3SVWD

Crystal structure of the p107v-maug/pre-methylamine dehydrogenase complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 97
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3svwD00
5C2WB 5IC7A 4CI8A 4KFMB 3L4MD 3OL2A 3N0DA 4J86A 3ZWLB 3B7FA 4AOWA 2QC5A 2G99A 3JRPA 3JROA 3KRWB 4J84A 1R5MA 5CYKA 3EI3A 1PEVA 2GC7A 1MG2A 4XEIC 1K32A 3UVLA 4FAVD 3PXTD 4XYHA 3V5WB 3MZKA 4MK0B 3J80g 3DSMA 5FKRA 2XL2A 3PXWD 2HYEA 2H68A 2H13A 1NEXB 4E54A 5IGOA 1P22A 5AJAA 1K8KC 3EI2A 3SXTD 4CY5A 2OIZA 4PBYA 4GZ8A 4AEZA 4ERQA 3AH8B 3EMHA 4CZXA 3BG1A 2CE9A 3OKTA 3UKRC 2HXCA 1JJUB 4CY2A 3I7OA 3SBPA 2CNXA 1JOFA 4GM3A 4X63B 4Z8LA 2P9NC 4GGAA 2I0TA 4XYIA 2UZXB 4QRJA 1XKSA 2AH1A 2IUPA 2W18A 4A2LA 2J56H 4YVDA 3VH0A 5FLXg 4PNKB 3UVNA 3I7PA 2EBSA 1JMXB 4GQ1A 2J57G 3SN6B 3VGZA 3OKYB 3C9CA 4FHLA 1TBGA 1SHYB 2H9LA 2H14A 3GFCA 4PSWB 4LG8A 3SWSD 4O3UB 2I0SA 5TEFA 5H14A 3FGBA 5FKTA 3F3FA 3KRXB 5TDHB 4CY1A 5GXIA 3DXKC 4PXWA 3I8CA 4J77A 3MKSB 4J78A 2H3XA 3L4OD 2HKMA 4A0BB 3A0FA 2BCJB 2O9KA 2H47A 3UVKA 4GQ2P 3OL2B 2P9KC 3RMZD 1U2VC 4ES0A 5CYKB 3EI4A 4ZN4A 1PGUA 5K19A 1N6DA 3EI3B 3IJ0A 1S4UX 5GMKn 2I3TA 2IWKA 4E5ZA 4X3EA 2OVPB 2CN3A 4CI3A 4BL0A 4A08A 3UR4A 5GXHA 3IKOA 3OW8A 3UVMA 2IUVA 4GM9A 4PBZA 3PXSD 1OLZA 1Q47A 4D6VA 2Z2OA 4E54B 4UI9R 2HKRA 3EI2B 3V9FA 5HE0B 3CFSB 4LG9A 4J79A 3ORVD 3SJLD 4J73A 2AQ5A 3MKQA 1GG2B 4O45A 4J81A 5SXMA 5JWZA 5I5MA 2PM6B 5EAPA 5K1CC 2HJ4A 2AH0A 4H5IA 1TYQC 5EMKB 2H9NA 5FXYA 4ERYA 2QXVA 3VA6A 4GGDA 4TZ4A 3FRXA 5EARA 2I3SA 2J55H 4QT8A 4U1EI 4N14A 3RRMC 4QL1A 2CO0C 3UKUC 5I5JA 2IUQA 3F3PA 5IJ7E 5EMLB 3ULEC 1SQ9A 4A09A 3MZLA 2GNQA 4J8GA 2YBAA 1VYHC 3AL8A 3NVXA 3NVNA 1OMWB 5HE2B 5FKSA 4IMMA 5FA5B 2YB8B 4A11A 2AGYA 2TRCB 5TF2A 3PVWB 4ZOXA 5GSAA 4L1QD 5C9ZB 2I0RA 4J0WA 3RLMD 3SLED 3DWLC 3MXXA 3SBQA 2CO0A 4GGCA 4PC0A 4JSVC 2AGZA 2P9PC 3JB9L 1GXRA 2PBIB 3ODTA 2GC4A 4EWRA 4FAND 2P9LC 3DXMC 3JPXA 4BH6A 3RSEC 3EI4B 4R7AB 4CI2A 3P4FA 5HQGA 2AGWA 3W15A 3BG0A 5AFU3 2H6NA 2H6QA 3JZHA 3RFGA 4E5ZB 1N6FA 2B5LA 2P9SC 3I8EA 5EALA 4O3TB 4A08B 5THAA 4IA9A 4JSNC 5CXCA 1NR0A 3EG6A 2OK6A 1GP2B 4FA9D 4JT5C 4A0AA 4L3GD 2P9UC 1XHMA 3PE7A 1MDAH 1ERJA 5B4WA 5A2Qg 1B9YA 4ZOZA 2YNOA 3N0EA 1XIPA 4J87A 2UZYB 2CE8A 4JT6C 2B5MA 4L3HD 5H17A 5EAMA 3PSCB 3JZGA 5FKQA 2H9PA 2HESX 3EI1A 2CN2A 3K27A 3UVOA 3EWEA 5EM2A 4CY3A 2AGLA 3E0CA 5C2VB 5TEEA 1PBYB 2PM9A 4K3ID 1A0RB 3EU7A 1N6EA 3CIKB 4K3JB 2PM7B 2BBKH 5CXBA 2Z2PA 4H5JA 3I7KA 2IWFA 3C5MA 4J0XA 3C75H 3OKWA 3I7LA 4LGNA 4D0KA 3SBRA 4CZVA 4OWRA 5H1MA 4ZOVA 2AGXA 5EMJB 4A09B 4I79A 3MMYA 4FB1D 5HE3B 2YNPA 4JXMA 3NVQA 3AL8B 3IJCA 3I7HA 4J8BA 4A2MA 1JMZB 4FA4D 4A11B 1FWXA 2H9MA 3DM0A 5IT9g 5HYNB 3RN0D 2OVRB 2YNNA 5IGQA 2IAAA 4Y5RD 3RFHA 3OTTA 5KDOB 3AFCA 2B5NA 4JD2C 2YMUA 1RI6A 3I89A 4BUJC 3K26A 3J81g 4CC9A 3I2NA 5FQDA 3BWSA 4JSXC 3IIWA 3PSLA 3JZNA 4X60B 2IURA 4ESGA 3RN1D 3CFVA 3V7DB 2G9AA 1U4CA 5CXCB 5AMSA 4GQBB 3SFZA 3SCYA 2B4EA 4A7JA 1SQJA 2Q7QA 4A0AB 4ZOYA 3JAMg 4G56B 4GM8A 2XL3A 4Y7RA 4CI1A 3FM0A 1GOTB 3IIYA 4CZYA 4NSXA 3SMRA 4ERZA 3SHFA 4J82A 1B9XA 2HJBA 5I5IA 4O9DA 1MG3A 2H6KA 2OK4A 2XYIA 3OKYA 3PVUB 1PI6A 5HE1B 3EI1B 2OJYA 4HDJA 2Z2NA 3GREA 5EM2B 3U4YA 4L9OA 3F3GA 1QNIA 4QQEA 2OVQB 1YFQA 2MTAH 2PM9B 4FA1D 4FA5D 3SVWD 4U7AA 4O1QD 3IJ1A 4OZUA 2XU7A 5CXBB 4GMBA 4X61B 5EMMB 3HFQA 3I7NA 4JSPC 3C99A 1L0QA 4FWWA 3AL9A 2P9IC 4A0BA 4PSXB 5IJ8E
