3SVWD

Crystal structure of the p107v-maug/pre-methylamine dehydrogenase complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
molecule tags Oxidoreductase/electron transport
source organism Paracoccus denitrificans
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
total genus 97
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3svwD00
3OL2B 4FB1D 3B7FA 4A08A 3NVNA 2GC7A 4FA1D 3A0FA 4CY2A 4ZOXA 3EU7A 1P22A 3JZGA 3RFHA 2GC4A 5IGOA 3UVNA 3OKTA 5EM2A 3OKYA 2H9MA 4X3EA 2P9KC 4OWRA 5HE0B 1N6FA 2XL3A 3SN6B 5IJ8E 5HE3B 1VYHC 4PC0A 4D0KA 5K19A 2BCJB 1GXRA 3IJ1A 3PXWD 2YNNA 2PM6B 4O3TB 4L1QD 5H14A 3OKWA 4JT6C 5CXBA 4A0AA 5SXMA 3I8CA 4IA9A 4PSXB 3MXXA 3V5WB 1R5MA 1L0QA 4A09B 3DXKC 4QQEA 5H1MA 2Q7QA 4L3GD 4GGAA 4ERQA 2H47A 3RSEC 4CZVA 3SMRA 4QRJA 4X60B 2OVPB 3JROA 5AJAA 2G9AA 5K1CC 3IJCA 5KDOB 2CE9A 3SXTD 5GSAA 3PVWB 4JSVC 5HE2B 5IGQA 3EG6A 4J84A 4A0BB 2W18A 3OW8A 3I7KA 2H13A 4GM8A 3F3GA 1B9YA 4LGNA 4CY5A 1PBYB 3J80g 3UKUC 3I7OA 3EI1A 5C2VB 3IKOA 5CXCA 1MG3A 3I8EA 3C99A 4GQBB 4E54A 3PVUB 2IUQA 2Z2NA 5CYKB 4E5ZB 2CO0C 1JMXB 2CE8A 1N6EA 2XL2A 4GGDA 3SWSD 3SBPA 3EI3B 3JRPA 4A08B 4PXWA 2UZXB 3PSLA 1NR0A 3ORVD 5I5MA 3PSCB 5CYKA 4GM9A 5FA5B 5FKTA 3I7NA 4Z8LA 3RRMC 4ES0A 5JWZA 2HKRA 5FKSA 1JOFA 4J8GA 4E54B 3I7HA 4A11B 4GZ8A 4J77A 2CN3A 4I79A 4GQ1A 3UVOA 2Z2PA 3IIWA 4J82A 3UVMA 4ZOVA 4CI1A 4K3JB 2AH0A 2H9LA 4J86A 3VH0A 3DWLC 4AOWA 5IT9g 4N14A 4L9OA 3UVLA 3MZKA 2YNOA 4A7JA 2J55H 3SHFA 3AH8B 3C75H 4GQ2P 4X61B 1XIPA 2AGLA 5I5JA 2PM9B 3BG1A 1YFQA 3L4MD 3GFCA 3ZWLB 2BBKH 2I3TA 1MG2A 1A0RB 4YVDA 2P9SC 1GG2B 4J8BA 3UKRC 3FRXA 1N6DA 2EBSA 4ERZA 3I2NA 3DM0A 2QXVA 4J81A 5GXIA 2I0RA 1K32A 4LG9A 3AL8B 2H9NA 1TYQC 2OK6A 4JSNC 3N0DA 4ZOZA 3FM0A 3F3PA 3JZHA 2J56H 4FAND 3RFGA 4OZUA 2G99A 4BUJC 1U4CA 1XHMA 4D6VA 2AQ5A 3EI2A 2HESX 2Z2OA 5IJ7E 3CIKB 3K27A 4ZOYA 2B4EA 3SCYA 5GMKn 4TZ4A 2I3SA 5HYNB 3SBRA 1ERJA 3GREA 4AEZA 3IIYA 3MZLA 4LG8A 2OVRB 5AMSA 2PBIB 3AL9A 3VA6A 2P9IC 4U7AA 4XYHA 2IAAA 4JSXC 4FHLA 4CI2A 2OJYA 3U4YA 1PI6A 3OTTA 5TDHB 3CFSB 4CC9A 5EMJB 2AGXA 3BG0A 4H5IA 3DXMC 5H17A 3OKYB 4G56B 3FGBA 2TRCB 4K3ID 2H9PA 3HFQA 4XEIC 1GP2B 2P9LC 5HQGA 3KRWB 3V7DB 3AL8A 4IMMA 5B4WA 3SVWD 2AGYA 3EI4B 4A09A 3MKSB 5TEFA 4J0WA 4ERYA 4CY1A 4JXMA 5EAMA 4EWRA 4ESGA 4BH6A 4UI9R 1U2VC 2H14A 4FAVD 5EMLB 5EALA 4ZN4A 3OL2A 3CFVA 2YMUA 1K8KC 1Q47A 1B9XA 2I0SA 4A11A 5C9ZB 4L3HD 4FA4D 5THAA 3UVKA 3I89A 4NSXA 5I5IA 3EI1B 1RI6A 4HDJA 4FWWA 3F3FA 5TEEA 1NEXB 3KRXB 4QT8A 3SFZA 5C2WB 4J79A 2OK4A 1FWXA 3BWSA 3C9CA 2YB8B 2H6QA 4O1QD 5EMKB 2P9PC 3NVQA 4JT5C 3PXTD 3E0CA 2H3XA 2YBAA 3RN1D 3SLED 2P9NC 2H68A 3I7LA 3EI3A 2IWFA 5FXYA 3JAMg 1SQJA 4J73A 5FLXg 2CO0A 1XKSA 4MK0B 2YNPA 3MKQA 2H6KA 3AFCA 4GM3A 4Y5RD 3W15A 4CI3A 4QL1A 3C5MA 4CZYA 1OMWB 5EAPA 3P4FA 2CN2A 3SJLD 4A0BA 3K26A 2B5MA 2O9KA 2B5LA 2P9UC 2AGZA 4O3UB 4PBZA 1QNIA 3RLMD 1OLZA 4FA9D 2I0TA 3RN0D 5HE1B 4PSWB 2HXCA 3UR4A 1MDAH 3ULEC 2B5NA 4JSPC 3SBQA 2XYIA 2H6NA 3EWEA 2HKMA 1JJUB 5FKQA 5EM2B 4CY3A 3JPXA 4CZXA 1PGUA 4CI8A 5FKRA 4JD2C 2OVQB 4O45A 2AH1A 2MTAH 4Y7RA 2PM9A 1GOTB 5A2Qg 2OIZA 5EARA 3VGZA 3DSMA 4O9DA 3PXSD 2HJBA 3I7PA 5GXHA 2IUVA 4X63B 2IURA 3EI4A 2UZYB 3ODTA 2PM7B 5EMMB 5FQDA 2AGWA 1PEVA 4H5JA 4XYIA 5CXCB 3NVXA 4PBYA 5IC7A 3PE7A 3EMHA 3JZNA 4BL0A 1SQ9A 2HJ4A 3V9FA 4J0XA 2IWKA 2HYEA 4J78A 1S4UX 2CNXA 4R7AB 2XU7A 3MMYA 3RMZD 4GGCA 3JB9L 3J81g 2QC5A 3IJ0A 4FA5D 1JMZB 4A2LA 5CXBB 4A0AB 2GNQA 2J57G 4KFMB 1TBGA 5TF2A 2IUPA 3N0EA 4U1EI 5AFU3 4J87A 3EI2B 4PNKB 1SHYB 4E5ZA 3L4OD 4GMBA 4A2MA
