3SVWD

Crystal structure of the p107v-maug/pre-methylamine dehydrogenase complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 97
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3svwD00
5TEEA 2AH0A 5I5MA 4GGDA 4PSXB 4A11A 1N6EA 2P9NC 2I0RA 3EMHA 5AMSA 2HYEA 1K8KC 3SLED 3EG6A 5THAA 1FWXA 3BG1A 3C9CA 2YNNA 3UVOA 3SXTD 4ZN4A 2CN2A 4CI2A 3DXMC 3RRMC 4A2LA 3SMRA 4H5JA 3RN1D 2I0TA 2O9KA 2H14A 2Z2OA 2XYIA 2XL3A 3OW8A 2IUQA 3MKSB 1PGUA 2XL2A 2YNPA 5I5IA 4XYHA 2YBAA 4A09A 5FXYA 4J86A 2PM7B 3K26A 2AH1A 2PBIB 3SVWD 4GM8A 4PNKB 5IJ7E 3UVLA 1B9XA 5I5JA 4BH6A 3N0DA 4A7JA 3JRPA 4J0XA 3EI2A 2Z2PA 4D0KA 2I3SA 5FQDA 1VYHC 4I79A 3CFVA 1RI6A 4X3EA 3NVXA 1MDAH 3F3GA 4J87A 2CO0C 1NR0A 4FA9D 4A0AB 2P9IC 2Q7QA 4PBZA 3JZGA 3VGZA 3IJ0A 2H47A 4Z8LA 4CI1A 1P22A 4GGAA 2BBKH 2GC7A 4FHLA 4CZVA 5TDHB 3ODTA 4O9DA 3RLMD 4J8GA 5EMLB 3RMZD 4GQBB 2HXCA 3I2NA 3UVMA 4L1QD 1GXRA 2YMUA 3OTTA 2I3TA 4LG8A 3AL9A 2AGZA 3C75H 3PXWD 4A2MA 5IJ8E 3V7DB 2G9AA 2OVPB 2IAAA 5HE2B 3E0CA 4L3GD 3VH0A 4CY1A 3EI4A 1JMZB 2HJBA 3A0FA 3P4FA 2MTAH 1QNIA 3IJ1A 3SHFA 3J81g 2H6KA 1SQJA 1PI6A 4QRJA 4JSNC 5FLXg 3GFCA 3UVNA 4YVDA 4QT8A 3EI1B 2Z2NA 4G56B 2CO0A 3JZNA 4PXWA 3RFHA 3HFQA 5AJAA 2B5LA 5KDOB 2G99A 4L3HD 5EARA 3V5WB 2B4EA 5EMMB 1Q47A 5FKSA 2CNXA 4GGCA 3I7PA 2H13A 3IKOA 4GM3A 3KRWB 3FRXA 4N14A 1B9YA 4QL1A 5CXBB 5GSAA 3JAMg 3K27A 3CFSB 2AGYA 4CI3A 3MZLA 4FA4D 3PSCB 3ZWLB 3GREA 4BUJC 4JT5C 4CZXA 4J84A 2H3XA 2AGLA 4ERYA 5CYKB 4ES0A 2B5MA 1N6FA 4CC9A 3MMYA 5EMJB 4AOWA 3PXTD 3SN6B 5HE0B 3F3FA 3KRXB 4EWRA 2EBSA 4ZOYA 1U2VC 2HESX 3MKQA 4CY2A 4ZOVA 3I8CA 4J77A 4AEZA 5EAPA 5FKTA 2P9SC 1JMXB 5IC7A 2P9LC 5TF2A 2P9PC 3SJLD 1SHYB 2OVRB 5AFU3 4JSVC 4ZOXA 3EU7A 4CI8A 3RSEC 4O45A 3I8EA 5H14A 5EM2B 5GMKn 2P9KC 3I89A 1XHMA 3PVWB 3OKTA 2GNQA 4LG9A 4FWWA 1A0RB 3J80g 3PSLA 2H6QA 3IIWA 2AGWA 4JXMA 2J57G 3SCYA 5CYKA 3VA6A 2OVQB 4UI9R 4J79A 2PM9B 2PM6B 2J56H 4J81A 4A08B 3I7KA 3OKWA 3JB9L 2H9NA 4HDJA 3I7NA 4Y7RA 1TBGA 3OL2B 1PBYB 1PEVA 4U1EI 2H9MA 4GZ8A 3DM0A 3CIKB 4PSWB 5B4WA 4XYIA 4IA9A 4GQ2P 2CE8A 3PXSD 3B7FA 3MXXA 4FAVD 4R7AB 3DWLC 4ERQA 2HKMA 4PBYA 1XKSA 2H9PA 3I7HA 5EM2A 4A0AA 4X61B 3RN0D 4ZOZA 4XEIC 4L9OA 4H5IA 1GG2B 5IT9g 4FB1D 3SBRA 4U7AA 3I7LA 2BCJB 2AGXA 2OK6A 4JD2C 1N6DA 3JROA 5FKQA 3IJCA 2PM9A 1SQ9A 4O3TB 4J82A 3UKRC 4A08A 2OK4A 4X63B 1OMWB 4QQEA 1JJUB 3ORVD 3N0EA 3NVQA 3JPXA 4ERZA 3RFGA 3OL2A 5FKRA 5HE3B 1L0QA 1JOFA 4BL0A 4E5ZB 2H68A 2UZYB 4IMMA 4CY5A 1OLZA 3BG0A 5SXMA 4JT6C 3EI1A 3L4OD 5EAMA 5CXCB 3OKYB 1GP2B 4MK0B 5JWZA 4K3ID 5HYNB 4A0BB 2CN3A 5GXHA 3AH8B 1R5MA 3PVUB 4CY3A 2OJYA 5K1CC 4D6VA 5HQGA 4ESGA 1TYQC 4J0WA 3ULEC 2J55H 3SWSD 3UKUC 3I7OA 5H1MA 5K19A 5CXBA 2QXVA 3SBQA 4KFMB 2H9LA 5H17A 5HE1B 4J78A 2HKRA 3JZHA 4FA1D 2W18A 5IGQA 3EI4B 3SFZA 4E54B 4O1QD 4TZ4A 1NEXB 5GXIA 3V9FA 3UR4A 3DSMA 1U4CA 4E5ZA 4J8BA 2H6NA 3IIYA 3UVKA 3F3PA 4JSXC 2IURA 3AL8B 3L4MD 5EALA 3EI3B 4O3UB 2HJ4A 2YB8B 3U4YA 5CXCA 3OKYA 5EMKB 5C2VB 5C9ZB 1YFQA 3C99A 4X60B 5C2WB 2OIZA 4JSPC 2IUPA 4LGNA 4A11B 4A0BA 3PE7A 4OWRA 4J73A 3BWSA 3FM0A 1K32A 5TEFA 3SBPA 4GQ1A 1GOTB 2IUVA 1ERJA 5IGOA 3EWEA 3MZKA 3C5MA 2AQ5A 4NSXA 4GM9A 3AFCA 4FA5D 3NVNA 3DXKC 2CE9A 4E54A 2IWKA 1S4UX 4PC0A 2TRCB 4Y5RD 2IWFA 3FGBA 5FA5B 2B5NA 4K3JB 4A09B 2XU7A 2GC4A 4OZUA 4CZYA 2UZXB 1XIPA 3AL8A 4FAND 3EI3A 3W15A 2P9UC 3EI2B 5A2Qg 2QC5A 1MG3A 2YNOA 4GMBA 1MG2A 2I0SA
