4K3ID

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug, c2 space group
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Structures of MauG in complex with quinol and quinone MADH.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 99
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4k3iD00
5FKTA 5C2VB 5FA5B 3SLED 3EI2B 3SCYA 3SWSD 2P9UC 5I5IA 2XU7A 3C5MA 3DWLC 4O3UB 4UI9R 4AEZA 5GXHA 3P4FA 4ZN4A 4A0AA 3EU7A 3DXMC 3V5WB 3I7KA 2PM9A 5H14A 3I7LA 4LG9A 5GXIA 4X3EA 4QL1A 4J77A 3I8CA 4J78A 2GC4A 3EI2A 5IGOA 3RFHA 5H1MA 5IGQA 3EG6A 3CIKB 1SQ9A 5B4WA 2CNXA 3RLMD 1L0QA 4G56B 2XL2A 2AQ5A 4GGDA 5FKRA 1K32A 1XHMA 2BBKH 1MG2A 3NVQA 4ERYA 3F3GA 3OKTA 3UVLA 2J56H 4KFMB 2H3XA 4ZOYA 4GM8A 3PVUB 5I5MA 3V9FA 4J84A 3UVMA 3AL8B 3OKYB 3JZNA 2YBAA 2PM6B 3JPXA 5EAPA 3J81g 4ERQA 3SHFA 3GREA 2I0RA 3NVNA 2H13A 3IJ1A 3UR4A 2IURA 2H9PA 5A2Qg 3SBRA 1P22A 5C9ZB 1OLZA 3AL8A 3OKYA 3PVWB 3BWSA 3V7DB 4LGNA 3MMYA 3BG0A 4U7AA 3UVOA 4J81A 3PXWD 3SBPA 2OK4A 5IJ7E 4Z8LA 2P9PC 2J57G 4J86A 3MXXA 4EWRA 4CI3A 3K26A 3RN0D 3AFCA 3L4OD 4GGAA 3IJ0A 4JT5C 5CXBB 3JZGA 5EAMA 3IIWA 1TBGA 5GSAA 2EBSA 4JXMA 4HDJA 4JD2C 4GM9A 1NEXB 2PM7B 2YMUA 3SBQA 4CI2A 1PEVA 1RI6A 2GC7A 5K19A 4J79A 3RN1D 2AGLA 3NVXA 5CXBA 1GOTB 4FHLA 2CN3A 4R7AB 5HE1B 4GGCA 1JJUB 2Z2NA 5EMKB 4U1EI 4X61B 2I3SA 5CXCB 3EI3B 3I8EA 5FKQA 4FAND 2P9KC 3B7FA 4L3HD 5EM2B 4JT6C 1Q47A 1K8KC 5EARA 5FLXg 5CYKB 4PC0A 4CZXA 3N0DA 2IWFA 1U4CA 2H6NA 2IAAA 3L4MD 1OMWB 4JSVC 1R5MA 4H5JA 4QQEA 4BL0A 5CXCA 3EI3A 3OTTA 2UZYB 2OVRB 3I7NA 4IMMA 2I3TA 3FM0A 2B5MA 5EM2A 4OWRA 5CYKA 4K3ID 2AGYA 5GMKn 3PSCB 2O9KA 2OJYA 3PXSD 3A0FA 2AGWA 3ZWLB 5IJ8E 1N6EA 2QC5A 4A2LA 1GP2B 3I2NA 3JZHA 4O1QD 2AH1A 4XYHA 2H6KA 4FB1D 4J87A 3SVWD 4BUJC 5IT9g 3OW8A 1PI6A 1QNIA 3EI1B 3ORVD 2YNNA 3PSLA 3VGZA 1SQJA 3SJLD 4GMBA 3KRWB 4FWWA 2YB8B 5TEFA 4D0KA 3I7HA 4BH6A 2GNQA 2HJBA 4GQ2P 1N6FA 3EI1A 3SN6B 4ESGA 4X60B 3RSEC 4PXWA 4ZOZA 2IUPA 3UVNA 3EWEA 4J8BA 2OVQB 4XYIA 5JWZA 3UVKA 1FWXA 2OIZA 5HYNB 3OL2B 4GQBB 2P9SC 4ES0A 3ODTA 4FA1D 5TEEA 2Z2PA 2IUQA 1NR0A 3AH8B 4GZ8A 4QRJA 3C99A 4CY5A 5C2WB 4D6VA 1SHYB 3JAMg 2W18A 2H9MA 4CZVA 2HKRA 5HE2B 1GXRA 3OL2A 5IC7A 4E54B 1B9YA 3SFZA 3IKOA 3W15A 2XYIA 1GG2B 4J82A 4PSWB 4A0BB 4QT8A 5FXYA 3KRXB 2P9LC 3F3FA 2P9IC 2OK6A 1JMXB 1B9XA 2HYEA 4E54A 2UZXB 4L9OA 2YNOA 2PBIB 2H14A 3C75H 3IIYA 4GM3A 4A0BA 4AOWA 3HFQA 1JMZB 2B5LA 5EMJB 4J8GA 2H9NA 5EALA 5H17A 3MZLA 2OVPB 2B4EA 