chains in the Genus database with same CATH superfamily
5C2WB 5IC7A 4CI8A 4KFMB 3L4MD 3OL2A 3N0DA 4J86A 3ZWLB 3B7FA 1QFSA 4AOWA 2HU8A 2QC5A 2G99A 3JRPA 3JROA 3KRWB 4J84A 1R5MA 5CYKA 3T3MA 3EI3A 1PEVA 2GC7A 1MG2A 4XEIC 1K32A 3UVLA 3K6SA 4FAVD 3PXTD 4XYHA 3V5WB 1BPOA 3MZKA 4MK0B 3J80g 3DSMA 5FFOA 4BP9A 5FKRA 3VI3A 2XL2A 3OF7A 3PXWD 2HYEA 2H68A 2H13A 5E6SA 1TYEA 1NEXB 4E54A 5IGOA 1P22A 5AJAA 1K8KC 5E6UA 1VZ2A 3EI2A 3SXTD 4CY5A 2OIZA 4PBYA 3FCUA 4GZ8A 3KCIA 4AEZA 4ERQA 4BCBA 3O4GA 3AH8B 3EMHA 4CZXA 3BG1A 2CE9A 5M5TA 3OKTA 3UKRC 2HXCA 1JJUB 4CY2A 3I7OA 3SBPA 2CNXA 1JOFA 4GM3A 4X63B 4Z8LA 2P9NC 4L1MA 4GGAA 2I0TA 4XYIA 2UZXB 2JKXA 4QRJA 1XKSA 2AH1A 2IUPA 2W18A 4A2LA 2VDLA 1A12A 2J56H 4RE5A 4YVDA 3VH0A 5FLXg 1GOFA 4PNKB 3UVNA 3I7PA 2EBSA 1JMXB 4GQ1A 2EIDA 3MVDK 2J57G 3SN6B 3VGZA 3OKYB 3C9CA 5M5UA 4FHLA 1TBGA 1SHYB 2H9LA 1O6GA 2H14A 3GFCA 4PSWB 4G1MA 4LG8A 3SWSD 4O3UB 2I0SA 5TEFA 5H14A 3FGBA 5FKTA 3F3FA 3KRXB 5TDHB 4AX4A 4CY1A 5GXIA 3DXKC 4PXWA 3VI4A 3I8CA 4J77A 3MKSB 4J78A 2H3XA 3L4OD 4O02A 2HKMA 4A0BB 3A0FA 2BCJB 2O9KA 2H47A 3UVKA 4GQ2P 3OL2B 2P9KC 1VZ3A 4NENA 2XE4A 3EQ7A 3RMZD 1U2VC 4BCDA 1M1XA 4ES0A 5CYKB 4AMZA 3EI4A 4JHNA 4ZN4A 1PGUA 1H2ZA 5K19A 1N6DA 3EI3B 3IJ0A 1S4UX 3K71A 3ZDYA 1H2XA 5GMKn 2I3TA 2IWKA 4E5ZA 4X3EA 2OVPB 2CN3A 4UM8A 4CI3A 4BL0A 4A08A 3UR4A 5GXHA 3K72A 3IKOA 4QAMA 3OW8A 3UVMA 2IUVA 4GM9A 4PBZA 3PXSD 1OLZA 3EQ9A 1Q47A 4D6VA 4Z7OA 2Z2OA 1C9LA 3ZE1A 4E54B 4AMYA 4UI9R 2HKRA 3EI2B 3V9FA 5HE0B 2VDNA 3CFSB 4LG9A 2VZ1A 4J79A 3ORVD 3SJLD 4J73A 2AQ5A 3MKQA 1E8NA 1E8MA 4WK2A 1GG2B 4O45A 4J81A 3EQ8A 3GD1I 5SXMA 5JWZA 5I5MA 2PM6B 5EAPA 5K1CC 2HJ4A 2AH0A 4H5IA 1TYQC 5EMKB 4MMXA 2H9NA 5FXYA 4ERYA 2QXVA 3QI0A 3VA6A 4GGDA 4TZ4A 3FRXA 3MUNA 5EARA 2I3SA 2J55H 4QT8A 4U1EI 1UOPA 4N14A 3RRMC 4QL1A 2CO0C 3UKUC 4RE6A 3ZE2A 5I5JA 2IUQA 3F3PA 5IJ7E 3GC3B 5EMLB 3ULEC 1SQ9A 4A09A 3MZLA 2GNQA 4J8GA 2YBAA 1GOHA 1VYHC 3IUMA 4Z7QA 1O6FA 3AL8A 1UOQA 3NVNA 1OMWB 3NVXA 4AN0A 4Z7NA 5HE2B 5FKSA 4IMMA 5FA5B 2YB8B 4A11A 2AGYA 2TRCB 5TF2A 3PVWB 5C86A 4ZOXA 3IUQA 5GSAA 2VDMA 4L1QD 5C9ZB 2I0RA 4J0WA 3RLMD 3SLED 3DWLC 3MXXA 3SBQA 2CO0A 4GGCA 4PC0A 4JSVC 2AGZA 4D9SA 2P9PC 3JB9L 4AN1A 1GXRA 2PBIB 2WQ8A 3NIGA 3ODTA 4UM9A 2GC4A 5C92A 4EWRA 4FAND 2P9LC 3DXMC 1C9IA 3JPXA 4BH6A 3RSEC 3EI4B 4R7AB 4CI2A 3P4FA 5HQGA 2AGWA 3W15A 3BG0A 5AFU3 2H6NA 2H6QA 3FCSA 3JZHA 3RFGA 4E5ZB 1YR2A 4DNWA 1N6FA 2B5LA 2P9SC 3I8EA 5EALA 4O3TB 2XZGA 1L5GA 5THAA 4IA9A 4A08B 3O4HA 4JSNC 5CXCA 1NR0A 3EG6A 4JHPC 1T2XA 2OK6A 3T3PA 1GP2B 2HU7A 2QR5A 5E6RA 4FA9D 4JT5C 4A0AA 4L3GD 2P9UC 1XHMA 3PE7A 1MDAH 4MMYA 1ERJA 5B4WA 5A2Qg 1B9YA 4ZOZA 2YNOA 3N0EA 1XIPA 4J87A 3IURA 4MMZA 2UZYB 2CE8A 2P9IC 4JT6C 2B5MA 4L3HD 5H17A 5EAMA 3PSCB 1K3IA 3JZGA 3ZE0A 5FKQA 2H9PA 2HESX 3EI1A 2CN2A 3K27A 3UVOA 3EWEA 5EM2A 4CY3A 3ZDXA 2AGLA 3E0CA 5C2VB 5TEEA 1PBYB 1GOGA 2BKLA 2PM9A 4K3ID 1I2MB 1A0RB 2VZ3A 3EU7A 1N6EA 3CIKB 2PM7B 4K3JB 2BBKH 5CXBA 2Z2PA 4H5JA 3I7KA 2IWFA 3C5MA 4J0XA 5M5VA 3C75H 1VE6A 4BP8A 4G1EA 3OKWA 3I7LA 4LGNA 4BCCA 4D0KA 3SBRA 4CZVA 4OWRA 5M5SA 1H2WA 5H1MA 2QZPA 4ZOVA 2AGXA 2VDKA 5EMJB 4A09B 4I79A 3MMYA 4FB1D 5HE3B 2YNPA 4JXMA 3NVQA 3IJEA 3AL8B 3IJCA 2EICA 3I7HA 4J8BA 4A2MA 4NAAA 1JMZB 4FA4D 4A11B 1FWXA 2H9MA 1JV2A 2XDWA 3DM0A 5IT9g 3MUOA 3O4JA 5HYNB 3RN0D 2OVRB 4WK4A 2YNNA 5IGQA 2IAAA 4Y5RD 