4FA9D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 30 days
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 94
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fa9D00
3UVNA 3I2NA 4GZ8A 1N6EA 4ESGA 3UVMA 2H9MA 2J56H 5HE3B 5A2Qg 4X3EA 5I5JA 3UVLA 1K32A 1MG3A 2HYEA 2OK6A 4J73A 3V9FA 2OVQB 3NVQA 5EAMA 4A0BB 4CY3A 3EI4B 5H17A 3VGZA 4MK0B 4J87A 4PC0A 5EAPA 5TDHB 4A09B 3C9CA 3ULEC 4XYIA 3SBRA 3JROA 4I79A 2CE8A 5THAA 4D0KA 5KDOB 1K8KC 4ZOVA 4L1QD 4CZXA 1B9XA 4L3HD 3RN1D 3SVWD 1MG2A 4G56B 3N0DA 5IJ7E 1N6DA 1B9YA 2H14A 3EI2A 2XL3A 5K19A 4ERQA 4BUJC 1JMZB 1U2VC 4AEZA 3JZGA 4FHLA 3SMRA 1OLZA 5FKRA 4A2LA 2IAAA 3OKYA 3RSEC 4O3UB 4J8GA 1SQ9A 4PBZA 5I5IA 2AQ5A 1FWXA 3SCYA 4NSXA 4ZN4A 4N14A 5I5MA 4XEIC 1XIPA 3I8EA 4GGDA 2GC7A 2TRCB 2CN3A 3L4OD 3CFSB 2CE9A 3PXSD 5TEEA 5GXHA 3JZNA 4PBYA 2MTAH 5IGOA 3KRXB 3SLED 2IURA 5HE1B 5HYNB 3I7KA 1SHYB 3OW8A 2YNOA 3SXTD 3IJ1A 4PSWB 3V7DB 3NVXA 4LGNA 4A11A 4KFMB 2W18A 3SJLD 2XL2A 2CO0A 3VA6A 2I0TA 3L4MD 3JZHA 4YVDA 5EMMB 1GOTB 3EI3A 3IIWA 2HKRA 3JAMg 4UI9R 4A08A 3PSLA 1JMXB 2PBIB 1Q47A 3RFGA 4CI8A 3F3GA 3OL2A 4CY5A 3ORVD 1GXRA 5CYKA 2P9KC 1XKSA 2QXVA 4JT5C 4JSNC 3BG0A 5EARA 2H6QA 3EMHA 4TZ4A 4A0AA 4FA4D 3HFQA 3DWLC 2UZXB 4JT6C 5TEFA 3RN0D 3AL8A 4O9DA 5B4WA 4E54A 4CY2A 5EALA 4A11B 4ZOZA 2I3SA 4U7AA 4J82A 4J81A 3EG6A 1JJUB 3PVUB 1A0RB 3EI3B 2J55H 4A7JA 4A08B 3DSMA 2HESX 3F3FA 3OL2B 2CN2A 5SXMA 2H6NA 4L9OA 5TF2A 3EWEA 4ERYA 1MDAH 3CIKB 2EBSA 4CC9A 3SFZA 3J80g 1NR0A 2OVPB 3RRMC 2B4EA 3I8CA 2I3TA 1QNIA 2IUPA 3IKOA 4GGAA 2Q7QA 3BWSA 3C5MA 2B5MA 4J0WA 3AL8B 3MZLA 2IUQA 4HDJA 5FKSA 4IA9A 4L3GD 4E54B 2AGWA 3UKUC 4CZYA 4QQEA 2PM7B 4D6VA 2CO0C 3N0EA 4U1EI 2AGLA 3W15A 2H3XA 5AMSA 4FWWA 3U4YA 3PXTD 3PXWD 4CI3A 3PSCB 1TYQC 4J8BA 3JRPA 2QC5A 4H5IA 5AFU3 5AJAA 3OKTA 2IWFA 4GQ2P 2IUVA 5K1CC 5IT9g 4E5ZA 4X61B 2Z2PA 5HE2B 3DXKC 4A2MA 3SBPA 3ODTA 1NEXB 3EI2B 5FLXg 5CXBA 3V5WB 5GMKn 3RMZD 2PM9A 5FKTA 2OK4A 5FQDA 2AH1A 3EI1A 4OWRA 2GC4A 3K26A 4R7AB 5EMLB 2YMUA 1JOFA 1U4CA 3OKYB 2B5NA 2I0SA 4FA9D 4ES0A 4GMBA 4ERZA 4JSVC 3RLMD 2G99A 3BG1A 2P9NC 1N6FA 4X63B 1VYHC 3FM0A 4PSXB 5C2WB 2XYIA 3MKQA 2B5LA 5CXCA 4JSPC 3PE7A 2UZYB 2AGXA 2HKMA 5HQGA 4X60B 5C9ZB 3B7FA 4ZOYA 2YB8B 5H1MA 4XYHA 3SN6B 2OVRB 3FRXA 5C2VB 5EMJB 2HJ4A 4PNKB 2H9LA 2H68A 5IJ8E 3OTTA 3C75H 4Y5RD 3A0FA 5FKQA 3MMYA 1RI6A 3K27A 4H5JA 5CXBB 5FA5B 4GQBB 3J81g 2AGYA 4GM8A 5EMKB 3EI1B 3FGBA 1PGUA 3I89A 3AL9A 4QL1A 4FAVD 2I0RA 4IMMA 2P9IC 4ZOXA 2P9SC 4CI2A 3MXXA 3SWSD 2PM6B 1P22A 4CY1A 1XHMA 2Z2OA 2H47A 4K3JB 3UKRC 3EU7A 4J84A 3VH0A 3RFHA 5CYKB 3CFVA 5CXCB 1S4UX 3GFCA 1GP2B 2XU7A 4J86A 3JB9L 5GXIA 4A0AB 1R5MA 3ZWLB 4LG9A 2AH0A 3UR4A 4O45A 3OKWA 3I7LA 1SQJA 2IWKA 3I7PA 4CI1A 4BH6A 4J78A 4FB1D 4J77A 5EM2A 1L0QA 2YNPA 2BCJB 4GGCA 3SBQA 4FA1D 4JXMA 2AGZA 3AH8B 4PXWA 3UVKA 1GG2B 2P9LC 3IJCA 4FAND 4CZVA 4OZUA 4LG8A 3DM0A 3MZKA 3F3PA 3GREA 2HXCA 3MKSB 3I7NA 3PVWB 3E0CA 4J79A 1OMWB 1TBGA 4GM3A 2HJBA 4JD2C 4QT8A 3KRWB 2H9NA 1ERJA 5FXYA 3IJ0A 5HE0B 1YFQA 2OIZA 3JPXA 4GQ1A 2YNNA 2OJYA 4Z8LA 3NVNA 4EWRA 5JWZA 2P9UC 5GSAA 5H14A 2G9AA 3C99A 3IIYA 5EM2B 3UVOA 5IC7A 4A0BA 4O3TB 3EI4A 3DXMC 2P9PC 4A09A 4BL0A 4AOWA 2GNQA 2H6KA 5IGQA 2H13A 4J0XA 4E5ZB 2CNXA 2O9KA 2YBAA 1PBYB 3I7HA 4GM9A 4O1QD 4K3ID 2H9PA 4Y7RA 1PI6A 4QRJA 3P4FA 2J57G 3I7OA 1PEVA 2Z2NA 3AFCA 4JSXC 2PM9B 2BBKH 4FA5D 3SHFA