chains in the Genus database with same CATH superfamily
2VDQA 3OL2B 4FB1D 3B7FA 3EQ8A 4A08A 3NVNA 2GC7A 4FA1D 3A0FA 4CY2A 4ZOXA 3EU7A 3NIGA 4BP8A 3K72A 1P22A 3JZGA 3RFHA 2GC4A 1QFSA 1VE7A 5IGOA 3UVNA 3OKTA 5EM2A 3OKYA 2H9MA 4X3EA 2P9KC 4OWRA 5HE0B 1N6FA 1T2XA 2XL3A 3SN6B 3VI4A 5IJ8E 5HE3B 1VYHC 3IUQA 4PC0A 4D0KA 5K19A 3MUNA 2BCJB 1GXRA 3IJ1A 4G1EA 4BCDA 3PXWD 2YNNA 4QAMA 4RE6A 2PM6B 3V4PA 4O3TB 3NIDA 3IULA 4L1QD 5H14A 3OKWA 4JT6C 5CXBA 4A0AA 5SXMA 4BP9A 3I8CA 1O6FA 4IA9A 2JKXA 4PSXB 4UM9A 3MXXA 3V5WB 4AN0A 1R5MA 5C86A 1L0QA 4A09B 1H2ZA 3DXKC 4QQEA 5H1MA 2Q7QA 4L3GD 4NC4A 4GGAA 4ERQA 2H47A 3RSEC 4CZVA 3SMRA 4QRJA 4X60B 2OVPB 3JROA 5AJAA 2G9AA 5K1CC 3IJCA 5KDOB 2CE9A 3SXTD 5GSAA 3PVWB 4JSVC 3IUMA 5HE2B 5IGQA 3EG6A 4G1MA 3O4JA 4J84A 4A0BB 2W18A 3OW8A 2VDNA 3I7KA 2H13A 4GM8A 3F3GA 3OF7A 1B9YA 4LGNA 4CY5A 1PBYB 3J80g 3UKUC 3I7OA 3EI1A 5C2VB 3IKOA 5CXCA 1MG3A 3I8EA 1VE6A 3C99A 3EQ9A 2BKLA 4GQBB 4E54A 3PVUB 2IUQA 2Z2NA 5CYKB 4E5ZB 2CO0C 1JMXB 2CE8A 1N6EA 2XL2A 4GGDA 1UOQA 3SWSD 3SBPA 3EI3B 3JRPA 4A08B 3IVMA 2UZXB 4PXWA 4WK2A 1H2YA 3PSLA 1NR0A 3ORVD 5I5MA 4AX4A 3PSCB 5CYKA 3DDUA 4GM9A 5M5SA 5FA5B 3K71A 5FKTA 4NENA 3I7NA 4Z8LA 3RRMC 4ES0A 3IUNA 5JWZA 1O6GA 2HKRA 5FKSA 1JOFA 4J8GA 4E54B 3ZE1A 3I7HA 4A11B 4GZ8A 4J77A 2CN3A 4I79A 4GQ1A 3VI3A 3UVOA 2Z2PA 3IIWA 4IRZA 4J82A 3UVMA 4ZOVA 4CI1A 4K3JB 2AH0A 2H9LA 4J86A 4BCBA 3VH0A 3DWLC 4AOWA 5IT9g 4N14A 1K3IA 4L9OA 3UVLA 3MZKA 2YNOA 4A7JA 2J55H 3QI0A 3SHFA 3AH8B 2XDWA 3C75H 3KCIA 4JHPC 4GQ2P 4X61B 2HU8A 1QFMA 1XIPA 2AGLA 5I5JA 2PM9B 3BG1A 1YFQA 3L4MD 3GFCA 3ZE0A 3ZWLB 2BBKH 2I3TA 1MG2A 1A0RB 5HDBA 4DNVA 4YVDA 4MMYA 2P9SC 1GG2B 4J8BA 3UKRC 1E8MA 3FRXA 1N6DA 2EBSA 4ERZA 3I2NA 1M1XA 3DM0A 2QXVA 4J81A 5GXIA 5M5VA 2I0RA 1K32A 4LG9A 3AL8B 1TYQC 2H9NA 2OK6A 3O4IA 4JSNC 3N0DA 4AMZA 4ZOZA 3ZE2A 3FM0A 3F3PA 2VDLA 3JZHA 2J56H 2VZ1A 4FAND 3RFGA 3MUOA 4AMYA 4OZUA 2G99A 4BUJC 1U4CA 3O4HA 1XHMA 2QZPA 4D6VA 5M5TA 2AQ5A 5E6UA 3ZDXA 3EI2A 2HESX 2Z2OA 3ZDYA 5IJ7E 3CIKB 3K27A 4ZOYA 2B4EA 3SCYA 5M5RA 5GMKn 4TZ4A 2I3SA 2WQ8A 5HYNB 3SBRA 4NBMA 1ERJA 3GREA 4AEZA 3IIYA 2QR5A 3IJEA 4RE5A 3MZLA 4LG8A 2OVRB 2VDOA 2VDMA 5AMSA 2PBIB 3AL9A 3VA6A 5E6RA 2P9IC 4U7AA 4XYHA 2IAAA 4JSXC 4FHLA 4AN1A 4CI2A 2OJYA 3U4YA 1PI6A 3OTTA 5TDHB 1GOGA 3CFSB 5EMJB 4WK0A 4CC9A 2AGXA 3BG0A 4H5IA 3DXMC 5H17A 3OKYB 4DNWA 4G56B 3FGBA 2TRCB 4K3ID 2H9PA 3HFQA 4XEIC 2XZGA 5E6SA 1GP2B 2P9LC 3O4GA 5HQGA 3KRWB 3V7DB 3AL8A 4IMMA 4Z7QA 5B4WA 3SVWD 3FCUA 2EIEA 2AGYA 3EI4B 4A09A 3MKSB 5TEFA 4J0WA 4ERYA 4CY1A 4JXMA 5EAMA 4EWRA 1BPOA 4ESGA 3QHYB 1UOOA 1TYEA 4BH6A 4UI9R 1U2VC 2H14A 4FAVD 1I2MB 5EMLB 1UTCA 5EALA 4ZN4A 3OL2A 3CFVA 2YMUA 1K8KC 1Q47A 1B9XA 2I0SA 4A11A 5C9ZB 4L3HD 3NIFA 4FA4D 5THAA 3IURA 3UVKA 3I89A 4NSXA 5I5IA 3EI1B 1RI6A 4HDJA 4FWWA 3F3FA 5TEEA 1NEXB 3KRXB 4WJKA 4QT8A 3SFZA 5C2WB 4J79A 3GD1I 2OK4A 1JV2A 1FWXA 1VZ3A 3BWSA 3C9CA 2YB8B 2H6QA 4O1QD 5EMKB 4O02A 2P9PC 3NVQA 4JT5C 3PXTD 4WK4A 2VDKA 3E0CA 1UOPA 5M5UA 3T3PA 2H3XA 2YBAA 3RN1D 3SLED 4O2WA 2VDPA 1VZ2A 2P9NC 2H68A 2VZ3A 3EI3A 2IWFA 3I7LA 5FXYA 3JAMg 4D9SA 1SQJA 4J73A 5FLXg 2CO0A 4MMXA 1XKSA 4MK0B 2YNPA 3MKQA 3IUJA 2H6KA 3AFCA 2EIDA 4GM3A 4Y5RD 3W15A 4CI3A 4QL1A 3C5MA 