4PBYA 2I0TA 4A2MA 4O9DA 1TYQC 2B5NA 5THAA 5SXMA 1U2VC 3VH0A 3I7OA 2MTAH 2G9AA 4CY1A 3MZKA 5K1CC 4L3GD 4FA4D 1S4UX 3K27A 3C9CA 3RFGA 4JSXC 3DM0A 4FAVD 4X63B 1PBYB 2H6QA 3RMZD 3PE7A 4PNKB 4CI8A 4J0WA 4NSXA 4ERZA 3EMHA 3AL9A 2G99A 4A11B 2J55H 2HESX 3ULEC 2HJ4A 4A08B 2CE8A 2I0SA 2QXVA 2H68A 5FKSA 3UKRC 1MG3A 4J73A 3EI4B 1ERJA 4O45A 5HE0B 4MK0B 3PXTD 4A7JA 5TF2A 4A11A 4IA9A 3SMRA 3BG1A 4A08A 5AMSA 5KDOB 5EMLB 4K3JB 4LG8A 3RRMC 4CY3A 2TRCB 4L1QD 5EMMB 3MKQA 3SXTD 1XKSA 1MDAH 3FGBA 3EI4A 1XIPA 3CFVA 4CY2A 3OKWA 3I89A 4JSPC 2HXCA 4PSXB 3CFSB 3E0CA 4ZOXA 2H9LA 1YFQA 4TZ4A 4CC9A 4FA9D 5FQDA 3F3PA 2CE9A 2BCJB 1JOFA 3DSMA 4JSNC 3JB9L 5AJAA 2AGXA 4Y7RA 4FA5D 3MKSB 2IUVA 3VA6A 3UKUC 3IJCA 1N6DA 2HKMA 2CO0C 3I7PA 2AH0A 2Z2OA 4XEIC 4A09B 2IWKA 4I79A 4OZUA 5I5JA 4CZYA 4H5IA 2P9NC 3DXKC 4N14A 4O3TB 3GFCA 3FRXA 4E5ZB 4J0XA 3JROA 5TDHB 2CN2A 2Q7QA 1PGUA 5AFU3 3JRPA 1A0RB 4A09A 3N0EA 4YVDA 3J80g 3U4YA 4PBZA 4GQ1A 2CO0A 5HE3B 5HQGA 4ZOVA 4Y5RD 1VYHC 4A0AB 2YNPA 2AGZA 4E5ZA 4CI1A 2PM9B 2H47A 2XL3A
chains in the Genus database with same CATH superfamily
1JTDB 5FKTA 5C2VB 5FA5B 3K6SA 3SLED 3EI2B 3SCYA 3SWSD 2P9UC 5I5IA 2XU7A 3C5MA 3DWLC 2QZPA 3NIDA 4O3UB 4UI9R 4AEZA 5GXHA 3P4FA 4ZN4A 4AMYA 2VDMA 4A0AA 3EU7A 3DXMC 3V5WB 2HU5A 3ZE0A 3I7KA 2PM9A 5H14A 3I7LA 4LG9A 5GXIA 4X3EA 4QL1A 4J77A 3I8CA 2XDWA 4J78A 2GC4A 4BCDA 3EI2A 5IGOA 3RFHA 1O6GA 5H1MA 5IGQA 3EG6A 4RE5A 3CIKB 4DNVA 4O2WA 1SQ9A 5B4WA 2VC2A 2CNXA 3RLMD 1L0QA 5M5TA 4G56B 2XL2A 2AQ5A 4GGDA 5FKRA 1K32A 1XHMA 2BBKH 2XE4A 1MG2A 3NVQA 4ERYA 3F3GA 2EICA 3OKTA 3UVLA 2J56H 4KFMB 2H3XA 4ZOYA 4Z7NA 4GM8A 3PVUB 5I5MA 3GD1I 3V9FA 4J84A 2VDKA 3GC3B 3UVMA 4Z7QA 3AL8B 3OKYB 3JZNA 2YBAA 2PM6B 4NC4A 3JPXA 5EAPA 3J81g 3T3PA 4ERQA 3SHFA 3GREA 2I0RA 3NVNA 2H13A 3IJ1A 3OF7A 2IURA 3UR4A 1O6FA 2H9PA 1BPOA 4NBMA 3IUQA 5A2Qg 3SBRA 1P22A 3EQ8A 1OLZA 5C9ZB 3AL8A 3OKYA 3PVWB 1GOFA 3BWSA 4L1MA 3V7DB 4LGNA 3MMYA 3BG0A 4U7AA 1E8NA 3UVOA 4J81A 3PXWD 3SBPA 2OK4A 5IJ7E 3K72A 4Z8LA 4BP9A 2HU7A 1VZ2A 2P9PC 4MMXA 2J57G 4J86A 3MXXA 4EWRA 4CI3A 3K26A 3RN0D 1H2YA 3AFCA 3L4OD 3IJ0A 3IULA 4GGAA 4JT5C 5CXBB 3JZGA 5EAMA 3IIWA 1TBGA 5GSAA 2EBSA 4JXMA 4HDJA 4JD2C 1M1XA 4GM9A 1UOOA 1NEXB 2PM7B 2YMUA 3SBQA 4CI2A 1PEVA 1RI6A 3IURA 2GC7A 3NIFA 1GOGA 5K19A 4J79A 4MMZA 3RN1D 2AGLA 3NVXA 5CXBA 1GOTB 4FHLA 2CN3A 1UOQA 4G1EA 4R7AB 5HE1B 4GGCA 1JJUB 2Z2NA 5EMKB 4U1EI 4X61B 2I3SA 5CXCB 3EI3B 3I8EA 5FKQA 2BKLA 