA 5HE0B 3ULEC 5EMMB 2I3TA 5E6UA 4CI8A 3IIYA 2OVPB 2P9IC 1M1XA 3IVMA 2VDRA 2J55H 3IJ0A 2YMUA 4A2MA 2HKMA 3PXSD 1H2WA 3OW8A 4O1QD 5M5SA 5HYNB 3SJLD 5C2VB 4JSPC 3OKYB 2WQ8A 3VI3A 2HJ4A 4I79A 5JWZA 1NR0A 5FFOA 4WK4A 3SHFA 1R5MA 4K3ID 3I7LA 4RE6A 4FHLA 2GC7A 5I5JA 5H17A 2PBIB 3PVUB 3OL2B 5C2WB 4YVDA 4ESGA 5M5TA 4J73A 4DNWA 2B4EA 2B5MA 3ZDZA 1H2YA 5FQDA 5C9ZB 4JSXC 1C9IA 3DXMC 4CZVA 5GXHA 4O3UB 2QXVA 2I0TA 4IA9A 4CC9A 4CY2A 2XU7A 4KFMB 3IUNA 1GXRA 4OZUA 5EAMA 3BG1A 3IUQA 3I7OA 5FKQA 3UVLA 2XZGA 5GSAA 2IUPA 2QR5A 3FRXA 2EIEA 4A08A 4L1QD 3CFVA 3ZE0A 4E5ZA 3EI4B 1UOOA 3DXKC 4J8BA 1XIPA 2UZYB 5TF2A 5FLXg 4QL1A 4BL0A 5AFU3 1SQ9A 5FXYA 1C9LA 5M61A 2YNPA 4DNUA 3JAMg 3K71A 2VZ1A 2HU7A 3ORVD 4FB1D 4FA9D 5M5UA 3IIWA 1O6FA 1U4CA 4GQ2P 4Z7OA 5HE2B 4PSXB 3VA6A 3UKRC 5EMKB 3T3PA 4GQ1A 3O4IA 1XHMA 3QHYB 4AMZA 2BBKH 3MVDK 1JJUB 5E6SA 3PXTD 4WK2A 1K8KC 2QZPA 1MDAH 4PNKB 5AMSA 4CY5A 1TBGA 4TZ4A 5CXBB 3EMHA 3NVXA 2IWFA 3SCYA 3EI1B 3EI2A 1SQJA 1QFMA 2OK4A 4K3JB 4UM9A 2GNQA 1FWXA 2EBSA 3MZLA 2J57G 3MUNA 4D0KA 5K1CC 4U1EI 3N0EA 5IGOA 4NBMA 3CFSB 4Y5RD 1PI6A 2HJBA 3ODTA 1PEVA 2H14A 3RFGA 3HFQA 4O3TB 2XL2A 4X60B 2Z2OA 4CZYA 1OLZA 5FKRA 5B4WA 3PSCB 5EM2A 1QFSA 4CI3A 3IURA 4FAVD 5SXMA 5K19A 1Q47A 4J86A 2QC5A 3MMYA 4U7AA 3ZE1A 3SBRA 2CO0A 3AFCA 4QAMA 3SVWD 3PE7A 3DSMA 4ZOZA 5CXCB 3I89A 2YB8B 3V4VA 4FA4D 5FKSA 4X63B 5EMLB 4Z7NA 3VH0A 3AL8A 3RMZD 3O4GA 3O4HA 2PM6B 2H9NA 3SLED 2H3XA 2XDWA 2YBAA 1XKSA 4QRJA 4JSVC 4ZOXA 3DDUA 2VZ3A 1GOGA 3ZDYA 2P9KC 4Y7RA 4Z8LA 4AEZA 3PXWD 3L4MD 1B9YA 2H9LA 1L0QA 3RN1D 2JKXA 3MKQA 3V5WB 3ZE2A 5IJ8E 3KCIA 1UOPA 3NIGA 2CO0C 3MKSB 3I7KA 5CYKB 4G1EA 4A0AA 1GP2B 4A09A 2PM7B 4LG8A 5HE1B 2H6NA 4G55A 4A7JA 1UOQA 2AQ5A 2IWKA 4A0BB 4AN1A 2OVRB 1P22A 3I7NA 4E54A 3SWSD 1E5TA 2Q7QA 4CI2A 5HDBA 3UVNA 3EI3B 3NIDA 4G56B 4X3EA 1UTCA 4H5IA 5GMKn 3GC3B 3I7PA 4O02A 4J82A 5IJ7E 3O4JA 3T3MA 3JZGA 4OWRA 1E8NA 4HDJA 1JTDB 2I3SA 2AGZA 4NAAA 5EAPA 3RN0D 4GMBA 2VDPA 4LG9A 1BPOA 4GQBB 2HKRA 2H9MA 2OIZA 1SHYB 4PSWB 3JROA 3K27A 4WJKA 2J56H 3VGZA 2VC2A 3SMRA 3OF7A 2PM9A 5HE3B 3FCSA 3W15A 4J81A 4L3HD 3JZNA 4A2LA 3P4FA 3UVKA 2I0RA 2XL3A 3BWSA 5AJAA 2IAAA 2G9AA 4NSXA 4XYIA 3ZWLB 5FKTA 2HU8A 1A0RB 4A11A 3PSLA 4J78A 3RRMC 3JB9L 1B9XA 2IURA 2O9KA 2H68A 4WK0A 5E6RA 4ZOVA 3K6SA 2BKLA 2OK6A 3A0FA 3SFZA 1GG2B 3C99A 1RI6A 4GGCA 4ZN4A 4J0XA 4BUJC
chains in the Genus database with same CATH topology
