2PBIB

The multifunctional nature of gbeta5/rgs9 revealed from its crystal structure
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
345
structure length
345
Chain Sequence
NETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Regulator of G-protein signaling 9
publication title Crystal structure of the multifunctional Gbeta5-RGS9 complex.
pubmed doi rcsb
source organism Mus musculus
total genus 115
structure length 345
sequence length 345
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2pbiB00
4BUJC 3NVXA 3SXTD 2H6KA 4X63B 4A0BB 3I7OA 1QNIA 2Z2PA 4A7JA 5EMMB 3EU7A 1ERJA 3SVWD 5C2WB 5FKRA 1TYQC 4J78A 4O45A 5FQDA 5TDHB 3I89A 3DWLC 3DSMA 4IMMA 5C9ZB 3IIWA 2CNXA 2H9NA 5KDOB 4J73A 4G56B 3JAMg 2UZXB 4PC0A 4CY1A 2HYEA 4J84A 2BBKH 2AGWA 3SBRA 2YNNA 2H6QA 2OVPB 3SWSD 5HE3B 3AH8B 2IAAA 4XYIA 1U4CA 5CXCB 2IWKA 3DXKC 3PXWD 5GXIA 4GZ8A 4JSNC 4L1QD 1GG2B 4J82A 3UVNA 2P9PC 3UVOA 4O9DA 4ZOVA 2IWFA 4X60B 3VH0A 4J81A 2PM7B 5I5JA 1L0QA 3K26A 5FKTA 2BCJB 4L3GD 5HQGA 3EI1B 4J86A 4JSXC 4NSXA 5CXBB 3L4MD 3SN6B 3U4YA 2OK6A 3MZKA 3JZGA 4GGCA 4X3EA 3DM0A 5EMJB 3IJ1A 5H17A 2PBIB 3IKOA 5B4WA 3K27A 4J0XA 4O3TB 5K19A 5IGOA 3EI2A 5HE1B 1B9XA 2AGLA 4FHLA 3B7FA 3VGZA 3JPXA 3PE7A 4CZVA 4LG9A 4ZOXA 4A0AA 3ORVD 4QQEA 2HKRA 3HFQA 5GXHA 1MG3A 1NR0A 3UKUC 4JD2C 4TZ4A 1MDAH 2Z2OA 3RFGA 3PVWB 5GSAA 5GMKn 3C5MA 3MKSB 3MMYA 1XIPA 3I2NA 1Q47A 3I8EA 4CY2A 4PSXB 3OKYA 1XKSA 2CE8A 3SCYA 3SJLD 4CI3A 1R5MA 4BL0A 2H3XA 2HJBA 3MKQA 2B4EA 4J8GA 4FAND 4U1EI 3EI2B 3VA6A 2P9NC 4QL1A 3J80g 4EWRA 2AQ5A 2CN3A 5CYKA 5EM2A 3C9CA 5FKQA 3C75H 3J81g 4A0AB 2OVRB 3AFCA 4ESGA 3OL2A 4GQ2P 2J57G 3EI3A 2H47A 1P22A 5HYNB 4PXWA 2AGYA 4AEZA 2YBAA 4CI1A 5FKSA 5TF2A 3I7KA 1RI6A 1B9YA 1N6EA 1SHYB 4LGNA 1PEVA 3JRPA 3SFZA 5C2VB 2XL3A 4U7AA 1N6DA 3I7NA 1S4UX 3C99A 1SQJA 4GQBB 1K8KC 2Z2NA 5FXYA 4CI2A 4CZXA 1JJUB 2OJYA 4ZOYA 3JZNA 4CZYA 4ES0A 3N0DA 1GOTB 2I0RA 4GQ1A 1N6FA 4H5JA 5CYKB 4XEIC 1TBGA 2HJ4A 2MTAH 2J55H 3EWEA 4Y7RA 3OL2B 3PXSD 4PNKB 2H9PA 4FA4D 3FRXA 2PM9A 2QXVA 3W15A 2G9AA 3MXXA 4FA9D 2IURA 4A2LA 1OMWB 2EBSA 3RLMD 2OVQB 2XU7A 4CC9A 5EARA 3I7PA 2B5NA 3I7HA 1PBYB 4A2MA 3PVUB 3SBQA 3NVQA 5IT9g 4O1QD 2P9LC 5H1MA 3IIYA 2H9LA 5FA5B 1SQ9A 2PM6B 4K3ID 1NEXB 2W18A 1OLZA 3PSCB 4CY5A 2Q7QA 3I7LA 4L3HD 5H14A 3OTTA 3ZWLB 2XYIA 3GREA 2H14A 3EG6A 4AOWA 3N0EA 3CFSB 5K1CC 3UVKA 3JROA 2H9MA 5EMKB 4A0BA 1K32A 4ZOZA 2YMUA 3BG1A 2CO0A 3MZLA 2AH0A 4J79A 4JSVC 1VYHC 4FA5D 4QRJA 3UR4A 3UVLA 3AL8A 4E5ZA 2YB8B 4GM9A 4IA9A 4I79A 4A08A 3RRMC 5HE0B 3PXTD 4ERYA 2HKMA 4HDJA 1PGUA 3FM0A 4OZUA 5IC7A 4JT6C 5AMSA 4O3UB 3OKWA 3PSLA 1GXRA 4Y5RD 4ERZA 2TRCB 4QT8A 4H5IA 2O9KA 2UZYB 5CXCA 4L9OA 2IUPA 4PBZA 3UKRC 4A09A 1MG2A 3OKTA 2H13A 2XL2A 2B5LA 4PBYA 4J87A 3OKYB 5I5IA 3DXMC 3KRWB 3GFCA 2OK4A 3F3PA 2QC5A 3AL8B 4CI8A 2I0TA 4E5ZB 3V5WB 4D0KA 3F3GA 3L4OD 3E0CA 5IJ7E 3EI1A 4OWRA 3EI4A 4A08B 2J56H 3CIKB 4GM8A 5CXBA 3EMHA 5SXMA 4D6VA 4J77A 2I3TA 5AJAA 5EM2B 2OIZA 4ZN4A 3BWSA 4J8BA 1FWXA 4FWWA 4X61B 3JB9L 2P9SC 3EI3B 2GNQA 3OW8A 4XYHA 3SBPA 1JMXB 4LG8A 1XHMA 4A09B 2CE9A 2H68A 1U2VC 3V7DB 2HXCA 3NVNA 4GGAA 4JXMA 2IUVA 4YVDA 3ODTA 1PI6A 4A11A 4FAVD 3IJCA 4FB1D 3BG0A 4GMBA 1JMZB 3AL9A 4R7AB 5HE2B 4MK0B 3SHFA 3EI4B 4CY3A 3A0FA 4KFMB 5FLXg 3SMRA 3RFHA 5EAPA 3RSEC 5AFU3 3KRXB 4E54A 5IGQA 4JT5C 3JZHA 5I5MA 2G99A 2YNOA 2CN2A 2PM9B 2P9IC 2AGZA 2HESX 3V9FA 3I8CA 2P9KC 5EAMA 3RN1D 2I0SA 3IJ0A 4JSPC 4ERQA 3FGBA 5JWZA 5IJ8E 3F3FA 5EMLB 2I3SA 3CFVA 2AH1A 4A11B 2AGXA 4Z8LA 1JOFA 2GC7A 2IUQA 3SLED 1YFQA 5TEFA 4K3JB 1A0RB 2H6NA 2P9UC 2B5MA 5TEEA 2GC4A 4UI9R 5EALA 4BH6A 3UVMA 4E54B 4FA1D 3ULEC 2CO0C 3RMZD 4J0WA 5A2Qg 3P4FA 4N14A 4GM3A 3RN0D 4PSWB 2YNPA 4GGDA 5THAA 1GP2B