4FAND 2P9KC 3B7FA 4L3HD 5EM2B 4JT6C 1K8KC 1Q47A 5EARA 5FLXg 5CYKB 4PC0A 4CZXA 2JKXA 3MVDK 3N0DA 3O4GA 2IWFA 1U4CA 2H6NA 2IAAA 3L4MD 1OMWB 4JSVC 1R5MA 4H5JA 4QQEA 4BL0A 5CXCA 3EI3A 3OTTA 2UZYB 2OVRB 3I7NA 4IMMA 3IUJA 2I3TA 3FM0A 2B5MA 5EM2A 3ZDZA 4OWRA 5FFGA 5CYKA 4K3ID 3T3MA 2AGYA 2WQ8A 4O02A 5GMKn 1I2MB 3PSCB 2O9KA 2OJYA 3PXSD 3EQ9A 5M5UA 3VI4A 3A0FA 2AGWA 1VE6A 3ZWLB 5IJ8E 1N6EA 2QC5A 4A2LA 1GP2B 3I2NA 1UTCA 3JZHA 2AH1A 4O1QD 4XYHA 4BCCA 2H6KA 4FB1D 4J87A 3SVWD 4BUJC 5IT9g 4JHPC 3OW8A 1PI6A 3IUMA 1QNIA 3EI1B 3ORVD 2YNNA 3PSLA 3VGZA 1SQJA 3SJLD 1QFSA 5E6UA 4GMBA 4BP8A 3KRWB 4FWWA 2YB8B 5TEFA 4D0KA 2VDLA 1VE7A 3I7HA 4BH6A 2GNQA 2HJBA 4GQ2P 1N6FA 1H2XA 3EI1A 3SN6B 4ESGA 4X60B 3QI0A 3RSEC 2VZ3A 4PXWA 1QFMA 2EIDA 4ZOZA 2IUPA 3UVNA 1C9IA 3EWEA 4J8BA 5E6RA 2OVQB 4XYIA 1E8MA 5JWZA 3UVKA 1FWXA 2OIZA 5HYNB 3ZE1A 3OL2B 4AN1A 1U8CA 2XZGA 4GQBB 2P9SC 4ES0A 3ODTA 4FA1D 5M61A 5TEEA 2Z2PA 2VDQA 4IRZA 2IUQA 1NR0A 3AH8B 4GZ8A 4QRJA 3C99A 4CY5A 5C2WB 4D6VA 1SHYB 3JAMg 2W18A 4WK4A 2H9MA 4CZVA 2HKRA 5HE2B 3O4JA 3IUNA 1GXRA 3OL2A 5IC7A 4E54B 1B9YA 1K3IA 3IKOA 3SFZA 3W15A 2XYIA 1GOHA 1TYEA 1GG2B 4J82A 4PSWB 4Z7OA 4A0BB 4QT8A 5FXYA 3KRXB 2P9LC 3F3FA 2P9IC 2OK6A 5M5RA 4G55A 1JMXB 1B9XA 2HYEA 4E54A 2UZXB 4L9OA 2YNOA 2PBIB 2H14A 1UOPA 3C75H 4G1MA 4MMYA 5C92A 3IIYA 4GM3A 4UM8A 3KCIA 4NENA 4A0BA 4AOWA 2VDRA 3HFQA 1JMZB 2B5LA 5EMJB 4J8GA 2H9NA 3ZDYA 4DNWA 5EALA 5H17A 3MZLA 2OVPB 5HDBA 2B4EA 4QAMA 2VDOA 4PBYA 2I0TA 4A2MA 4O9DA 1TYQC 3O4HA 4UM9A 2B5NA 5THAA 5SXMA 1U2VC 1E5TA 3VH0A 3I7OA 2MTAH 2G9AA 4CY1A 3MZKA 3FCUA 5K1CC 4L3GD 3ZDXA 4FA4D 1S4UX 3K27A 3C9CA 3RFGA 4JSXC 3DM0A 4FAVD 4X63B 1PBYB 3FCSA 2H6QA 3RMZD 4JHNA 3PE7A 4PNKB 4CI8A 4J0WA 4NSXA 4ERZA 3EMHA 3AL9A 2G99A 4A11B 2J55H 2HESX 3ULEC 2HJ4A 4A08B 2CE8A 2I0SA 2QXVA 2H68A 5FKSA 3UKRC 1MG3A 4WK2A 4J73A 3ZE2A 1YR2A 3EI4B 1ERJA 4O45A 5HE0B 4MK0B 3PXTD 4A7JA 4AX4A 4NAAA 4AMZA 5TF2A 4A11A 4IA9A 3SMRA 3O4IA 3BG1A 3EQ7A 4A08A 5AMSA 5KDOB 5EMLB 2EIBA 3DDUA 4K3JB 4LG8A 3RRMC 4RE6A 4CY3A 2TRCB 4L1QD 5EMMB 3MKQA 3SXTD 1XKSA 1MDAH 1L5GA 3FGBA 3EI4A 1XIPA 4WK0A 3CFVA 4CY2A 1H2WA 3OKWA 3I89A 5FFOA 4JSPC 4AN0A 4WJKA 2HXCA 4PSXB 3CFSB 3E0CA 1C9LA 4ZOXA 2H9LA 1YFQA 3NIGA 4TZ4A 4CC9A 4FA9D 5FQDA 3F3PA 2VZ1A 3MUOA 2CE9A 2BCJB 2QR5A 5C86A 1JOFA 1H2ZA 3DSMA 4JSNC 3JB9L 3QHYB 5AJAA 1A12A 2AGXA 2VDNA 3IJEA 4Y7RA 2EIEA 4FA5D 2VDPA 3MKSB 2IUVA 3VA6A 3UKUC 3IJCA 1N6DA 2HKMA 2HU8A 