4CZYA 1OMWB 1YR2A 5EAPA 3P4FA 2CN2A 3SJLD 1U8CA 4A0BA 3K26A 2B5MA 2O9KA 2B5LA 2P9UC 2AGZA 4O3UB 4PBZA 5C92A 1QNIA 3RLMD 3GC3B 1OLZA 4FA9D 2I0TA 3RN0D 1JTDB 5HE1B 4PSWB 2HXCA 4Z7OA 3UR4A 1MDAH 3ULEC 1E8NA 2B5NA 4JSPC 3SBQA 2XYIA 2H6NA 3EWEA 2XE4A 2HKMA 1JJUB 3V4VA 5FKQA 5EM2B 4NAAA 4CY3A 1H2WA 4JHNA 3JPXA 4CZXA 1PGUA 1E5TA 4CI8A 5FKRA 4JD2C 2OVQB 4O45A 2AH1A 3T3MA 3K6SA 2MTAH 4Y7RA 4L1MA 2PM9A 1GOTB 5A2Qg 5FFOA 2OIZA 5EARA 3FCSA 3VGZA 3EQ7A 4Z7NA 3DSMA 4O9DA 4DNUA 3PXSD 1L5GA 2HJBA 3I7PA 5GXHA 2IUVA 4BCCA 2VC2A 4X63B 2IURA 3EI4A 1A12A 2UZYB 3ODTA 2PM7B 5FFGA 2HU5A 5EMMB 5FQDA 2AGWA 1PEVA 4H5JA 4XYIA 2VDRA 5CXCB 3NVXA 4PBYA 2EICA 5IC7A 3ZDZA 3PE7A 3EMHA 3JZNA 4BL0A 4UM8A 1SQ9A 2HJ4A 3V9FA 4J0XA 2IWKA 2HYEA 4J78A 1S4UX 4MMZA 2CNXA 4R7AB 2XU7A 3MMYA 2EIBA 1H2XA 4GGCA 3RMZD 3JB9L 3J81g 2QC5A 1GOHA 1GOFA 3IJ0A 1C9LA 1JMZB 4A2LA 4FA5D 2HU7A 5CXBB 4A0AB 4G55A 2GNQA 2J57G 4KFMB 1TBGA 5M61A 5TF2A 2IUPA 3N0EA 1C9IA 4U1EI 4J87A 5AFU3 3EI2B 4PNKB 1SHYB 4E5ZA 3MVDK 3L4OD 4GMBA 4A2MA
chains in the Genus database with same CATH topology
3OL2B 4FB1D 3B7FA 4A08A 3NVNA 2GC7A 4FA1D 3A0FA 4CY2A 4ZOXA 3EU7A 1P22A 3JZGA 3RFHA 2GC4A 5IGOA 3UVNA 3OKTA 5EM2A 3OKYA 2H9MA 4X3EA 2P9KC 4OWRA 5HE0B 1N6FA 2XL3A 3SN6B 5IJ8E 5HE3B 1VYHC 4PC0A 4D0KA 5K19A 2BCJB 1GXRA 3IJ1A 3PXWD 2YNNA 2PM6B 4O3TB 4L1QD 5H14A 3OKWA 4JT6C 5CXBA 4A0AA 5SXMA 3I8CA 4IA9A 4PSXB 3MXXA 3V5WB 1R5MA 1L0QA 4A09B 3DXKC 4QQEA 5H1MA 2Q7QA 4L3GD 4GGAA 4ERQA 2H47A 3RSEC 4CZVA 3SMRA 4QRJA 4X60B 2OVPB 3JROA 5AJAA 2G9AA 5K1CC 3IJCA 5KDOB 2CE9A 3SXTD 5GSAA 3PVWB 4JSVC 5HE2B 5IGQA 3EG6A 4J84A 4A0BB 2W18A 3OW8A 3I7KA 2H13A 4GM8A 3F3GA 1B9YA 4LGNA 4CY5A 1PBYB 3J80g 3UKUC 3I7OA 3EI1A 5C2VB 3IKOA 5CXCA 1MG3A 3I8EA 3C99A 4GQBB 4E54A 3PVUB 2IUQA 2Z2NA 5CYKB 4E5ZB 2CO0C 1JMXB 2CE8A 1N6EA 2XL2A 4GGDA 3SWSD 3SBPA 3EI3B 3JRPA 4A08B 4PXWA 2UZXB 3PSLA 1NR0A 3ORVD 5I5MA 3PSCB 5CYKA 4GM9A 5FA5B 5FKTA 3I7NA 4Z8LA 3RRMC 4ES0A 5JWZA 2HKRA 5FKSA 1JOFA 4J8GA 4E54B 3I7HA 4A11B 4GZ8A 4J77A 2CN3A 4I79A 4GQ1A 3UVOA 2Z2PA 3IIWA 4J82A 3UVMA 4ZOVA 4CI1A 4K3JB 2AH0A 2H9LA 4J86A 3VH0A 3DWLC 4AOWA 5IT9g 4N14A 4L9OA 3UVLA 3MZKA 2YNOA 4A7JA 2J55H 3SHFA 3AH8B 3C75H 4GQ2P 4X61B 1XIPA 2AGLA 5I5JA 2PM9B 3BG1A 1YFQA 3L4MD 3GFCA 3ZWLB 2BBKH 2I3TA 1MG2A 1A0RB 4YVDA 2P9SC 1GG2B 4J8BA 3UKRC 3FRXA 1N6DA 2EBSA 4ERZA 3I2NA 3DM0A 2QXVA 4J81A 5GXIA 2I0RA 1K32A 4LG9A 3AL8B 2H9NA 1TYQC 2OK6A 4JSNC 3N0DA 4ZOZA 3FM0A 3F3PA 3JZHA 2J56H 4FAND 3RFGA 4OZUA 2G99A 4BUJC 1U4CA 1XHMA 4D6VA 2AQ5A 3EI2A 2HESX 2Z2OA 5IJ7E 3CIKB 3K27A 4ZOYA 2B4EA 3SCYA 5GMKn 4TZ4A 2I3SA 5HYNB 3SBRA 1ERJA 3GREA 4AEZA 3IIYA 3MZLA 4LG8A 2OVRB 5AMSA 2PBIB 3AL9A 3VA6A 2P9IC 4U7AA 4XYHA 2IAAA 4JSXC 4FHLA 4CI2A 2OJYA 3U4YA 1PI6A 3OTTA 5TDHB 3CFSB 4CC9A 5EMJB 2AGXA 3BG0A 4H5IA 3DXMC 5H17A 3OKYB 4G56B 3FGBA 2TRCB 4K3ID 2H9PA 3HFQA 4XEIC 1GP2B 2P9LC 5HQGA 3KRWB 3V7DB 3AL8A 4IMMA 5B4WA 3SVWD 2AGYA 3EI4B 4A09A 3MKSB 5TEFA 4J0WA 4ERYA 4CY1A 4JXMA 5EAMA 4EWRA 4ESGA 4BH6A 4UI9R 1U2VC 2H14A 4FAVD 5EMLB 5EALA 4ZN4A 3OL2A 3CFVA 2YMUA 1K8KC 1Q47A 1B9XA 2I0SA 4A11A 5C9ZB 4L3HD 4FA4D 5THAA 3UVKA 3I89A 4NSXA 5I5IA 3EI1B 1RI6A 4HDJA 4FWWA 3F3FA 5TEEA 1NEXB 3KRXB 4QT8A 3SFZA 5C2WB 4J79A 2OK4A 1FWXA 3BWSA 3C9CA 2YB8B 2H6QA 4O1QD 5EMKB 2P9PC 3NVQA 4JT5C 3PXTD 3E0CA 2H3XA 2YBAA 3RN1D 3SLED 2P9NC 2H68A 3I7LA 3EI3A 2IWFA 5FXYA 