chains in the Genus database with same CATH superfamily
2VDOA 5TEEA 2AH0A 4AX4A 3IUMA 5E6UA 5I5MA 4GGDA 4PSXB 5FFOA 4A11A 3IURA 2EIBA 1N6EA 2P9NC 2I0RA 3EMHA 5AMSA 2HYEA 1K8KC 2VDRA 3SLED 3EG6A 5THAA 1FWXA 3BG1A 3C9CA 4JHPC 3GD1I 2YNNA 3ZE0A 4L1MA 1UOPA 3UVOA 3SXTD 4ZN4A 2CN2A 4CI2A 3DXMC 3RRMC 4A2LA 1UOQA 3SMRA 2VZ3A 4H5JA 3GC3B 3RN1D 2I0TA 2O9KA 2H14A 2Z2OA 2XYIA 2XL3A 2EICA 3OW8A 2IUQA 3MKSB 1PGUA 2XL2A 2YNPA 3IULA 5I5IA 4XYHA 2YBAA 4A09A 1UOOA 5FXYA 4J86A 2PM7B 3K26A 2AH1A 2PBIB 3SVWD 4GM8A 4PNKB 3ZDYA 5IJ7E 3UVLA 3VI3A 1B9XA 3O4GA 5I5JA 4BH6A 3N0DA 4A7JA 3JRPA 4J0XA 3EI2A 2Z2PA 4G55A 4BCCA 3EQ9A 4D0KA 2HU7A 4IRZA 2I3SA 5FQDA 1VYHC 4I79A 2VDPA 3CFVA 4WJKA 1RI6A 4X3EA 3NVXA 1MDAH 3F3GA 4J87A 2CO0C 2VDMA 1NR0A 4FA9D 4NENA 2VC2A 4A0AB 2P9IC 2Q7QA 4PBZA 3T3PA 1TYEA 3JZGA 3VGZA 3IJ0A 2H47A 4Z8LA 2JKXA 4CI1A 1P22A 4GGAA 2BBKH 2GC7A 4FHLA 4CZVA 5TDHB 2QR5A 3ODTA 4O9DA 3RLMD 4J8GA 3MVDK 5EMLB 3RMZD 4GQBB 4BCDA 3EQ8A 2HXCA 1VE6A 3I2NA 3UVMA 4L1QD 4NBMA 4BCBA 1GXRA 2YMUA 3OTTA 2I3TA 4LG8A 3AL9A 1JTDB 2AGZA 1UTCA 3NIFA 2XZGA 3C75H 3PXWD 3V4PA 4A2MA 5IJ8E 4DNUA 3V7DB 2G9AA 2OVPB 2IAAA 3QHYB 5HE2B 1GOGA 4MMZA 3E0CA 4L3GD 3VH0A 4CY1A 3EI4A 1JMZB 3ZE1A 2HJBA 3A0FA 3NIDA 1VZ2A 3P4FA 5M5VA 2MTAH 1QNIA 3IJ1A 3SHFA 3J81g 2H6KA 5C92A 1SQJA 1PI6A 3NIGA 4QRJA 4JSNC 5FLXg 3O4HA 5C86A 3GFCA 3UVNA 4YVDA 4QT8A 3EI1B 2Z2NA 4G56B 3VI4A 2CO0A 3JZNA 4PXWA 3RFHA 3HFQA 5AJAA 2B5LA 5KDOB 2G99A 4L3HD 5EARA 1U8CA 3V5WB 2B4EA 5EMMB 1Q47A 5FKSA 3DDUA 2CNXA 4GGCA 3I7PA 2H13A 3IKOA 4GM3A 1H2WA 3EQ7A 3KRWB 3FRXA 3QI0A 1B9YA 4N14A 2WQ8A 4QL1A 5CXBB 5GSAA 3JAMg 3K27A 3CFSB 1GOHA 2AGYA 2VDNA 4CI3A 3MZLA 4FA4D 3PSCB 3ZWLB 4AMZA 3GREA 4BUJC 4JT5C 4WK2A 4CZXA 4J84A 2H3XA 2AGLA 4ERYA 5CYKB 4ES0A 2B5MA 3KCIA 3K71A 1N6FA 4CC9A 1O6FA 4O02A 3MMYA 5EMJB 1E8MA 4AOWA 3PXTD 3SN6B 5HE0B 3F3FA 3KRXB 4EWRA 2EBSA 4ZOYA 1U2VC 2HESX 1I2MB 3MKQA 4CY2A 4ZOVA 3I8CA 4J77A 4AEZA 1T2XA 5EAPA 5FKTA 1C9IA 4O2WA 2P9SC 3O4IA 3OF7A 1JMXB 5IC7A 2P9LC 5TF2A 3MUOA 2P9PC 3SJLD 3ZE2A 1SHYB 2OVRB 5AFU3 4JSVC 4ZOXA 4UM9A 3EU7A 4CI8A 3RSEC 4DNWA 4O45A 3I8EA 5E6SA 1E8NA 5H14A 5EM2B 5GMKn 2BKLA 2P9KC 3I89A 1XHMA 3PVWB 1O6GA 3IJEA 3OKTA 1H2YA 2GNQA 4LG9A 3K72A 4WK4A 4D9SA 4FWWA 1A0RB 3J80g 1BPOA 3PSLA 2H6QA 3IIWA 2AGWA 2J57G 4JXMA 3SCYA 5CYKA 3VA6A 5M5UA 2OVQB 4UI9R 4J79A 2PM9B 2PM6B 2J56H 4J81A 4A08B 3I7KA 3OKWA 3JB9L 2H9NA 4HDJA 3I7NA 4Y7RA 4G1MA 1TBGA 4RE5A 3OL2B 1QFSA 5FFGA 1PBYB 1PEVA 4U1EI 2H9MA 4GZ8A 3DM0A 3CIKB 4PSWB 5B4WA 3K6SA 4XYIA 4IA9A 4GQ2P 2CE8A 3PXSD 4WK0A 3B7FA 3MXXA 4FAVD 4R7AB 3DWLC 4ERQA 2HKMA 4PBYA 1YR2A 5M5SA 1XKSA 2H9PA 3I7HA 5EM2A 4A0AA 4X61B 3RN0D 1A12A 2XE4A 4ZOZA 4XEIC 4L9OA 3FCUA 4H5IA 1GG2B 5IT9g 4FB1D 3SBRA 4U7AA 3I7LA 2BCJB 2AGXA 2OK6A 2QZPA 4JD2C 1N6DA 3JROA 5FKQA 3IJCA 1L5GA 2VDLA 3IVMA 2PM9A 1SQ9A 4O3TB 4J82A 3UKRC 4A08A 2OK4A 4BP9A 4X63B 4Z7QA 4UM8A 1OMWB 4QQEA 1JJUB 3ORVD 3N0EA 3NVQA 1JV2A 4NC4A 1QFMA 3JPXA 4ERZA 3RFGA 3OL2A 5FKRA 5HE3B 1L0QA 1E5TA 1JOFA 4BL0A 4E5ZB 2H68A 1VZ3A 2VZ1A 2UZYB 4IMMA 4QAMA 2XDWA 3MUNA 3IUNA 4CY5A 1OLZA 3BG0A 5SXMA 4JT6C 4DNVA 3EI1A 3L4OD 5EAMA 5CXCB 3OKYB 1GP2B 4MK0B 3IUJA 5JWZA 4K3ID 5HYNB 4A0BB 2CN3A 4AN1A 5E6RA 5GXHA 3AH8B 1R5MA 3PVUB 4CY3A 2OJYA 5K1CC 4D6VA 5HQGA 4ESGA 1TYQC 4J0WA 3ULEC 2J55H 3SWSD 3UKUC 3I7OA 1H2XA 3O4JA 5H1MA 