2CO0C 3I7PA 2AH0A 2Z2OA 4BCBA 3MUNA 3K71A 1JV2A 4XEIC 4D9SA 4A09B 2IWKA 4I79A 4OZUA 5I5JA 4CZYA 3V4VA 4H5IA 5M5VA 2P9NC 3DXKC 5E6SA 4N14A 4O3TB 3GFCA 3FRXA 4E5ZB 4J0XA 3JROA 3V4PA 5TDHB 3VI3A 5M5SA 2CN2A 2Q7QA 1PGUA 5AFU3 1T2XA 3JRPA 1A0RB 4A09A 3N0EA 4YVDA 3J80g 3U4YA 4PBZA 4GQ1A 2CO0A 5HE3B 5HQGA 4DNUA 1VZ3A 4ZOVA 4Y5RD 1VYHC 4A0AB 2YNPA 2AGZA 4E5ZA 4CI1A 2PM9B 2H47A 3IVMA 2XL3A
chains in the Genus database with same CATH topology
5FKTA 5C2VB 5FA5B 3SLED 3EI2B 3SCYA 3SWSD 2P9UC 5I5IA 2XU7A 3C5MA 3DWLC 4O3UB 4UI9R 4AEZA 5GXHA 3P4FA 4ZN4A 4A0AA 3EU7A 3DXMC 3V5WB 3I7KA 2PM9A 5H14A 3I7LA 4LG9A 5GXIA 4X3EA 4QL1A 4J77A 3I8CA 4J78A 2GC4A 3EI2A 5IGOA 3RFHA 5H1MA 5IGQA 3EG6A 3CIKB 1SQ9A 5B4WA 2CNXA 3RLMD 1L0QA 4G56B 2XL2A 2AQ5A 4GGDA 5FKRA 1K32A 1XHMA 2BBKH 1MG2A 3NVQA 4ERYA 3F3GA 3OKTA 3UVLA 2J56H 4KFMB 2H3XA 4ZOYA 4GM8A 3PVUB 5I5MA 3V9FA 4J84A 3UVMA 3AL8B 3OKYB 3JZNA 2YBAA 2PM6B 3JPXA 5EAPA 3J81g 4ERQA 3SHFA 3GREA 2I0RA 3NVNA 2H13A 3IJ1A 3UR4A 2IURA 2H9PA 5A2Qg 3SBRA 1P22A 5C9ZB 1OLZA 3AL8A 3OKYA 3PVWB 3BWSA 3V7DB 4LGNA 3MMYA 3BG0A 4U7AA 3UVOA 4J81A 3PXWD 3SBPA 2OK4A 5IJ7E 4Z8LA 2P9PC 2J57G 4J86A 3MXXA 4EWRA 4CI3A 3K26A 3RN0D 3AFCA 3L4OD 4GGAA 3IJ0A 4JT5C 5CXBB 3JZGA 5EAMA 3IIWA 1TBGA 5GSAA 2EBSA 4JXMA 4HDJA 4JD2C 4GM9A 1NEXB 2PM7B 2YMUA 3SBQA 4CI2A 1PEVA 1RI6A 2GC7A 5K19A 4J79A 3RN1D 2AGLA 3NVXA 5CXBA 1GOTB 4FHLA 2CN3A 4R7AB 5HE1B 4GGCA 1JJUB 2Z2NA 5EMKB 4U1EI 4X61B 2I3SA 5CXCB 3EI3B 3I8EA 5FKQA 4FAND 2P9KC 3B7FA 4L3HD 5EM2B 4JT6C 1Q47A 1K8KC 5EARA 5FLXg 5CYKB 4PC0A 4CZXA 3N0DA 2IWFA 1U4CA 2H6NA 2IAAA 3L4MD 1OMWB 4JSVC 1R5MA 4H5JA 4QQEA 4BL0A 5CXCA 3EI3A 3OTTA 2UZYB 2OVRB 3I7NA 4IMMA 2I3TA 3FM0A 2B5MA 5EM2A 4OWRA 5CYKA 4K3ID 2AGYA 5GMKn 3PSCB 2O9KA 2OJYA 3PXSD 3A0FA 2AGWA 3ZWLB 5IJ8E 1N6EA 2QC5A 4A2LA 1GP2B 3I2NA 3JZHA 4O1QD 2AH1A 4XYHA 2H6KA 4FB1D 4J87A 3SVWD 4BUJC 5IT9g 3OW8A 1PI6A 1QNIA 3EI1B 3ORVD 2YNNA 3PSLA 3VGZA 1SQJA 3SJLD 4GMBA 3KRWB 4FWWA 2YB8B 5TEFA 4D0KA 3I7HA 4BH6A 2GNQA 2HJBA 4GQ2P 1N6FA 3EI1A 3SN6B 4ESGA 4X60B 3RSEC 4PXWA 4ZOZA 2IUPA 3UVNA 3EWEA 4J8BA 2OVQB 4XYIA 5JWZA 3UVKA 1FWXA 2OIZA 5HYNB 3OL2B 4GQBB 2P9SC 4ES0A 3ODTA 4FA1D 5TEEA 2Z2PA 2IUQA 1NR0A 3AH8B 4GZ8A 4QRJA 3C99A 4CY5A 5C2WB 4D6VA 1SHYB 3JAMg 2W18A 2H9MA 4CZVA 2HKRA 5HE2B 1GXRA 3OL2A 5IC7A 4E54B 1B9YA 3SFZA 3IKOA 3W15A 2XYIA 1GG2B 4J82A 4PSWB 4A0BB 4QT8A 5FXYA 3KRXB 2P9LC 3F3FA 2P9IC 2OK6A 1JMXB 1B9XA 2HYEA 