3JAMg 1SQJA 4J73A 5FLXg 2CO0A 1XKSA 4MK0B 2YNPA 3MKQA 2H6KA 3AFCA 4GM3A 4Y5RD 3W15A 4CI3A 4QL1A 3C5MA 4CZYA 1OMWB 5EAPA 3P4FA 2CN2A 3SJLD 4A0BA 3K26A 2B5MA 2O9KA 2B5LA 2P9UC 2AGZA 4O3UB 4PBZA 1QNIA 3RLMD 1OLZA 4FA9D 2I0TA 3RN0D 5HE1B 4PSWB 2HXCA 3UR4A 1MDAH 3ULEC 2B5NA 4JSPC 3SBQA 2XYIA 2H6NA 3EWEA 2HKMA 1JJUB 5FKQA 5EM2B 4CY3A 3JPXA 4CZXA 1PGUA 4CI8A 5FKRA 4JD2C 2OVQB 4O45A 2AH1A 2MTAH 4Y7RA 2PM9A 1GOTB 5A2Qg 2OIZA 5EARA 3VGZA 3DSMA 4O9DA 3PXSD 2HJBA 3I7PA 5GXHA 2IUVA 4X63B 2IURA 3EI4A 2UZYB 3ODTA 2PM7B 5EMMB 5FQDA 2AGWA 1PEVA 4H5JA 4XYIA 5CXCB 3NVXA 4PBYA 5IC7A 3PE7A 3EMHA 3JZNA 4BL0A 1SQ9A 2HJ4A 3V9FA 4J0XA 2IWKA 2HYEA 4J78A 1S4UX 2CNXA 4R7AB 2XU7A 3MMYA 3RMZD 4GGCA 3JB9L 3J81g 2QC5A 3IJ0A 4FA5D 1JMZB 4A2LA 5CXBB 4A0AB 2GNQA 2J57G 4KFMB 1TBGA 5TF2A 2IUPA 3N0EA 4U1EI 5AFU3 4J87A 3EI2B 4PNKB 1SHYB 4E5ZA 3L4OD 4GMBA 4A2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL2 B;  4FB1 D;  3B7F A;  4A08 A;  3NVN A;  2GC7 A;  4FA1 D;  3A0F A;  4CY2 A;  4ZOX A;  3EU7 A;  1P22 A;  3JZG A;  3RFH A;  2GC4 A;  5IGO A;  3UVN A;  3OKT A;  5EM2 A;  3OKY A;  2H9M A;  4X3E A;  2P9K C;  4OWR A;  5HE0 B;  1N6F A;  2XL3 A;  3SN6 B;  5IJ8 E;  5HE3 B;  1VYH C;  4PC0 A;  4D0K A;  5K19 A;  2BCJ B;  1GXR A;  3IJ1 A;  3PXW D;  2YNN A;  2PM6 B;  4O3T B;  4L1Q D;  5H14 A;  3OKW A;  4JT6 C;  5CXB A;  4A0A A;  5SXM A;  3I8C A;  4IA9 A;  4PSX B;  3MXX A;  3V5W B;  1R5M A;  1L0Q A;  4A09 B;  3DXK C;  4QQE A;  5H1M A;  2Q7Q A;  4L3G D;  4GGA A;  4ERQ A;  2H47 A;  3RSE C;  4CZV A;  3SMR A;  4QRJ A;  4X60 B;  2OVP B;  3JRO A;  5AJA A;  2G9A A;  5K1C C;  3IJC A;  5KDO B;  2CE9 A;  3SXT D;  5GSA A;  3PVW B;  4JSV C;  5HE2 B;  5IGQ A;  3EG6 A;  4J84 A;  4A0B B;  2W18 A;  3OW8 A;  3I7K A;  2H13 A;  4GM8 A;  3F3G A;  1B9Y A;  4LGN A;  4CY5 A;  1PBY B;  3J80 g;  3UKU C;  3I7O A;  3EI1 A;  5C2V B;  3IKO A;  5CXC A;  1MG3 A;  3I8E A;  3C99 A;  4GQB B;  4E54 A;  3PVU B;  2IUQ A;  2Z2N A;  5CYK B;  4E5Z B;  2CO0 C;  1JMX B;  2CE8 A;  1N6E A;  2XL2 A;  4GGD A;  3SWS D;  3SBP A;  3EI3 B;  3JRP A;  4A08 B;  4PXW A;  2UZX B;  3PSL A;  1NR0 A;  3ORV D;  5I5M A;  3PSC B;  5CYK A;  4GM9 A;  5FA5 B;  5FKT A;  3I7N A;  4Z8L A;  3RRM C;  4ES0 A;  5JWZ A;  2HKR A;  5FKS A;  1JOF A;  4J8G A;  4E54 B;  3I7H A;  4A11 B;  4GZ8 A;  4J77 A;  2CN3 A;  4I79 A;  4GQ1 A;  3UVO A;  2Z2P A;  3IIW A;  4J82 A;  3UVM A;  4ZOV A;  4CI1 A;  4K3J B;  2AH0 A;  2H9L A;  4J86 A;  3VH0 A;  3DWL C;  4AOW A;  5IT9 g;  4N14 A;  4L9O A;  3UVL A;  3MZK A;  2YNO A;  4A7J A;  2J55 H;  3SHF A;  3AH8 B;  3C75 H;  4GQ2 P;  4X61 B;  1XIP A;  2AGL A;  5I5J A;  2PM9 B;  3BG1 A;  1YFQ A;  3L4M D;  3GFC A;  3ZWL B;  2BBK H;  2I3T A;  1MG2 A;  1A0R B;  4YVD A;  2P9S C;  1GG2 B;  4J8B A;  3UKR C;  3FRX A;  1N6D A;  2EBS A;  4ERZ A;  3I2N A;  3DM0 A;  2QXV A;  4J81 A;  5GXI A;  2I0R A;  1K32 A;  4LG9 A;  3AL8 B;  2H9N A;  1TYQ C;  2OK6 A;  4JSN C;  3N0D A;  4ZOZ A;  3FM0 A;  3F3P A;  3JZH A;  2J56 H;  4FAN D;  3RFG A;  4OZU A;  2G99 A;  4BUJ C;  1U4C A;  1XHM A;  4D6V A;  2AQ5 A;  3EI2 A;  2HES X;  2Z2O A;  5IJ7 E;  3CIK B;  3K27 A;  4ZOY A;  2B4E A;  3SCY A;  5GMK n;  4TZ4 A;  2I3S A;  5HYN B;  3SBR A;  1ERJ A;  3GRE A;  4AEZ A;  3IIY A;  3MZL A;  4LG8 A;  2OVR B;  5AMS A;  2PBI B;  3AL9 A;  3VA6 A;  2P9I C;  4U7A A;  4XYH A;  2IAA A;  4JSX