5K19A 1GOFA 5CXBA 2QXVA 4JHNA 3ZDXA 3SBQA 3FCSA 4KFMB 2H9LA 5H17A 5HE1B 4J78A 2HKRA 3JZHA 4FA1D 2W18A 3ZDZA 3EI4B 5IGQA 4AN0A 3SFZA 4E54B 4NAAA 4O1QD 4TZ4A 1NEXB 5GXIA 5M5TA 3V9FA 3UR4A 3DSMA 3V4VA 1U4CA 4E5ZA 4J8BA 2H6NA 3IIYA 3UVKA 3F3PA 4JSXC 2IURA 3AL8B 4BP8A 3L4MD 2HU8A 4MMXA 5EALA 3EI3B 4O3UB 2HJ4A 2YB8B 4AMYA 3U4YA 5CXCA 3OKYA 5EMKB 5C2VB 5C9ZB 1YFQA 2EIDA 3C99A 4X60B 5C2WB 3IUQA 2OIZA 5M61A 4JSPC 2IUPA 4LGNA 4A11B 2HU5A 4A0BA 3PE7A 5M5RA 4OWRA 1K3IA 4J73A 3BWSA 3FM0A 1K32A 5TEFA 3SBPA 4Z7NA 4GQ1A 1GOTB 4MMYA 2IUVA 4G1EA 1ERJA 5IGOA 3EWEA 3MZKA 3C5MA 2AQ5A 2EIEA 4NSXA 4GM9A 3AFCA 4FA5D 3NVNA 3DXKC 2CE9A 5HDBA 4RE6A 4E54A 2IWKA 1S4UX 4PC0A 2VDKA 2TRCB 4Y5RD 2IWFA 3FGBA 5FA5B 2B5NA 4K3JB 4A09B 2XU7A 2GC4A 1VE7A 4OZUA 1M1XA 4CZYA 2UZXB 1XIPA 3T3MA 3AL8A 2VDQA 4FAND 3EI3A 1H2ZA 3W15A 2P9UC 3EI2B 5A2Qg 1C9LA 2QC5A 1MG3A 2YNOA 4GMBA 1MG2A 2I0SA 4Z7OA
chains in the Genus database with same CATH topology
5TEEA 2AH0A 5I5MA 4GGDA 4PSXB 4A11A 1N6EA 2P9NC 2I0RA 3EMHA 5AMSA 2HYEA 1K8KC 3SLED 3EG6A 5THAA 1FWXA 3BG1A 3C9CA 2YNNA 3UVOA 3SXTD 4ZN4A 2CN2A 4CI2A 3DXMC 3RRMC 4A2LA 3SMRA 4H5JA 3RN1D 2I0TA 2O9KA 2H14A 2Z2OA 2XYIA 2XL3A 3OW8A 2IUQA 3MKSB 1PGUA 2XL2A 2YNPA 5I5IA 4XYHA 2YBAA 4A09A 5FXYA 4J86A 2PM7B 3K26A 2AH1A 2PBIB 3SVWD 4GM8A 4PNKB 5IJ7E 3UVLA 1B9XA 5I5JA 4BH6A 3N0DA 4A7JA 3JRPA 4J0XA 3EI2A 2Z2PA 4D0KA 2I3SA 5FQDA 1VYHC 4I79A 3CFVA 1RI6A 4X3EA 3NVXA 1MDAH 3F3GA 4J87A 2CO0C 1NR0A 4FA9D 4A0AB 2P9IC 2Q7QA 4PBZA 3JZGA 3VGZA 3IJ0A 2H47A 4Z8LA 4CI1A 1P22A 4GGAA 2BBKH 2GC7A 4FHLA 4CZVA 5TDHB 3ODTA 4O9DA 3RLMD 4J8GA 5EMLB 3RMZD 4GQBB 2HXCA 3I2NA 3UVMA 4L1QD 1GXRA 2YMUA 3OTTA 2I3TA 4LG8A 3AL9A 2AGZA 3C75H 3PXWD 4A2MA 5IJ8E 3V7DB 2G9AA 2OVPB 2IAAA 5HE2B 3E0CA 4L3GD 3VH0A 4CY1A 3EI4A 1JMZB 2HJBA 3A0FA 3P4FA 2MTAH 1QNIA 3IJ1A 3SHFA 3J81g 2H6KA 1SQJA 1PI6A 4QRJA 4JSNC 5FLXg 3GFCA 3UVNA 4YVDA 4QT8A 3EI1B 2Z2NA 4G56B 2CO0A 3JZNA 4PXWA 3RFHA 3HFQA 5AJAA 2B5LA 5KDOB 2G99A 4L3HD 5EARA 3V5WB 2B4EA 5EMMB 1Q47A 5FKSA 2CNXA 4GGCA 3I7PA 2H13A 3IKOA 4GM3A 3KRWB 3FRXA 4N14A 1B9YA 4QL1A 5CXBB 5GSAA 3JAMg 3K27A 3CFSB 2AGYA 4CI3A 3MZLA 4FA4D 3PSCB 3ZWLB 3GREA 4BUJC 4JT5C 4CZXA 4J84A 2H3XA 2AGLA 4ERYA 5CYKB 4ES0A 2B5MA 1N6FA 4CC9A 3MMYA 5EMJB 4AOWA 3PXTD 3SN6B 5HE0B 3F3FA 3KRXB 4EWRA 2EBSA 4ZOYA 1U2VC 2HESX 3MKQA 4CY2A 4ZOVA 3I8CA 4J77A 4AEZA 5EAPA 5FKTA 2P9SC 1JMXB 5IC7A 2P9LC 5TF2A 2P9PC 3SJLD 1SHYB 2OVRB 5AFU3 4JSVC 4ZOXA 3EU7A 4CI8A 3RSEC 4O45A 3I8EA 5H14A 5EM2B 5GMKn 2P9KC 3I89A 1XHMA 3PVWB 3OKTA 2GNQA 4LG9A 4FWWA 1A0RB 3J80g 3PSLA 2H6QA 3IIWA 2AGWA 4JXMA 2J57G 3SCYA 5CYKA 3VA6A 2OVQB 4UI9R 4J79A 2PM9B 2PM6B 2J56H 4J81A 4A08B 3I7KA 3OKWA 3JB9L 2H9NA 4HDJA 3I7NA 4Y7RA 1TBGA 3OL2B 1PBYB 1PEVA 4U1EI 2H9MA 4GZ8A 3DM0A 3CIKB 4PSWB 5B4WA 4XYIA 4IA9A 4GQ2P 2CE8A 3PXSD 3B7FA 3MXXA 4FAVD 4R7AB 3DWLC 4ERQA 2HKMA 4PBYA 1XKSA 2H9PA 3I7HA 5EM2A 4A0AA 4X61B 3RN0D 4ZOZA 4XEIC 4L9OA 4H5IA 1GG2B 5IT9g 4FB1D 3SBRA 4U7AA 3I7LA 2BCJB 2AGXA 2OK6A 4JD2C 1N6DA 3JROA 5FKQA 3IJCA 2PM9A 1SQ9A 4O3TB 4J82A 3UKRC 4A08A 2OK4A 4X63B 1OMWB 4QQEA 1JJUB 3ORVD 3N0EA 3NVQA 3JPXA 4ERZA 3RFGA 3OL2A 5FKRA 5HE3B 1L0QA 1JOFA 4BL0A 4E5ZB 2H68A 2UZYB 4IMMA 4CY5A 1OLZA 3BG0A 5SXMA 4JT6C 3EI1A 3L4OD 5EAMA 5CXCB 3OKYB 1GP2B 4MK0B 5JWZA 4K3ID 5HYNB 4A0BB 2CN3A 5GXHA 3AH8B 1R5MA 3PVUB 4CY3A 2OJYA 