3RFHA 3OTTA 4DNVA 5KDOB 2HU5A 3AFCA 2B5NA 1UOOA 4JD2C 4NC4A 2YMUA 2VDQA 4WK0A 1RI6A 1QFMA 2EIBA 3I89A 4BUJC 3K26A 3J81g 4CC9A 3I2NA 3IULA 5FQDA 1UTCA 3BWSA 4JSXC 3IIWA 3PSLA 3JZNA 4X60B 1H2YA 2IURA 4ESGA 3RN1D 3CFVA 3V7DB 2G9AA 5M5RA 4NBMA 1U4CA 5CXCB 5AMSA 4GQBB 3SFZA 1U8CA 3SCYA 2B4EA 4A7JA 3NIDA 1SQJA 2Q7QA 2VC2A 4A0AB 4ZOYA 3JAMg 4G56B 4GM8A 2XL3A 4WJKA 4Y7RA 4CI1A 3FM0A 1GOTB 3IIYA 4CZYA 3V4PA 1E5TA 4NSXA 3SMRA 4ERZA 3SHFA 3V4VA 4J82A 1B9XA 2HJBA 3O4IA 5I5IA 4O9DA 1MG3A 2H6KA 2OK4A 4DNUA 4G55A 2XYIA 3QHYB 3OKYA 3PVUB 1PI6A 5HE1B 3EI1B 2OJYA 4IRZA 4HDJA 2VDOA 2Z2NA 3GREA 5EM2B 3U4YA 4L9OA 3F3GA 4O2WA 1QNIA 2VDRA 4QQEA 1YFQA 2OVQB 2MTAH 2PM9B 4FA1D 4FA5D 3ZDZA 5M61A 3SVWD 1JTDB 4U7AA 4O1QD 3IJ1A 4OZUA 2XU7A 1VE7A 3DDUA 3NIFA 5CXBB 3IVMA 4GMBA 3IUNA 4X61B 3HFQA 5EMMB 2EIEA 3I7NA 3IUJA 4JSPC 3C99A 1L0QA 5HDBA 5FFGA 4FWWA 3AL9A 2VDPA 4A0BA 4PSXB 5IJ8E
chains in the Genus database with same CATH topology
5C2WB 5IC7A 4CI8A 4KFMB 3L4MD 3OL2A 3N0DA 4J86A 3ZWLB 3B7FA 4AOWA 2QC5A 2G99A 3JRPA 3JROA 3KRWB 4J84A 1R5MA 5CYKA 3EI3A 1PEVA 2GC7A 1MG2A 4XEIC 1K32A 3UVLA 4FAVD 3PXTD 4XYHA 3V5WB 3MZKA 4MK0B 3J80g 3DSMA 5FKRA 2XL2A 3PXWD 2HYEA 2H68A 2H13A 1NEXB 4E54A 5IGOA 1P22A 5AJAA 1K8KC 3EI2A 3SXTD 4CY5A 2OIZA 4PBYA 4GZ8A 4AEZA 4ERQA 3AH8B 3EMHA 4CZXA 3BG1A 2CE9A 3OKTA 3UKRC 2HXCA 1JJUB 4CY2A 3I7OA 3SBPA 2CNXA 1JOFA 4GM3A 4X63B 4Z8LA 2P9NC 4GGAA 2I0TA 4XYIA 2UZXB 4QRJA 1XKSA 2AH1A 2IUPA 2W18A 4A2LA 2J56H 4YVDA 3VH0A 5FLXg 4PNKB 3UVNA 3I7PA 2EBSA 1JMXB 4GQ1A 2J57G 3SN6B 3VGZA 3OKYB 3C9CA 4FHLA 1TBGA 1SHYB 2H9LA 2H14A 3GFCA 4PSWB 4LG8A 3SWSD 4O3UB 2I0SA 5TEFA 5H14A 3FGBA 5FKTA 3F3FA 3KRXB 5TDHB 4CY1A 5GXIA 3DXKC 4PXWA 3I8CA 4J77A 3MKSB 4J78A 2H3XA 3L4OD 2HKMA 4A0BB 3A0FA 2BCJB 2O9KA 2H47A 3UVKA 4GQ2P 3OL2B 2P9KC 3RMZD 1U2VC 4ES0A 5CYKB 3EI4A 4ZN4A 1PGUA 5K19A 1N6DA 3EI3B 3IJ0A 1S4UX 5GMKn 2I3TA 2IWKA 4E5ZA 4X3EA 2OVPB 2CN3A 4CI3A 4BL0A 4A08A 3UR4A 5GXHA 3IKOA 3OW8A 3UVMA 2IUVA 4GM9A 4PBZA 3PXSD 1OLZA 1Q47A 4D6VA 2Z2OA 4E54B 4UI9R 2HKRA 3EI2B 3V9FA 5HE0B 3CFSB 4LG9A 4J79A 3ORVD 3SJLD 4J73A 2AQ5A 3MKQA 1GG2B 4O45A 4J81A 5SXMA 5JWZA 5I5MA 2PM6B 5EAPA 5K1CC 2HJ4A 2AH0A 4H5IA 1TYQC 5EMKB 2H9NA 5FXYA 4ERYA 2QXVA 3VA6A 4GGDA 4TZ4A 3FRXA 5EARA 2I3SA 2J55H 4QT8A 4U1EI 4N14A 3RRMC 4QL1A 2CO0C 3UKUC 5I5JA 2IUQA 3F3PA 5IJ7E 5EMLB 3ULEC 1SQ9A 4A09A 3MZLA 2GNQA 4J8GA 2YBAA 1VYHC 3AL8A 3NVXA 3NVNA 1OMWB 5HE2B 5FKSA 4IMMA 5FA5B 2YB8B 4A11A 2AGYA 2TRCB 5TF2A 3PVWB 4ZOXA 5GSAA 4L1QD 5C9ZB 2I0RA 4J0WA 3RLMD 3SLED 3DWLC 3MXXA 3SBQA 2CO0A 4GGCA 4PC0A 4JSVC 2AGZA 2P9PC 3JB9L 1GXRA 2PBIB 3ODTA 2GC4A 4EWRA 4FAND 2P9LC 3DXMC 3JPXA 4BH6A 3RSEC 3EI4B 4R7AB 4CI2A 3P4FA 5HQGA 2AGWA 3W15A 3BG0A 5AFU3 2H6NA 2H6QA 3JZHA 3RFGA 4E5ZB 1N6FA 2B5LA 2P9SC 3I8EA 5EALA 4O3TB 4A08B 5THAA 4IA9A 4JSNC 5CXCA 1NR0A 3EG6A 2OK6A 1GP2B 4FA9D 4JT5C 4A0AA 4L3GD 2P9UC 1XHMA 3PE7A 1MDAH 1ERJA 5B4WA 5A2Qg 1B9YA 4ZOZA 2YNOA 3N0EA 1XIPA 4J87A 2UZYB 2CE8A 4JT6C 2B5MA 4L3HD 5H17A 5EAMA 3PSCB 3JZGA 5FKQA 2H9PA 2HESX 3EI1A 2CN2A 3K27A 3UVOA 3EWEA 5EM2A 4CY3A 2AGLA 3E0CA 5C2VB 5TEEA 1PBYB 2PM9A 4K3ID 1A0RB 3EU7A 1N6EA 3CIKB 4K3JB 2PM7B 2BBKH 5CXBA 2Z2PA 4H5JA 3I7KA 2IWFA 3C5MA 4J0XA 3C75H 3OKWA 3I7LA 4LGNA 4D0KA 3SBRA 4CZVA 4OWRA 5H1MA 4ZOVA 2AGXA 5EMJB 4A09B 4I79A 3MMYA 4FB1D 5HE3B 2YNPA 4JXMA 3NVQA 