C;  4FHL A;  4CI2 A;  2OJY A;  3U4Y A;  1PI6 A;  3OTT A;  5TDH B;  3CFS B;  4CC9 A;  5EMJ B;  2AGX A;  3BG0 A;  4H5I A;  3DXM C;  5H17 A;  3OKY B;  4G56 B;  3FGB A;  2TRC B;  4K3I D;  2H9P A;  3HFQ A;  4XEI C;  1GP2 B;  2P9L C;  5HQG A;  3KRW B;  3V7D B;  3AL8 A;  4IMM A;  5B4W A;  3SVW D;  2AGY A;  3EI4 B;  4A09 A;  3MKS B;  5TEF A;  4J0W A;  4ERY A;  4CY1 A;  4JXM A;  5EAM A;  4EWR A;  4ESG A;  4BH6 A;  4UI9 R;  1U2V C;  2H14 A;  4FAV D;  5EML B;  5EAL A;  4ZN4 A;  3OL2 A;  3CFV A;  2YMU A;  1K8K C;  1Q47 A;  1B9X A;  2I0S A;  4A11 A;  5C9Z B;  4L3H D;  4FA4 D;  5THA A;  3UVK A;  3I89 A;  4NSX A;  5I5I A;  3EI1 B;  1RI6 A;  4HDJ A;  4FWW A;  3F3F A;  5TEE A;  1NEX B;  3KRX B;  4QT8 A;  3SFZ A;  5C2W B;  4J79 A;  2OK4 A;  1FWX A;  3BWS A;  3C9C A;  2YB8 B;  2H6Q A;  4O1Q D;  5EMK B;  2P9P C;  3NVQ A;  4JT5 C;  3PXT D;  3E0C A;  2H3X A;  2YBA A;  3RN1 D;  3SLE D;  2P9N C;  2H68 A;  3I7L A;  3EI3 A;  2IWF A;  5FXY A;  3JAM g;  1SQJ A;  4J73 A;  5FLX g;  2CO0 A;  1XKS A;  4MK0 B;  2YNP A;  3MKQ A;  2H6K A;  3AFC A;  4GM3 A;  4Y5R D;  3W15 A;  4CI3 A;  4QL1 A;  3C5M A;  4CZY A;  1OMW B;  5EAP A;  3P4F A;  2CN2 A;  3SJL D;  4A0B A;  3K26 A;  2B5M A;  2O9K A;  2B5L A;  2P9U C;  2AGZ A;  4O3U B;  4PBZ A;  1QNI A;  3RLM D;  1OLZ A;  4FA9 D;  2I0T A;  3RN0 D;  5HE1 B;  4PSW B;  2HXC A;  3UR4 A;  1MDA H;  3ULE C;  2B5N A;  4JSP C;  3SBQ A;  2XYI A;  2H6N A;  3EWE A;  2HKM A;  1JJU B;  5FKQ A;  5EM2 B;  4CY3 A;  3JPX A;  4CZX A;  1PGU A;  4CI8 A;  5FKR A;  4JD2 C;  2OVQ B;  4O45 A;  2AH1 A;  2MTA H;  4Y7R A;  2PM9 A;  1GOT B;  5A2Q g;  2OIZ A;  5EAR A;  3VGZ A;  3DSM A;  4O9D A;  3PXS D;  2HJB A;  3I7P A;  5GXH A;  2IUV A;  4X63 B;  2IUR A;  3EI4 A;  2UZY B;  3ODT A;  2PM7 B;  5EMM B;  5FQD A;  2AGW A;  1PEV A;  4H5J A;  4XYI A;  5CXC B;  3NVX A;  4PBY A;  5IC7 A;  3PE7 A;  3EMH A;  3JZN A;  4BL0 A;  1SQ9 A;  2HJ4 A;  3V9F A;  4J0X A;  2IWK A;  2HYE A;  4J78 A;  1S4U X;  2CNX A;  4R7A B;  2XU7 A;  3MMY A;  3RMZ D;  4GGC A;  3JB9 L;  3J81 g;  2QC5 A;  3IJ0 A;  4FA5 D;  1JMZ B;  4A2L A;  5CXB B;  4A0A B;  2GNQ A;  2J57 G;  4KFM B;  1TBG A;  5TF2 A;  2IUP A;  3N0E A;  4U1E I;  5AFU 3;  4J87 A;  3EI2 B;  4PNK B;  1SHY B;  4E5Z A;  3L4O D;  4GMB A;  4A2M A; 
#chains in the Genus database with same CATH topology
 2VDQ A;  3OL2 B;  4FB1 D;  3B7F A;  3EQ8 A;  4A08 A;  3NVN A;  2GC7 A;  4FA1 D;  3A0F A;  4CY2 A;  4ZOX A;  3EU7 A;  3NIG A;  4BP8 A;  3K72 A;  1P22 A;  3JZG A;  3RFH A;  2GC4 A;  1QFS A;  1VE7 A;  5IGO A;  3UVN A;  3OKT A;  5EM2 A;  3OKY A;  2H9M A;  4X3E A;  2P9K C;  4OWR A;  5HE0 B;  1N6F A;  1T2X A;  2XL3 A;  3SN6 B;  3VI4 A;  5IJ8 E;  5HE3 B;  1VYH C;  3IUQ A;  4PC0 A;  4D0K A;  5K19 A;  3MUN A;  2BCJ B;  1GXR A;  3IJ1 A;  4G1E A;  4BCD A;  3PXW D;  2YNN A;  4QAM A;  4RE6 A;  2PM6 B;  3V4P A;  4O3T B;  3NID A;  3IUL A;  4L1Q D;  5H14 A;  3OKW A;  4JT6 C;  5CXB A;  4A0A A;  5SXM A;  4BP9 A;  3I8C A;  1O6F A;  4IA9 A;  2JKX A;  4PSX B;  4UM9 A;  3MXX A;  3V5W B;  4AN0 A;  1R5M A;  5C86 A;  1L0Q A;  4A09 B;  1H2Z A;  3DXK C;  4QQE A;  5H1M A;  2Q7Q A;  4L3G D;  4NC4 A;  4GGA A;  4ERQ A;  2H47 A;  3RSE C;  4CZV A;  3SMR A;  4QRJ A;  4X60 B;  2OVP B;  3JRO A;  5AJA A;  2G9A A;  5K1C C;  3IJC A;  5KDO B;  2CE9 A;  3SXT D;  5GSA A;  3PVW B;  4JSV C;  3IUM