5K1CC 4D6VA 5HQGA 4ESGA 1TYQC 4J0WA 3ULEC 2J55H 3SWSD 3UKUC 3I7OA 5H1MA 5K19A 5CXBA 2QXVA 3SBQA 4KFMB 2H9LA 5H17A 5HE1B 4J78A 2HKRA 3JZHA 4FA1D 2W18A 5IGQA 3EI4B 3SFZA 4E54B 4O1QD 4TZ4A 1NEXB 5GXIA 3V9FA 3UR4A 3DSMA 1U4CA 4E5ZA 4J8BA 2H6NA 3IIYA 3UVKA 3F3PA 4JSXC 2IURA 3AL8B 3L4MD 5EALA 3EI3B 4O3UB 2HJ4A 2YB8B 3U4YA 5CXCA 3OKYA 5EMKB 5C2VB 5C9ZB 1YFQA 3C99A 4X60B 5C2WB 2OIZA 4JSPC 2IUPA 4LGNA 4A11B 4A0BA 3PE7A 4OWRA 4J73A 3BWSA 3FM0A 1K32A 5TEFA 3SBPA 4GQ1A 1GOTB 2IUVA 1ERJA 5IGOA 3EWEA 3MZKA 3C5MA 2AQ5A 4NSXA 4GM9A 3AFCA 4FA5D 3NVNA 3DXKC 2CE9A 4E54A 2IWKA 1S4UX 4PC0A 2TRCB 4Y5RD 2IWFA 3FGBA 5FA5B 2B5NA 4K3JB 4A09B 2XU7A 2GC4A 4OZUA 4CZYA 2UZXB 1XIPA 3AL8A 4FAND 3EI3A 3W15A 2P9UC 3EI2B 5A2Qg 2QC5A 1MG3A 2YNOA 4GMBA 1MG2A 2I0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TEE A;  2AH0 A;  5I5M A;  4GGD A;  4PSX B;  4A11 A;  1N6E A;  2P9N C;  2I0R A;  3EMH A;  5AMS A;  2HYE A;  1K8K C;  3SLE D;  3EG6 A;  5THA A;  1FWX A;  3BG1 A;  3C9C A;  2YNN A;  3UVO A;  3SXT D;  4ZN4 A;  2CN2 A;  4CI2 A;  3DXM C;  3RRM C;  4A2L A;  3SMR A;  4H5J A;  3RN1 D;  2I0T A;  2O9K A;  2H14 A;  2Z2O A;  2XYI A;  2XL3 A;  3OW8 A;  2IUQ A;  3MKS B;  1PGU A;  2XL2 A;  2YNP A;  5I5I A;  4XYH A;  2YBA A;  4A09 A;  5FXY A;  4J86 A;  2PM7 B;  3K26 A;  2AH1 A;  2PBI B;  3SVW D;  4GM8 A;  4PNK B;  5IJ7 E;  3UVL A;  1B9X A;  5I5J A;  4BH6 A;  3N0D A;  4A7J A;  3JRP A;  4J0X A;  3EI2 A;  2Z2P A;  4D0K A;  2I3S A;  5FQD A;  1VYH C;  4I79 A;  3CFV A;  1RI6 A;  4X3E A;  3NVX A;  1MDA H;  3F3G A;  4J87 A;  2CO0 C;  1NR0 A;  4FA9 D;  4A0A B;  2P9I C;  2Q7Q A;  4PBZ A;  3JZG A;  3VGZ A;  3IJ0 A;  2H47 A;  4Z8L A;  4CI1 A;  1P22 A;  4GGA A;  2BBK H;  2GC7 A;  4FHL A;  4CZV A;  5TDH B;  3ODT A;  4O9D A;  3RLM D;  4J8G A;  5EML B;  3RMZ D;  4GQB B;  2HXC A;  3I2N A;  3UVM A;  4L1Q D;  1GXR A;  2YMU A;  3OTT A;  2I3T A;  4LG8 A;  3AL9 A;  2AGZ A;  3C75 H;  3PXW D;  4A2M A;  5IJ8 E;  3V7D B;  2G9A A;  2OVP B;  2IAA A;  5HE2 B;  3E0C A;  4L3G D;  3VH0 A;  4CY1 A;  3EI4 A;  1JMZ B;  2HJB A;  3A0F A;  3P4F A;  2MTA H;  1QNI A;  3IJ1 A;  3SHF A;  3J81 g;  2H6K A;  1SQJ A;  1PI6 A;  4QRJ A;  4JSN C;  5FLX g;  3GFC A;  3UVN A;  4YVD A;  4QT8 A;  3EI1 B;  2Z2N A;  4G56 B;  2CO0 A;  3JZN A;  4PXW A;  3RFH A;  3HFQ A;  5AJA A;  2B5L A;  5KDO B;  2G99 A;  4L3H D;  5EAR A;  3V5W B;  2B4E A;  5EMM B;  1Q47 A;  5FKS A;  2CNX A;  4GGC A;  3I7P A;  2H13 A;  3IKO A;  4GM3 A;  3KRW B;  3FRX A;  4N14 A;  1B9Y A;  4QL1 A;  5CXB B;  5GSA A;  3JAM g;  3K27 A;  3CFS B;  2AGY A;  4CI3 A;  3MZL A;  4FA4 D;  3PSC B;  3ZWL B;  3GRE A;  4BUJ C;  4JT5 C;  4CZX A;  4J84 A;  2H3X A;  2AGL A;  4ERY A;  5CYK B;  4ES0 A;  2B5M A;  1N6F A;  4CC9 A;  3MMY A;  5EMJ B;  4AOW A;  3PXT D;  3SN6 B;  5HE0 B;  3F3F A;  3KRX B;  4EWR A;  2EBS A;  4ZOY A;  1U2V C;  2HES X;  3MKQ A;  4CY2 A;  4ZOV A;  3I8C A;  4J77 A;  4AEZ A;  5EAP A;  5FKT A;  2P9S C;  1JMX B;  5IC7 A;  2P9L C;  5TF2 A;  2P9P C;  3SJL D;  1SHY B;  2OVR B;  5AFU 3;  4JSV C;  4ZOX A;  3EU7 A;  4CI8 A;  3RSE C;  4O45 A;  3I8E A;  5H14 A;  5EM2 B;  5GMK n;  2P9K C;  3I89 A;  1XHM A;  3PVW B;  3OKT A;  2GNQ A;  4LG9 A;  4FWW A;  1A0R B;  3J80 g;  3PSL A;  2H6Q A;  3IIW A;  2AGW A;  4JXM A;  2J57 G;  3SCY A;  5CYK A;  3VA6 A;  2OVQ B;  4UI9 R;  4J79 A;  