3AL8B 3IJCA 3I7HA 4J8BA 4A2MA 1JMZB 4FA4D 4A11B 1FWXA 2H9MA 3DM0A 5IT9g 5HYNB 3RN0D 2OVRB 2YNNA 5IGQA 2IAAA 4Y5RD 3RFHA 3OTTA 5KDOB 3AFCA 2B5NA 4JD2C 2YMUA 1RI6A 3I89A 4BUJC 3K26A 3J81g 4CC9A 3I2NA 5FQDA 3BWSA 4JSXC 3IIWA 3PSLA 3JZNA 4X60B 2IURA 4ESGA 3RN1D 3CFVA 3V7DB 2G9AA 1U4CA 5CXCB 5AMSA 4GQBB 3SFZA 3SCYA 2B4EA 4A7JA 1SQJA 2Q7QA 4A0AB 4ZOYA 3JAMg 4G56B 4GM8A 2XL3A 4Y7RA 4CI1A 3FM0A 1GOTB 3IIYA 4CZYA 4NSXA 3SMRA 4ERZA 3SHFA 4J82A 1B9XA 2HJBA 5I5IA 4O9DA 1MG3A 2H6KA 2OK4A 2XYIA 3OKYA 3PVUB 1PI6A 5HE1B 3EI1B 2OJYA 4HDJA 2Z2NA 3GREA 5EM2B 3U4YA 4L9OA 3F3GA 1QNIA 4QQEA 2OVQB 1YFQA 2MTAH 2PM9B 4FA1D 4FA5D 3SVWD 4U7AA 4O1QD 3IJ1A 4OZUA 2XU7A 5CXBB 4GMBA 4X61B 5EMMB 3HFQA 3I7NA 4JSPC 3C99A 1L0QA 4FWWA 3AL9A 2P9IC 4A0BA 4PSXB 5IJ8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2W B;  5IC7 A;  4CI8 A;  4KFM B;  3L4M D;  3OL2 A;  3N0D A;  4J86 A;  3ZWL B;  3B7F A;  4AOW A;  2QC5 A;  2G99 A;  3JRP A;  3JRO A;  3KRW B;  4J84 A;  1R5M A;  5CYK A;  3EI3 A;  1PEV A;  2GC7 A;  1MG2 A;  4XEI C;  1K32 A;  3UVL A;  4FAV D;  3PXT D;  4XYH A;  3V5W B;  3MZK A;  4MK0 B;  3J80 g;  3DSM A;  5FKR A;  2XL2 A;  3PXW D;  2HYE A;  2H68 A;  2H13 A;  1NEX B;  4E54 A;  5IGO A;  1P22 A;  5AJA A;  1K8K C;  3EI2 A;  3SXT D;  4CY5 A;  2OIZ A;  4PBY A;  4GZ8 A;  4AEZ A;  4ERQ A;  3AH8 B;  3EMH A;  4CZX A;  3BG1 A;  2CE9 A;  3OKT A;  3UKR C;  2HXC A;  1JJU B;  4CY2 A;  3I7O A;  3SBP A;  2CNX A;  1JOF A;  4GM3 A;  4X63 B;  4Z8L A;  2P9N C;  4GGA A;  2I0T A;  4XYI A;  2UZX B;  4QRJ A;  1XKS A;  2AH1 A;  2IUP A;  2W18 A;  4A2L A;  2J56 H;  4YVD A;  3VH0 A;  5FLX g;  4PNK B;  3UVN A;  3I7P A;  2EBS A;  1JMX B;  4GQ1 A;  2J57 G;  3SN6 B;  3VGZ A;  3OKY B;  3C9C A;  4FHL A;  1TBG A;  1SHY B;  2H9L A;  2H14 A;  3GFC A;  4PSW B;  4LG8 A;  3SWS D;  4O3U B;  2I0S A;  5TEF A;  5H14 A;  3FGB A;  5FKT A;  3F3F A;  3KRX B;  5TDH B;  4CY1 A;  5GXI A;  3DXK C;  4PXW A;  3I8C A;  4J77 A;  3MKS B;  4J78 A;  2H3X A;  3L4O D;  2HKM A;  4A0B B;  3A0F A;  2BCJ B;  2O9K A;  2H47 A;  3UVK A;  4GQ2 P;  3OL2 B;  2P9K C;  3RMZ D;  1U2V C;  4ES0 A;  5CYK B;  3EI4 A;  4ZN4 A;  1PGU A;  5K19 A;  1N6D A;  3EI3 B;  3IJ0 A;  1S4U X;  5GMK n;  2I3T A;  2IWK A;  4E5Z A;  4X3E A;  2OVP B;  2CN3 A;  4CI3 A;  4BL0 A;  4A08 A;  3UR4 A;  5GXH A;  3IKO A;  3OW8 A;  3UVM A;  2IUV A;  4GM9 A;  4PBZ A;  3PXS D;  1OLZ A;  1Q47 A;  4D6V A;  2Z2O A;  4E54 B;  4UI9 R;  2HKR A;  3EI2 B;  3V9F A;  5HE0 B;  3CFS B;  4LG9 A;  4J79 A;  3ORV D;  3SJL D;  4J73 A;  2AQ5 A;  3MKQ A;  1GG2 B;  4O45 A;  4J81 A;  5SXM A;  5JWZ A;  5I5M A;  2PM6 B;  5EAP A;  5K1C C;  2HJ4 A;  2AH0 A;  4H5I A;  1TYQ C;  5EMK B;  2H9N A;  5FXY A;  4ERY A;  2QXV A;  3VA6 A;  4GGD A;  4TZ4 A;  3FRX A;  5EAR A;  2I3S A;  2J55 H;  4QT8 A;  4U1E I;  4N14 A;  3RRM C;  4QL1 A;  2CO0 C;  3UKU C;  5I5J A;  2IUQ A;  3F3P A;  5IJ7 E;  5EML B;  3ULE C;  1SQ9 A;  4A09 A;  3MZL A;  2GNQ A;  4J8G A;  2YBA A;  1VYH C;  3AL8 A;  3NVX A;  3NVN A;  1OMW B;  5HE2 B;  5FKS A;  4IMM A;  5FA5 B;  2YB8 B;  4A11 A;  2AGY A;  2TRC B;  5TF2 A;  3PVW B;  4ZOX A;  5GSA A;  4L1Q D;  5C9Z B;  2I0R A;  4J0W A;  3RLM D;  3SLE D;  3DWL C;  3MXX A;  3SBQ A;  2CO0 A;  4GGC A;  4PC0 A;  4JSV C;  2AGZ A;  2P9P C;  3JB9 L;  1GXR A;  2PBI B;  3ODT A;  2GC4 A;  4EWR A;  4FAN D;  