3SBQA 2CE8A 1GOTB 3OKYA 4IMMA 4A08B 4PBZA 4E5ZB 3F3GA 3I2NA 5THAA 4ERYA 3OKWA 2H9PA 3C9CA 5GXIA 1JMZB 3N0DA 3MXXA 3UR4A 3DWLC 3AL9A 4GGDA 2CN3A 2YNOA 3JRPA 4GM3A 1N6FA 1PGUA 5H14A 1TYQC 2B5NA 4N14A 3OKTA 3OTTA 4R7AB 5TEEA 5IT9g 3EU7A 2CNXA 4O45A 1U2VC 5TDHB 2P9NC 5TEFA 1K32A 1MG3A 4L3GD 3EI4A 3JZHA 5FA5B 3EI2B 1N6EA 4JXMA 4O9DA 4H5JA 2IUQA 2AGWA 3E0CA 1S4UX 2YNNA 4GZ8A 4FAND 2P9PC 2CE9A 4QQEA 3L4OD 2HESX 1QNIA 1JOFA 3IKOA 3SN6B 3I8CA 2P9UC 4CZXA 2CN2A 5EARA 4UI9R 5H1MA 3C75H 5EM2B 3I7HA 4MK0B 2B5LA 2P9SC 2OVQB 3KRXB 4J0WA 5CXBA 2IUVA 3DM0A 4JSNC 2Z2PA 4JD2C 3UVOA 3EI1A 3GREA 1VYHC 3FM0A 4XYHA 2H13A 3RLMD 4L9OA 3EWEA 3AL8B 5IC7A 3F3FA 3I8EA 1NEXB 2W18A 4JT5C 4LGNA 3IJ1A 3V7DB 1OMWB 4J84A 1YFQA 4PBYA 2P9LC 5A2Qg 3UVMA 2AH1A 4PXWA 4XEIC 2BCJB 2H6KA 4ES0A 3KRWB 5CXCA 5EMJB 3SXTD 4PC0A 1PBYB 4A0AB 4A09B 4JT6C 4ERQA 3FGBA 4X61B 3AH8B 5HQGA 2I0SA 4E54B 4ERZA 3RSEC 3EG6A 4QT8A 3RFHA 1N6DA 3MZKA 4GM8A 5IGQA 5I5IA 3BG0A 4D6VA 2AH0A 4J79A 2HXCA 3PVWB 4FA1D 3J80g 1ERJA 2TRCB 4FWWA 5I5MA 2G99A 4J8GA 3OL2A 1MG2A 4AOWA 2OJYA 3B7FA 4GM9A 4ZOYA 2UZXB 2H47A 3C5MA 4J87A 3UKUC 2AGYA 5CYKA 5EALA 4CY3A 3JPXA 2PM9B 3F3PA 2MTAH 4BH6A 4EWRA 4A0BA 3NVQA 4CI1A 3U4YA 2XYIA 3K26A 3IJCA 2AGXA 2AGLA 3V9FA 3CIKB 1JMXB 3EI3A 3J81g 2Z2NA 5KDOB 3GFCA 4J77A 4GGAA 2HYEA 4A11B 3NVNA 4CY1A 4FA5D 3SBPA 2GC4A 2H6QA 5HE0B 3ULEC 5EMMB 2I3TA 4CI8A 3IIYA 2OVPB 2P9IC 2J55H 3IJ0A 2YMUA 4A2MA 2HKMA 3PXSD 3OW8A 4O1QD 5HYNB 3SJLD 5C2VB 4JSPC 3OKYB 2HJ4A 4I79A 5JWZA 1NR0A 3SHFA 1R5MA 4K3ID 3I7LA 4FHLA 2GC7A 5I5JA 5H17A 2PBIB 3PVUB 3OL2B 5C2WB 4YVDA 4ESGA 4J73A 2B4EA 2B5MA 5FQDA 5C9ZB 4JSXC 3DXMC 4CZVA 5GXHA 4O3UB 2QXVA 2I0TA 4IA9A 4CC9A 4CY2A 2XU7A 4KFMB 1GXRA 4OZUA 5EAMA 3BG1A 3I7OA 5FKQA 3UVLA 5GSAA 2IUPA 3FRXA 4A08A 4L1QD 3CFVA 4E5ZA 3EI4B 3DXKC 4J8BA 1XIPA 2UZYB 5TF2A 5FLXg 4QL1A 4BL0A 5AFU3 1SQ9A 5FXYA 2YNPA 3JAMg 4FA9D 3ORVD 4FB1D 3IIWA 1U4CA 4GQ2P 5HE2B 4PSXB 3VA6A 3UKRC 5EMKB 4GQ1A 1XHMA 2BBKH 1JJUB 3PXTD 1K8KC 4PNKB 1MDAH 5AMSA 4CY5A 1TBGA 4TZ4A 5CXBB 3EMHA 3NVXA 2IWFA 3SCYA 3EI1B 3EI2A 1SQJA 4K3JB 2OK4A 2GNQA 1FWXA 2EBSA 2J57G 3MZLA 4D0KA 5K1CC 4U1EI 3N0EA 5IGOA 3CFSB 4Y5RD 1PI6A 2HJBA 3ODTA 1PEVA 2H14A 3RFGA 3HFQA 4O3TB 2XL2A 4X60B 2Z2OA 4CZYA 1OLZA 5FKRA 5B4WA 3PSCB 5EM2A 4CI3A 4FAVD 5SXMA 5K19A 1Q47A 4J86A 2QC5A 3MMYA 4U7AA 3SBRA 2CO0A 3AFCA 3SVWD 3PE7A 3DSMA 4ZOZA 5CXCB 3I89A 2YB8B 4FA4D 5FKSA 4X63B 5EMLB 3VH0A 3AL8A 3RMZD 2PM6B 2H9NA 3SLED 2H3XA 2YBAA 1XKSA 4QRJA 4JSVC 4ZOXA 2P9KC 4Y7RA 4Z8LA 4AEZA 3PXWD 3L4MD 1B9YA 2H9LA 1L0QA 3RN1D 3MKQA 3V5WB 5IJ8E 2CO0C 3MKSB 3I7KA 5CYKB 4A0AA 4A09A 1GP2B 2PM7B 4LG8A 5HE1B 2H6NA 4A7JA 2AQ5A 2IWKA 4A0BB 2OVRB 1P22A 3I7NA 4E54A 3SWSD 2Q7QA 4CI2A 3UVNA 3EI3B 4G56B 4X3EA 4H5IA 5GMKn 3I7PA 4J82A 5IJ7E 3JZGA 4OWRA 4HDJA 3RN0D 2I3SA 2AGZA 5EAPA 4GMBA 4LG9A 4GQBB 2HKRA 2H9MA 2OIZA 1SHYB 4PSWB 3JROA 3K27A 2J56H 3VGZA 3SMRA 2PM9A 5HE3B 3W15A 4J81A 4L3HD 3JZNA 4A2LA 3P4FA 3UVKA 2I0RA 2XL3A 