4E54A 2UZXB 4L9OA 2YNOA 2PBIB 2H14A 3C75H 3IIYA 4GM3A 4A0BA 4AOWA 3HFQA 1JMZB 2B5LA 5EMJB 4J8GA 2H9NA 5EALA 5H17A 3MZLA 2OVPB 2B4EA 4PBYA 2I0TA 4A2MA 4O9DA 1TYQC 2B5NA 5THAA 5SXMA 1U2VC 3VH0A 3I7OA 2MTAH 2G9AA 4CY1A 3MZKA 5K1CC 4L3GD 4FA4D 1S4UX 3K27A 3C9CA 3RFGA 4JSXC 3DM0A 4FAVD 4X63B 1PBYB 2H6QA 3RMZD 3PE7A 4PNKB 4CI8A 4J0WA 4NSXA 4ERZA 3EMHA 3AL9A 2G99A 4A11B 2J55H 2HESX 3ULEC 2HJ4A 4A08B 2CE8A 2I0SA 2QXVA 2H68A 5FKSA 3UKRC 1MG3A 4J73A 3EI4B 1ERJA 4O45A 5HE0B 4MK0B 3PXTD 4A7JA 5TF2A 4A11A 4IA9A 3SMRA 3BG1A 4A08A 5AMSA 5KDOB 5EMLB 4K3JB 4LG8A 3RRMC 4CY3A 2TRCB 4L1QD 5EMMB 3MKQA 3SXTD 1XKSA 1MDAH 3FGBA 3EI4A 1XIPA 3CFVA 4CY2A 3OKWA 3I89A 4JSPC 2HXCA 4PSXB 3CFSB 3E0CA 4ZOXA 2H9LA 1YFQA 4TZ4A 4CC9A 4FA9D 5FQDA 3F3PA 2CE9A 2BCJB 1JOFA 3DSMA 4JSNC 3JB9L 5AJAA 2AGXA 4Y7RA 4FA5D 3MKSB 2IUVA 3VA6A 3UKUC 3IJCA 1N6DA 2HKMA 2CO0C 3I7PA 2AH0A 2Z2OA 4XEIC 4A09B 2IWKA 4I79A 4OZUA 5I5JA 4CZYA 4H5IA 2P9NC 3DXKC 4N14A 4O3TB 3GFCA 3FRXA 4E5ZB 4J0XA 3JROA 5TDHB 2CN2A 2Q7QA 1PGUA 5AFU3 3JRPA 1A0RB 4A09A 3N0EA 4YVDA 3J80g 3U4YA 4PBZA 4GQ1A 2CO0A 5HE3B 5HQGA 4ZOVA 4Y5RD 1VYHC 4A0AB 2YNPA 2AGZA 4E5ZA 4CI1A 2PM9B 2H47A 2XL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKT A;  5C2V B;  5FA5 B;  3SLE D;  3EI2 B;  3SCY A;  3SWS D;  2P9U C;  5I5I A;  2XU7 A;  3C5M A;  3DWL C;  4O3U B;  4UI9 R;  4AEZ A;  5GXH A;  3P4F A;  4ZN4 A;  4A0A A;  3EU7 A;  3DXM C;  3V5W B;  3I7K A;  2PM9 A;  5H14 A;  3I7L A;  4LG9 A;  5GXI A;  4X3E A;  4QL1 A;  4J77 A;  3I8C A;  4J78 A;  2GC4 A;  3EI2 A;  5IGO A;  3RFH A;  5H1M A;  5IGQ A;  3EG6 A;  3CIK B;  1SQ9 A;  5B4W A;  2CNX A;  3RLM D;  1L0Q A;  4G56 B;  2XL2 A;  2AQ5 A;  4GGD A;  5FKR A;  1K32 A;  1XHM A;  2BBK H;  1MG2 A;  3NVQ A;  4ERY A;  3F3G A;  3OKT A;  3UVL A;  2J56 H;  4KFM B;  2H3X A;  4ZOY A;  4GM8 A;  3PVU B;  5I5M A;  3V9F A;  4J84 A;  3UVM A;  3AL8 B;  3OKY B;  3JZN A;  2YBA A;  2PM6 B;  3JPX A;  5EAP A;  3J81 g;  4ERQ A;  3SHF A;  3GRE A;  2I0R A;  3NVN A;  2H13 A;  3IJ1 A;  3UR4 A;  2IUR A;  2H9P A;  5A2Q g;  3SBR A;  1P22 A;  5C9Z B;  1OLZ A;  3AL8 A;  3OKY A;  3PVW B;  3BWS A;  3V7D B;  4LGN A;  3MMY A;  3BG0 A;  4U7A A;  3UVO A;  4J81 A;  3PXW D;  3SBP A;  2OK4 A;  5IJ7 E;  4Z8L A;  2P9P C;  2J57 G;  4J86 A;  3MXX A;  4EWR A;  4CI3 A;  3K26 A;  3RN0 D;  3AFC A;  3L4O D;  4GGA A;  3IJ0 A;  4JT5 C;  5CXB B;  3JZG A;  5EAM A;  3IIW A;  1TBG A;  5GSA A;  2EBS