chains in the Genus database with same CATH superfamily
3UVNA 3I2NA 4GZ8A 2QZPA 1N6EA 4ESGA 3UVMA 2H9MA 2J56H 5HE3B 3ZDYA 1VE7A 5A2Qg 2BKLA 4X3EA 2JKXA 5I5JA 3UVLA 1K32A 1MG3A 4WK0A 2HYEA 2OK6A 4J73A 3V9FA 2OVQB 3IVMA 3QI0A 3NVQA 1UOPA 5EAMA 1E8NA 3IJEA 4A0BB 4Z7NA 4CY3A 3EI4B 5H17A 3VGZA 4MK0B 4G1EA 4J87A 3EQ9A 4PC0A 5EAPA 1H2YA 5TDHB 4A09B 2EIEA 3C9CA 3ULEC 2HU8A 4XYIA 3SBRA 2QR5A 1K3IA 3JROA 4I79A 2CE8A 5THAA 4AN1A 4D0KA 5KDOB 4AMZA 1JV2A 1K8KC 4ZOVA 4L1QD 4CZXA 3VI4A 1B9XA 4L3HD 3RN1D 4DNUA 3SVWD 1MG2A 4G56B 3N0DA 5IJ7E 4JHPC 1N6DA 1B9YA 2H14A 1GOHA 3EI2A 2XL3A 5K19A 4MMZA 4ERQA 1VE6A 4BUJC 1JMZB 1U2VC 3OF7A 4AEZA 4G1MA 5M5VA 3JZGA 4FHLA 3SMRA 1OLZA 5FKRA 4A2LA 2IAAA 3OKYA 2EICA 3RSEC 3VI3A 4O3UB 3FCUA 3V4PA 4J8GA 1SQ9A 4PBZA 5I5IA 1E5TA 2AQ5A 1FWXA 2VDLA 2WQ8A 4NSXA 4NC4A 3SCYA 4ZN4A 4N14A 4WK4A 5I5MA 4XEIC 4BCBA 1XIPA 3I8EA 4GGDA 2GC7A 2TRCB 2CN3A 2VDKA 3L4OD 3CFSB 2CE9A 3PXSD 3FCSA 4MMYA 5TEEA 5GXHA 3JZNA 4PBYA 4D9SA 2MTAH 5IGOA 4RE5A 3KRXB 3SLED 2IURA 5HE1B 5HYNB 5E6RA 3I7KA 1SHYB 3OW8A 2YNOA 3SXTD 1C9LA 1TYEA 3IJ1A 4PSWB 3V7DB 3GC3B 2VZ1A 3NVXA 4LGNA 4JHNA 4A11A 4KFMB 5C86A 2W18A 5FFOA 3SJLD 2XL2A 2CO0A 3VA6A 2I0TA 3L4MD 3JZHA 4YVDA 5EMMB 1GOTB 3EI3A 1M1XA 3IIWA 2HKRA 3JAMg 4WK2A 4UI9R 4A08A 3PSLA 4AN0A 1JMXB 1A12A 2PBIB 1Q47A 3RFGA 4CI8A 3F3GA 3ZDZA 3OL2A 4CY5A 3ORVD 5FFGA 1GXRA 5CYKA 2P9KC 1XKSA 2QXVA 4JT5C 4JSNC 1VZ2A 5E6UA 3BG0A 5EARA 2H6QA 3EMHA 4TZ4A 4A0AA 4FA4D 3HFQA 3K71A 3DWLC 2UZXB 1T2XA 4JT6C 5TEFA 3RN0D 3AL8A 4AX4A 4O9DA 5B4WA 1QFMA 4E54A 4CY2A 3MVDK 5EALA 4A11B 3IULA 4ZOZA 2I3SA 2XDWA 4U7AA 4J82A 1GOFA 3EG6A 4J81A 4BP8A 4BP9A 1JJUB 3K72A 3PVUB 3O4HA 1A0RB 3EI3B 2J55H 4A7JA 4A08B 4WJKA 3DSMA 2HESX 5E6SA 3F3FA 3OL2B 2VDQA 2CN2A 5SXMA 2H6NA 4L9OA 5TF2A 3EWEA 4ERYA 1MDAH 3CIKB 1GOGA 2EBSA 4CC9A 5M5TA 2EIBA 4Z7OA 3SFZA 4NENA 1O6FA 3MUNA 3J80g 1NR0A 2OVPB 3RRMC 2B4EA 5M61A 3I8CA 2I3TA 1QNIA 2IUPA 3IKOA 2VDOA 4GGAA 2Q7QA 3BWSA 3K6SA 3C5MA 2B5MA 3AL8B 3MZLA 4J0WA 2IUQA 4HDJA 5FKSA 4O2WA 4DNVA 4IA9A 4L3GD 4NAAA 3O4IA 4E54B 2AGWA 4L1MA 3UKUC 4CZYA 4QQEA 2PM7B 4D6VA 2CO0C 3N0EA 3IUJA 2AGLA 4U1EI 3W15A 2H3XA 5AMSA 4FWWA 3U4YA 3PXTD 3PXWD 4CI3A 3O4JA 3PSCB 1TYQC 4J8BA 3JRPA 2QC5A 5C92A 4H5IA 5AFU3 5AJAA 3OKTA 2IWFA 4GQ2P 2IUVA 5K1CC 5IT9g 4E5ZA 4X61B 2Z2PA 4BCDA 5HE2B 3DXKC 4A2MA 3SBPA 3ODTA 1NEXB 5M5UA 3GD1I 3EI2B 5FLXg 3V4VA 5CXBA 3V5WB 5GMKn 3IUNA 3RMZD 2PM9A 5FKTA 2OK4A 5FQDA 2AH1A 3EI1A 4OWRA 1UOOA 2GC4A 3K26A 4R7AB 5EMLB 2YMUA 1JOFA 1U4CA 3NIGA 3OKYB 2B5NA 2I0SA 4O02A 4FA9D 1H2XA 4ES0A 4GMBA 4ERZA 4JSVC 1E8MA 3RLMD 2G99A 3BG1A 2P9NC 1N6FA 4X63B 1VYHC 3FM0A 4PSXB 5M5RA 5C2WB 1BPOA 2XYIA 3MKQA 2B5LA 5CXCA 4G55A 4JSPC 3PE7A 2EIDA 4QAMA 2UZYB 2AGXA 2HKMA 5HQGA 4X60B 5C9ZB 3B7FA 1U8CA 4ZOYA 2YB8B 5H1MA 4XYHA 3SN6B 2OVRB 3FRXA 5C2VB 4Z7QA 3ZE1A 5EMJB 2HJ4A 4PNKB 2H9LA 2H68A 1QFSA 5IJ8E 3OTTA 1H2ZA 3C75H 4Y5RD 3A0FA 5FKQA 3MMYA 1I2MB 1RI6A 3K27A 4H5JA 5CXBB 5FA5B 4GQBB 3ZE2A 3J81g 2AGYA 4GM8A 2VDMA 5EMKB 3EI1B 3MUOA 3FGBA 1PGUA 3I89A 3AL9A 4QL1A 4FAVD 2I0RA 4IMMA 2P9IC 4ZOXA 2P9SC 4CI2A 3T3MA 3MXXA 3SWSD 2PM6B 1P22A 4CY1A 1XHMA 2Z2OA 2H47A 4K3JB 3UKRC 1UOQA 3EU7A 4J84A 3VH0A 3O4GA 3RFHA 5CYKB 3CFVA 5CXCB 1S4UX 5M5SA 3GFCA 1GP2B 3QHYB 1JTDB 2XU7A 4J86A 3JB9L 5GXIA 4A0AB 2VDPA 3IURA 1R5MA 3ZWLB 4LG9A 2AH0A 3UR4A 4O45A 