2PM9 B;  2PM6 B;  2J56 H;  4J81 A;  4A08 B;  3I7K A;  3OKW A;  3JB9 L;  2H9N A;  4HDJ A;  3I7N A;  4Y7R A;  1TBG A;  3OL2 B;  1PBY B;  1PEV A;  4U1E I;  2H9M A;  4GZ8 A;  3DM0 A;  3CIK B;  4PSW B;  5B4W A;  4XYI A;  4IA9 A;  4GQ2 P;  2CE8 A;  3PXS D;  3B7F A;  3MXX A;  4FAV D;  4R7A B;  3DWL C;  4ERQ A;  2HKM A;  4PBY A;  1XKS A;  2H9P A;  3I7H A;  5EM2 A;  4A0A A;  4X61 B;  3RN0 D;  4ZOZ A;  4XEI C;  4L9O A;  4H5I A;  1GG2 B;  5IT9 g;  4FB1 D;  3SBR A;  4U7A A;  3I7L A;  2BCJ B;  2AGX A;  2OK6 A;  4JD2 C;  1N6D A;  3JRO A;  5FKQ A;  3IJC A;  2PM9 A;  1SQ9 A;  4O3T B;  4J82 A;  3UKR C;  4A08 A;  2OK4 A;  4X63 B;  1OMW B;  4QQE A;  1JJU B;  3ORV D;  3N0E A;  3NVQ A;  3JPX A;  4ERZ A;  3RFG A;  3OL2 A;  5FKR A;  5HE3 B;  1L0Q A;  1JOF A;  4BL0 A;  4E5Z B;  2H68 A;  2UZY B;  4IMM A;  4CY5 A;  1OLZ A;  3BG0 A;  5SXM A;  4JT6 C;  3EI1 A;  3L4O D;  5EAM A;  5CXC B;  3OKY B;  1GP2 B;  4MK0 B;  5JWZ A;  4K3I D;  5HYN B;  4A0B B;  2CN3 A;  5GXH A;  3AH8 B;  1R5M A;  3PVU B;  4CY3 A;  2OJY A;  5K1C C;  4D6V A;  5HQG A;  4ESG A;  1TYQ C;  4J0W A;  3ULE C;  2J55 H;  3SWS D;  3UKU C;  3I7O A;  5H1M A;  5K19 A;  5CXB A;  2QXV A;  3SBQ A;  4KFM B;  2H9L A;  5H17 A;  5HE1 B;  4J78 A;  2HKR A;  3JZH A;  4FA1 D;  2W18 A;  5IGQ A;  3EI4 B;  3SFZ A;  4E54 B;  4O1Q D;  4TZ4 A;  1NEX B;  5GXI A;  3V9F A;  3UR4 A;  3DSM A;  1U4C A;  4E5Z A;  4J8B A;  2H6N A;  3IIY A;  3UVK A;  3F3P A;  4JSX C;  2IUR A;  3AL8 B;  3L4M D;  5EAL A;  3EI3 B;  4O3U B;  2HJ4 A;  2YB8 B;  3U4Y A;  5CXC A;  3OKY A;  5EMK B;  5C2V B;  5C9Z B;  1YFQ A;  3C99 A;  4X60 B;  5C2W B;  2OIZ A;  4JSP C;  2IUP A;  4LGN A;  4A11 B;  4A0B A;  3PE7 A;  4OWR A;  4J73 A;  3BWS A;  3FM0 A;  1K32 A;  5TEF A;  3SBP A;  4GQ1 A;  1GOT B;  2IUV A;  1ERJ A;  5IGO A;  3EWE A;  3MZK A;  3C5M A;  2AQ5 A;  4NSX A;  4GM9 A;  3AFC A;  4FA5 D;  3NVN A;  3DXK C;  2CE9 A;  4E54 A;  2IWK A;  1S4U X;  4PC0 A;  2TRC B;  4Y5R D;  2IWF A;  3FGB A;  5FA5 B;  2B5N A;  4K3J B;  4A09 B;  2XU7 A;  2GC4 A;  4OZU A;  4CZY A;  2UZX B;  1XIP A;  3AL8 A;  4FAN D;  3EI3 A;  3W15 A;  2P9U C;  3EI2 B;  5A2Q g;  2QC5 A;  1MG3 A;  2YNO A;  4GMB A;  1MG2 A;  2I0S A; 
#chains in the Genus database with same CATH topology
 2VDO A;  5TEE A;  2AH0 A;  4AX4 A;  3IUM A;  5E6U A;  5I5M A;  4GGD A;  4PSX B;  5FFO A;  4A11 A;  3IUR A;  2EIB A;  1N6E A;  2P9N C;  2I0R A;  3EMH A;  5AMS A;  2HYE A;  1K8K C;  2VDR A;  3SLE D;  3EG6 A;  5THA A;  1FWX A;  3BG1 A;  3C9C A;  4JHP C;  3GD1 I;  2YNN A;  3ZE0 A;  4L1M A;  1UOP A;  3UVO A;  3SXT D;  4ZN4 A;  2CN2 A;  4CI2 A;  3DXM C;  3RRM C;  4A2L A;  1UOQ A;  3SMR A;  2VZ3 A;  4H5J A;  3GC3 B;  3RN1 D;  2I0T A;  2O9K A;  2H14 A;  2Z2O A;  2XYI A;  2XL3 A;  2EIC A;  3OW8 A;  2IUQ A;  3MKS B;  1PGU A;  2XL2 A;  2YNP A;  3IUL A;  5I5I A;  4XYH A;  2YBA A;  4A09 A;  1UOO A;  5FXY A;  4J86 A;  2PM7 B;  3K26 A;  2AH1 A;  2PBI B;  3SVW D;  4GM8 A;  4PNK B;  3ZDY A;  5IJ7 E;  3UVL A;  3VI3 A;  1B9X A;  3O4G A;  5I5J A;  4BH6 A;  3N0D A;  4A7J A;  3JRP A;  4J0X A;  3EI2 A;  2Z2P A;  4G55 A;  4BCC A;  3EQ9 A;  4D0K A;  2HU7 A;  4IRZ A;  2I3S A;  5FQD A;  1VYH C;  4I79 A;  2VDP A;  3CFV A;  4WJK A;  1RI6 A;  4X3E A;  3NVX A;  1MDA H;  3F3G A;  4J87 A;  2CO0 C;  2VDM A;  1NR0 A;  4FA9 D;  4NEN A;  2VC2 A;  