2P9L C;  3DXM C;  3JPX A;  4BH6 A;  3RSE C;  3EI4 B;  4R7A B;  4CI2 A;  3P4F A;  5HQG A;  2AGW A;  3W15 A;  3BG0 A;  5AFU 3;  2H6N A;  2H6Q A;  3JZH A;  3RFG A;  4E5Z B;  1N6F A;  2B5L A;  2P9S C;  3I8E A;  5EAL A;  4O3T B;  4A08 B;  5THA A;  4IA9 A;  4JSN C;  5CXC A;  1NR0 A;  3EG6 A;  2OK6 A;  1GP2 B;  4FA9 D;  4JT5 C;  4A0A A;  4L3G D;  2P9U C;  1XHM A;  3PE7 A;  1MDA H;  1ERJ A;  5B4W A;  5A2Q g;  1B9Y A;  4ZOZ A;  2YNO A;  3N0E A;  1XIP A;  4J87 A;  2UZY B;  2CE8 A;  4JT6 C;  2B5M A;  4L3H D;  5H17 A;  5EAM A;  3PSC B;  3JZG A;  5FKQ A;  2H9P A;  2HES X;  3EI1 A;  2CN2 A;  3K27 A;  3UVO A;  3EWE A;  5EM2 A;  4CY3 A;  2AGL A;  3E0C A;  5C2V B;  5TEE A;  1PBY B;  2PM9 A;  4K3I D;  1A0R B;  3EU7 A;  1N6E A;  3CIK B;  4K3J B;  2PM7 B;  2BBK H;  5CXB A;  2Z2P A;  4H5J A;  3I7K A;  2IWF A;  3C5M A;  4J0X A;  3C75 H;  3OKW A;  3I7L A;  4LGN A;  4D0K A;  3SBR A;  4CZV A;  4OWR A;  5H1M A;  4ZOV A;  2AGX A;  5EMJ B;  4A09 B;  4I79 A;  3MMY A;  4FB1 D;  5HE3 B;  2YNP A;  4JXM A;  3NVQ A;  3AL8 B;  3IJC A;  3I7H A;  4J8B A;  4A2M A;  1JMZ B;  4FA4 D;  4A11 B;  1FWX A;  2H9M A;  3DM0 A;  5IT9 g;  5HYN B;  3RN0 D;  2OVR B;  2YNN A;  5IGQ A;  2IAA A;  4Y5R D;  3RFH A;  3OTT A;  5KDO B;  3AFC A;  2B5N A;  4JD2 C;  2YMU A;  1RI6 A;  3I89 A;  4BUJ C;  3K26 A;  3J81 g;  4CC9 A;  3I2N A;  5FQD A;  3BWS A;  4JSX C;  3IIW A;  3PSL A;  3JZN A;  4X60 B;  2IUR A;  4ESG A;  3RN1 D;  3CFV A;  3V7D B;  2G9A A;  1U4C A;  5CXC B;  5AMS A;  4GQB B;  3SFZ A;  3SCY A;  2B4E A;  4A7J A;  1SQJ A;  2Q7Q A;  4A0A B;  4ZOY A;  3JAM g;  4G56 B;  4GM8 A;  2XL3 A;  4Y7R A;  4CI1 A;  3FM0 A;  1GOT B;  3IIY A;  4CZY A;  4NSX A;  3SMR A;  4ERZ A;  3SHF A;  4J82 A;  1B9X A;  2HJB A;  5I5I A;  4O9D A;  1MG3 A;  2H6K A;  2OK4 A;  2XYI A;  3OKY A;  3PVU B;  1PI6 A;  5HE1 B;  3EI1 B;  2OJY A;  4HDJ A;  2Z2N A;  3GRE A;  5EM2 B;  3U4Y A;  4L9O A;  3F3G A;  1QNI A;  4QQE A;  2OVQ B;  1YFQ A;  2MTA H;  2PM9 B;  4FA1 D;  4FA5 D;  3SVW D;  4U7A A;  4O1Q D;  3IJ1 A;  4OZU A;  2XU7 A;  5CXB B;  4GMB A;  4X61 B;  5EMM B;  3HFQ A;  3I7N A;  4JSP C;  3C99 A;  1L0Q A;  4FWW A;  3AL9 A;  2P9I C;  4A0B A;  4PSX B;  5IJ8 E; 
#chains in the Genus database with same CATH topology
 5C2W B;  5IC7 A;  4CI8 A;  4KFM B;  3L4M D;  3OL2 A;  3N0D A;  4J86 A;  3ZWL B;  3B7F A;  1QFS A;  4AOW A;  2HU8 A;  2QC5 A;  2G99 A;  3JRP A;  3JRO A;  3KRW B;  4J84 A;  1R5M A;  5CYK A;  3T3M A;  3EI3 A;  1PEV A;  2GC7 A;  1MG2 A;  4XEI C;  1K32 A;  3UVL A;  3K6S A;  4FAV D;  3PXT D;  4XYH A;  3V5W B;  1BPO A;  3MZK A;  4MK0 B;  3J80 g;  3DSM A;  5FFO A;  4BP9 A;  5FKR A;  3VI3 A;  2XL2 A;  3OF7 A;  3PXW D;  2HYE A;  2H68 A;  2H13 A;  5E6S A;  1TYE A;  1NEX B;  4E54 A;  5IGO A;  1P22 A;  5AJA A;  1K8K C;  5E6U A;  1VZ2 A;  3EI2 A;  3SXT D;  4CY5 A;  2OIZ A;  4PBY A;  3FCU A;  4GZ8 A;  3KCI A;  4AEZ A;  4ERQ A;  4BCB A;  3O4G A;  3AH8 B;  3EMH A;  4CZX A;  3BG1 A;  2CE9 A;  5M5T A;  3OKT A;  3UKR C;  2HXC A;  1JJU B;  4CY2 A;  3I7O A;  3SBP A;  2CNX A;  1JOF A;  4GM3 A;  4X63 B;  4Z8L A;  2P9N C;  4L1M A;  4GGA A;  2I0T A;  4XYI A;  2UZX B;  2JKX A;  4QRJ A;  1XKS A;  2AH1 A;  2IUP A;  2W18 A;  4A2L A;  2VDL A;  1A12 A;  2J56 H;  4RE5 A;  4YVD A;  3VH0 A;  5FLX g;  1GOF A;  4PNK B;  3UVN A;  3I7P A;  2EBS A;  