chains in the Genus database with same CATH superfamily
4BUJC 3NVXA 3SXTD 3VI4A 2H6KA 4X63B 4A0BB 3I7OA 1QNIA 2Z2PA 4A7JA 5EMMB 3EU7A 1ERJA 3SVWD 1QFMA 5C2WB 4BCDA 5FKRA 4BP9A 1TYQC 4J78A 4O45A 5FQDA 5TDHB 3EQ9A 3I89A 3DWLC 3NIFA 3DSMA 4IMMA 5C9ZB 3IIWA 2CNXA 2H9NA 2EICA 5KDOB 4J73A 3MUNA 4G56B 3JAMg 2UZXB 4PC0A 4CY1A 2HYEA 4J84A 2BBKH 1O6GA 2AGWA 3SBRA 2YNNA 2WQ8A 2H6QA 3IUJA 2OVPB 4MMYA 5FFOA 3SWSD 5E6RA 5HE3B 3IUMA 3AH8B 2IAAA 3QHYB 4XYIA 1U4CA 5CXCB 3V4PA 2IWKA 3DXKC 3PXWD 5GXIA 1U8CA 2HU8A 3GD1I 4NAAA 2QR5A 2EIEA 4GZ8A 3MVDK 5E6UA 4JSNC 3ZDZA 4L1QD 1GG2B 4J82A 3UVNA 2P9PC 2VDMA 3UVOA 4O9DA 4ZOVA 2IWFA 1UTCA 4O2WA 4X60B 3VH0A 4J81A 2PM7B 5I5JA 1L0QA 3K26A 4AMZA 5FKTA 2BCJB 4L3GD 5HQGA 4BCBA 3EI1B 1M1XA 1VZ2A 4J86A 4JSXC 4NSXA 5CXBB 3L4MD 4IRZA 3SN6B 3U4YA 2OK6A 3MZKA 3JZGA 4GGCA 4X3EA 1VE7A 3DM0A 5M5SA 5EMJB 3IJ1A 1YR2A 5H17A 2VC2A 1H2ZA 2PBIB 3IKOA 4NENA 2XDWA 3ZDXA 5B4WA 3K27A 4J0XA 4O3TB 4WJKA 1UOQA 5K19A 5IGOA 3EI2A 3O4IA 5HE1B 1B9XA 2AGLA 4FHLA 3B7FA 3VGZA 3IVMA 3JPXA 3PE7A 4CZVA 2VZ1A 5C86A 4LG9A 1GOGA 4D9SA 4RE6A 4ZOXA 4A0AA 3ORVD 4QQEA 2HKRA 3HFQA 5GXHA 1MG3A 1NR0A 3UKUC 4JD2C 4TZ4A 1MDAH 2Z2OA 3RFGA 3PVWB 5GSAA 5GMKn 3C5MA 3MKSB 3MMYA 1XIPA 1GOHA 1JTDB 3I2NA 1Q47A 3I8EA 5M5UA 4CY2A 4PSXB 3OKYA 1XKSA 2CE8A 3SCYA 3SJLD 4CI3A 1R5MA 4BL0A 2H3XA 4MMXA 1O6FA 2HJBA 3MKQA 3QI0A 4Z7NA 2B4EA 4QAMA 5HDBA 4J8GA 4FAND 1L5GA 4U1EI 2JKXA 3EI2B 2EIDA 3VA6A 2P9NC 4QL1A 3J80g 3KCIA 4EWRA 2AQ5A 4O02A 2CN3A 2VDOA 5CYKA 5EM2A 3C9CA 4Z7OA 4L1MA 3FCSA 5FKQA 3C75H 3J81g 3O4JA 4A0AB 2OVRB 3AFCA 4ESGA 3IUNA 3O4HA 3OL2A 2J57G 4GQ2P 3EI3A 2HU7A 2H47A 1P22A 5HYNB 4PXWA 2AGYA 4AEZA 2YBAA 4CI1A 5FKSA 5TF2A 3I7KA 1RI6A 1B9YA 1N6EA 1SHYB 4LGNA 1PEVA 3JRPA 3SFZA 4AN1A 5C2VB 1UOOA 2XL3A 4U7AA 1H2YA 4WK2A 3GC3B 5M5TA 1N6DA 3I7NA 1S4UX 3C99A 1SQJA 4GQBB 1K8KC 2Z2NA 1H2WA 2VDQA 5FXYA 4CI2A 4CZXA 1JJUB 1VE6A 2OJYA 4ZOYA 4DNUA 3JZNA 4CZYA 4ES0A 3N0DA 1GOTB 1A12A 2I0RA 4GQ1A 1N6FA 4H5JA 5CYKB 4XEIC 1TBGA 2HJ4A 2MTAH 2J55H 3OF7A 3EWEA 4Y7RA 3OL2B 3PXSD 4PNKB 2H9PA 4FA4D 3FRXA 2PM9A 2QXVA 2XE4A 4G1EA 3W15A 2G9AA 3MXXA 4FA9D 4Z7QA 2IURA 4A2LA 1OMWB 2EBSA 3ZE1A 3RLMD 2OVQB 2XU7A 4CC9A 5EARA 3I7PA 2B5NA 3IULA 1H2XA 3EQ7A 3I7HA 1PBYB 2XZGA 3T3MA 4A2MA 3PVUB 3SBQA 3NVQA 5IT9g 3ZE0A 3NIDA 4O1QD 2P9LC 5H1MA 3IIYA 2H9LA 5FA5B 1C9IA 1SQ9A 2PM6B 3EQ8A 4K3ID 1NEXB 2W18A 1OLZA 3PSCB 4CY5A 4MMZA 3IJEA 2Q7QA 3I7LA 3IURA 4L3HD 1E8NA 5H14A 3OTTA 3ZWLB 2XYIA 3MUOA 4BCCA 3GREA 1TYEA 3ZE2A 2H14A 3EG6A 4AOWA 3N0EA 3CFSB 4WK4A 5K1CC 3UVKA 3JROA 2VDRA 2H9MA 4AN0A 1E5TA 5EMKB 4A0BA 1K32A 4ZOZA 2YMUA 3BG1A 2CO0A 3MZLA 2AH0A 4J79A 2VDKA 4JSVC 3K71A 3FCUA 1VYHC 4FA5D 5E6SA 4QRJA 3UR4A 3UVLA 3AL8A 4BP8A 4E5ZA 2YB8B 4DNWA 4GM9A 4IA9A 5M61A 4I79A 4A08A 3RRMC 5HE0B 2VDLA 3PXTD 4ERYA 2HKMA 4HDJA 1PGUA 3FM0A 4OZUA 5IC7A 4JT6C 5AMSA 2VDNA 4O3UB 1QFSA 3OKWA 3PSLA 1GXRA 4Y5RD 4ERZA 2TRCB 4QT8A 4H5IA 2O9KA 3K72A 2UZYB 5CXCA 4L9OA 2IUPA 4PBZA 3UKRC 5FFGA 4A09A 1MG2A 3OKTA 2H13A 2XL2A 2B5LA 4PBYA 4J87A 3OKYB 4RE5A 5I5IA 3DXMC 5M5RA 3KRWB 3GFCA 2OK4A 