4A0A B;  2P9I C;  2Q7Q A;  4PBZ A;  3T3P A;  1TYE A;  3JZG A;  3VGZ A;  3IJ0 A;  2H47 A;  4Z8L A;  2JKX A;  4CI1 A;  1P22 A;  4GGA A;  2BBK H;  2GC7 A;  4FHL A;  4CZV A;  5TDH B;  2QR5 A;  3ODT A;  4O9D A;  3RLM D;  4J8G A;  3MVD K;  5EML B;  3RMZ D;  4GQB B;  4BCD A;  3EQ8 A;  2HXC A;  1VE6 A;  3I2N A;  3UVM A;  4L1Q D;  4NBM A;  4BCB A;  1GXR A;  2YMU A;  3OTT A;  2I3T A;  4LG8 A;  3AL9 A;  1JTD B;  2AGZ A;  1UTC A;  3NIF A;  2XZG A;  3C75 H;  3PXW D;  3V4P A;  4A2M A;  5IJ8 E;  4DNU A;  3V7D B;  2G9A A;  2OVP B;  2IAA A;  3QHY B;  5HE2 B;  1GOG A;  4MMZ A;  3E0C A;  4L3G D;  3VH0 A;  4CY1 A;  3EI4 A;  1JMZ B;  3ZE1 A;  2HJB A;  3A0F A;  3NID A;  1VZ2 A;  3P4F A;  5M5V A;  2MTA H;  1QNI A;  3IJ1 A;  3SHF A;  3J81 g;  2H6K A;  5C92 A;  1SQJ A;  1PI6 A;  3NIG A;  4QRJ A;  4JSN C;  5FLX g;  3O4H A;  5C86 A;  3GFC A;  3UVN A;  4YVD A;  4QT8 A;  3EI1 B;  2Z2N A;  4G56 B;  3VI4 A;  2CO0 A;  3JZN A;  4PXW A;  3RFH A;  3HFQ A;  5AJA A;  2B5L A;  5KDO B;  2G99 A;  4L3H D;  5EAR A;  1U8C A;  3V5W B;  2B4E A;  5EMM B;  1Q47 A;  5FKS A;  3DDU A;  2CNX A;  4GGC A;  3I7P A;  2H13 A;  3IKO A;  4GM3 A;  1H2W A;  3EQ7 A;  3KRW B;  3FRX A;  3QI0 A;  1B9Y A;  4N14 A;  2WQ8 A;  4QL1 A;  5CXB B;  5GSA A;  3JAM g;  3K27 A;  3CFS B;  1GOH A;  2AGY A;  2VDN A;  4CI3 A;  3MZL A;  4FA4 D;  3PSC B;  3ZWL B;  4AMZ A;  3GRE A;  4BUJ C;  4JT5 C;  4WK2 A;  4CZX A;  4J84 A;  2H3X A;  2AGL A;  4ERY A;  5CYK B;  4ES0 A;  2B5M A;  3KCI A;  3K71 A;  1N6F A;  4CC9 A;  1O6F A;  4O02 A;  3MMY A;  5EMJ B;  1E8M A;  4AOW A;  3PXT D;  3SN6 B;  5HE0 B;  3F3F A;  3KRX B;  4EWR A;  2EBS A;  4ZOY A;  1U2V C;  2HES X;  1I2M B;  3MKQ A;  4CY2 A;  4ZOV A;  3I8C A;  4J77 A;  4AEZ A;  1T2X A;  5EAP A;  5FKT A;  1C9I A;  4O2W A;  2P9S C;  3O4I A;  3OF7 A;  1JMX B;  5IC7 A;  2P9L C;  5TF2 A;  3MUO A;  2P9P C;  3SJL D;  3ZE2 A;  1SHY B;  2OVR B;  5AFU 3;  4JSV C;  4ZOX A;  4UM9 A;  3EU7 A;  4CI8 A;  3RSE C;  4DNW A;  4O45 A;  3I8E A;  5E6S A;  1E8N A;  5H14 A;  5EM2 B;  5GMK n;  2BKL A;  2P9K C;  3I89 A;  1XHM A;  3PVW B;  1O6G A;  3IJE A;  3OKT A;  1H2Y A;  2GNQ A;  4LG9 A;  3K72 A;  4WK4 A;  4D9S A;  4FWW A;  1A0R B;  3J80 g;  1BPO A;  3PSL A;  2H6Q A;  3IIW A;  2AGW A;  2J57 G;  4JXM A;  3SCY A;  5CYK A;  3VA6 A;  5M5U A;  2OVQ B;  4UI9 R;  4J79 A;  2PM9 B;  2PM6 B;  2J56 H;  4J81 A;  4A08 B;  3I7K A;  3OKW A;  3JB9 L;  2H9N A;  4HDJ A;  3I7N A;  4Y7R A;  4G1M A;  1TBG A;  4RE5 A;  3OL2 B;  1QFS A;  5FFG A;  1PBY B;  1PEV A;  4U1E I;  2H9M A;  4GZ8 A;  3DM0 A;  3CIK B;  4PSW B;  5B4W A;  3K6S A;  4XYI A;  4IA9 A;  4GQ2 P;  2CE8 A;  3PXS D;  4WK0 A;  3B7F A;  3MXX A;  4FAV D;  4R7A B;  3DWL C;  4ERQ A;  2HKM A;  4PBY A;  1YR2 A;  5M5S A;  1XKS A;  2H9P A;  3I7H A;  5EM2 A;  4A0A A;  4X61 B;  3RN0 D;  1A12 A;  2XE4 A;  4ZOZ A;  4XEI C;  4L9O A;  3FCU A;  4H5I A;  1GG2 B;  5IT9 g;  4FB1 D;  3SBR A;  4U7A A;  3I7L A;  2BCJ B;  2AGX A;  2OK6 A;  2QZP A;  4JD2 C;  1N6D A;  3JRO A;  5FKQ A;  3IJC A;  1L5G A;  2VDL A;  3IVM A;  2PM9 A;  1SQ9 A;  4O3T B;  4J82 A;  3UKR C;  4A08 A;  2OK4 A;  4BP9 A;  4X63 B;  4Z7Q A;  4UM8 A;  1OMW B;  4QQE A;  1JJU B;  3ORV D;  3N0E A;  3NVQ A;  1JV2 A;  4NC4 A;  1QFM A;  3JPX A;  4ERZ A;  3RFG A;  3OL2 A;  5FKR A;  5HE3 B;  1L0Q A;  1E5T A;  1JOF A;  