3BWSA 5AJAA 2IAAA 2G9AA 4NSXA 4XYIA 3ZWLB 5FKTA 1A0RB 4A11A 3PSLA 4J78A 3RRMC 3JB9L 1B9XA 2IURA 2O9KA 2H68A 4ZOVA 2OK6A 3A0FA 3SFZA 1GG2B 3C99A 1RI6A 4GGCA 4ZN4A 4J0XA 4BUJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBQ A;  2CE8 A;  1GOT B;  3OKY A;  4IMM A;  4A08 B;  4PBZ A;  4E5Z B;  3F3G A;  3I2N A;  5THA A;  4ERY A;  3OKW A;  2H9P A;  3C9C A;  5GXI A;  1JMZ B;  3N0D A;  3MXX A;  3UR4 A;  3DWL C;  3AL9 A;  4GGD A;  2CN3 A;  2YNO A;  3JRP A;  4GM3 A;  1N6F A;  1PGU A;  5H14 A;  1TYQ C;  2B5N A;  4N14 A;  3OKT A;  3OTT A;  4R7A B;  5TEE A;  5IT9 g;  3EU7 A;  2CNX A;  4O45 A;  1U2V C;  5TDH B;  2P9N C;  5TEF A;  1K32 A;  1MG3 A;  4L3G D;  3EI4 A;  3JZH A;  5FA5 B;  3EI2 B;  1N6E A;  4JXM A;  4O9D A;  4H5J A;  2IUQ A;  2AGW A;  3E0C A;  1S4U X;  2YNN A;  4GZ8 A;  4FAN D;  2P9P C;  2CE9 A;  4QQE A;  3L4O D;  2HES X;  1QNI A;  1JOF A;  3IKO A;  3SN6 B;  3I8C A;  2P9U C;  4CZX A;  2CN2 A;  5EAR A;  4UI9 R;  5H1M A;  3C75 H;  5EM2 B;  3I7H A;  4MK0 B;  2B5L A;  2P9S C;  2OVQ B;  3KRX B;  4J0W A;  5CXB A;  2IUV A;  3DM0 A;  4JSN C;  2Z2P A;  4JD2 C;  3UVO A;  3EI1 A;  3GRE A;  1VYH C;  3FM0 A;  4XYH A;  2H13 A;  3RLM D;  4L9O A;  3EWE A;  3AL8 B;  5IC7 A;  3F3F A;  3I8E A;  1NEX B;  2W18 A;  4JT5 C;  4LGN A;  3IJ1 A;  3V7D B;  1OMW B;  4J84 A;  1YFQ A;  4PBY A;  2P9L C;  5A2Q g;  3UVM A;  2AH1 A;  4PXW A;  4XEI C;  2BCJ B;  2H6K A;  4ES0 A;  3KRW B;  5CXC A;  5EMJ B;  3SXT D;  4PC0 A;  1PBY B;  4A0A B;  4A09 B;  4JT6 C;  4ERQ A;  3FGB A;  4X61 B;  3AH8 B;  5HQG A;  2I0S A;  4E54 B;  4ERZ A;  3RSE C;  3EG6 A;  4QT8 A;  3RFH A;  1N6D A;  3MZK A;  4GM8 A;  5IGQ A;  5I5I A;  3BG0 A;  4D6V A;  2AH0 A;  4J79 A;  2HXC A;  3PVW B;  4FA1 D;  3J80 g;  1ERJ A;  2TRC B;  4FWW A;  5I5M A;  2G99 A;  4J8G A;  3OL2 A;  1MG2 A;  4AOW A;  2OJY A;  3B7F A;  4GM9 A;  4ZOY A;  2UZX B;  2H47 A;  3C5M A;  4J87 A;  3UKU C;  2AGY A;  5CYK A;  5EAL A;  4CY3 A;  3JPX A;  2PM9 B;  3F3P A;  2MTA H;  4BH6 A;  4EWR A;  4A0B A;  3NVQ A;  4CI1 A;  3U4Y A;  2XYI A;  3K26 A;  3IJC A;  2AGX A;  2AGL A;  3V9F A;  3CIK B;  1JMX B;  3EI3 A;  3J81 g;  2Z2N A;  5KDO B;  3GFC A;  4J77 A;  4GGA A;  2HYE A;  4A11 B;  3NVN A;  4CY1 A;  4FA5 D;  3SBP A;  2GC4 A;  2H6Q A;  5HE0 B;  3ULE C;  5EMM B;  2I3T A;  4CI8 A;  3IIY A;  2OVP B;  2P9I C;  2J55 H;  3IJ0 A;  2YMU A;  4A2M A;  2HKM A;  3PXS D;  3OW8 A;  4O1Q D;  5HYN B;  3SJL D;  5C2V B;  4JSP C;  3OKY B;  2HJ4 A;  4I79 A;  5JWZ A;  1NR0 A;  3SHF A;  1R5M A;  4K3I D;  3I7L A;  4FHL A;  2GC7 A;  5I5J A;  5H17 A;  2PBI B;  3PVU B;  3OL2 B;  5C2W B;  4YVD A;  4ESG A;  4J73 A;  2B4E A;  2B5M A;  5FQD A;  5C9Z B;  