3OKWA 4IRZA 1YR2A 3I7LA 1SQJA 4RE6A 2IWKA 3I7PA 4CI1A 4BH6A 4J78A 4FB1D 4J77A 5EM2A 1L0QA 4UM9A 2YNPA 2VDRA 2BCJB 3T3PA 4GGCA 3SBQA 4FA1D 3IUMA 4JXMA 1H2WA 2AGZA 3AH8B 4PXWA 3UVKA 1GG2B 3NIFA 2P9LC 3IJCA 4FAND 4CZVA 4OZUA 4LG8A 3DM0A 1C9IA 3MZKA 3F3PA 3GREA 2HXCA 3MKSB 3I7NA 3PVWB 3E0CA 4J79A 1OMWB 2HU7A 1TBGA 1O6GA 3NIDA 3KCIA 4GM3A 2HJBA 4JD2C 4QT8A 3KRWB 2H9NA 1ERJA 5FXYA 2VC2A 3IJ0A 5HE0B 1YFQA 2OIZA 3JPXA 4GQ1A 2YNNA 2OJYA 4UM8A 4Z8LA 3NVNA 4EWRA 5JWZA 2P9UC 5HDBA 5GSAA 5H14A 2XE4A 2VDNA 2G9AA 3C99A 3IIYA 5EM2B 3UVOA 5IC7A 4A0BA 1L5GA 4O3TB 1VZ3A 3EI4A 3EQ7A 3ZDXA 3EQ8A 3DXMC 2P9PC 4NBMA 3ZE0A 4A09A 4BL0A 4AOWA 2GNQA 2H6KA 1UTCA 5IGQA 4AMYA 2H13A 4J0XA 4E5ZB 2CNXA 2O9KA 2YBAA 1PBYB 3I7HA 4DNWA 4GM9A 4O1QD 4K3ID 2H9PA 4Y7RA 1PI6A 3IUQA 3DDUA 4QRJA 3P4FA 2J57G 4MMXA 3I7OA 2XZGA 1PEVA 4BCCA 2Z2NA 3AFCA 2HU5A 2VZ3A 4JSXC 2PM9B 2BBKH 4FA5D 3SHFA
chains in the Genus database with same CATH topology
3UVNA 3I2NA 4GZ8A 1N6EA 4ESGA 3UVMA 2H9MA 2J56H 5HE3B 5A2Qg 4X3EA 5I5JA 3UVLA 1K32A 1MG3A 2HYEA 2OK6A 4J73A 3V9FA 2OVQB 3NVQA 5EAMA 4A0BB 4CY3A 3EI4B 5H17A 3VGZA 4MK0B 4J87A 4PC0A 5EAPA 5TDHB 4A09B 3C9CA 3ULEC 4XYIA 3SBRA 3JROA 4I79A 2CE8A 5THAA 4D0KA 5KDOB 1K8KC 4ZOVA 4L1QD 4CZXA 1B9XA 4L3HD 3RN1D 3SVWD 1MG2A 4G56B 3N0DA 5IJ7E 1N6DA 1B9YA 2H14A 3EI2A 2XL3A 5K19A 4ERQA 4BUJC 1JMZB 1U2VC 4AEZA 3JZGA 4FHLA 3SMRA 1OLZA 5FKRA 4A2LA 2IAAA 3OKYA 3RSEC 4O3UB 4J8GA 1SQ9A 4PBZA 5I5IA 2AQ5A 1FWXA 3SCYA 4NSXA 4ZN4A 4N14A 5I5MA 4XEIC 1XIPA 3I8EA 4GGDA 2GC7A 2TRCB 2CN3A 3L4OD 3CFSB 2CE9A 3PXSD 5TEEA 5GXHA 3JZNA 4PBYA 2MTAH 5IGOA 3KRXB 3SLED 2IURA 5HE1B 5HYNB 3I7KA 1SHYB 3OW8A 2YNOA 3SXTD 3IJ1A 4PSWB 3V7DB 3NVXA 4LGNA 4A11A 4KFMB 2W18A 3SJLD 2XL2A 2CO0A 3VA6A 2I0TA 3L4MD 3JZHA 4YVDA 5EMMB 1GOTB 3EI3A 3IIWA 2HKRA 3JAMg 4UI9R 4A08A 3PSLA 1JMXB 2PBIB 1Q47A 3RFGA 4CI8A 3F3GA 3OL2A 4CY5A 3ORVD 1GXRA 5CYKA 2P9KC 1XKSA 2QXVA 4JT5C 4JSNC 3BG0A 5EARA 2H6QA 3EMHA 4TZ4A 4A0AA 4FA4D 3HFQA 3DWLC 2UZXB 4JT6C 5TEFA 3RN0D 3AL8A 4O9DA 5B4WA 4E54A 4CY2A 5EALA 4A11B 4ZOZA 2I3SA 4U7AA 4J82A 4J81A 3EG6A 1JJUB 3PVUB 1A0RB 3EI3B 2J55H 4A7JA 4A08B 3DSMA 2HESX 3F3FA 3OL2B 2CN2A 5SXMA 2H6NA 4L9OA 5TF2A 3EWEA 4ERYA 1MDAH 3CIKB 2EBSA 4CC9A 3SFZA 3J80g 1NR0A 2OVPB 3RRMC 2B4EA 3I8CA 2I3TA 1QNIA 2IUPA 3IKOA 4GGAA 2Q7QA 3BWSA 3C5MA 2B5MA 4J0WA 3AL8B 3MZLA 2IUQA 4HDJA 5FKSA 4IA9A 4L3GD 4E54B 2AGWA 3UKUC 4CZYA 4QQEA 2PM7B 4D6VA 2CO0C 3N0EA 4U1EI 2AGLA 3W15A 2H3XA 5AMSA 4FWWA 3U4YA 3PXTD 3PXWD 4CI3A 3PSCB 1TYQC 4J8BA 3JRPA 2QC5A 4H5IA 5AFU3 5AJAA 3OKTA 2IWFA 4GQ2P 2IUVA 5K1CC 5IT9g 4E5ZA 4X61B 2Z2PA 5HE2B 3DXKC 4A2MA 3SBPA 3ODTA 1NEXB 3EI2B 5FLXg 5CXBA 3V5WB 5GMKn 3RMZD 2PM9A 5FKTA 2OK4A 5FQDA 2AH1A 3EI1A 4OWRA 2GC4A 3K26A 4R7AB 5EMLB 2YMUA 1JOFA 1U4CA 3OKYB 2B5NA 2I0SA 4FA9D 4ES0A 4GMBA 4ERZA 4JSVC 3RLMD 2G99A 3BG1A 2P9NC 1N6FA 4X63B 1VYHC 3FM0A 4PSXB 5C2WB 2XYIA 3MKQA 2B5LA 5CXCA 4JSPC 3PE7A 2UZYB 2AGXA 2HKMA 5HQGA 4X60B 5C9ZB 3B7FA 4ZOYA 2YB8B 5H1MA 4XYHA 3SN6B 2OVRB 3FRXA 5C2VB 5EMJB 2HJ4A 4PNKB 2H9LA 2H68A 5IJ8E 3OTTA 3C75H 4Y5RD 3A0FA 5FKQA 3MMYA 1RI6A 3K27A 4H5JA 5CXBB 5FA5B 4GQBB 3J81g 2AGYA 4GM8A 5EMKB 3EI1B 3FGBA 1PGUA 3I89A 3AL9A 4QL1A 4FAVD 2I0RA 4IMMA 2P9IC 4ZOXA 2P9SC 4CI2A 3MXXA 3SWSD 2PM6B 1P22A 4CY1A 1XHMA 2Z2OA 2H47A 4K3JB 3UKRC 3EU7A 4J84A 3VH0A 3RFHA 5CYKB 3CFVA 