1JMX B;  4GQ1 A;  2EID A;  3MVD K;  2J57 G;  3SN6 B;  3VGZ A;  3OKY B;  3C9C A;  5M5U A;  4FHL A;  1TBG A;  1SHY B;  2H9L A;  1O6G A;  2H14 A;  3GFC A;  4PSW B;  4G1M A;  4LG8 A;  3SWS D;  4O3U B;  2I0S A;  5TEF A;  5H14 A;  3FGB A;  5FKT A;  3F3F A;  3KRX B;  5TDH B;  4AX4 A;  4CY1 A;  5GXI A;  3DXK C;  4PXW A;  3VI4 A;  3I8C A;  4J77 A;  3MKS B;  4J78 A;  2H3X A;  3L4O D;  4O02 A;  2HKM A;  4A0B B;  3A0F A;  2BCJ B;  2O9K A;  2H47 A;  3UVK A;  4GQ2 P;  3OL2 B;  2P9K C;  1VZ3 A;  4NEN A;  2XE4 A;  3EQ7 A;  3RMZ D;  1U2V C;  4BCD A;  1M1X A;  4ES0 A;  5CYK B;  4AMZ A;  3EI4 A;  4JHN A;  4ZN4 A;  1PGU A;  1H2Z A;  5K19 A;  1N6D A;  3EI3 B;  3IJ0 A;  1S4U X;  3K71 A;  3ZDY A;  1H2X A;  5GMK n;  2I3T A;  2IWK A;  4E5Z A;  4X3E A;  2OVP B;  2CN3 A;  4UM8 A;  4CI3 A;  4BL0 A;  4A08 A;  3UR4 A;  5GXH A;  3K72 A;  3IKO A;  4QAM A;  3OW8 A;  3UVM A;  2IUV A;  4GM9 A;  4PBZ A;  3PXS D;  1OLZ A;  3EQ9 A;  1Q47 A;  4D6V A;  4Z7O A;  2Z2O A;  1C9L A;  3ZE1 A;  4E54 B;  4AMY A;  4UI9 R;  2HKR A;  3EI2 B;  3V9F A;  5HE0 B;  2VDN A;  3CFS B;  4LG9 A;  2VZ1 A;  4J79 A;  3ORV D;  3SJL D;  4J73 A;  2AQ5 A;  3MKQ A;  1E8N A;  1E8M A;  4WK2 A;  1GG2 B;  4O45 A;  4J81 A;  3EQ8 A;  3GD1 I;  5SXM A;  5JWZ A;  5I5M A;  2PM6 B;  5EAP A;  5K1C C;  2HJ4 A;  2AH0 A;  4H5I A;  1TYQ C;  5EMK B;  4MMX A;  2H9N A;  5FXY A;  4ERY A;  2QXV A;  3QI0 A;  3VA6 A;  4GGD A;  4TZ4 A;  3FRX A;  3MUN A;  5EAR A;  2I3S A;  2J55 H;  4QT8 A;  4U1E I;  1UOP A;  4N14 A;  3RRM C;  4QL1 A;  2CO0 C;  3UKU C;  4RE6 A;  3ZE2 A;  5I5J A;  2IUQ A;  3F3P A;  5IJ7 E;  3GC3 B;  5EML B;  3ULE C;  1SQ9 A;  4A09 A;  3MZL A;  2GNQ A;  4J8G A;  2YBA A;  1GOH A;  1VYH C;  3IUM A;  4Z7Q A;  1O6F A;  3AL8 A;  1UOQ A;  3NVN A;  1OMW B;  3NVX A;  4AN0 A;  4Z7N A;  5HE2 B;  5FKS A;  4IMM A;  5FA5 B;  2YB8 B;  4A11 A;  2AGY A;  2TRC B;  5TF2 A;  3PVW B;  5C86 A;  4ZOX A;  3IUQ A;  5GSA A;  2VDM A;  4L1Q D;  5C9Z B;  2I0R A;  4J0W A;  3RLM D;  3SLE D;  3DWL C;  3MXX A;  3SBQ A;  2CO0 A;  4GGC A;  4PC0 A;  4JSV C;  2AGZ A;  4D9S A;  2P9P C;  3JB9 L;  4AN1 A;  1GXR A;  2PBI B;  2WQ8 A;  3NIG A;  3ODT A;  4UM9 A;  2GC4 A;  5C92 A;  4EWR A;  4FAN D;  2P9L C;  3DXM C;  1C9I A;  3JPX A;  4BH6 A;  3RSE C;  3EI4 B;  4R7A B;  4CI2 A;  3P4F A;  5HQG A;  2AGW A;  3W15 A;  3BG0 A;  5AFU 3;  2H6N A;  2H6Q A;  3FCS A;  3JZH A;  3RFG A;  4E5Z B;  1YR2 A;  4DNW A;  1N6F A;  2B5L A;  2P9S C;  3I8E A;  5EAL A;  4O3T B;  2XZG A;  1L5G A;  5THA A;  4IA9 A;  4A08 B;  3O4H A;  4JSN C;  5CXC A;  1NR0 A;  3EG6 A;  4JHP C;  1T2X A;  2OK6 A;  3T3P A;  1GP2 B;  2HU7 A;  2QR5 A;  5E6R A;  4FA9 D;  4JT5 C;  4A0A A;  4L3G D;  2P9U C;  1XHM A;  3PE7 A;  1MDA H;  4MMY A;  1ERJ A;  5B4W A;  5A2Q g;  1B9Y A;  4ZOZ A;  2YNO A;  3N0E A;  1XIP A;  4J87 A;  3IUR A;  4MMZ A;  2UZY B;  2CE8 A;  2P9I C;  4JT6 C;  2B5M A;  4L3H D;  5H17 A;  5EAM A;  3PSC B;  1K3I A;  3JZG A;  3ZE0 A;  5FKQ A;  2H9P A;  2HES X;  3EI1 A;  2CN2 A;  3K27 A;  3UVO A;  3EWE A;  5EM2 A;  4CY3 A;  3ZDX A;  2AGL A;  3E0C A;  5C2V B;  5TEE A;  1PBY B;  1GOG A;  2BKL A;  2PM9 A;  4K3I D;  1I2M B;  1A0R B;  2VZ3 A;  3EU7 A;  1N6E A;  3CIK B;  2PM7 B;  4K3J B;  2BBK H;  5CXB A;  2Z2P A;  4H5J A;  3I7K A;  2IWF A;  3C5M A;  4J0X A;  5M5V A;  3C75 H;  1VE6 A;  4BP8 A;  4G1E