3F3PA 2QC5A 3AL8B 4CI8A 2I0TA 4E5ZB 3V5WB 4D0KA 3F3GA 3L4OD 3E0CA 5IJ7E 3EI1A 4OWRA 3EI4A 1I2MB 4A08B 2J56H 3CIKB 3O4GA 4GM8A 4NC4A 5CXBA 3EMHA 5SXMA 4D6VA 3ZDYA 4J77A 2I3TA 5AJAA 5EM2B 2OIZA 4JHNA 5C92A 4ZN4A 3BWSA 4J8BA 1FWXA 4FWWA 4X61B 3JB9L 2EIBA 2P9SC 3EI3B 2QZPA 2GNQA 3OW8A 4XYHA 4AX4A 3SBPA 1JMXB 4LG8A 3DDUA 1XHMA 4A09B 2HU5A 2CE9A 5M5VA 2H68A 1U2VC 1GOFA 3V7DB 2HXCA 3NVNA 4GGAA 1UOPA 4JXMA 2IUVA 4YVDA 3ODTA 1PI6A 4A11A 4FAVD 4G55A 1BPOA 3IJCA 4FB1D 3BG0A 4GMBA 1JMZB 3AL9A 4R7AB 5HE2B 4MK0B 3SHFA 3EI4B 4CY3A 3A0FA 4KFMB 5FLXg 1K3IA 2VDPA 4AMYA 3SMRA 4DNVA 3RFHA 1C9LA 5EAPA 3RSEC 5AFU3 3KRXB 1T2XA 3V4VA 3K6SA 4E54A 5IGQA 4JT5C 4UM8A 3JZHA 5I5MA 2G99A 2YNOA 4G1MA 3T3PA 2CN2A 2PM9B 2P9IC 2AGZA 2HESX 3V9FA 3I8CA 2P9KC 5EAMA 1VZ3A 2VZ3A 3RN1D 2I0SA 3IJ0A 4JSPC 4ERQA 3FGBA 5JWZA 5IJ8E 3F3FA 5EMLB 2I3SA 3CFVA 2AH1A 4A11B 2AGXA 4Z8LA 1JOFA 2GC7A 2IUQA 3SLED 1YFQA 5TEFA 4JHPC 4K3JB 1A0RB 2H6NA 2P9UC 2B5MA 5TEEA 2GC4A 1JV2A 2BKLA 4UI9R 5EALA 4BH6A 4WK0A 3UVMA 3IUQA 4E54B 4FA1D 3ULEC 2CO0C 3RMZD 4J0WA 5A2Qg 3P4FA 4N14A 4GM3A 3RN0D 4NBMA 3NIGA 3VI3A 4PSWB 4UM9A 1E8MA 2YNPA 4GGDA 5THAA 1GP2B
chains in the Genus database with same CATH topology
4BUJC 3NVXA 3SXTD 2H6KA 4X63B 4A0BB 3I7OA 1QNIA 2Z2PA 4A7JA 5EMMB 3EU7A 1ERJA 3SVWD 5C2WB 5FKRA 1TYQC 4J78A 4O45A 5FQDA 5TDHB 3I89A 3DWLC 3DSMA 4IMMA 5C9ZB 3IIWA 2CNXA 2H9NA 5KDOB 4J73A 4G56B 3JAMg 2UZXB 4PC0A 4CY1A 2HYEA 4J84A 2BBKH 2AGWA 3SBRA 2YNNA 2H6QA 2OVPB 3SWSD 5HE3B 3AH8B 2IAAA 4XYIA 1U4CA 5CXCB 2IWKA 3DXKC 3PXWD 5GXIA 4GZ8A 4JSNC 4L1QD 1GG2B 4J82A 3UVNA 2P9PC 3UVOA 4O9DA 4ZOVA 2IWFA 4X60B 3VH0A 4J81A 2PM7B 5I5JA 1L0QA 3K26A 5FKTA 2BCJB 4L3GD 5HQGA 3EI1B 4J86A 4JSXC 4NSXA 5CXBB 3L4MD 3SN6B 3U4YA 2OK6A 3MZKA 3JZGA 4GGCA 4X3EA 3DM0A 5EMJB 3IJ1A 5H17A 2PBIB 3IKOA 5B4WA 3K27A 4J0XA 4O3TB 5K19A 5IGOA 3EI2A 5HE1B 1B9XA 2AGLA 4FHLA 3B7FA 3VGZA 3JPXA 3PE7A 4CZVA 4LG9A 4ZOXA 4A0AA 3ORVD 4QQEA 2HKRA 3HFQA 5GXHA 1MG3A 1NR0A 3UKUC 4JD2C 4TZ4A 1MDAH 2Z2OA 3RFGA 3PVWB 5GSAA 5GMKn 3C5MA 3MKSB 3MMYA 1XIPA 3I2NA 1Q47A 3I8EA 4CY2A 4PSXB 3OKYA 1XKSA 2CE8A 3SCYA 3SJLD 4CI3A 1R5MA 4BL0A 2H3XA 2HJBA 3MKQA 2B4EA 4J8GA 4FAND 4U1EI 3EI2B 3VA6A 2P9NC 4QL1A 3J80g 4EWRA 2AQ5A 2CN3A 5CYKA 5EM2A 3C9CA 5FKQA 3C75H 3J81g 4A0AB 2OVRB 3AFCA 4ESGA 3OL2A 4GQ2P 2J57G 3EI3A 2H47A 1P22A 5HYNB 4PXWA 2AGYA 4AEZA 2YBAA 4CI1A 5FKSA 5TF2A 3I7KA 1RI6A 1B9YA 1N6EA 1SHYB 4LGNA 1PEVA 3JRPA 3SFZA 5C2VB 2XL3A 4U7AA 1N6DA 3I7NA 1S4UX 3C99A 1SQJA 4GQBB 1K8KC 2Z2NA 5FXYA 4CI2A 4CZXA 1JJUB 2OJYA 4ZOYA 3JZNA 4CZYA 4ES0A 3N0DA 1GOTB 2I0RA 4GQ1A 1N6FA 4H5JA 5CYKB 4XEIC 1TBGA 2HJ4A 2MTAH 2J55H 3EWEA 4Y7RA 3OL2B 3PXSD 4PNKB 2H9PA 4FA4D 3FRXA 2PM9A 2QXVA 3W15A 2G9AA 3MXXA 4FA9D 2IURA 4A2LA 1OMWB 2EBSA 3RLMD 2OVQB 2XU7A 4CC9A 5EARA 3I7PA 2B5NA 3I7HA 1PBYB 4A2MA 3PVUB 3SBQA 3NVQA 5IT9g 4O1QD 2P9LC 5H1MA 3IIYA 2H9LA 5FA5B 1SQ9A 2PM6B 4K3ID 1NEXB 2W18A 1OLZA 3PSCB 4CY5A 2Q7QA 3I7LA 4L3HD 5H14A 3OTTA 3ZWLB 2XYIA 3GREA 2H14A 3EG6A 4AOWA 3N0EA 3CFSB 5K1CC 3UVKA 3JROA 2H9MA 5EMKB 4A0BA 1K32A 4ZOZA 2YMUA 3BG1A 2CO0A 3MZLA 2AH0A 4J79A 4JSVC 1VYHC 4FA5D 4QRJA 3UR4A 3UVLA 3AL8A 4E5ZA 2YB8B 4GM9A 4IA9A 4I79A 4A08A 3RRMC 5HE0B 3PXTD 4ERYA 2HKMA 4HDJA 1PGUA 3FM0A 4OZUA 5IC7A 4JT6C 5AMSA 4O3UB 3OKWA 3PSLA 1GXRA 4Y5RD 4ERZA 2TRCB 4QT8A 4H5IA 2O9KA 2UZYB 5CXCA 4L9OA 2IUPA 4PBZA 3UKRC 4A09A 1MG2A 3OKTA 