5CXCB 1S4UX 3GFCA 1GP2B 2XU7A 4J86A 3JB9L 5GXIA 4A0AB 1R5MA 3ZWLB 4LG9A 2AH0A 3UR4A 4O45A 3OKWA 3I7LA 1SQJA 2IWKA 3I7PA 4CI1A 4BH6A 4J78A 4FB1D 4J77A 5EM2A 1L0QA 2YNPA 2BCJB 4GGCA 3SBQA 4FA1D 4JXMA 2AGZA 3AH8B 4PXWA 3UVKA 1GG2B 2P9LC 3IJCA 4FAND 4CZVA 4OZUA 4LG8A 3DM0A 3MZKA 3F3PA 3GREA 2HXCA 3MKSB 3I7NA 3PVWB 3E0CA 4J79A 1OMWB 1TBGA 4GM3A 2HJBA 4JD2C 4QT8A 3KRWB 2H9NA 1ERJA 5FXYA 3IJ0A 5HE0B 1YFQA 2OIZA 3JPXA 4GQ1A 2YNNA 2OJYA 4Z8LA 3NVNA 4EWRA 5JWZA 2P9UC 5GSAA 5H14A 2G9AA 3C99A 3IIYA 5EM2B 3UVOA 5IC7A 4A0BA 4O3TB 3EI4A 3DXMC 2P9PC 4A09A 4BL0A 4AOWA 2GNQA 2H6KA 5IGQA 2H13A 4J0XA 4E5ZB 2CNXA 2O9KA 2YBAA 1PBYB 3I7HA 4GM9A 4O1QD 4K3ID 2H9PA 4Y7RA 1PI6A 4QRJA 3P4FA 2J57G 3I7OA 1PEVA 2Z2NA 3AFCA 4JSXC 2PM9B 2BBKH 4FA5D 3SHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVN A;  3I2N A;  4GZ8 A;  1N6E A;  4ESG A;  3UVM A;  2H9M A;  2J56 H;  5HE3 B;  5A2Q g;  4X3E A;  5I5J A;  3UVL A;  1K32 A;  1MG3 A;  2HYE A;  2OK6 A;  4J73 A;  3V9F A;  2OVQ B;  3NVQ A;  5EAM A;  4A0B B;  4CY3 A;  3EI4 B;  5H17 A;  3VGZ A;  4MK0 B;  4J87 A;  4PC0 A;  5EAP A;  5TDH B;  4A09 B;  3C9C A;  3ULE C;  4XYI A;  3SBR A;  3JRO A;  4I79 A;  2CE8 A;  5THA A;  4D0K A;  5KDO B;  1K8K C;  4ZOV A;  4L1Q D;  4CZX A;  1B9X A;  4L3H D;  3RN1 D;  3SVW D;  1MG2 A;  4G56 B;  3N0D A;  5IJ7 E;  1N6D A;  1B9Y A;  2H14 A;  3EI2 A;  2XL3 A;  5K19 A;  4ERQ A;  4BUJ C;  1JMZ B;  1U2V C;  4AEZ A;  3JZG A;  4FHL A;  3SMR A;  1OLZ A;  5FKR A;  4A2L A;  2IAA A;  3OKY A;  3RSE C;  4O3U B;  4J8G A;  1SQ9 A;  4PBZ A;  5I5I A;  2AQ5 A;  1FWX A;  3SCY A;  4NSX A;  4ZN4 A;  4N14 A;  5I5M A;  4XEI C;  1XIP A;  3I8E A;  4GGD A;  2GC7 A;  2TRC B;  2CN3 A;  3L4O D;  3CFS B;  2CE9 A;  3PXS D;  5TEE A;  5GXH A;  3JZN A;  4PBY A;  2MTA H;  5IGO A;  3KRX B;  3SLE D;  2IUR A;  5HE1 B;  5HYN B;  3I7K A;  1SHY B;  3OW8 A;  2YNO A;  3SXT D;  3IJ1 A;  4PSW B;  3V7D B;  3NVX A;  4LGN A;  4A11 A;  4KFM B;  2W18 A;  3SJL D;  2XL2 A;  2CO0 A;  3VA6 A;  2I0T A;  3L4M D;  3JZH A;  4YVD A;  5EMM B;  1GOT B;  3EI3 A;  3IIW A;  2HKR A;  3JAM g;  4UI9 R;  4A08 A;  3PSL A;  1JMX B;  2PBI B;  1Q47 A;  3RFG A;  4CI8 A;  3F3G A;  3OL2 A;  4CY5 A;  3ORV D;  1GXR A;  5CYK A;  2P9K C;  1XKS A;  2QXV A;  4JT5 C;  4JSN C;  3BG0 A;  5EAR A;  2H6Q A;  3EMH A;  4TZ4 A;  4A0A A;  4FA4 D;  3HFQ A;  3DWL C;  2UZX B;  4JT6 C;  5TEF A;  3RN0 D;  3AL8 A;  4O9D A;  5B4W A;  4E54 A;  4CY2 A;  5EAL A;  4A11 B;  4ZOZ A;  2I3S A;  4U7A A;  4J82 A;  4J81 A;  3EG6 A;  1JJU B;  3PVU B;  1A0R B;  3EI3 B;  2J55 H;  4A7J A;  4A08 B;  3DSM A;  2HES X;  3F3F A;  3OL2 B;  2CN2 A;  5SXM A;  2H6N A;  4L9O A;  5TF2 A;  3EWE A;  4ERY A;  1MDA H;  3CIK B;  2EBS A;  4CC9 A;  3SFZ A;  3J80 g;  1NR0 A;  2OVP B;  3RRM C;  2B4E A;  3I8C A;  2I3T A;  1QNI A;  2IUP A;  3IKO A;  4GGA A;  2Q7Q A;  3BWS A;  3C5M A;  2B5M A;  4J0W A;  3AL8 B;  3MZL A;  2IUQ A;  4HDJ A;  5FKS A;  4IA9 A;  4L3G D;  4E54 B;  2AGW A;  3UKU C;  4CZY A;  4QQE A;  2PM7 B;  4D6V A;  2CO0 C;  3N0E A;  4U1E I;  2AGL A;  3W15 A;  2H3X A;  5AMS A;  4FWW A;  3U4Y A;  3PXT D;  3PXW D;  4CI3 A;  3PSC B;  1TYQ C;  4J8B A;  3JRP A;  2QC5 A;  4H5I A;  5AFU 3;  5AJA A;  3OKT A;  2IWF A;  4GQ2 P;  2IUV A;  5K1C C;  5IT9 g;  4E5Z A;  4X61 B;  2Z2P A;  5HE2 B;  3DXK C;  4A2M A;  3SBP A;  3ODT