A;  5HE2 B;  5IGQ A;  3EG6 A;  4G1M A;  3O4J A;  4J84 A;  4A0B B;  2W18 A;  3OW8 A;  2VDN A;  3I7K A;  2H13 A;  4GM8 A;  3F3G A;  3OF7 A;  1B9Y A;  4LGN A;  4CY5 A;  1PBY B;  3J80 g;  3UKU C;  3I7O A;  3EI1 A;  5C2V B;  3IKO A;  5CXC A;  1MG3 A;  3I8E A;  1VE6 A;  3C99 A;  3EQ9 A;  2BKL A;  4GQB B;  4E54 A;  3PVU B;  2IUQ A;  2Z2N A;  5CYK B;  4E5Z B;  2CO0 C;  1JMX B;  2CE8 A;  1N6E A;  2XL2 A;  4GGD A;  1UOQ A;  3SWS D;  3SBP A;  3EI3 B;  3JRP A;  4A08 B;  3IVM A;  2UZX B;  4PXW A;  4WK2 A;  1H2Y A;  3PSL A;  1NR0 A;  3ORV D;  5I5M A;  4AX4 A;  3PSC B;  5CYK A;  3DDU A;  4GM9 A;  5M5S A;  5FA5 B;  3K71 A;  5FKT A;  4NEN A;  3I7N A;  4Z8L A;  3RRM C;  4ES0 A;  3IUN A;  5JWZ A;  1O6G A;  2HKR A;  5FKS A;  1JOF A;  4J8G A;  4E54 B;  3ZE1 A;  3I7H A;  4A11 B;  4GZ8 A;  4J77 A;  2CN3 A;  4I79 A;  4GQ1 A;  3VI3 A;  3UVO A;  2Z2P A;  3IIW A;  4IRZ A;  4J82 A;  3UVM A;  4ZOV A;  4CI1 A;  4K3J B;  2AH0 A;  2H9L A;  4J86 A;  4BCB A;  3VH0 A;  3DWL C;  4AOW A;  5IT9 g;  4N14 A;  1K3I A;  4L9O A;  3UVL A;  3MZK A;  2YNO A;  4A7J A;  2J55 H;  3QI0 A;  3SHF A;  3AH8 B;  2XDW A;  3C75 H;  3KCI A;  4JHP C;  4GQ2 P;  4X61 B;  2HU8 A;  1QFM A;  1XIP A;  2AGL A;  5I5J A;  2PM9 B;  3BG1 A;  1YFQ A;  3L4M D;  3GFC A;  3ZE0 A;  3ZWL B;  2BBK H;  2I3T A;  1MG2 A;  1A0R B;  5HDB A;  4DNV A;  4YVD A;  4MMY A;  2P9S C;  1GG2 B;  4J8B A;  3UKR C;  1E8M A;  3FRX A;  1N6D A;  2EBS A;  4ERZ A;  3I2N A;  1M1X A;  3DM0 A;  2QXV A;  4J81 A;  5GXI A;  5M5V A;  2I0R A;  1K32 A;  4LG9 A;  3AL8 B;  1TYQ C;  2H9N A;  2OK6 A;  3O4I A;  4JSN C;  3N0D A;  4AMZ A;  4ZOZ A;  3ZE2 A;  3FM0 A;  3F3P A;  2VDL A;  3JZH A;  2J56 H;  2VZ1 A;  4FAN D;  3RFG A;  3MUO A;  4AMY A;  4OZU A;  2G99 A;  4BUJ C;  1U4C A;  3O4H A;  1XHM A;  2QZP A;  4D6V A;  5M5T A;  2AQ5 A;  5E6U A;  3ZDX A;  3EI2 A;  2HES X;  2Z2O A;  3ZDY A;  5IJ7 E;  3CIK B;  3K27 A;  4ZOY A;  2B4E A;  3SCY A;  5M5R A;  5GMK n;  4TZ4 A;  2I3S A;  2WQ8 A;  5HYN B;  3SBR A;  4NBM A;  1ERJ A;  3GRE A;  4AEZ A;  3IIY A;  2QR5 A;  3IJE A;  4RE5 A;  3MZL A;  4LG8 A;  2OVR B;  2VDO A;  2VDM A;  5AMS A;  2PBI B;  3AL9 A;  3VA6 A;  5E6R A;  2P9I C;  4U7A A;  4XYH A;  2IAA A;  4JSX C;  4FHL A;  4AN1 A;  4CI2 A;  2OJY A;  3U4Y A;  1PI6 A;  3OTT A;  5TDH B;  1GOG A;  3CFS B;  5EMJ B;  4WK0 A;  4CC9 A;  2AGX A;  3BG0 A;  4H5I A;  3DXM C;  5H17 A;  3OKY B;  4DNW A;  4G56 B;  3FGB A;  2TRC B;  4K3I D;  2H9P A;  3HFQ A;  4XEI C;  2XZG A;  5E6S A;  1GP2 B;  2P9L C;  3O4G A;  5HQG A;  3KRW B;  3V7D B;  3AL8 A;  4IMM A;  4Z7Q A;  5B4W A;  3SVW D;  3FCU A;  2EIE A;  2AGY A;  3EI4 B;  4A09 A;  3MKS B;  5TEF A;  4J0W A;  4ERY A;  4CY1 A;  4JXM A;  5EAM A;  4EWR A;  1BPO A;  4ESG A;  3QHY B;  1UOO A;  1TYE A;  4BH6 A;  4UI9 R;  1U2V C;  2H14 A;  4FAV D;  1I2M B;  5EML B;  1UTC A;  5EAL A;  4ZN4 A;  3OL2 A;  3CFV A;  2YMU A;  1K8K C;  1Q47 A;  1B9X A;  2I0S A;  4A11 A;  5C9Z B;  4L3H D;  3NIF A;  4FA4 D;  5THA A;  3IUR A;  3UVK A;  3I89 A;  4NSX A;  5I5I A;  3EI1 B;  1RI6 A;  4HDJ A;  4FWW A;  3F3F A;  5TEE A;  1NEX B;  3KRX B;  4WJK A;  4QT8 A;  3SFZ A;  5C2W B;  4J79 A;  3GD1 I;  2OK4 A;  1JV2 A;  1FWX A;  1VZ3 A;  3BWS A;  3C9C A;  2YB8 B;  2H6Q A;  4O1Q D;  5EMK B;  4O02 A;  2P9P C;  3NVQ A;  4JT5 C;  3PXT D;  4WK4 A;  2VDK A;  3E0C A;  1UOP A;  5M5U A;  