2H13A 2XL2A 2B5LA 4PBYA 4J87A 3OKYB 5I5IA 3DXMC 3KRWB 3GFCA 2OK4A 3F3PA 2QC5A 3AL8B 4CI8A 2I0TA 4E5ZB 3V5WB 4D0KA 3F3GA 3L4OD 3E0CA 5IJ7E 3EI1A 4OWRA 3EI4A 4A08B 2J56H 3CIKB 4GM8A 5CXBA 3EMHA 5SXMA 4D6VA 4J77A 2I3TA 5AJAA 5EM2B 2OIZA 4ZN4A 3BWSA 4J8BA 1FWXA 4FWWA 4X61B 3JB9L 2P9SC 3EI3B 2GNQA 3OW8A 4XYHA 3SBPA 1JMXB 4LG8A 1XHMA 4A09B 2CE9A 2H68A 1U2VC 3V7DB 2HXCA 3NVNA 4GGAA 4JXMA 2IUVA 4YVDA 3ODTA 1PI6A 4A11A 4FAVD 3IJCA 4FB1D 3BG0A 4GMBA 1JMZB 3AL9A 4R7AB 5HE2B 4MK0B 3SHFA 3EI4B 4CY3A 3A0FA 4KFMB 5FLXg 3SMRA 3RFHA 5EAPA 3RSEC 5AFU3 3KRXB 4E54A 5IGQA 4JT5C 3JZHA 5I5MA 2G99A 2YNOA 2CN2A 2PM9B 2P9IC 2AGZA 2HESX 3V9FA 3I8CA 2P9KC 5EAMA 3RN1D 2I0SA 3IJ0A 4JSPC 4ERQA 3FGBA 5JWZA 5IJ8E 3F3FA 5EMLB 2I3SA 3CFVA 2AH1A 4A11B 2AGXA 4Z8LA 1JOFA 2GC7A 2IUQA 3SLED 1YFQA 5TEFA 4K3JB 1A0RB 2H6NA 2P9UC 2B5MA 5TEEA 2GC4A 4UI9R 5EALA 4BH6A 3UVMA 4E54B 4FA1D 3ULEC 2CO0C 3RMZD 4J0WA 5A2Qg 3P4FA 4N14A 4GM3A 3RN0D 4PSWB 2YNPA 4GGDA 5THAA 1GP2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUJ C;  3NVX A;  3SXT D;  2H6K A;  4X63 B;  4A0B B;  3I7O A;  1QNI A;  2Z2P A;  4A7J A;  5EMM B;  3EU7 A;  1ERJ A;  3SVW D;  5C2W B;  5FKR A;  1TYQ C;  4J78 A;  4O45 A;  5FQD A;  5TDH B;  3I89 A;  3DWL C;  3DSM A;  4IMM A;  5C9Z B;  3IIW A;  2CNX A;  2H9N A;  5KDO B;  4J73 A;  4G56 B;  3JAM g;  2UZX B;  4PC0 A;  4CY1 A;  2HYE A;  4J84 A;  2BBK H;  2AGW A;  3SBR A;  2YNN A;  2H6Q A;  2OVP B;  3SWS D;  5HE3 B;  3AH8 B;  2IAA A;  4XYI A;  1U4C A;  5CXC B;  2IWK A;  3DXK C;  3PXW D;  5GXI A;  4GZ8 A;  4JSN C;  4L1Q D;  1GG2 B;  4J82 A;  3UVN A;  2P9P C;  3UVO A;  4O9D A;  4ZOV A;  2IWF A;  4X60 B;  3VH0 A;  4J81 A;  2PM7 B;  5I5J A;  1L0Q A;  3K26 A;  5FKT A;  2BCJ B;  4L3G D;  5HQG A;  3EI1 B;  4J86 A;  4JSX C;  4NSX A;  5CXB B;  3L4M D;  3SN6 B;  3U4Y A;  2OK6 A;  3MZK A;  3JZG A;  4GGC A;  4X3E A;  3DM0 A;  5EMJ B;  3IJ1 A;  5H17 A;  2PBI B;  3IKO A;  5B4W A;  3K27 A;  4J0X A;  4O3T B;  5K19 A;  5IGO A;  3EI2 A;  5HE1 B;  1B9X A;  2AGL A;  4FHL A;  3B7F A;  3VGZ A;  3JPX A;  3PE7 A;  4CZV A;  4LG9 A;  4ZOX A;  4A0A A;  3ORV D;  4QQE A;  2HKR A;  3HFQ A;  5GXH A;  1MG3 A;  1NR0 A;  3UKU C;  4JD2 C;  4TZ4 A;  1MDA H;  2Z2O A;  3RFG A;  3PVW B;  5GSA A;  5GMK n;  3C5M A;  3MKS B;  3MMY A;  1XIP A;  3I2N A;  1Q47 A;  3I8E A;  4CY2 A;  4PSX B;  3OKY A;  1XKS A;  2CE8 A;  3SCY A;  3SJL D;  4CI3 A;  1R5M A;  4BL0 A;  2H3X A;  2HJB A;  3MKQ A;  2B4E A;  4J8G A;  4FAN D;  4U1E I;  3EI2 B;  3VA6 A;  2P9N C;  4QL1 A;  3J80 g;  4EWR A;  2AQ5 A;  2CN3 A;  5CYK A;  5EM2 A;  3C9C A;  5FKQ A;  3C75 H;  3J81 g;  4A0A B;  2OVR B;  3AFC A;  4ESG A;  3OL2 A;  4GQ2 P;  2J57 G;  3EI3 A;  2H47 A;  1P22 A;  5HYN B;  4PXW A;  2AGY A;  4AEZ A;  2YBA A;  4CI1 A;  5FKS A;  5TF2 A;  3I7K A;  1RI6 A;  1B9Y A;  1N6E A;  1SHY B;  4LGN A;  1PEV A;  3JRP A;  3SFZ A;  5C2V B;  2XL3 A;  4U7A A;  1N6D A;  3I7N A;  1S4U X;  3C99 A;  1SQJ A;  4GQB B;  1K8K C;  2Z2N A;  5FXY A;  4CI2 A;  4CZX A;  1JJU B;  2OJY A;  4ZOY A;  3JZN A;  4CZY A;  4ES0 A;  3N0D A;  1GOT B;  2I0R A;  4GQ1 A;  1N6F A;  4H5J A;  5CYK B;  4XEI C;  1TBG A;  2HJ4 A;  2MTA H;  2J55 H;  3EWE A;  4Y7R A;  3OL2 B;  3PXS D;  4PNK B;  2H9P A;  4FA4 D;  3FRX A;  2PM9 A;  2QXV A;  3W15 A;  2G9A A;  3MXX A;  4FA9 D;  2IUR A;  4A2L A;  1OMW B;  2EBS A;  3RLM D;  2OVQ B;  2XU7 A;  4CC9 