A;  1NEX B;  3EI2 B;  5FLX g;  5CXB A;  3V5W B;  5GMK n;  3RMZ D;  2PM9 A;  5FKT A;  2OK4 A;  5FQD A;  2AH1 A;  3EI1 A;  4OWR A;  2GC4 A;  3K26 A;  4R7A B;  5EML B;  2YMU A;  1JOF A;  1U4C A;  3OKY B;  2B5N A;  2I0S A;  4FA9 D;  4ES0 A;  4GMB A;  4ERZ A;  4JSV C;  3RLM D;  2G99 A;  3BG1 A;  2P9N C;  1N6F A;  4X63 B;  1VYH C;  3FM0 A;  4PSX B;  5C2W B;  2XYI A;  3MKQ A;  2B5L A;  5CXC A;  4JSP C;  3PE7 A;  2UZY B;  2AGX A;  2HKM A;  5HQG A;  4X60 B;  5C9Z B;  3B7F A;  4ZOY A;  2YB8 B;  5H1M A;  4XYH A;  3SN6 B;  2OVR B;  3FRX A;  5C2V B;  5EMJ B;  2HJ4 A;  4PNK B;  2H9L A;  2H68 A;  5IJ8 E;  3OTT A;  3C75 H;  4Y5R D;  3A0F A;  5FKQ A;  3MMY A;  1RI6 A;  3K27 A;  4H5J A;  5CXB B;  5FA5 B;  4GQB B;  3J81 g;  2AGY A;  4GM8 A;  5EMK B;  3EI1 B;  3FGB A;  1PGU A;  3I89 A;  3AL9 A;  4QL1 A;  4FAV D;  2I0R A;  4IMM A;  2P9I C;  4ZOX A;  2P9S C;  4CI2 A;  3MXX A;  3SWS D;  2PM6 B;  1P22 A;  4CY1 A;  1XHM A;  2Z2O A;  2H47 A;  4K3J B;  3UKR C;  3EU7 A;  4J84 A;  3VH0 A;  3RFH A;  5CYK B;  3CFV A;  5CXC B;  1S4U X;  3GFC A;  1GP2 B;  2XU7 A;  4J86 A;  3JB9 L;  5GXI A;  4A0A B;  1R5M A;  3ZWL B;  4LG9 A;  2AH0 A;  3UR4 A;  4O45 A;  3OKW A;  3I7L A;  1SQJ A;  2IWK A;  3I7P A;  4CI1 A;  4BH6 A;  4J78 A;  4FB1 D;  4J77 A;  5EM2 A;  1L0Q A;  2YNP A;  2BCJ B;  4GGC A;  3SBQ A;  4FA1 D;  4JXM A;  2AGZ A;  3AH8 B;  4PXW A;  3UVK A;  1GG2 B;  2P9L C;  3IJC A;  4FAN D;  4CZV A;  4OZU A;  4LG8 A;  3DM0 A;  3MZK A;  3F3P A;  3GRE A;  2HXC A;  3MKS B;  3I7N A;  3PVW B;  3E0C A;  4J79 A;  1OMW B;  1TBG A;  4GM3 A;  2HJB A;  4JD2 C;  4QT8 A;  3KRW B;  2H9N A;  1ERJ A;  5FXY A;  3IJ0 A;  5HE0 B;  1YFQ A;  2OIZ A;  3JPX A;  4GQ1 A;  2YNN A;  2OJY A;  4Z8L A;  3NVN A;  4EWR A;  5JWZ A;  2P9U C;  5GSA A;  5H14 A;  2G9A A;  3C99 A;  3IIY A;  5EM2 B;  3UVO A;  5IC7 A;  4A0B A;  4O3T B;  3EI4 A;  3DXM C;  2P9P C;  4A09 A;  4BL0 A;  4AOW A;  2GNQ A;  2H6K A;  5IGQ A;  2H13 A;  4J0X A;  4E5Z B;  2CNX A;  2O9K A;  2YBA A;  1PBY B;  3I7H A;  4GM9 A;  4O1Q D;  4K3I D;  2H9P A;  4Y7R A;  1PI6 A;  4QRJ A;  3P4F A;  2J57 G;  3I7O A;  1PEV A;  2Z2N A;  3AFC A;  4JSX C;  2PM9 B;  2BBK H;  4FA5 D;  3SHF A; 
#chains in the Genus database with same CATH topology
 3UVN A;  3I2N A;  4GZ8 A;  2QZP A;  1N6E A;  4ESG A;  3UVM A;  2H9M A;  2J56 H;  5HE3 B;  3ZDY A;  1VE7 A;  5A2Q g;  2BKL A;  4X3E A;  2JKX A;  5I5J A;  3UVL A;  1K32 A;  1MG3 A;  4WK0 A;  2HYE A;  2OK6 A;  4J73 A;  3V9F A;  2OVQ B;  3IVM A;  3QI0 A;  3NVQ A;  1UOP A;  5EAM A;  1E8N A;  3IJE A;  4A0B B;  4Z7N A;  4CY3 A;  3EI4 B;  5H17 A;  3VGZ A;  4MK0 B;  4G1E A;  4J87 A;  3EQ9 A;  4PC0 A;  5EAP A;  1H2Y A;  5TDH B;  4A09 B;  2EIE A;  3C9C A;  3ULE C;  2HU8 A;  4XYI A;  3SBR A;  2QR5 A;  1K3I A;  3JRO A;  4I79 A;  2CE8 A;  5THA A;  4AN1 A;  4D0K A;  5KDO B;  4AMZ A;  1JV2 A;  1K8K C;  4ZOV A;  4L1Q D;  4CZX A;  3VI4 A;  1B9X A;  4L3H D;  3RN1 D;  4DNU A;  3SVW D;  1MG2 A;  4G56 B;  3N0D A;  5IJ7 E;  4JHP C;  1N6D A;  1B9Y A;  2H14 A;  1GOH A;  3EI2 A;  2XL3 A;  5K19 A;  4MMZ A;  4ERQ A;  1VE6 A;  4BUJ C;  1JMZ B;  1U2V C;  3OF7 A;  4AEZ A;  4G1M A;  5M5V A;  3JZG A;  4FHL A;  3SMR A;  1OLZ A;  5FKR A;  4A2L A;  2IAA A;  3OKY A;  2EIC A;  3RSE C;  3VI3 A;  4O3U B;  3FCU A;  3V4P A;  4J8G A;  1SQ9 A;  4PBZ A;  5I5I