4JSX C;  3DXM C;  4CZV A;  5GXH A;  4O3U B;  2QXV A;  2I0T A;  4IA9 A;  4CC9 A;  4CY2 A;  2XU7 A;  4KFM B;  1GXR A;  4OZU A;  5EAM A;  3BG1 A;  3I7O A;  5FKQ A;  3UVL A;  5GSA A;  2IUP A;  3FRX A;  4A08 A;  4L1Q D;  3CFV A;  4E5Z A;  3EI4 B;  3DXK C;  4J8B A;  1XIP A;  2UZY B;  5TF2 A;  5FLX g;  4QL1 A;  4BL0 A;  5AFU 3;  1SQ9 A;  5FXY A;  2YNP A;  3JAM g;  4FA9 D;  3ORV D;  4FB1 D;  3IIW A;  1U4C A;  4GQ2 P;  5HE2 B;  4PSX B;  3VA6 A;  3UKR C;  5EMK B;  4GQ1 A;  1XHM A;  2BBK H;  1JJU B;  3PXT D;  1K8K C;  4PNK B;  1MDA H;  5AMS A;  4CY5 A;  1TBG A;  4TZ4 A;  5CXB B;  3EMH A;  3NVX A;  2IWF A;  3SCY A;  3EI1 B;  3EI2 A;  1SQJ A;  4K3J B;  2OK4 A;  2GNQ A;  1FWX A;  2EBS A;  2J57 G;  3MZL A;  4D0K A;  5K1C C;  4U1E I;  3N0E A;  5IGO A;  3CFS B;  4Y5R D;  1PI6 A;  2HJB A;  3ODT A;  1PEV A;  2H14 A;  3RFG A;  3HFQ A;  4O3T B;  2XL2 A;  4X60 B;  2Z2O A;  4CZY A;  1OLZ A;  5FKR A;  5B4W A;  3PSC B;  5EM2 A;  4CI3 A;  4FAV D;  5SXM A;  5K19 A;  1Q47 A;  4J86 A;  2QC5 A;  3MMY A;  4U7A A;  3SBR A;  2CO0 A;  3AFC A;  3SVW D;  3PE7 A;  3DSM A;  4ZOZ A;  5CXC B;  3I89 A;  2YB8 B;  4FA4 D;  5FKS A;  4X63 B;  5EML B;  3VH0 A;  3AL8 A;  3RMZ D;  2PM6 B;  2H9N A;  3SLE D;  2H3X A;  2YBA A;  1XKS A;  4QRJ A;  4JSV C;  4ZOX A;  2P9K C;  4Y7R A;  4Z8L A;  4AEZ A;  3PXW D;  3L4M D;  1B9Y A;  2H9L A;  1L0Q A;  3RN1 D;  3MKQ A;  3V5W B;  5IJ8 E;  2CO0 C;  3MKS B;  3I7K A;  5CYK B;  4A0A A;  4A09 A;  1GP2 B;  2PM7 B;  4LG8 A;  5HE1 B;  2H6N A;  4A7J A;  2AQ5 A;  2IWK A;  4A0B B;  2OVR B;  1P22 A;  3I7N A;  4E54 A;  3SWS D;  2Q7Q A;  4CI2 A;  3UVN A;  3EI3 B;  4G56 B;  4X3E A;  4H5I A;  5GMK n;  3I7P A;  4J82 A;  5IJ7 E;  3JZG A;  4OWR A;  4HDJ A;  3RN0 D;  2I3S A;  2AGZ A;  5EAP A;  4GMB A;  4LG9 A;  4GQB B;  2HKR A;  2H9M A;  2OIZ A;  1SHY B;  4PSW B;  3JRO A;  3K27 A;  2J56 H;  3VGZ A;  3SMR A;  2PM9 A;  5HE3 B;  3W15 A;  4J81 A;  4L3H D;  3JZN A;  4A2L A;  3P4F A;  3UVK A;  2I0R A;  2XL3 A;  3BWS A;  5AJA A;  2IAA A;  2G9A A;  4NSX A;  4XYI A;  3ZWL B;  5FKT A;  1A0R B;  4A11 A;  3PSL A;  4J78 A;  3RRM C;  3JB9 L;  1B9X A;  2IUR A;  2O9K A;  2H68 A;  4ZOV A;  2OK6 A;  3A0F A;  3SFZ A;  1GG2 B;  3C99 A;  1RI6 A;  4GGC A;  4ZN4 A;  4J0X A;  4BUJ C; 
#chains in the Genus database with same CATH topology