A;  3OKW A;  3I7L A;  4LGN A;  4BCC A;  4D0K A;  3SBR A;  4CZV A;  4OWR A;  5M5S A;  1H2W A;  5H1M A;  2QZP A;  4ZOV A;  2AGX A;  2VDK A;  5EMJ B;  4A09 B;  4I79 A;  3MMY A;  4FB1 D;  5HE3 B;  2YNP A;  4JXM A;  3NVQ A;  3IJE A;  3AL8 B;  3IJC A;  2EIC A;  3I7H A;  4J8B A;  4A2M A;  4NAA A;  1JMZ B;  4FA4 D;  4A11 B;  1FWX A;  2H9M A;  1JV2 A;  2XDW A;  3DM0 A;  5IT9 g;  3MUO A;  3O4J A;  5HYN B;  3RN0 D;  2OVR B;  4WK4 A;  2YNN A;  5IGQ A;  2IAA A;  4Y5R D;  3RFH A;  3OTT A;  4DNV A;  5KDO B;  2HU5 A;  3AFC A;  2B5N A;  1UOO A;  4JD2 C;  4NC4 A;  2YMU A;  2VDQ A;  4WK0 A;  1RI6 A;  1QFM A;  2EIB A;  3I89 A;  4BUJ C;  3K26 A;  3J81 g;  4CC9 A;  3I2N A;  3IUL A;  5FQD A;  1UTC A;  3BWS A;  4JSX C;  3IIW A;  3PSL A;  3JZN A;  4X60 B;  1H2Y A;  2IUR A;  4ESG A;  3RN1 D;  3CFV A;  3V7D B;  2G9A A;  5M5R A;  4NBM A;  1U4C A;  5CXC B;  5AMS A;  4GQB B;  3SFZ A;  1U8C A;  3SCY A;  2B4E A;  4A7J A;  3NID A;  1SQJ A;  2Q7Q A;  2VC2 A;  4A0A B;  4ZOY A;  3JAM g;  4G56 B;  4GM8 A;  2XL3 A;  4WJK A;  4Y7R A;  4CI1 A;  3FM0 A;  1GOT B;  3IIY A;  4CZY A;  3V4P A;  1E5T A;  4NSX A;  3SMR A;  4ERZ A;  3SHF A;  3V4V A;  4J82 A;  1B9X A;  2HJB A;  3O4I A;  5I5I A;  4O9D A;  1MG3 A;  2H6K A;  2OK4 A;  4DNU A;  4G55 A;  2XYI A;  3QHY B;  3OKY A;  3PVU B;  1PI6 A;  5HE1 B;  3EI1 B;  2OJY A;  4IRZ A;  4HDJ A;  2VDO A;  2Z2N A;  3GRE A;  5EM2 B;  3U4Y A;  4L9O A;  3F3G A;  4O2W A;  1QNI A;  2VDR A;  4QQE A;  1YFQ A;  2OVQ B;  2MTA H;  2PM9 B;  4FA1 D;  4FA5 D;  3ZDZ A;  5M61 A;  3SVW D;  1JTD B;  4U7A A;  4O1Q D;  3IJ1 A;  4OZU A;  2XU7 A;  1VE7 A;  3DDU A;  3NIF A;  5CXB B;  3IVM A;  4GMB A;  3IUN A;  4X61 B;  3HFQ A;  5EMM B;  2EIE A;  3I7N A;  3IUJ A;  4JSP C;  3C99 A;  1L0Q A;  5HDB A;  5FFG A;  4FWW A;  3AL9 A;  2VDP A;  4A0B A;  4PSX B;  5IJ8 E; 
#chains in the Genus database with same CATH homology
 5C2W B;  5IC7 A;  4CI8 A;  4KFM B;  3L4M D;  3OL2 A;  3N0D A;  4J86 A;  3ZWL B;  3B7F A;  4AOW A;  2QC5 A;  2G99 A;  3JRP A;  3JRO A;  3KRW B;  4J84 A;  1R5M A;  5CYK A;  3EI3 A;  1PEV A;  2GC7 A;  1MG2 A;  4XEI C;  1K32 A;  3UVL A;  4FAV D;  3PXT D;  4XYH A;  3V5W B;  3MZK A;  4MK0 B;  3J80 g;  3DSM A;  5FKR A;  2XL2 A;  3PXW D;  2HYE A;  2H68 A;  2H13 A;  1NEX B;  4E54 A;  5IGO A;  1P22 A;  5AJA A;  1K8K C;  3EI2 A;  3SXT D;  4CY5 A;  2OIZ A;  4PBY A;  4GZ8 A;  4AEZ A;  4ERQ A;  3AH8 B;  3EMH A;  4CZX A;  3BG1 A;  2CE9 A;  3OKT A;  3UKR C;  2HXC A;  1JJU B;  4CY2 A;  3I7O A;  3SBP A;  2CNX A;  1JOF A;  4GM3 A;  4X63 B;  4Z8L A;  2P9N C;  4GGA A;  2I0T A;  4XYI A;  2UZX B;  4QRJ A;  1XKS A;  2AH1 A;  2IUP A;  2W18 A;  4A2L A;  2J56 H;  4YVD A;  3VH0 A;  5FLX g;  4PNK B;  3UVN A;  3I7P A;  2EBS A;  1JMX B;  4GQ1 A;  2J57 G;  3SN6 B;  3VGZ A;  3OKY B;  3C9C A;  4FHL A;  1TBG A;  1SHY B;  2H9L A;  2H14 A;  3GFC A;  4PSW B;  4LG8 A;  3SWS D;  4O3U B;  2I0S A;  5TEF A;  5H14 A;  3FGB A;  5FKT A;  3F3F A;  3KRX B;  5TDH B;  4CY1 A;  5GXI A;  3DXK C;  4PXW A;  3I8C A;  4J77 A;  3MKS B;  4J78 A;  2H3X A;  3L4O D;  2HKM A;  4A0B B;  3A0F A;  2BCJ B;  2O9K A;  2H47 A;  3UVK A;  4GQ2 P;  3OL2 B;  2P9K C;  3RMZ D;  1U2V C;  4ES0 A;  5CYK B;  3EI4 A;  4ZN4 A;  1PGU A;  5K19 A;  1N6D A;  3EI3 B;  3IJ0 A;  1S4U X;  5GMK n;  2I3T A;  2IWK A;  4E5Z A;  4X3E A;  2OVP