A;  1E5T A;  2AQ5 A;  1FWX A;  2VDL A;  2WQ8 A;  4NSX A;  4NC4 A;  3SCY A;  4ZN4 A;  4N14 A;  4WK4 A;  5I5M A;  4XEI C;  4BCB A;  1XIP A;  3I8E A;  4GGD A;  2GC7 A;  2TRC B;  2CN3 A;  2VDK A;  3L4O D;  3CFS B;  2CE9 A;  3PXS D;  3FCS A;  4MMY A;  5TEE A;  5GXH A;  3JZN A;  4PBY A;  4D9S A;  2MTA H;  5IGO A;  4RE5 A;  3KRX B;  3SLE D;  2IUR A;  5HE1 B;  5HYN B;  5E6R A;  3I7K A;  1SHY B;  3OW8 A;  2YNO A;  3SXT D;  1C9L A;  1TYE A;  3IJ1 A;  4PSW B;  3V7D B;  3GC3 B;  2VZ1 A;  3NVX A;  4LGN A;  4JHN A;  4A11 A;  4KFM B;  5C86 A;  2W18 A;  5FFO A;  3SJL D;  2XL2 A;  2CO0 A;  3VA6 A;  2I0T A;  3L4M D;  3JZH A;  4YVD A;  5EMM B;  1GOT B;  3EI3 A;  1M1X A;  3IIW A;  2HKR A;  3JAM g;  4WK2 A;  4UI9 R;  4A08 A;  3PSL A;  4AN0 A;  1JMX B;  1A12 A;  2PBI B;  1Q47 A;  3RFG A;  4CI8 A;  3F3G A;  3ZDZ A;  3OL2 A;  4CY5 A;  3ORV D;  5FFG A;  1GXR A;  5CYK A;  2P9K C;  1XKS A;  2QXV A;  4JT5 C;  4JSN C;  1VZ2 A;  5E6U A;  3BG0 A;  5EAR A;  2H6Q A;  3EMH A;  4TZ4 A;  4A0A A;  4FA4 D;  3HFQ A;  3K71 A;  3DWL C;  2UZX B;  1T2X A;  4JT6 C;  5TEF A;  3RN0 D;  3AL8 A;  4AX4 A;  4O9D A;  5B4W A;  1QFM A;  4E54 A;  4CY2 A;  3MVD K;  5EAL A;  4A11 B;  3IUL A;  4ZOZ A;  2I3S A;  2XDW A;  4U7A A;  4J82 A;  1GOF A;  3EG6 A;  4J81 A;  4BP8 A;  4BP9 A;  1JJU B;  3K72 A;  3PVU B;  3O4H A;  1A0R B;  3EI3 B;  2J55 H;  4A7J A;  4A08 B;  4WJK A;  3DSM A;  2HES X;  5E6S A;  3F3F A;  3OL2 B;  2VDQ A;  2CN2 A;  5SXM A;  2H6N A;  4L9O A;  5TF2 A;  3EWE A;  4ERY A;  1MDA H;  3CIK B;  1GOG A;  2EBS A;  4CC9 A;  5M5T A;  2EIB A;  4Z7O A;  3SFZ A;  4NEN A;  1O6F A;  3MUN A;  3J80 g;  1NR0 A;  2OVP B;  3RRM C;  2B4E A;  5M61 A;  3I8C A;  2I3T A;  1QNI A;  2IUP A;  3IKO A;  2VDO A;  4GGA A;  2Q7Q A;  3BWS A;  3K6S A;  3C5M A;  2B5M A;  3AL8 B;  3MZL A;  4J0W A;  2IUQ A;  4HDJ A;  5FKS A;  4O2W A;  4DNV A;  4IA9 A;  4L3G D;  4NAA A;  3O4I A;  4E54 B;  2AGW A;  4L1M A;  3UKU C;  4CZY A;  4QQE A;  2PM7 B;  4D6V A;  2CO0 C;  3N0E A;  3IUJ A;  2AGL A;  4U1E I;  3W15 A;  2H3X A;  5AMS A;  4FWW A;  3U4Y A;  3PXT D;  3PXW D;  4CI3 A;  3O4J A;  3PSC B;  1TYQ C;  4J8B A;  3JRP A;  2QC5 A;  5C92 A;  4H5I A;  5AFU 3;  5AJA A;  3OKT A;  2IWF A;  4GQ2 P;  2IUV A;  5K1C C;  5IT9 g;  4E5Z A;  4X61 B;  2Z2P A;  4BCD A;  5HE2 B;  3DXK C;  4A2M A;  3SBP A;  3ODT A;  1NEX B;  5M5U A;  3GD1 I;  3EI2 B;  5FLX g;  3V4V A;  5CXB A;  3V5W B;  5GMK n;  3IUN A;  3RMZ D;  2PM9 A;  5FKT A;  2OK4 A;  5FQD A;  2AH1 A;  3EI1 A;  4OWR A;  1UOO A;  2GC4 A;  3K26 A;  4R7A B;  5EML B;  2YMU A;  1JOF A;  1U4C A;  3NIG A;  3OKY B;  2B5N A;  2I0S A;  4O02 A;  4FA9 D;  1H2X A;  4ES0 A;  4GMB A;  4ERZ A;  4JSV C;  1E8M A;  3RLM D;  2G99 A;  3BG1 A;  2P9N C;  1N6F A;  4X63 B;  1VYH C;  3FM0 A;  4PSX B;  5M5R A;  5C2W B;  1BPO A;  2XYI A;  3MKQ A;  2B5L A;  5CXC A;  4G55 A;  4JSP C;  3PE7 A;  2EID A;  4QAM A;  2UZY B;  2AGX A;  2HKM A;  5HQG A;  4X60 B;  5C9Z B;  3B7F A;  1U8C A;  4ZOY A;  2YB8 B;  5H1M A;  4XYH A;  3SN6 B;  2OVR B;  3FRX A;  5C2V B;  4Z7Q A;  3ZE1 A;  5EMJ B;  2HJ4 A;  4PNK B;  2H9L A;  2H68 A;  1QFS A;  5IJ8 E;  3OTT A;  1H2Z A;  3C75 H;  4Y5R D;  3A0F A;  5FKQ A;  3MMY A;  1I2M B;  1RI6 A;  3K27 A;  4H5J A;  5CXB B;  5FA5 B;  4GQB B;  3ZE2 A;  3J81 g;  2AGY A;  4GM8 A;  2VDM A;  5EMK B;  3EI1 B;  3MUO A;  3FGB A;  1PGU A;  3I89 A;  3AL9 A;  4QL1 A;  4FAV D;  2I0R A;  4IMM A;  2P9I C;  4ZOX A;  2P9S C;  4CI2 A;  3T3M A;  3MXX A;  3SWS D;  2PM6 B;  1P22 A;  4CY1 A;  1XHM A;  2Z2O A;  2H47 A;  4K3J B;  3UKR C;  1UOQ A;  3EU7 A;  4J84 A;  3VH0 A;  3O4G A;  3RFH A;  5CYK B;  3CFV A;  5CXC B;  1S4U X;  5M5S A;  3GFC A;  1GP2 B;  3QHY B;  1JTD B;  2XU7 A;  4J86 A;  3JB9 L;  5GXI A;  4A0A B;  2VDP A;  3IUR A;  1R5M A;  3ZWL B;  4LG9 A;  2AH0 A;  3UR4 A;  4O45 A;  3OKW A;  4IRZ A;  1YR2 A;  3I7L A;  1SQJ A;  4RE6 A;  2IWK A;  3I7P A;  4CI1 A;  4BH6 A;  4J78 A;  4FB1 D;  4J77 A;  5EM2 A;  1L0Q A;  4UM9 A;  2YNP A;  2VDR A;  2BCJ B;  3T3P A;  4GGC A;  3SBQ A;  4FA1 D;  3IUM A;  4JXM A;  1H2W A;  2AGZ A;  3AH8 B;  4PXW A;  3UVK A;  1GG2 B;  3NIF A;  2P9L C;  3IJC A;  4FAN D;  4CZV A;  4OZU A;  4LG8 A;  3DM0 A;  1C9I A;  3MZK A;  3F3P A;  3GRE A;  2HXC A;  3MKS B;  3I7N A;  3PVW B;  3E0C A;  4J79 A;  1OMW B;  2HU7 A;  1TBG A;  1O6G A;  3NID A;  3KCI A;  4GM3 A;  2HJB A;  4JD2 C;  4QT8 A;  3KRW B;  2H9N A;  1ERJ A;  5FXY A;  2VC2 A;  3IJ0 A;  5HE0 B;  1YFQ A;  2OIZ A;  3JPX A;  4GQ1 A;  2YNN A;  2OJY A;  4UM8 A;  4Z8L A;  3NVN A;  4EWR A;  5JWZ A;  2P9U C;  5HDB A;  5GSA A;  5H14 A;  2XE4 A;  2VDN A;  2G9A A;  3C99 A;  3IIY A;  5EM2 B;  3UVO A;  5IC7 A;  4A0B A;  1L5G A;  4O3T B;  1VZ3 A;  3EI4 A;  3EQ7 A;  3ZDX A;  3EQ8 A;  3DXM C;  2P9P C;  4NBM A;  3ZE0 A;  4A09 A;  4BL0 A;  4AOW A;  2GNQ A;  2H6K A;  1UTC A;  5IGQ A;  4AMY A;  2H13 A;  4J0X A;  4E5Z B;  2CNX A;  2O9K A;  2YBA A;  1PBY B;  3I7H A;  4DNW A;  4GM9 A;  4O1Q D;  4K3I D;  2H9P A;  4Y7R A;  1PI6 A;  3IUQ A;  3DDU A;  4QRJ A;  3P4F A;  2J57 G;  4MMX A;  3I7O A;  2XZG A;  1PEV A;  4BCC A;  2Z2N A;  3AFC A;  2HU5 A;  2VZ3 A;  4JSX C;  2PM9 B;  2BBK H;  4FA5 D;  3SHF A; 
#chains in the Genus database with same CATH homology
 3UVN A;  3I2N A;  4GZ8 A;  1N6E A;  4ESG A;  3UVM A;  2H9M A;  2J56 H;  5HE3 B;  5A2Q g;  4X3E A;  5I5J A;  3UVL A;  1K32 A;  1MG3 A;  2HYE A;  2OK6 A;  4J73 A;  3V9F A;  2OVQ B;  3NVQ A;  5EAM A;  4A0B B;  4CY3 A;  3EI4 B;  5H17 A;  3VGZ A;  4MK0 B;  4J87 A;  4PC0 A;  5EAP A;  5TDH B;  4A09 B;  3C9C A;  3ULE C;  4XYI A;  3SBR A;  3JRO A;  4I79 A;  2CE8 A;  5THA A;  4D0K A;  5KDO B;  1K8K C;  4ZOV A;  4L1Q D;  4CZX A;  1B9X A;  4L3H D;  3RN1 D;  3SVW D;  1MG2 A;  4G56 B;  3N0D A;  5IJ7 E;  1N6D A;  1B9Y A;  2H14 A;  3EI2 A;  2XL3 A;  5K19 A;  4ERQ A;  4BUJ C;  1JMZ B;  1U2V C;  4AEZ A;  3JZG A;  4FHL A;  3SMR A;  1OLZ A;  5FKR A;  4A2L A;  2IAA A;  3OKY A;  3RSE C;  4O3U B;  4J8G A;  1SQ9 A;  4PBZ A;  5I5I A;  2AQ5 A;  1FWX A;  3SCY A;  4NSX A;  4ZN4 A;  4N14 A;  5I5M A;  4XEI C;  1XIP A;  3I8E A;  4GGD A;  2GC7 A;  2TRC B;  2CN3 A;  3L4O D;  3CFS B;  2CE9 A;  3PXS D;  5TEE A;  5GXH A;  3JZN A;  4PBY A;  2MTA H;  5IGO A;  3KRX B;  3SLE D;  2IUR A;  5HE1 B;  5HYN B;  3I7K A;  1SHY B;  3OW8 A;  2YNO A;  3SXT D;  3IJ1 A;  4PSW B;  3V7D B;  3NVX A;  4LGN A;  4A11 A;  4KFM B;  2W18 A;  3SJL D;  2XL2 A;  2CO0 A;  3VA6 A;  2I0T A;  3L4M D;  3JZH A;  4YVD A;  5EMM B;  1GOT B;  3EI3 A;  3IIW A;  2HKR A;  3JAM g;  4UI9 R;  4A08 A;  3PSL A;  1JMX B;  2PBI B;  1Q47 A;  3RFG A;  4CI8 A;  3F3G A;  3OL2 A;  4CY5 A;  3ORV D;  1GXR A;  5CYK A;  2P9K C;  1XKS A;  2QXV