 4BCB A;  3SBQ A;  4G1M A;  2CE8 A;  1GOT B;  3OKY A;  4IMM A;  4A08 B;  4PBZ A;  4E5Z B;  3F3G A;  3I2N A;  5THA A;  4ERY A;  3OKW A;  2VDQ A;  2H9P A;  3C9C A;  5GXI A;  1JMZ B;  3N0D A;  4BP9 A;  1O6G A;  3MXX A;  3UR4 A;  3DWL C;  3AL9 A;  1TYE A;  4GGD A;  2CN3 A;  2YNO A;  3JRP A;  3EQ8 A;  2VDL A;  4GM3 A;  1H2Z A;  1N6F A;  1PGU A;  3IUL A;  2VDN A;  4NEN A;  5H14 A;  1TYQ C;  2B5N A;  4N14 A;  4MMZ A;  1GOF A;  3OKT A;  3OTT A;  4R7A B;  5TEE A;  3K72 A;  3VI4 A;  5IT9 g;  3EU7 A;  1YR2 A;  2CNX A;  4O45 A;  1U2V C;  5TDH B;  2P9N C;  4BP8 A;  5TEF A;  1K32 A;  1MG3 A;  4L3G D;  3QI0 A;  4NC4 A;  3EI4 A;  3V4P A;  3JZH A;  5FA5 B;  3EI2 B;  1N6E A;  4JXM A;  4O9D A;  4H5J A;  2IUQ A;  2AGW A;  2VDK A;  1S4U X;  3E0C A;  4DNV A;  2YNN A;  4GZ8 A;  4FAN D;  2P9P C;  1I2M B;  2CE9 A;  4QQE A;  3L4O D;  2HES X;  1QNI A;  3GD1 I;  1JOF A;  3IKO A;  3SN6 B;  3I8C A;  2P9U C;  4CZX A;  2CN2 A;  5EAR A;  1JV2 A;  1A12 A;  4UI9 R;  5H1M A;  3C75 H;  5EM2 B;  3I7H A;  4MK0 B;  2B5L A;  2P9S C;  2OVQ B;  3NIF A;  3KRX B;  4J0W A;  2VDM A;  5CXB A;  2IUV A;  3DM0 A;  4JSN C;  2Z2P A;  4JD2 C;  1K3I A;  2EIC A;  3UVO A;  3EI1 A;  4UM8 A;  3GRE A;  1VYH C;  3FM0 A;  4MMX A;  1U8C A;  4XYH A;  3IUJ A;  2H13 A;  5FFG A;  4JHP C;  2HU5 A;  3RLM D;  4L9O A;  3EQ7 A;  3EWE A;  3AL8 B;  5IC7 A;  3F3F A;  3I8E A;  5C92 A;  4O2W A;  1NEX B;  4D9S A;  2W18 A;  4JT5 C;  4LGN A;  1T2X A;  3IJ1 A;  3V7D B;  1OMW B;  4J84 A;  1YFQ A;  4PBY A;  2P9L C;  4BCC A;  5A2Q g;  3UVM A;  4IRZ A;  2AH1 A;  4PXW A;  4XEI C;  2BCJ B;  3IUM A;  2H6K A;  4ES0 A;  3KRW B;  5CXC A;  5EMJ B;  3SXT D;  4PC0 A;  3IJE A;  1PBY B;  4A0A B;  4A09 B;  4JT6 C;  4ERQ A;  3FGB A;  4AN0 A;  4X61 B;  2XE4 A;  2EIB A;  3AH8 B;  1E8M A;  5HQG A;  2I0S A;  3EQ9 A;  4E54 B;  4AMY A;  4ERZ A;  3RSE C;  3EG6 A;  4QT8 A;  3RFH A;  5M5V A;  1N6D A;  2VDO A;  3MZK A;  4GM8 A;  5IGQ A;  5I5I A;  3BG0 A;  4D6V A;  2AH0 A;  4J79 A;  1VZ3 A;  2HXC A;  3MUO A;  3PVW B;  4FA1 D;  3J80 g;  1ERJ A;  5C86 A;  2TRC B;  4FWW A;  5I5M A;  2G99 A;  4J8G A;  3OL2 A;  1MG2 A;  4AOW A;  2OJY A;  1GOH A;  3B7F A;  4GM9 A;  4ZOY A;  2UZX B;  4L1M A;  2H47 A;  3C5M A;  4J87 A;  3UKU C;  4Z7Q A;  2AGY A;  5CYK A;  5M5R A;  3ZDX A;  5EAL A;  4CY3 A;  3JPX A;  2PM9 B;  3F3P A;  2MTA H;  4BH6 A;  4EWR A;  1VE7 A;  4A0B A;  3NVQ A;  4RE5 A;  4CI1 A;  3U4Y A;  2XYI A;  3K26 A;  3IJC A;  2AGX A;  1VZ2 A;  2AGL A;  3V9F A;  3CIK B;  1JMX B;  4BCD A;  4JHN A;  3EI3 A;  1VE6 A;  3J81 g;  1H2X A;  4MMY A;  2Z2N A;  5KDO B;  3GFC A;  1L5G A;  4J77 A;  4GGA A;  2HYE A;  4A11 B;  3NVN A;  4AX4 A;  4CY1 A;  4FA5 D;  3SBP A;  2GC4 A;  2H6Q A;  3FCU A;  2EID A;  5HE0 B;  3ULE C;  5EMM B;  2I3T A;  5E6U A;  4CI8 A;  3IIY A;  2OVP B;  2P9I C;  1M1X A;  3IVM A;  2VDR A;  2J55 H;  3IJ0 A;  2YMU A;  4A2M A;  2HKM A;  3PXS D;  1H2W A;  3OW8 A;  4O1Q D;  5M5S A;  5HYN B;  3SJL D;  5C2V B;  4JSP C;  3OKY B;  2WQ8 A;  3VI3 A;  2HJ4 A;  4I79 A;  5JWZ A;  1NR0 A;  5FFO A;  4WK4 A;  3SHF A;  1R5M A;  4K3I D;  3I7L A;  4RE6 A;  4FHL A;  2GC7 A;  5I5J A;  5H17 A;  2PBI B;  3PVU B;  3OL2 B;  5C2W B;  4YVD A;  4ESG A;  5M5T A;  4J73 A;  4DNW A;  2B4E A;  2B5M A;  3ZDZ A;  1H2Y A;  5FQD A;  5C9Z B;  4JSX C;  1C9I A;  3DXM C;  4CZV A;  5GXH A;  4O3U B;  2QXV A;  2I0T A;  4IA9 A;  4CC9 A;  4CY2 A;  2XU7 A;  4KFM B;  3IUN A;  1GXR A;  4OZU A;  5EAM A;  3BG1 A;  3IUQ A;  3I7O A;  5FKQ A;  3UVL A;  2XZG A;  5GSA A;  2IUP A;  2QR5 A;  3FRX A;  2EIE A;  4A08 A;  4L1Q D;  3CFV A;  3ZE0 A;  4E5Z A;  3EI4 B;  1UOO A;  3DXK C;  4J8B A;  1XIP A;  2UZY B;  5TF2 A;  5FLX g;  4QL1 A;  4BL0 A;  5AFU 3;  1SQ9 A;  5FXY A;  1C9L A;  5M61 A;  2YNP A;  4DNU A;  3JAM g;  3K71 A;  2VZ1 A;  2HU7 A;  3ORV D;  4FB1 D;  4FA9 D;  5M5U A;  3IIW A;  1O6F A;  1U4C A;  4GQ2 P;  4Z7O A;  5HE2 B;  4PSX B;  3VA6 A;  3UKR C;  5EMK B;  3T3P A;  4GQ1 A;  3O4I A;  1XHM A;  3QHY B;  4AMZ A;  2BBK H;  3MVD K;  1JJU B;  5E6S A;  3PXT D;  4WK2 A;  1K8K C;  2QZP A;  1MDA H;  4PNK B;  5AMS A;  4CY5 A;  1TBG A;  4TZ4 A;  5CXB B;  3EMH A;  3NVX A;  2IWF A;  3SCY A;  3EI1 B;  3EI2 A;  1SQJ A;  1QFM A;  2OK4 A;  4K3J B;  4UM9 A;  2GNQ A;  1FWX A;  2EBS A;  3MZL A;  2J57 G;  3MUN A;  4D0K A;  5K1C C;  4U1E I;  3N0E A;  5IGO A;  4NBM A;  3CFS B;  4Y5R D;  1PI6 A;  2HJB A;  3ODT A;  1PEV A;  2H14 A;  3RFG A;  3HFQ A;  4O3T B;  2XL2 A;  4X60 B;  2Z2O A;  4CZY A;  1OLZ A;  5FKR A;  5B4W A;  3PSC B;  5EM2 A;  1QFS A;  4CI3 A;  3IUR A;  4FAV D;  5SXM A;  5K19 A;  1Q47 A;  4J86 A;  2QC5 A;  3MMY A;  4U7A A;  3ZE1 A;  3SBR A;  2CO0 A;  3AFC A;  4QAM A;  3SVW D;  3PE7 A;  3DSM A;  4ZOZ A;  5CXC B;  3I89 A;  2YB8 B;  3V4V A;  4FA4 D;  5FKS A;  4X63 B;  5EML B;  4Z7N A;  3VH0 A;  3AL8 A;  3RMZ D;  3O4G A;  3O4H A;  2PM6 B;  2H9N A;  3SLE D;  2H3X A;  2XDW A;  2YBA A;  1XKS A;  4QRJ A;  4JSV C;  4ZOX A;  3DDU A;  2VZ3 A;  1GOG A;  3ZDY A;  2P9K C;  4Y7R A;  4Z8L A;  4AEZ A;  3PXW D;  3L4M D;  1B9Y A;  2H9L A;  1L0Q A;  3RN1 D;  2JKX A;  3MKQ A;  3V5W B;  3ZE2 A;  5IJ8 E;  3KCI A;  1UOP A;  3NIG A;  2CO0 C;  3MKS B;  3I7K A;  5CYK B;  4G1E A;  4A0A A;  1GP2 B;  4A09 A;  2PM7 B;  4LG8 A;  5HE1 B;  2H6N A;  4G55 A;  4A7J A;  1UOQ A;  2AQ5 A;  2IWK A;  4A0B B;  4AN1 A;  2OVR B;  1P22 A;  3I7N A;  4E54 A;  3SWS D;  1E5T A;  2Q7Q A;  4CI2 A;  5HDB A;  3UVN A;  3EI3 B;  3NID A;  4G56 B;  4X3E A;  1UTC A;  4H5I A;  5GMK n;  3GC3 B;  3I7P A;  4O02 A;  4J82 A;  5IJ7 E;  3O4J A;  3T3M A;  3JZG A;  4OWR A;  1E8N A;  4HDJ A;  1JTD B;  2I3S A;  2AGZ A;  4NAA A;  5EAP A;  3RN0 D;  4GMB A;  2VDP A;  4LG9 A;  1BPO A;  4GQB B;  2HKR A;  2H9M A;  