B;  2CN3 A;  4CI3 A;  4BL0 A;  4A08 A;  3UR4 A;  5GXH A;  3IKO A;  3OW8 A;  3UVM A;  2IUV A;  4GM9 A;  4PBZ A;  3PXS D;  1OLZ A;  1Q47 A;  4D6V A;  2Z2O A;  4E54 B;  4UI9 R;  2HKR A;  3EI2 B;  3V9F A;  5HE0 B;  3CFS B;  4LG9 A;  4J79 A;  3ORV D;  3SJL D;  4J73 A;  2AQ5 A;  3MKQ A;  1GG2 B;  4O45 A;  4J81 A;  5SXM A;  5JWZ A;  5I5M A;  2PM6 B;  5EAP A;  5K1C C;  2HJ4 A;  2AH0 A;  4H5I A;  1TYQ C;  5EMK B;  2H9N A;  5FXY A;  4ERY A;  2QXV A;  3VA6 A;  4GGD A;  4TZ4 A;  3FRX A;  5EAR A;  2I3S A;  2J55 H;  4QT8 A;  4U1E I;  4N14 A;  3RRM C;  4QL1 A;  2CO0 C;  3UKU C;  5I5J A;  2IUQ A;  3F3P A;  5IJ7 E;  5EML B;  3ULE C;  1SQ9 A;  4A09 A;  3MZL A;  2GNQ A;  4J8G A;  2YBA A;  1VYH C;  3AL8 A;  3NVX A;  3NVN A;  1OMW B;  5HE2 B;  5FKS A;  4IMM A;  5FA5 B;  2YB8 B;  4A11 A;  2AGY A;  2TRC B;  5TF2 A;  3PVW B;  4ZOX A;  5GSA A;  4L1Q D;  5C9Z B;  2I0R A;  4J0W A;  3RLM D;  3SLE D;  3DWL C;  3MXX A;  3SBQ A;  2CO0 A;  4GGC A;  4PC0 A;  4JSV C;  2AGZ A;  2P9P C;  3JB9 L;  1GXR A;  2PBI B;  3ODT A;  2GC4 A;  4EWR A;  4FAN D;  2P9L C;  3DXM C;  3JPX A;  4BH6 A;  3RSE C;  3EI4 B;  4R7A B;  4CI2 A;  3P4F A;  5HQG A;  2AGW A;  3W15 A;  3BG0 A;  5AFU 3;  2H6N A;  2H6Q A;  3JZH A;  3RFG A;  4E5Z B;  1N6F A;  2B5L A;  2P9S C;  3I8E A;  5EAL A;  4O3T B;  4A08 B;  5THA A;  4IA9 A;  4JSN C;  5CXC A;  1NR0 A;  3EG6 A;  2OK6 A;  1GP2 B;  4FA9 D;  4JT5 C;  4A0A A;  4L3G D;  2P9U C;  1XHM A;  3PE7 A;  1MDA H;  1ERJ A;  5B4W A;  5A2Q g;  1B9Y A;  4ZOZ A;  2YNO A;  3N0E A;  1XIP A;  4J87 A;  2UZY B;  2CE8 A;  4JT6 C;  2B5M A;  4L3H D;  5H17 A;  5EAM A;  3PSC B;  3JZG A;  5FKQ A;  2H9P A;  2HES X;  3EI1 A;  2CN2 A;  3K27 A;  3UVO A;  3EWE A;  5EM2 A;  4CY3 A;  2AGL A;  3E0C A;  5C2V B;  5TEE A;  1PBY B;  2PM9 A;  4K3I D;  1A0R B;  3EU7 A;  1N6E A;  3CIK B;  4K3J B;  2PM7 B;  2BBK H;  5CXB A;  2Z2P A;  4H5J A;  3I7K A;  2IWF A;  3C5M A;  4J0X A;  3C75 H;  3OKW A;  3I7L A;  4LGN A;  4D0K A;  3SBR A;  4CZV A;  4OWR A;  5H1M A;  4ZOV A;  2AGX A;  5EMJ B;  4A09 B;  4I79 A;  3MMY A;  4FB1 D;  5HE3 B;  2YNP A;  4JXM A;  3NVQ A;  3AL8 B;  3IJC A;  3I7H A;  4J8B A;  4A2M A;  1JMZ B;  4FA4 D;  4A11 B;  1FWX A;  2H9M A;  3DM0 A;  5IT9 g;  5HYN B;  3RN0 D;  2OVR B;  2YNN A;  5IGQ A;  2IAA A;  4Y5R D;  3RFH A;  3OTT A;  5KDO B;  3AFC A;  2B5N A;  4JD2 C;  2YMU A;  1RI6 A;  3I89 A;  4BUJ C;  3K26 A;  3J81 g;  4CC9 A;  3I2N A;  5FQD A;  3BWS A;  4JSX C;  3IIW A;  3PSL A;  3JZN A;  4X60 B;  2IUR A;  4ESG A;  3RN1 D;  3CFV A;  3V7D B;  2G9A A;  1U4C A;  5CXC B;  5AMS A;  4GQB B;  3SFZ A;  3SCY A;  2B4E A;  4A7J A;  1SQJ A;  2Q7Q A;  4A0A B;  4ZOY A;  3JAM g;  4G56 B;  4GM8 A;  2XL3 A;  4Y7R A;  4CI1 A;  3FM0 A;  1GOT B;  3IIY A;  4CZY A;  4NSX A;  3SMR A;  4ERZ A;  3SHF A;  4J82 A;  1B9X A;  2HJB A;  5I5I A;  4O9D A;  1MG3 A;  2H6K A;  2OK4 A;  2XYI A;  3OKY A;  3PVU B;  1PI6 A;  5HE1 B;  3EI1 B;  2OJY A;  4HDJ A;  2Z2N A;  3GRE A;  5EM2 B;  3U4Y A;  4L9O A;  3F3G A;  1QNI A;  4QQE A;  2OVQ B;  1YFQ A;  2MTA H;  2PM9 B;  4FA1 D;  4FA5 D;  3SVW D;  4U7A A;  4O1Q D;  3IJ1 A;  4OZU A;  2XU7 A;  5CXB B;  4GMB A;  4X61 B;  5EMM B;  3HFQ A;  3I7N A;  4JSP C;  3C99 A;  1L0Q A;  4FWW A;  3AL9 A;  2P9I C;  4A0B A;  4PSX B;  5IJ8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...