4BL0 A;  4E5Z B;  2H68 A;  1VZ3 A;  2VZ1 A;  2UZY B;  4IMM A;  4QAM A;  2XDW A;  3MUN A;  3IUN A;  4CY5 A;  1OLZ A;  3BG0 A;  5SXM A;  4JT6 C;  4DNV A;  3EI1 A;  3L4O D;  5EAM A;  5CXC B;  3OKY B;  1GP2 B;  4MK0 B;  3IUJ A;  5JWZ A;  4K3I D;  5HYN B;  4A0B B;  2CN3 A;  4AN1 A;  5E6R A;  5GXH A;  3AH8 B;  1R5M A;  3PVU B;  4CY3 A;  2OJY A;  5K1C C;  4D6V A;  5HQG A;  4ESG A;  1TYQ C;  4J0W A;  3ULE C;  2J55 H;  3SWS D;  3UKU C;  3I7O A;  1H2X A;  3O4J A;  5H1M A;  5K19 A;  1GOF A;  5CXB A;  2QXV A;  4JHN A;  3ZDX A;  3SBQ A;  3FCS A;  4KFM B;  2H9L A;  5H17 A;  5HE1 B;  4J78 A;  2HKR A;  3JZH A;  4FA1 D;  2W18 A;  3ZDZ A;  3EI4 B;  5IGQ A;  4AN0 A;  3SFZ A;  4E54 B;  4NAA A;  4O1Q D;  4TZ4 A;  1NEX B;  5GXI A;  5M5T A;  3V9F A;  3UR4 A;  3DSM A;  3V4V A;  1U4C A;  4E5Z A;  4J8B A;  2H6N A;  3IIY A;  3UVK A;  3F3P A;  4JSX C;  2IUR A;  3AL8 B;  4BP8 A;  3L4M D;  2HU8 A;  4MMX A;  5EAL A;  3EI3 B;  4O3U B;  2HJ4 A;  2YB8 B;  4AMY A;  3U4Y A;  5CXC A;  3OKY A;  5EMK B;  5C2V B;  5C9Z B;  1YFQ A;  2EID A;  3C99 A;  4X60 B;  5C2W B;  3IUQ A;  2OIZ A;  5M61 A;  4JSP C;  2IUP A;  4LGN A;  4A11 B;  2HU5 A;  4A0B A;  3PE7 A;  5M5R A;  4OWR A;  1K3I A;  4J73 A;  3BWS A;  3FM0 A;  1K32 A;  5TEF A;  3SBP A;  4Z7N A;  4GQ1 A;  1GOT B;  4MMY A;  2IUV A;  4G1E A;  1ERJ A;  5IGO A;  3EWE A;  3MZK A;  3C5M A;  2AQ5 A;  2EIE A;  4NSX A;  4GM9 A;  3AFC A;  4FA5 D;  3NVN A;  3DXK C;  2CE9 A;  5HDB A;  4RE6 A;  4E54 A;  2IWK A;  1S4U X;  4PC0 A;  2VDK A;  2TRC B;  4Y5R D;  2IWF A;  3FGB A;  5FA5 B;  2B5N A;  4K3J B;  4A09 B;  2XU7 A;  2GC4 A;  1VE7 A;  4OZU A;  1M1X A;  4CZY A;  2UZX B;  1XIP A;  3T3M A;  3AL8 A;  2VDQ A;  4FAN D;  3EI3 A;  1H2Z A;  3W15 A;  2P9U C;  3EI2 B;  5A2Q g;  1C9L A;  2QC5 A;  1MG3 A;  2YNO A;  4GMB A;  1MG2 A;  2I0S A;  4Z7O A; 
#chains in the Genus database with same CATH homology
 5TEE A;  2AH0 A;  5I5M A;  4GGD A;  4PSX B;  4A11 A;  1N6E A;  2P9N C;  2I0R A;  3EMH A;  5AMS A;  2HYE A;  1K8K C;  3SLE D;  3EG6 A;  5THA A;  1FWX A;  3BG1 A;  3C9C A;  2YNN A;  3UVO A;  3SXT D;  4ZN4 A;  2CN2 A;  4CI2 A;  3DXM C;  3RRM C;  4A2L A;  3SMR A;  4H5J A;  3RN1 D;  2I0T A;  2O9K A;  2H14 A;  2Z2O A;  2XYI A;  2XL3 A;  3OW8 A;  2IUQ A;  3MKS B;  1PGU A;  2XL2 A;  2YNP A;  5I5I A;  4XYH A;  2YBA A;  4A09 A;  5FXY A;  4J86 A;  2PM7 B;  3K26 A;  2AH1 A;  2PBI B;  3SVW D;  4GM8 A;  4PNK B;  5IJ7 E;  3UVL A;  1B9X A;  5I5J A;  4BH6 A;  3N0D A;  4A7J A;  3JRP A;  4J0X A;  3EI2 A;  2Z2P A;  4D0K A;  2I3S A;  5FQD A;  1VYH C;  4I79 A;  3CFV A;  1RI6 A;  4X3E A;  3NVX A;  1MDA H;  3F3G A;  4J87 A;  2CO0 C;  1NR0 A;  4FA9 D;  4A0A B;  2P9I C;  2Q7Q A;  4PBZ A;  3JZG A;  3VGZ A;  3IJ0 A;  2H47 A;  4Z8L A;  4CI1 A;  1P22 A;  4GGA A;  2BBK H;  2GC7 A;  4FHL A;  4CZV A;  5TDH B;  3ODT A;  4O9D A;  3RLM D;  4J8G A;  5EML B;  3RMZ D;  4GQB B;  2HXC A;  3I2N A;  3UVM A;  4L1Q D;  1GXR A;  2YMU A;  3OTT A;  2I3T A;  4LG8 A;  3AL9 A;  2AGZ A;  3C75 H;  3PXW D;  4A2M A;  5IJ8 E;  3V7D B;  2G9A A;  2OVP B;  2IAA A;  5HE2 B;  3E0C A;  4L3G D;  3VH0 A;  4CY1 A;  3EI4 A;  1JMZ B;  2HJB A;  3A0F A;  3P4F A;  2MTA H;  1QNI A;  3IJ1 A;  3SHF A;  3J81 g;  2H6K A;  1SQJ A;  1PI6 A;  4QRJ A;  4JSN C;  5FLX g;  3GFC A;  3UVN A;  4YVD A;  4QT8 A;  3EI1 B;  2Z2N A;  4G56 