2OIZ A;  1SHY B;  4PSW B;  3JRO A;  3K27 A;  4WJK A;  2J56 H;  3VGZ A;  2VC2 A;  3SMR A;  3OF7 A;  2PM9 A;  5HE3 B;  3FCS A;  3W15 A;  4J81 A;  4L3H D;  3JZN A;  4A2L A;  3P4F A;  3UVK A;  2I0R A;  2XL3 A;  3BWS A;  5AJA A;  2IAA A;  2G9A A;  4NSX A;  4XYI A;  3ZWL B;  5FKT A;  2HU8 A;  1A0R B;  4A11 A;  3PSL A;  4J78 A;  3RRM C;  3JB9 L;  1B9X A;  2IUR A;  2O9K A;  2H68 A;  4WK0 A;  5E6R A;  4ZOV A;  3K6S A;  2BKL A;  2OK6 A;  3A0F A;  3SFZ A;  1GG2 B;  3C99 A;  1RI6 A;  4GGC A;  4ZN4 A;  4J0X A;  4BUJ C; 
#chains in the Genus database with same CATH homology
 3SBQ A;  2CE8 A;  1GOT B;  3OKY A;  4IMM A;  4A08 B;  4PBZ A;  4E5Z B;  3F3G A;  3I2N A;  5THA A;  4ERY A;  3OKW A;  2H9P A;  3C9C A;  5GXI A;  1JMZ B;  3N0D A;  3MXX A;  3UR4 A;  3DWL C;  3AL9 A;  4GGD A;  2CN3 A;  2YNO A;  3JRP A;  4GM3 A;  1N6F A;  1PGU A;  5H14 A;  1TYQ C;  2B5N A;  4N14 A;  3OKT A;  3OTT A;  4R7A B;  5TEE A;  5IT9 g;  3EU7 A;  2CNX A;  4O45 A;  1U2V C;  5TDH B;  2P9N C;  5TEF A;  1K32 A;  1MG3 A;  4L3G D;  3EI4 A;  3JZH A;  5FA5 B;  3EI2 B;  1N6E A;  4JXM A;  4O9D A;  4H5J A;  2IUQ A;  2AGW A;  3E0C A;  1S4U X;  2YNN A;  4GZ8 A;  4FAN D;  2P9P C;  2CE9 A;  4QQE A;  3L4O D;  2HES X;  1QNI A;  1JOF A;  3IKO A;  3SN6 B;  3I8C A;  2P9U C;  4CZX A;  2CN2 A;  5EAR A;  4UI9 R;  5H1M A;  3C75 H;  5EM2 B;  3I7H A;  4MK0 B;  2B5L A;  2P9S C;  2OVQ B;  3KRX B;  4J0W A;  5CXB A;  2IUV A;  3DM0 A;  4JSN C;  2Z2P A;  4JD2 C;  3UVO A;  3EI1 A;  3GRE A;  1VYH C;  3FM0 A;  4XYH A;  2H13 A;  3RLM D;  4L9O A;  3EWE A;  3AL8 B;  5IC7 A;  3F3F A;  3I8E A;  1NEX B;  2W18 A;  4JT5 C;  4LGN A;  3IJ1 A;  3V7D B;  1OMW B;  4J84 A;  1YFQ A;  4PBY A;  2P9L C;  5A2Q g;  3UVM A;  2AH1 A;  4PXW A;  4XEI C;  2BCJ B;  2H6K A;  4ES0 A;  3KRW B;  5CXC A;  5EMJ B;  3SXT D;  4PC0 A;  1PBY B;  4A0A B;  4A09 B;  4JT6 C;  4ERQ A;  3FGB A;  4X61 B;  3AH8 B;  5HQG A;  2I0S A;  4E54 B;  4ERZ A;  3RSE C;  3EG6 A;  4QT8 A;  3RFH A;  1N6D A;  3MZK A;  4GM8 A;  5IGQ A;  5I5I A;  3BG0 A;  4D6V A;  2AH0 A;  4J79 A;  2HXC A;  3PVW B;  4FA1 D;  3J80 g;  1ERJ A;  2TRC B;  4FWW A;  5I5M A;  2G99 A;  4J8G A;  3OL2 A;  1MG2 A;  4AOW A;  2OJY A;  3B7F A;  4GM9 A;  4ZOY A;  2UZX B;  2H47 A;  3C5M A;  4J87 A;  3UKU C;  2AGY A;  5CYK A;  5EAL A;  4CY3 A;  3JPX A;  2PM9 B;  3F3P A;  2MTA H;  4BH6 A;  4EWR A;  4A0B A;  3NVQ A;  4CI1 A;  3U4Y A;  2XYI A;  3K26 A;  3IJC A;  2AGX A;  2AGL A;  3V9F A;  3CIK B;  1JMX B;  3EI3 A;  3J81 g;  2Z2N A;  5KDO B;  3GFC A;  4J77 A;  4GGA A;  2HYE A;  4A11 B;  3NVN A;  4CY1 A;  4FA5 D;  3SBP A;  2GC4 A;  2H6Q A;  5HE0 B;  3ULE C;  5EMM B;  2I3T A;  4CI8 A;  3IIY A;  