3T3P A;  2H3X A;  2YBA A;  3RN1 D;  3SLE D;  4O2W A;  2VDP A;  1VZ2 A;  2P9N C;  2H68 A;  2VZ3 A;  3EI3 A;  2IWF A;  3I7L A;  5FXY A;  3JAM g;  4D9S A;  1SQJ A;  4J73 A;  5FLX g;  2CO0 A;  4MMX A;  1XKS A;  4MK0 B;  2YNP A;  3MKQ A;  3IUJ A;  2H6K A;  3AFC A;  2EID A;  4GM3 A;  4Y5R D;  3W15 A;  4CI3 A;  4QL1 A;  3C5M A;  4CZY A;  1OMW B;  1YR2 A;  5EAP A;  3P4F A;  2CN2 A;  3SJL D;  1U8C A;  4A0B A;  3K26 A;  2B5M A;  2O9K A;  2B5L A;  2P9U C;  2AGZ A;  4O3U B;  4PBZ A;  5C92 A;  1QNI A;  3RLM D;  3GC3 B;  1OLZ A;  4FA9 D;  2I0T A;  3RN0 D;  1JTD B;  5HE1 B;  4PSW B;  2HXC A;  4Z7O A;  3UR4 A;  1MDA H;  3ULE C;  1E8N A;  2B5N A;  4JSP C;  3SBQ A;  2XYI A;  2H6N A;  3EWE A;  2XE4 A;  2HKM A;  1JJU B;  3V4V A;  5FKQ A;  5EM2 B;  4NAA A;  4CY3 A;  1H2W A;  4JHN A;  3JPX A;  4CZX A;  1PGU A;  1E5T A;  4CI8 A;  5FKR A;  4JD2 C;  2OVQ B;  4O45 A;  2AH1 A;  3T3M A;  3K6S A;  2MTA H;  4Y7R A;  4L1M A;  2PM9 A;  1GOT B;  5A2Q g;  5FFO A;  2OIZ A;  5EAR A;  3FCS A;  3VGZ A;  3EQ7 A;  4Z7N A;  3DSM A;  4O9D A;  4DNU A;  3PXS D;  1L5G A;  2HJB A;  3I7P A;  5GXH A;  2IUV A;  4BCC A;  2VC2 A;  4X63 B;  2IUR A;  3EI4 A;  1A12 A;  2UZY B;  3ODT A;  2PM7 B;  5FFG A;  2HU5 A;  5EMM B;  5FQD A;  2AGW A;  1PEV A;  4H5J A;  4XYI A;  2VDR A;  5CXC B;  3NVX A;  4PBY A;  2EIC A;  5IC7 A;  3ZDZ A;  3PE7 A;  3EMH A;  3JZN A;  4BL0 A;  4UM8 A;  1SQ9 A;  2HJ4 A;  3V9F A;  4J0X A;  2IWK A;  2HYE A;  4J78 A;  1S4U X;  4MMZ A;  2CNX A;  4R7A B;  2XU7 A;  3MMY A;  2EIB A;  1H2X A;  4GGC A;  3RMZ D;  3JB9 L;  3J81 g;  2QC5 A;  1GOH A;  1GOF A;  3IJ0 A;  1C9L A;  1JMZ B;  4A2L A;  4FA5 D;  2HU7 A;  5CXB B;  4A0A B;  4G55 A;  2GNQ A;  2J57 G;  4KFM B;  1TBG A;  5M61 A;  5TF2 A;  2IUP A;  3N0E A;  1C9I A;  4U1E I;  4J87 A;  5AFU 3;  3EI2 B;  4PNK B;  1SHY B;  4E5Z A;  3MVD K;  3L4O D;  4GMB A;  4A2M A; 
#chains in the Genus database with same CATH homology
 3OL2 B;  4FB1 D;  3B7F A;  4A08 A;  3NVN A;  2GC7 A;  4FA1 D;  3A0F A;  4CY2 A;  4ZOX A;  3EU7 A;  1P22 A;  3JZG A;  3RFH A;  2GC4 A;  5IGO A;  3UVN A;  3OKT A;  5EM2 A;  3OKY A;  2H9M A;  4X3E A;  2P9K C;  4OWR A;  5HE0 B;  1N6F A;  2XL3 A;  3SN6 B;  5IJ8 E;  5HE3 B;  1VYH C;  4PC0 A;  4D0K A;  5K19 A;  2BCJ B;  1GXR A;  3IJ1 A;  3PXW D;  2YNN A;  2PM6 B;  4O3T B;  4L1Q D;  5H14 A;  3OKW A;  4JT6 C;  5CXB A;  4A0A A;  5SXM A;  3I8C A;  4IA9 A;  4PSX B;  3MXX A;  3V5W B;  1R5M A;  1L0Q A;  4A09 B;  3DXK C;  4QQE A;  5H1M A;  2Q7Q A;  4L3G D;  4GGA A;  4ERQ A;  2H47 A;  3RSE C;  4CZV A;  3SMR A;  4QRJ A;  4X60 B;  2OVP B;  3JRO A;  5AJA A;  2G9A A;  5K1C C;  3IJC A;  5KDO B;  2CE9 A;  3SXT D;  5GSA A;  3PVW B;  4JSV C;  5HE2 B;  5IGQ A;  3EG6 A;  4J84 A;  4A0B B;  2W18 A;  3OW8 A;  3I7K A;  2H13 A;  4GM8 A;  3F3G A;  1B9Y A;  4LGN A;  4CY5 A;  1PBY B;  3J80 g;  3UKU C;  3I7O A;  3EI1 A;  5C2V B;  3IKO A;  5CXC A;  1MG3 A;  3I8E A;  3C99 A;  4GQB B;  4E54 A;  3PVU B;  2IUQ A;  2Z2N A;  5CYK B;  4E5Z B;  2CO0 C;  1JMX B;  2CE8 A;  1N6E A;  2XL2 A;  4GGD A;  3SWS D;  3SBP A;  3EI3 B;  3JRP A;  4A08 B;  4PXW A;  2UZX B;  3PSL A;  1NR0 A;  3ORV D;  5I5M A;  3PSC B;  5CYK A;  4GM9 A;  5FA5 B;  5FKT A;  3I7N A;  4Z8L A;  3RRM C;  4ES0 A;  5JWZ A;  2HKR A;  5FKS A;  1JOF A;  4J8G A;  4E54 B;  3I7H A;  4A11 B;  4GZ8 A;  4J77 A;  2CN3 A;  