B;  2CO0 A;  3JZN A;  4PXW A;  3RFH A;  3HFQ A;  5AJA A;  2B5L A;  5KDO B;  2G99 A;  4L3H D;  5EAR A;  3V5W B;  2B4E A;  5EMM B;  1Q47 A;  5FKS A;  2CNX A;  4GGC A;  3I7P A;  2H13 A;  3IKO A;  4GM3 A;  3KRW B;  3FRX A;  4N14 A;  1B9Y A;  4QL1 A;  5CXB B;  5GSA A;  3JAM g;  3K27 A;  3CFS B;  2AGY A;  4CI3 A;  3MZL A;  4FA4 D;  3PSC B;  3ZWL B;  3GRE A;  4BUJ C;  4JT5 C;  4CZX A;  4J84 A;  2H3X A;  2AGL A;  4ERY A;  5CYK B;  4ES0 A;  2B5M A;  1N6F A;  4CC9 A;  3MMY A;  5EMJ B;  4AOW A;  3PXT D;  3SN6 B;  5HE0 B;  3F3F A;  3KRX B;  4EWR A;  2EBS A;  4ZOY A;  1U2V C;  2HES X;  3MKQ A;  4CY2 A;  4ZOV A;  3I8C A;  4J77 A;  4AEZ A;  5EAP A;  5FKT A;  2P9S C;  1JMX B;  5IC7 A;  2P9L C;  5TF2 A;  2P9P C;  3SJL D;  1SHY B;  2OVR B;  5AFU 3;  4JSV C;  4ZOX A;  3EU7 A;  4CI8 A;  3RSE C;  4O45 A;  3I8E A;  5H14 A;  5EM2 B;  5GMK n;  2P9K C;  3I89 A;  1XHM A;  3PVW B;  3OKT A;  2GNQ A;  4LG9 A;  4FWW A;  1A0R B;  3J80 g;  3PSL A;  2H6Q A;  3IIW A;  2AGW A;  4JXM A;  2J57 G;  3SCY A;  5CYK A;  3VA6 A;  2OVQ B;  4UI9 R;  4J79 A;  2PM9 B;  2PM6 B;  2J56 H;  4J81 A;  4A08 B;  3I7K A;  3OKW A;  3JB9 L;  2H9N A;  4HDJ A;  3I7N A;  4Y7R A;  1TBG A;  3OL2 B;  1PBY B;  1PEV A;  4U1E I;  2H9M A;  4GZ8 A;  3DM0 A;  3CIK B;  4PSW B;  5B4W A;  4XYI A;  4IA9 A;  4GQ2 P;  2CE8 A;  3PXS D;  3B7F A;  3MXX A;  4FAV D;  4R7A B;  3DWL C;  4ERQ A;  2HKM A;  4PBY A;  1XKS A;  2H9P A;  3I7H A;  5EM2 A;  4A0A A;  4X61 B;  3RN0 D;  4ZOZ A;  4XEI C;  4L9O A;  4H5I A;  1GG2 B;  5IT9 g;  4FB1 D;  3SBR A;  4U7A A;  3I7L A;  2BCJ B;  2AGX A;  2OK6 A;  4JD2 C;  1N6D A;  3JRO A;  5FKQ A;  3IJC A;  2PM9 A;  1SQ9 A;  4O3T B;  4J82 A;  3UKR C;  4A08 A;  2OK4 A;  4X63 B;  1OMW B;  4QQE A;  1JJU B;  3ORV D;  3N0E A;  3NVQ A;  3JPX A;  4ERZ A;  3RFG A;  3OL2 A;  5FKR A;  5HE3 B;  1L0Q A;  1JOF A;  4BL0 A;  4E5Z B;  2H68 A;  2UZY B;  4IMM A;  4CY5 A;  1OLZ A;  3BG0 A;  5SXM A;  4JT6 C;  3EI1 A;  3L4O D;  5EAM A;  5CXC B;  3OKY B;  1GP2 B;  4MK0 B;  5JWZ A;  4K3I D;  5HYN B;  4A0B B;  2CN3 A;  5GXH A;  3AH8 B;  1R5M A;  3PVU B;  4CY3 A;  2OJY A;  5K1C C;  4D6V A;  5HQG A;  4ESG A;  1TYQ C;  4J0W A;  3ULE C;  2J55 H;  3SWS D;  3UKU C;  3I7O A;  5H1M A;  5K19 A;  5CXB A;  2QXV A;  3SBQ A;  4KFM B;  2H9L A;  5H17 A;  5HE1 B;  4J78 A;  2HKR A;  3JZH A;  4FA1 D;  2W18 A;  5IGQ A;  3EI4 B;  3SFZ A;  4E54 B;  4O1Q D;  4TZ4 A;  1NEX B;  5GXI A;  3V9F A;  3UR4 A;  3DSM A;  1U4C A;  4E5Z A;  4J8B A;  2H6N A;  3IIY A;  3UVK A;  3F3P A;  4JSX C;  2IUR A;  3AL8 B;  3L4M D;  5EAL A;  3EI3 B;  4O3U B;  2HJ4 A;  2YB8 B;  3U4Y A;  5CXC A;  3OKY A;  5EMK B;  5C2V B;  5C9Z B;  1YFQ A;  3C99 A;  4X60 B;  5C2W B;  2OIZ A;  4JSP C;  2IUP A;  4LGN A;  4A11 B;  4A0B A;  3PE7 A;  4OWR A;  4J73 A;  3BWS A;  3FM0 A;  1K32 A;  5TEF A;  3SBP A;  4GQ1 A;  1GOT B;  2IUV A;  1ERJ A;  5IGO A;  3EWE A;  3MZK A;  3C5M A;  2AQ5 A;  4NSX A;  4GM9 A;  3AFC A;  4FA5 D;  3NVN A;  3DXK C;  2CE9 A;  4E54 A;  2IWK A;  1S4U X;  4PC0 A;  2TRC B;  4Y5R D;  2IWF A;  3FGB A;  5FA5 B;  2B5N A;  4K3J B;  4A09 B;  2XU7 A;  2GC4 A;  4OZU A;  4CZY A;  2UZX B;  1XIP A;  3AL8 A;  4FAN D;  3EI3 A;  3W15 A;  2P9U C;  3EI2 B;  5A2Q g;  2QC5 A;  1MG3 A;  2YNO A;  4GMB A;  1MG2 A;  2I0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...