A;  5EAR A;  3I7P A;  2B5N A;  3I7H A;  1PBY B;  4A2M A;  3PVU B;  3SBQ A;  3NVQ A;  5IT9 g;  4O1Q D;  2P9L C;  5H1M A;  3IIY A;  2H9L A;  5FA5 B;  1SQ9 A;  2PM6 B;  4K3I D;  1NEX B;  2W18 A;  1OLZ A;  3PSC B;  4CY5 A;  2Q7Q A;  3I7L A;  4L3H D;  5H14 A;  3OTT A;  3ZWL B;  2XYI A;  3GRE A;  2H14 A;  3EG6 A;  4AOW A;  3N0E A;  3CFS B;  5K1C C;  3UVK A;  3JRO A;  2H9M A;  5EMK B;  4A0B A;  1K32 A;  4ZOZ A;  2YMU A;  3BG1 A;  2CO0 A;  3MZL A;  2AH0 A;  4J79 A;  4JSV C;  1VYH C;  4FA5 D;  4QRJ A;  3UR4 A;  3UVL A;  3AL8 A;  4E5Z A;  2YB8 B;  4GM9 A;  4IA9 A;  4I79 A;  4A08 A;  3RRM C;  5HE0 B;  3PXT D;  4ERY A;  2HKM A;  4HDJ A;  1PGU A;  3FM0 A;  4OZU A;  5IC7 A;  4JT6 C;  5AMS A;  4O3U B;  3OKW A;  3PSL A;  1GXR A;  4Y5R D;  4ERZ A;  2TRC B;  4QT8 A;  4H5I A;  2O9K A;  2UZY B;  5CXC A;  4L9O A;  2IUP A;  4PBZ A;  3UKR C;  4A09 A;  1MG2 A;  3OKT A;  2H13 A;  2XL2 A;  2B5L A;  4PBY A;  4J87 A;  3OKY B;  5I5I A;  3DXM C;  3KRW B;  3GFC A;  2OK4 A;  3F3P A;  2QC5 A;  3AL8 B;  4CI8 A;  2I0T A;  4E5Z B;  3V5W B;  4D0K A;  3F3G A;  3L4O D;  3E0C A;  5IJ7 E;  3EI1 A;  4OWR A;  3EI4 A;  4A08 B;  2J56 H;  3CIK B;  4GM8 A;  5CXB A;  3EMH A;  5SXM A;  4D6V A;  4J77 A;  2I3T A;  5AJA A;  5EM2 B;  2OIZ A;  4ZN4 A;  3BWS A;  4J8B A;  1FWX A;  4FWW A;  4X61 B;  3JB9 L;  2P9S C;  3EI3 B;  2GNQ A;  3OW8 A;  4XYH A;  3SBP A;  1JMX B;  4LG8 A;  1XHM A;  4A09 B;  2CE9 A;  2H68 A;  1U2V C;  3V7D B;  2HXC A;  3NVN A;  4GGA A;  4JXM A;  2IUV A;  4YVD A;  3ODT A;  1PI6 A;  4A11 A;  4FAV D;  3IJC A;  4FB1 D;  3BG0 A;  4GMB A;  1JMZ B;  3AL9 A;  4R7A B;  5HE2 B;  4MK0 B;  3SHF A;  3EI4 B;  4CY3 A;  3A0F A;  4KFM B;  5FLX g;  3SMR A;  3RFH A;  5EAP A;  3RSE C;  5AFU 3;  3KRX B;  4E54 A;  5IGQ A;  4JT5 C;  3JZH A;  5I5M A;  2G99 A;  2YNO A;  2CN2 A;  2PM9 B;  2P9I C;  2AGZ A;  2HES X;  3V9F A;  3I8C A;  2P9K C;  5EAM A;  3RN1 D;  2I0S A;  3IJ0 A;  4JSP C;  4ERQ A;  3FGB A;  5JWZ A;  5IJ8 E;  3F3F A;  5EML B;  2I3S A;  3CFV A;  2AH1 A;  4A11 B;  2AGX A;  4Z8L A;  1JOF A;  2GC7 A;  2IUQ A;  3SLE D;  1YFQ A;  5TEF A;  4K3J B;  1A0R B;  2H6N A;  2P9U C;  2B5M A;  5TEE A;  2GC4 A;  4UI9 R;  5EAL A;  4BH6 A;  3UVM A;  4E54 B;  4FA1 D;  3ULE C;  2CO0 C;  3RMZ D;  4J0W A;  5A2Q g;  3P4F A;  4N14 A;  4GM3 A;  3RN0 D;  4PSW B;  2YNP A;  4GGD A;  5THA A;  1GP2 B; 
#chains in the Genus database with same CATH topology
 4BUJ C;  3NVX A;  3SXT D;  3VI4 A;  2H6K A;  4X63 B;  4A0B B;  3I7O A;  1QNI A;  2Z2P A;  4A7J A;  5EMM B;  3EU7 A;  1ERJ A;  3SVW D;  1QFM A;  5C2W B;  4BCD A;  5FKR A;  4BP9 A;  1TYQ C;  4J78 A;  4O45 A;  5FQD A;  5TDH B;  3EQ9 A;  3I89 A;  3DWL C;  3NIF A;  3DSM A;  4IMM A;  5C9Z B;  3IIW A;  2CNX A;  2H9N A;  2EIC A;  5KDO B;  4J73 A;  3MUN A;  4G56 B;  3JAM g;  2UZX B;  4PC0 A;  4CY1 A;  2HYE A;  4J84 A;  2BBK H;  1O6G A;  2AGW A;  3SBR A;  2YNN A;  2WQ8 A;  2H6Q A;  3IUJ A;  2OVP B;  4MMY A;  5FFO A;  3SWS D;  5E6R A;  5HE3 B;  3IUM A;  3AH8 B;  2IAA A;  3QHY B;  4XYI A;  1U4C A;  5CXC B;  3V4P A;  2IWK A;  3DXK C;  3PXW D;  5GXI A;  1U8C A;  2HU8 A;  3GD1 I;  4NAA A;  2QR5 A;  2EIE A;  4GZ8 A;  3MVD K;  5E6U A;  4JSN C;  3ZDZ A;  4L1Q D;  1GG2 B;  4J82 A;  3UVN A;  2P9P C;  2VDM A;  3UVO A;  4O9D A;  4ZOV A;  2IWF A;  1UTC A;  4O2W A;  4X60 B;  3VH0 A;  4J81 A;  2PM7 B;  5I5J A;  1L0Q A;  