4I79 A;  4GQ1 A;  3UVO A;  2Z2P A;  3IIW A;  4J82 A;  3UVM A;  4ZOV A;  4CI1 A;  4K3J B;  2AH0 A;  2H9L A;  4J86 A;  3VH0 A;  3DWL C;  4AOW A;  5IT9 g;  4N14 A;  4L9O A;  3UVL A;  3MZK A;  2YNO A;  4A7J A;  2J55 H;  3SHF A;  3AH8 B;  3C75 H;  4GQ2 P;  4X61 B;  1XIP A;  2AGL A;  5I5J A;  2PM9 B;  3BG1 A;  1YFQ A;  3L4M D;  3GFC A;  3ZWL B;  2BBK H;  2I3T A;  1MG2 A;  1A0R B;  4YVD A;  2P9S C;  1GG2 B;  4J8B A;  3UKR C;  3FRX A;  1N6D A;  2EBS A;  4ERZ A;  3I2N A;  3DM0 A;  2QXV A;  4J81 A;  5GXI A;  2I0R A;  1K32 A;  4LG9 A;  3AL8 B;  2H9N A;  1TYQ C;  2OK6 A;  4JSN C;  3N0D A;  4ZOZ A;  3FM0 A;  3F3P A;  3JZH A;  2J56 H;  4FAN D;  3RFG A;  4OZU A;  2G99 A;  4BUJ C;  1U4C A;  1XHM A;  4D6V A;  2AQ5 A;  3EI2 A;  2HES X;  2Z2O A;  5IJ7 E;  3CIK B;  3K27 A;  4ZOY A;  2B4E A;  3SCY A;  5GMK n;  4TZ4 A;  2I3S A;  5HYN B;  3SBR A;  1ERJ A;  3GRE A;  4AEZ A;  3IIY A;  3MZL A;  4LG8 A;  2OVR B;  5AMS A;  2PBI B;  3AL9 A;  3VA6 A;  2P9I C;  4U7A A;  4XYH A;  2IAA A;  4JSX C;  4FHL A;  4CI2 A;  2OJY A;  3U4Y A;  1PI6 A;  3OTT A;  5TDH B;  3CFS B;  4CC9 A;  5EMJ B;  2AGX A;  3BG0 A;  4H5I A;  3DXM C;  5H17 A;  3OKY B;  4G56 B;  3FGB A;  2TRC B;  4K3I D;  2H9P A;  3HFQ A;  4XEI C;  1GP2 B;  2P9L C;  5HQG A;  3KRW B;  3V7D B;  3AL8 A;  4IMM A;  5B4W A;  3SVW D;  2AGY A;  3EI4 B;  4A09 A;  3MKS B;  5TEF A;  4J0W A;  4ERY A;  4CY1 A;  4JXM A;  5EAM A;  4EWR A;  4ESG A;  4BH6 A;  4UI9 R;  1U2V C;  2H14 A;  4FAV D;  5EML B;  5EAL A;  4ZN4 A;  3OL2 A;  3CFV A;  2YMU A;  1K8K C;  1Q47 A;  1B9X A;  2I0S A;  4A11 A;  5C9Z B;  4L3H D;  4FA4 D;  5THA A;  3UVK A;  3I89 A;  4NSX A;  5I5I A;  3EI1 B;  1RI6 A;  4HDJ A;  4FWW A;  3F3F A;  5TEE A;  1NEX B;  3KRX B;  4QT8 A;  3SFZ A;  5C2W B;  4J79 A;  2OK4 A;  1FWX A;  3BWS A;  3C9C A;  2YB8 B;  2H6Q A;  4O1Q D;  5EMK B;  2P9P C;  3NVQ A;  4JT5 C;  3PXT D;  3E0C A;  2H3X A;  2YBA A;  3RN1 D;  3SLE D;  2P9N C;  2H68 A;  3I7L A;  3EI3 A;  2IWF A;  5FXY A;  3JAM g;  1SQJ A;  4J73 A;  5FLX g;  2CO0 A;  1XKS A;  4MK0 B;  2YNP A;  3MKQ A;  2H6K A;  3AFC A;  4GM3 A;  4Y5R D;  3W15 A;  4CI3 A;  4QL1 A;  3C5M A;  4CZY A;  1OMW B;  5EAP A;  3P4F A;  2CN2 A;  3SJL D;  4A0B A;  3K26 A;  2B5M A;  2O9K A;  2B5L A;  2P9U C;  2AGZ A;  4O3U B;  4PBZ A;  1QNI A;  3RLM D;  1OLZ A;  4FA9 D;  2I0T A;  3RN0 D;  5HE1 B;  4PSW B;  2HXC A;  3UR4 A;  1MDA H;  3ULE C;  2B5N A;  4JSP C;  3SBQ A;  2XYI A;  2H6N A;  3EWE A;  2HKM A;  1JJU B;  5FKQ A;  5EM2 B;  4CY3 A;  3JPX A;  4CZX A;  1PGU A;  4CI8 A;  5FKR A;  4JD2 C;  2OVQ B;  4O45 A;  2AH1 A;  2MTA H;  4Y7R A;  2PM9 A;  1GOT B;  5A2Q g;  2OIZ A;  5EAR A;  3VGZ A;  3DSM A;  4O9D A;  3PXS D;  2HJB A;  3I7P A;  5GXH A;  2IUV A;  4X63 B;  2IUR A;  3EI4 A;  2UZY B;  3ODT A;  2PM7 B;  5EMM B;  5FQD A;  2AGW A;  1PEV A;  4H5J A;  4XYI A;  5CXC B;  3NVX A;  4PBY A;  5IC7 A;  3PE7 A;  3EMH A;  3JZN A;  4BL0 A;  1SQ9 A;  2HJ4 A;  3V9F A;  4J0X A;  2IWK A;  2HYE A;  4J78 A;  1S4U X;  2CNX A;  4R7A B;  2XU7 A;  3MMY A;  3RMZ D;  4GGC A;  3JB9 L;  3J81 g;  2QC5 A;  3IJ0 A;  4FA5 D;  1JMZ B;  4A2L A;  5CXB B;  4A0A B;  2GNQ A;  2J57 G;  4KFM B;  1TBG A;  5TF2 A;  2IUP A;  3N0E A;  4U1E I;  5AFU 3;  4J87 A;  3EI2 B;  4PNK B;  1SHY B;  4E5Z A;  3L4O D;  4GMB A;  4A2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...