A;  4JXM A;  4HDJ A;  4JD2 C;  4GM9 A;  1NEX B;  2PM7 B;  2YMU A;  3SBQ A;  4CI2 A;  1PEV A;  1RI6 A;  2GC7 A;  5K19 A;  4J79 A;  3RN1 D;  2AGL A;  3NVX A;  5CXB A;  1GOT B;  4FHL A;  2CN3 A;  4R7A B;  5HE1 B;  4GGC A;  1JJU B;  2Z2N A;  5EMK B;  4U1E I;  4X61 B;  2I3S A;  5CXC B;  3EI3 B;  3I8E A;  5FKQ A;  4FAN D;  2P9K C;  3B7F A;  4L3H D;  5EM2 B;  4JT6 C;  1Q47 A;  1K8K C;  5EAR A;  5FLX g;  5CYK B;  4PC0 A;  4CZX A;  3N0D A;  2IWF A;  1U4C A;  2H6N A;  2IAA A;  3L4M D;  1OMW B;  4JSV C;  1R5M A;  4H5J A;  4QQE A;  4BL0 A;  5CXC A;  3EI3 A;  3OTT A;  2UZY B;  2OVR B;  3I7N A;  4IMM A;  2I3T A;  3FM0 A;  2B5M A;  5EM2 A;  4OWR A;  5CYK A;  4K3I D;  2AGY A;  5GMK n;  3PSC B;  2O9K A;  2OJY A;  3PXS D;  3A0F A;  2AGW A;  3ZWL B;  5IJ8 E;  1N6E A;  2QC5 A;  4A2L A;  1GP2 B;  3I2N A;  3JZH A;  4O1Q D;  2AH1 A;  4XYH A;  2H6K A;  4FB1 D;  4J87 A;  3SVW D;  4BUJ C;  5IT9 g;  3OW8 A;  1PI6 A;  1QNI A;  3EI1 B;  3ORV D;  2YNN A;  3PSL A;  3VGZ A;  1SQJ A;  3SJL D;  4GMB A;  3KRW B;  4FWW A;  2YB8 B;  5TEF A;  4D0K A;  3I7H A;  4BH6 A;  2GNQ A;  2HJB A;  4GQ2 P;  1N6F A;  3EI1 A;  3SN6 B;  4ESG A;  4X60 B;  3RSE C;  4PXW A;  4ZOZ A;  2IUP A;  3UVN A;  3EWE A;  4J8B A;  2OVQ B;  4XYI A;  5JWZ A;  3UVK A;  1FWX A;  2OIZ A;  5HYN B;  3OL2 B;  4GQB B;  2P9S C;  4ES0 A;  3ODT A;  4FA1 D;  5TEE A;  2Z2P A;  2IUQ A;  1NR0 A;  3AH8 B;  4GZ8 A;  4QRJ A;  3C99 A;  4CY5 A;  5C2W B;  4D6V A;  1SHY B;  3JAM g;  2W18 A;  2H9M A;  4CZV A;  2HKR A;  5HE2 B;  1GXR A;  3OL2 A;  5IC7 A;  4E54 B;  1B9Y A;  3SFZ A;  3IKO A;  3W15 A;  2XYI A;  1GG2 B;  4J82 A;  4PSW B;  4A0B B;  4QT8 A;  5FXY A;  3KRX B;  2P9L C;  3F3F A;  2P9I C;  2OK6 A;  1JMX B;  1B9X A;  2HYE A;  4E54 A;  2UZX B;  4L9O A;  2YNO A;  2PBI B;  2H14 A;  3C75 H;  3IIY A;  4GM3 A;  4A0B A;  4AOW A;  3HFQ A;  1JMZ B;  2B5L A;  5EMJ B;  4J8G A;  2H9N A;  5EAL A;  5H17 A;  3MZL A;  2OVP B;  2B4E A;  4PBY A;  2I0T A;  4A2M A;  4O9D A;  1TYQ C;  2B5N A;  5THA A;  5SXM A;  1U2V C;  3VH0 A;  3I7O A;  2MTA H;  2G9A A;  4CY1 A;  3MZK A;  5K1C C;  4L3G D;  4FA4 D;  1S4U X;  3K27 A;  3C9C A;  3RFG A;  4JSX C;  3DM0 A;  4FAV D;  4X63 B;  1PBY B;  2H6Q A;  3RMZ D;  3PE7 A;  4PNK B;  4CI8 A;  4J0W A;  4NSX A;  4ERZ A;  3EMH A;  3AL9 A;  2G99 A;  4A11 B;  2J55 H;  2HES X;  3ULE C;  2HJ4 A;  4A08 B;  2CE8 A;  2I0S A;  2QXV A;  2H68 A;  5FKS A;  3UKR C;  1MG3 