3K26 A;  4AMZ A;  5FKT A;  2BCJ B;  4L3G D;  5HQG A;  4BCB A;  3EI1 B;  1M1X A;  1VZ2 A;  4J86 A;  4JSX C;  4NSX A;  5CXB B;  3L4M D;  4IRZ A;  3SN6 B;  3U4Y A;  2OK6 A;  3MZK A;  3JZG A;  4GGC A;  4X3E A;  1VE7 A;  3DM0 A;  5M5S A;  5EMJ B;  3IJ1 A;  1YR2 A;  5H17 A;  2VC2 A;  1H2Z A;  2PBI B;  3IKO A;  4NEN A;  2XDW A;  3ZDX A;  5B4W A;  3K27 A;  4J0X A;  4O3T B;  4WJK A;  1UOQ A;  5K19 A;  5IGO A;  3EI2 A;  3O4I A;  5HE1 B;  1B9X A;  2AGL A;  4FHL A;  3B7F A;  3VGZ A;  3IVM A;  3JPX A;  3PE7 A;  4CZV A;  2VZ1 A;  5C86 A;  4LG9 A;  1GOG A;  4D9S A;  4RE6 A;  4ZOX A;  4A0A A;  3ORV D;  4QQE A;  2HKR A;  3HFQ A;  5GXH A;  1MG3 A;  1NR0 A;  3UKU C;  4JD2 C;  4TZ4 A;  1MDA H;  2Z2O A;  3RFG A;  3PVW B;  5GSA A;  5GMK n;  3C5M A;  3MKS B;  3MMY A;  1XIP A;  1GOH A;  1JTD B;  3I2N A;  1Q47 A;  3I8E A;  5M5U A;  4CY2 A;  4PSX B;  3OKY A;  1XKS A;  2CE8 A;  3SCY A;  3SJL D;  4CI3 A;  1R5M A;  4BL0 A;  2H3X A;  4MMX A;  1O6F A;  2HJB A;  3MKQ A;  3QI0 A;  4Z7N A;  2B4E A;  4QAM A;  5HDB A;  4J8G A;  4FAN D;  1L5G A;  4U1E I;  2JKX A;  3EI2 B;  2EID A;  3VA6 A;  2P9N C;  4QL1 A;  3J80 g;  3KCI A;  4EWR A;  2AQ5 A;  4O02 A;  2CN3 A;  2VDO A;  5CYK A;  5EM2 A;  3C9C A;  4Z7O A;  4L1M A;  3FCS A;  5FKQ A;  3C75 H;  3J81 g;  3O4J A;  4A0A B;  2OVR B;  3AFC A;  4ESG A;  3IUN A;  3O4H A;  3OL2 A;  2J57 G;  4GQ2 P;  3EI3 A;  2HU7 A;  2H47 A;  1P22 A;  5HYN B;  4PXW A;  2AGY A;  4AEZ A;  2YBA A;  4CI1 A;  5FKS A;  5TF2 A;  3I7K A;  1RI6 A;  1B9Y A;  1N6E A;  1SHY B;  4LGN A;  1PEV A;  3JRP A;  3SFZ A;  4AN1 A;  5C2V B;  1UOO A;  2XL3 A;  4U7A A;  1H2Y A;  4WK2 A;  3GC3 B;  5M5T A;  1N6D A;  3I7N A;  1S4U X;  3C99 A;  1SQJ A;  4GQB B;  1K8K C;  2Z2N A;  1H2W A;  2VDQ A;  5FXY A;  4CI2 A;  4CZX A;  1JJU B;  1VE6 A;  2OJY A;  4ZOY A;  4DNU A;  3JZN A;  4CZY A;  4ES0 A;  3N0D A;  1GOT B;  1A12 A;  2I0R A;  4GQ1 A;  1N6F A;  4H5J A;  5CYK B;  4XEI C;  1TBG A;  2HJ4 A;  2MTA H;  2J55 H;  3OF7 A;  3EWE A;  4Y7R A;  3OL2 B;  3PXS D;  4PNK B;  2H9P A;  4FA4 D;  3FRX A;  2PM9 A;  2QXV A;  2XE4 A;  4G1E A;  3W15 A;  2G9A A;  3MXX A;  4FA9 D;  4Z7Q A;  2IUR A;  4A2L A;  1OMW B;  2EBS A;  3ZE1 A;  3RLM D;  2OVQ B;  2XU7 A;  4CC9 A;  5EAR A;  3I7P A;  2B5N A;  3IUL A;  1H2X A;  3EQ7 A;  3I7H A;  1PBY B;  2XZG A;  3T3M A;  4A2M A;  3PVU B;  3SBQ A;  3NVQ A;  5IT9 g;  3ZE0 A;  3NID A;  4O1Q D;  2P9L C;  5H1M A;  3IIY A;  2H9L A;  5FA5 B;  1C9I A;  1SQ9 A;  2PM6 B;  3EQ8 A;  4K3I D;  1NEX B;  2W18 A;  1OLZ A;  3PSC B;  4CY5 A;  4MMZ A;  3IJE A;  2Q7Q A;  3I7L A;  3IUR A;  4L3H D;  1E8N A;  5H14 A;  3OTT A;  3ZWL B;  2XYI A;  3MUO A;  4BCC A;  3GRE A;  1TYE A;  3ZE2 A;  2H14 A;  3EG6 A;  4AOW A;  3N0E A;  3CFS B;  4WK4 A;  5K1C C;  3UVK A;  3JRO A;  2VDR A;  2H9M A;  4AN0 A;  1E5T A;  5EMK B;  4A0B A;  1K32 A;  4ZOZ A;  2YMU A;  3BG1 A;  2CO0 A;  3MZL A;  2AH0 A;  4J79 A;  2VDK A;  4JSV C;  3K71 A;  3FCU A;  1VYH C;  4FA5 D;  5E6S A;  4QRJ A;  3UR4 A;  3UVL A;  3AL8 A;  4BP8 A;  4E5Z A;  2YB8 B;  4DNW A;  4GM9 A;  4IA9 A;  5M61 A;  4I79 A;  4A08 A;  3RRM C;  5HE0 B;  2VDL A;  3PXT D;  4ERY A;  2HKM A;  4HDJ A;  1PGU A;  3FM0 A;  4OZU A;  5IC7 A;  4JT6 C;  5AMS A;  2VDN A;  4O3U B;  1QFS A;  3OKW A;  3PSL A;  1GXR A;  4Y5R D;  4ERZ A;  2TRC B;  4QT8 A;  4H5I A;  2O9K A;  3K72 A;  2UZY B;  5CXC A;  4L9O