A;  4JT5 C;  4JSN C;  3BG0 A;  5EAR A;  2H6Q A;  3EMH A;  4TZ4 A;  4A0A A;  4FA4 D;  3HFQ A;  3DWL C;  2UZX B;  4JT6 C;  5TEF A;  3RN0 D;  3AL8 A;  4O9D A;  5B4W A;  4E54 A;  4CY2 A;  5EAL A;  4A11 B;  4ZOZ A;  2I3S A;  4U7A A;  4J82 A;  4J81 A;  3EG6 A;  1JJU B;  3PVU B;  1A0R B;  3EI3 B;  2J55 H;  4A7J A;  4A08 B;  3DSM A;  2HES X;  3F3F A;  3OL2 B;  2CN2 A;  5SXM A;  2H6N A;  4L9O A;  5TF2 A;  3EWE A;  4ERY A;  1MDA H;  3CIK B;  2EBS A;  4CC9 A;  3SFZ A;  3J80 g;  1NR0 A;  2OVP B;  3RRM C;  2B4E A;  3I8C A;  2I3T A;  1QNI A;  2IUP A;  3IKO A;  4GGA A;  2Q7Q A;  3BWS A;  3C5M A;  2B5M A;  4J0W A;  3AL8 B;  3MZL A;  2IUQ A;  4HDJ A;  5FKS A;  4IA9 A;  4L3G D;  4E54 B;  2AGW A;  3UKU C;  4CZY A;  4QQE A;  2PM7 B;  4D6V A;  2CO0 C;  3N0E A;  4U1E I;  2AGL A;  3W15 A;  2H3X A;  5AMS A;  4FWW A;  3U4Y A;  3PXT D;  3PXW D;  4CI3 A;  3PSC B;  1TYQ C;  4J8B A;  3JRP A;  2QC5 A;  4H5I A;  5AFU 3;  5AJA A;  3OKT A;  2IWF A;  4GQ2 P;  2IUV A;  5K1C C;  5IT9 g;  4E5Z A;  4X61 B;  2Z2P A;  5HE2 B;  3DXK C;  4A2M A;  3SBP A;  3ODT A;  1NEX B;  3EI2 B;  5FLX g;  5CXB A;  3V5W B;  5GMK n;  3RMZ D;  2PM9 A;  5FKT A;  2OK4 A;  5FQD A;  2AH1 A;  3EI1 A;  4OWR A;  2GC4 A;  3K26 A;  4R7A B;  5EML B;  2YMU A;  1JOF A;  1U4C A;  3OKY B;  2B5N A;  2I0S A;  4FA9 D;  4ES0 A;  4GMB A;  4ERZ A;  4JSV C;  3RLM D;  2G99 A;  3BG1 A;  2P9N C;  1N6F A;  4X63 B;  1VYH C;  3FM0 A;  4PSX B;  5C2W B;  2XYI A;  3MKQ A;  2B5L A;  5CXC A;  4JSP C;  3PE7 A;  2UZY B;  2AGX A;  2HKM A;  5HQG A;  4X60 B;  5C9Z B;  3B7F A;  4ZOY A;  2YB8 B;  5H1M A;  4XYH A;  3SN6 B;  2OVR B;  3FRX A;  5C2V B;  5EMJ B;  2HJ4 A;  4PNK B;  2H9L A;  2H68 A;  5IJ8 E;  3OTT A;  3C75 H;  4Y5R D;  3A0F A;  5FKQ A;  3MMY A;  1RI6 A;  3K27 A;  4H5J A;  5CXB B;  5FA5 B;  4GQB B;  3J81 g;  2AGY A;  4GM8 A;  5EMK B;  3EI1 B;  3FGB A;  1PGU A;  3I89 A;  3AL9 A;  4QL1 A;  4FAV D;  2I0R A;  4IMM A;  2P9I C;  4ZOX A;  2P9S C;  4CI2 A;  3MXX A;  3SWS D;  2PM6 B;  1P22 A;  4CY1 A;  1XHM A;  2Z2O A;  2H47 A;  4K3J B;  3UKR C;  3EU7 A;  4J84 A;  3VH0 A;  3RFH A;  5CYK B;  3CFV A;  5CXC B;  1S4U X;  3GFC A;  1GP2 B;  2XU7 A;  4J86 A;  3JB9 L;  5GXI A;  4A0A B;  1R5M A;  3ZWL B;  4LG9 A;  2AH0 A;  3UR4 A;  4O45 A;  3OKW A;  3I7L A;  1SQJ A;  2IWK A;  3I7P A;  4CI1 A;  4BH6 A;  4J78 A;  4FB1 D;  4J77 A;  5EM2 A;  1L0Q A;  2YNP A;  2BCJ B;  4GGC A;  3SBQ A;  4FA1 D;  4JXM A;  2AGZ A;  3AH8 B;  4PXW A;  3UVK A;  1GG2 B;  2P9L C;  3IJC A;  4FAN D;  4CZV A;  4OZU A;  4LG8 A;  3DM0 A;  3MZK A;  3F3P A;  3GRE A;  2HXC A;  3MKS B;  3I7N A;  3PVW B;  3E0C A;  4J79 A;  1OMW B;  1TBG A;  4GM3 A;  2HJB A;  4JD2 C;  4QT8 A;  3KRW B;  2H9N A;  1ERJ A;  5FXY A;  3IJ0 A;  5HE0 B;  1YFQ A;  2OIZ A;  3JPX A;  4GQ1 A;  2YNN A;  2OJY A;  4Z8L A;  3NVN A;  4EWR A;  5JWZ A;  2P9U C;  5GSA A;  5H14 A;  2G9A A;  3C99 A;  3IIY A;  5EM2 B;  3UVO A;  5IC7 A;  4A0B A;  4O3T B;  3EI4 A;  3DXM C;  2P9P C;  4A09 A;  4BL0 A;  4AOW A;  2GNQ A;  2H6K A;  5IGQ A;  2H13 A;  4J0X A;  4E5Z B;  2CNX A;  2O9K A;  2YBA A;  1PBY B;  3I7H A;  4GM9 A;  4O1Q D;  4K3I D;  2H9P A;  4Y7R A;  1PI6 A;  4QRJ A;  3P4F A;  2J57 G;  3I7O A;  1PEV A;  2Z2N A;  3AFC A;  4JSX C;  2PM9 B;  2BBK H;  4FA5 D;  3SHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...