A;  4J73 A;  3EI4 B;  1ERJ A;  4O45 A;  5HE0 B;  4MK0 B;  3PXT D;  4A7J A;  5TF2 A;  4A11 A;  4IA9 A;  3SMR A;  3BG1 A;  4A08 A;  5AMS A;  5KDO B;  5EML B;  4K3J B;  4LG8 A;  3RRM C;  4CY3 A;  2TRC B;  4L1Q D;  5EMM B;  3MKQ A;  3SXT D;  1XKS A;  1MDA H;  3FGB A;  3EI4 A;  1XIP A;  3CFV A;  4CY2 A;  3OKW A;  3I89 A;  4JSP C;  2HXC A;  4PSX B;  3CFS B;  3E0C A;  4ZOX A;  2H9L A;  1YFQ A;  4TZ4 A;  4CC9 A;  4FA9 D;  5FQD A;  3F3P A;  2CE9 A;  2BCJ B;  1JOF A;  3DSM A;  4JSN C;  3JB9 L;  5AJA A;  2AGX A;  4Y7R A;  4FA5 D;  3MKS B;  2IUV A;  3VA6 A;  3UKU C;  3IJC A;  1N6D A;  2HKM A;  2CO0 C;  3I7P A;  2AH0 A;  2Z2O A;  4XEI C;  4A09 B;  2IWK A;  4I79 A;  4OZU A;  5I5J A;  4CZY A;  4H5I A;  2P9N C;  3DXK C;  4N14 A;  4O3T B;  3GFC A;  3FRX A;  4E5Z B;  4J0X A;  3JRO A;  5TDH B;  2CN2 A;  2Q7Q A;  1PGU A;  5AFU 3;  3JRP A;  1A0R B;  4A09 A;  3N0E A;  4YVD A;  3J80 g;  3U4Y A;  4PBZ A;  4GQ1 A;  2CO0 A;  5HE3 B;  5HQG A;  4ZOV A;  4Y5R D;  1VYH C;  4A0A B;  2YNP A;  2AGZ A;  4E5Z A;  4CI1 A;  2PM9 B;  2H47 A;  2XL3 A; 
#chains in the Genus database with same CATH topology
 1JTD B;  5FKT A;  5C2V B;  5FA5 B;  3K6S A;  3SLE D;  3EI2 B;  3SCY A;  3SWS D;  2P9U C;  5I5I A;  2XU7 A;  3C5M A;  3DWL C;  2QZP A;  3NID A;  4O3U B;  4UI9 R;  4AEZ A;  5GXH A;  3P4F A;  4ZN4 A;  4AMY A;  2VDM A;  4A0A A;  3EU7 A;  3DXM C;  3V5W B;  2HU5 A;  3ZE0 A;  3I7K A;  2PM9 A;  5H14 A;  3I7L A;  4LG9 A;  5GXI A;  4X3E A;  4QL1 A;  4J77 A;  3I8C A;  2XDW A;  4J78 A;  2GC4 A;  4BCD A;  3EI2 A;  5IGO A;  3RFH A;  1O6G A;  5H1M A;  5IGQ A;  3EG6 A;  4RE5 A;  3CIK B;  4DNV A;  4O2W A;  1SQ9 A;  5B4W A;  2VC2 A;  2CNX A;  3RLM D;  1L0Q A;  5M5T A;  4G56 B;  2XL2 A;  2AQ5 A;  4GGD A;  5FKR A;  1K32 A;  1XHM A;  2BBK H;  2XE4 A;  1MG2 A;  3NVQ A;  4ERY A;  3F3G A;  2EIC A;  3OKT A;  3UVL A;  2J56 H;  4KFM B;  2H3X A;  4ZOY A;  4Z7N A;  4GM8 A;  3PVU B;  5I5M A;  3GD1 I;  3V9F A;  4J84 A;  2VDK A;  3GC3 B;  3UVM A;  4Z7Q A;  3AL8 B;  3OKY B;  3JZN A;  2YBA A;  2PM6 B;  4NC4 A;  3JPX A;  5EAP A;  3J81 g;  3T3P A;  4ERQ A;  3SHF A;  3GRE A;  2I0R A;  3NVN A;  2H13 A;  3IJ1 A;  3OF7 A;  2IUR A;  3UR4 A;  1O6F A;  2H9P A;  1BPO A;  4NBM A;  3IUQ A;  5A2Q g;  3SBR A;  1P22 A;  3EQ8 A;  1OLZ A;  5C9Z B;  3AL8 A;  3OKY A;  3PVW B;  1GOF A;  3BWS A;  4L1M A;  3V7D B;  4LGN A;  3MMY A;  3BG0 A;  4U7A A;  1E8N A;  3UVO A;  4J81 A;  