A;  2IUP A;  4PBZ A;  3UKR C;  5FFG A;  4A09 A;  1MG2 A;  3OKT A;  2H13 A;  2XL2 A;  2B5L A;  4PBY A;  4J87 A;  3OKY B;  4RE5 A;  5I5I A;  3DXM C;  5M5R A;  3KRW B;  3GFC A;  2OK4 A;  3F3P A;  2QC5 A;  3AL8 B;  4CI8 A;  2I0T A;  4E5Z B;  3V5W B;  4D0K A;  3F3G A;  3L4O D;  3E0C A;  5IJ7 E;  3EI1 A;  4OWR A;  3EI4 A;  1I2M B;  4A08 B;  2J56 H;  3CIK B;  3O4G A;  4GM8 A;  4NC4 A;  5CXB A;  3EMH A;  5SXM A;  4D6V A;  3ZDY A;  4J77 A;  2I3T A;  5AJA A;  5EM2 B;  2OIZ A;  4JHN A;  5C92 A;  4ZN4 A;  3BWS A;  4J8B A;  1FWX A;  4FWW A;  4X61 B;  3JB9 L;  2EIB A;  2P9S C;  3EI3 B;  2QZP A;  2GNQ A;  3OW8 A;  4XYH A;  4AX4 A;  3SBP A;  1JMX B;  4LG8 A;  3DDU A;  1XHM A;  4A09 B;  2HU5 A;  2CE9 A;  5M5V A;  2H68 A;  1U2V C;  1GOF A;  3V7D B;  2HXC A;  3NVN A;  4GGA A;  1UOP A;  4JXM A;  2IUV A;  4YVD A;  3ODT A;  1PI6 A;  4A11 A;  4FAV D;  4G55 A;  1BPO A;  3IJC A;  4FB1 D;  3BG0 A;  4GMB A;  1JMZ B;  3AL9 A;  4R7A B;  5HE2 B;  4MK0 B;  3SHF A;  3EI4 B;  4CY3 A;  3A0F A;  4KFM B;  5FLX g;  1K3I A;  2VDP A;  4AMY A;  3SMR A;  4DNV A;  3RFH A;  1C9L A;  5EAP A;  3RSE C;  5AFU 3;  3KRX B;  1T2X A;  3V4V A;  3K6S A;  4E54 A;  5IGQ A;  4JT5 C;  4UM8 A;  3JZH A;  5I5M A;  2G99 A;  2YNO A;  4G1M A;  3T3P A;  2CN2 A;  2PM9 B;  2P9I C;  2AGZ A;  2HES X;  3V9F A;  3I8C A;  2P9K C;  5EAM A;  1VZ3 A;  2VZ3 A;  3RN1 D;  2I0S A;  3IJ0 A;  4JSP C;  4ERQ A;  3FGB A;  5JWZ A;  5IJ8 E;  3F3F A;  5EML B;  2I3S A;  3CFV A;  2AH1 A;  4A11 B;  2AGX A;  4Z8L A;  1JOF A;  2GC7 A;  2IUQ A;  3SLE D;  1YFQ A;  5TEF A;  4JHP C;  4K3J B;  1A0R B;  2H6N A;  2P9U C;  2B5M A;  5TEE A;  2GC4 A;  1JV2 A;  2BKL A;  4UI9 R;  5EAL A;  4BH6 A;  4WK0 A;  3UVM A;  3IUQ A;  4E54 B;  4FA1 D;  3ULE C;  2CO0 C;  3RMZ D;  4J0W A;  5A2Q g;  3P4F A;  4N14 A;  4GM3 A;  3RN0 D;  4NBM A;  3NIG A;  3VI3 A;  4PSW B;  4UM9 A;  1E8M A;  2YNP A;  4GGD A;  5THA A;  1GP2 B; 
#chains in the Genus database with same CATH homology
 4BUJ C;  3NVX A;  3SXT D;  2H6K A;  4X63 B;  4A0B B;  3I7O A;  1QNI A;  2Z2P A;  4A7J A;  5EMM B;  3EU7 A;  1ERJ A;  3SVW D;  5C2W B;  5FKR A;  1TYQ C;  4J78 A;  4O45 A;  5FQD A;  5TDH B;  3I89 A;  3DWL C;  3DSM A;  4IMM A;  5C9Z B;  3IIW A;  2CNX A;  2H9N A;  5KDO B;  4J73 A;  4G56 B;  3JAM g;  2UZX B;  4PC0 A;  4CY1 A;  2HYE A;  4J84 A;  2BBK H;  2AGW A;  3SBR A;  2YNN A;  2H6Q A;  2OVP B;  3SWS D;  5HE3 B;  3AH8 B;  2IAA A;  4XYI A;  1U4C A;  5CXC B;  2IWK A;  3DXK C;  3PXW D;  5GXI A;  4GZ8 A;  4JSN C;  4L1Q D;  1GG2 B;  4J82 A;  3UVN A;  2P9P C;  3UVO A;  4O9D A;  4ZOV A;  2IWF A;  4X60 B;  3VH0 A;  4J81 A;  2PM7 B;  5I5J A;  1L0Q A;  3K26 A;  5FKT A;  2BCJ B;  4L3G D;  5HQG A;  3EI1 B;  4J86 A;  4JSX C;  4NSX A;  5CXB B;  3L4M D;  3SN6 B;  3U4Y A;  2OK6 A;  3MZK A;  3JZG A;  4GGC A;  4X3E A;  3DM0 A;  5EMJ B;  3IJ1 A;  5H17 A;  2PBI B;  3IKO A;  5B4W A;  3K27 A;  4J0X A;  4O3T B;  5K19 A;  5IGO A;  3EI2 A;  5HE1 B;  1B9X A;  2AGL A;  4FHL A;  3B7F A;  3VGZ A;  3JPX A;  3PE7 A;  4CZV A;  4LG9 A;  4ZOX A;  4A0A A;  3ORV D;  4QQE A;  2HKR A;  3HFQ A;  5GXH A;  1MG3 A;  1NR0 A;  3UKU C;  4JD2 C;  4TZ4 A;  1MDA H;  2Z2O A;  3RFG A;  3PVW B;  5GSA A;  5GMK n;  3C5M A;  3MKS B;  3MMY A;  1XIP A;  3I2N A;  1Q47 A;  3I8E A;  4CY2 A;  4PSX B;  3OKY A;  1XKS A;  2CE8 A;  3SCY A;  3SJL D;  4CI3 A;  1R5M A;  4BL0 A;  