2OVP B;  2P9I C;  2J55 H;  3IJ0 A;  2YMU A;  4A2M A;  2HKM A;  3PXS D;  3OW8 A;  4O1Q D;  5HYN B;  3SJL D;  5C2V B;  4JSP C;  3OKY B;  2HJ4 A;  4I79 A;  5JWZ A;  1NR0 A;  3SHF A;  1R5M A;  4K3I D;  3I7L A;  4FHL A;  2GC7 A;  5I5J A;  5H17 A;  2PBI B;  3PVU B;  3OL2 B;  5C2W B;  4YVD A;  4ESG A;  4J73 A;  2B4E A;  2B5M A;  5FQD A;  5C9Z B;  4JSX C;  3DXM C;  4CZV A;  5GXH A;  4O3U B;  2QXV A;  2I0T A;  4IA9 A;  4CC9 A;  4CY2 A;  2XU7 A;  4KFM B;  1GXR A;  4OZU A;  5EAM A;  3BG1 A;  3I7O A;  5FKQ A;  3UVL A;  5GSA A;  2IUP A;  3FRX A;  4A08 A;  4L1Q D;  3CFV A;  4E5Z A;  3EI4 B;  3DXK C;  4J8B A;  1XIP A;  2UZY B;  5TF2 A;  5FLX g;  4QL1 A;  4BL0 A;  5AFU 3;  1SQ9 A;  5FXY A;  2YNP A;  3JAM g;  4FA9 D;  3ORV D;  4FB1 D;  3IIW A;  1U4C A;  4GQ2 P;  5HE2 B;  4PSX B;  3VA6 A;  3UKR C;  5EMK B;  4GQ1 A;  1XHM A;  2BBK H;  1JJU B;  3PXT D;  1K8K C;  4PNK B;  1MDA H;  5AMS A;  4CY5 A;  1TBG A;  4TZ4 A;  5CXB B;  3EMH A;  3NVX A;  2IWF A;  3SCY A;  3EI1 B;  3EI2 A;  1SQJ A;  4K3J B;  2OK4 A;  2GNQ A;  1FWX A;  2EBS A;  2J57 G;  3MZL A;  4D0K A;  5K1C C;  4U1E I;  3N0E A;  5IGO A;  3CFS B;  4Y5R D;  1PI6 A;  2HJB A;  3ODT A;  1PEV A;  2H14 A;  3RFG A;  3HFQ A;  4O3T B;  2XL2 A;  4X60 B;  2Z2O A;  4CZY A;  1OLZ A;  5FKR A;  5B4W A;  3PSC B;  5EM2 A;  4CI3 A;  4FAV D;  5SXM A;  5K19 A;  1Q47 A;  4J86 A;  2QC5 A;  3MMY A;  4U7A A;  3SBR A;  2CO0 A;  3AFC A;  3SVW D;  3PE7 A;  3DSM A;  4ZOZ A;  5CXC B;  3I89 A;  2YB8 B;  4FA4 D;  5FKS A;  4X63 B;  5EML B;  3VH0 A;  3AL8 A;  3RMZ D;  2PM6 B;  2H9N A;  3SLE D;  2H3X A;  2YBA A;  1XKS A;  4QRJ A;  4JSV C;  4ZOX A;  2P9K C;  4Y7R A;  4Z8L A;  4AEZ A;  3PXW D;  3L4M D;  1B9Y A;  2H9L A;  1L0Q A;  3RN1 D;  3MKQ A;  3V5W B;  5IJ8 E;  2CO0 C;  3MKS B;  3I7K A;  5CYK B;  4A0A A;  4A09 A;  1GP2 B;  2PM7 B;  4LG8 A;  5HE1 B;  2H6N A;  4A7J A;  2AQ5 A;  2IWK A;  4A0B B;  2OVR B;  1P22 A;  3I7N A;  4E54 A;  3SWS D;  2Q7Q A;  4CI2 A;  3UVN A;  3EI3 B;  4G56 B;  4X3E A;  4H5I A;  5GMK n;  3I7P A;  4J82 A;  5IJ7 E;  3JZG A;  4OWR A;  4HDJ A;  3RN0 D;  2I3S A;  2AGZ A;  5EAP A;  4GMB A;  4LG9 A;  4GQB B;  2HKR A;  2H9M A;  2OIZ A;  1SHY B;  4PSW B;  3JRO A;  3K27 A;  2J56 H;  3VGZ A;  3SMR A;  2PM9 A;  5HE3 B;  3W15 A;  4J81 A;  4L3H D;  3JZN A;  4A2L A;  3P4F A;  3UVK A;  2I0R A;  2XL3 A;  3BWS A;  5AJA A;  2IAA A;  2G9A A;  4NSX A;  4XYI A;  3ZWL B;  5FKT A;  1A0R B;  4A11 A;  3PSL A;  4J78 A;  3RRM C;  3JB9 L;  1B9X A;  2IUR A;  2O9K A;  2H68 A;  4ZOV A;  2OK6 A;  3A0F A;  3SFZ A;  1GG2 B;  3C99 A;  1RI6 A;  4GGC A;  4ZN4 A;  4J0X A;  4BUJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...