2H3X A;  2HJB A;  3MKQ A;  2B4E A;  4J8G A;  4FAN D;  4U1E I;  3EI2 B;  3VA6 A;  2P9N C;  4QL1 A;  3J80 g;  4EWR A;  2AQ5 A;  2CN3 A;  5CYK A;  5EM2 A;  3C9C A;  5FKQ A;  3C75 H;  3J81 g;  4A0A B;  2OVR B;  3AFC A;  4ESG A;  3OL2 A;  4GQ2 P;  2J57 G;  3EI3 A;  2H47 A;  1P22 A;  5HYN B;  4PXW A;  2AGY A;  4AEZ A;  2YBA A;  4CI1 A;  5FKS A;  5TF2 A;  3I7K A;  1RI6 A;  1B9Y A;  1N6E A;  1SHY B;  4LGN A;  1PEV A;  3JRP A;  3SFZ A;  5C2V B;  2XL3 A;  4U7A A;  1N6D A;  3I7N A;  1S4U X;  3C99 A;  1SQJ A;  4GQB B;  1K8K C;  2Z2N A;  5FXY A;  4CI2 A;  4CZX A;  1JJU B;  2OJY A;  4ZOY A;  3JZN A;  4CZY A;  4ES0 A;  3N0D A;  1GOT B;  2I0R A;  4GQ1 A;  1N6F A;  4H5J A;  5CYK B;  4XEI C;  1TBG A;  2HJ4 A;  2MTA H;  2J55 H;  3EWE A;  4Y7R A;  3OL2 B;  3PXS D;  4PNK B;  2H9P A;  4FA4 D;  3FRX A;  2PM9 A;  2QXV A;  3W15 A;  2G9A A;  3MXX A;  4FA9 D;  2IUR A;  4A2L A;  1OMW B;  2EBS A;  3RLM D;  2OVQ B;  2XU7 A;  4CC9 A;  5EAR A;  3I7P A;  2B5N A;  3I7H A;  1PBY B;  4A2M A;  3PVU B;  3SBQ A;  3NVQ A;  5IT9 g;  4O1Q D;  2P9L C;  5H1M A;  3IIY A;  2H9L A;  5FA5 B;  1SQ9 A;  2PM6 B;  4K3I D;  1NEX B;  2W18 A;  1OLZ A;  3PSC B;  4CY5 A;  2Q7Q A;  3I7L A;  4L3H D;  5H14 A;  3OTT A;  3ZWL B;  2XYI A;  3GRE A;  2H14 A;  3EG6 A;  4AOW A;  3N0E A;  3CFS B;  5K1C C;  3UVK A;  3JRO A;  2H9M A;  5EMK B;  4A0B A;  1K32 A;  4ZOZ A;  2YMU A;  3BG1 A;  2CO0 A;  3MZL A;  2AH0 A;  4J79 A;  4JSV C;  1VYH C;  4FA5 D;  4QRJ A;  3UR4 A;  3UVL A;  3AL8 A;  4E5Z A;  2YB8 B;  4GM9 A;  4IA9 A;  4I79 A;  4A08 A;  3RRM C;  5HE0 B;  3PXT D;  4ERY A;  2HKM A;  4HDJ A;  1PGU A;  3FM0 A;  4OZU A;  5IC7 A;  4JT6 C;  5AMS A;  4O3U B;  3OKW A;  3PSL A;  1GXR A;  4Y5R D;  4ERZ A;  2TRC B;  4QT8 A;  4H5I A;  2O9K A;  2UZY B;  5CXC A;  4L9O A;  2IUP A;  4PBZ A;  3UKR C;  4A09 A;  1MG2 A;  3OKT A;  2H13 A;  2XL2 A;  2B5L A;  4PBY A;  4J87 A;  3OKY B;  5I5I A;  3DXM C;  3KRW B;  3GFC A;  2OK4 A;  3F3P A;  2QC5 A;  3AL8 B;  4CI8 A;  2I0T A;  4E5Z B;  3V5W B;  4D0K A;  3F3G A;  3L4O D;  3E0C A;  5IJ7 E;  3EI1 A;  4OWR A;  3EI4 A;  4A08 B;  2J56 H;  3CIK B;  4GM8 A;  5CXB A;  3EMH A;  5SXM A;  4D6V A;  4J77 A;  2I3T A;  5AJA A;  5EM2 B;  2OIZ A;  4ZN4 A;  3BWS A;  4J8B A;  1FWX A;  4FWW A;  4X61 B;  3JB9 L;  2P9S C;  3EI3 B;  2GNQ A;  3OW8 A;  4XYH A;  3SBP A;  1JMX B;  4LG8 A;  1XHM A;  4A09 B;  2CE9 A;  2H68 A;  1U2V C;  3V7D B;  2HXC A;  3NVN A;  4GGA A;  4JXM A;  2IUV A;  4YVD A;  3ODT A;  1PI6 A;  4A11 A;  4FAV D;  3IJC A;  4FB1 D;  3BG0 A;  4GMB A;  1JMZ B;  3AL9 A;  4R7A B;  5HE2 B;  4MK0 B;  3SHF A;  3EI4 B;  4CY3 A;  3A0F A;  4KFM B;  5FLX g;  3SMR A;  3RFH A;  5EAP A;  3RSE C;  5AFU 3;  3KRX B;  4E54 A;  5IGQ A;  4JT5 C;  3JZH A;  5I5M A;  2G99 A;  2YNO A;  2CN2 A;  2PM9 B;  2P9I C;  2AGZ A;  2HES X;  3V9F A;  3I8C A;  2P9K C;  5EAM A;  3RN1 D;  2I0S A;  3IJ0 A;  4JSP C;  4ERQ A;  3FGB A;  5JWZ A;  5IJ8 E;  3F3F A;  5EML B;  2I3S A;  3CFV A;  2AH1 A;  4A11 B;  2AGX A;  4Z8L A;  1JOF A;  2GC7 A;  2IUQ A;  3SLE D;  1YFQ A;  5TEF A;  4K3J B;  1A0R B;  2H6N A;  2P9U C;  2B5M A;  5TEE A;  2GC4 A;  4UI9 R;  5EAL A;  4BH6 A;  3UVM A;  4E54 B;  4FA1 D;  3ULE C;  2CO0 C;  3RMZ D;  4J0W A;  5A2Q g;  3P4F A;  4N14 A;  4GM3 A;  3RN0 D;  4PSW B;  2YNP A;  4GGD A;  5THA A;  1GP2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...