3PXW D;  3SBP A;  2OK4 A;  5IJ7 E;  3K72 A;  4Z8L A;  4BP9 A;  2HU7 A;  1VZ2 A;  2P9P C;  4MMX A;  2J57 G;  4J86 A;  3MXX A;  4EWR A;  4CI3 A;  3K26 A;  3RN0 D;  1H2Y A;  3AFC A;  3L4O D;  3IJ0 A;  3IUL A;  4GGA A;  4JT5 C;  5CXB B;  3JZG A;  5EAM A;  3IIW A;  1TBG A;  5GSA A;  2EBS A;  4JXM A;  4HDJ A;  4JD2 C;  1M1X A;  4GM9 A;  1UOO A;  1NEX B;  2PM7 B;  2YMU A;  3SBQ A;  4CI2 A;  1PEV A;  1RI6 A;  3IUR A;  2GC7 A;  3NIF A;  1GOG A;  5K19 A;  4J79 A;  4MMZ A;  3RN1 D;  2AGL A;  3NVX A;  5CXB A;  1GOT B;  4FHL A;  2CN3 A;  1UOQ A;  4G1E A;  4R7A B;  5HE1 B;  4GGC A;  1JJU B;  2Z2N A;  5EMK B;  4U1E I;  4X61 B;  2I3S A;  5CXC B;  3EI3 B;  3I8E A;  5FKQ A;  2BKL A;  4FAN D;  2P9K C;  3B7F A;  4L3H D;  5EM2 B;  4JT6 C;  1K8K C;  1Q47 A;  5EAR A;  5FLX g;  5CYK B;  4PC0 A;  4CZX A;  2JKX A;  3MVD K;  3N0D A;  3O4G A;  2IWF A;  1U4C A;  2H6N A;  2IAA A;  3L4M D;  1OMW B;  4JSV C;  1R5M A;  4H5J A;  4QQE A;  4BL0 A;  5CXC A;  3EI3 A;  3OTT A;  2UZY B;  2OVR B;  3I7N A;  4IMM A;  3IUJ A;  2I3T A;  3FM0 A;  2B5M A;  5EM2 A;  3ZDZ A;  4OWR A;  5FFG A;  5CYK A;  4K3I D;  3T3M A;  2AGY A;  2WQ8 A;  4O02 A;  5GMK n;  1I2M B;  3PSC B;  2O9K A;  2OJY A;  3PXS D;  3EQ9 A;  5M5U A;  3VI4 A;  3A0F A;  2AGW A;  1VE6 A;  3ZWL B;  5IJ8 E;  1N6E A;  2QC5 A;  4A2L A;  1GP2 B;  3I2N A;  1UTC A;  3JZH A;  2AH1 A;  4O1Q D;  4XYH A;  4BCC A;  2H6K A;  4FB1 D;  4J87 A;  3SVW D;  4BUJ C;  5IT9 g;  4JHP C;  3OW8 A;  1PI6 A;  3IUM A;  1QNI A;  3EI1 B;  3ORV D;  2YNN A;  3PSL A;  3VGZ A;  1SQJ A;  3SJL D;  1QFS A;  5E6U A;  4GMB A;  4BP8 A;  3KRW B;  4FWW A;  2YB8 B;  5TEF A;  4D0K A;  2VDL A;  1VE7 A;  3I7H A;  4BH6 A;  2GNQ A;  2HJB A;  4GQ2 P;  1N6F A;  1H2X A;  3EI1 A;  3SN6 B;  4ESG A;  4X60 B;  3QI0 A;  3RSE C;  2VZ3 A;  4PXW A;  1QFM A;  2EID A;  4ZOZ A;  2IUP A;  3UVN A;  1C9I A;  3EWE A;  4J8B A;  5E6R A;  2OVQ B;  4XYI A;  1E8M A;  5JWZ A;  3UVK A;  1FWX A;  2OIZ A;  5HYN B;  3ZE1 A;  3OL2 B;  4AN1 A;  1U8C A;  2XZG A;  4GQB B;  2P9S C;  4ES0 A;  3ODT A;  4FA1 D;  5M61 A;  5TEE A;  2Z2P A;  2VDQ A;  4IRZ A;  2IUQ A;  1NR0 A;  3AH8 B;  4GZ8 A;  4QRJ A;  3C99 A;  4CY5 A;  5C2W B;  4D6V A;  1SHY B;  3JAM g;  2W18 A;  4WK4 A;  2H9M A;  4CZV A;  2HKR A;  5HE2 B;  3O4J A;  3IUN A;  1GXR A;  3OL2 A;  5IC7 A;  4E54 B;  1B9Y A;  1K3I A;  3IKO A;  3SFZ A;  3W15 A;  2XYI A;  1GOH A;  1TYE A;  1GG2 B;  4J82 A;  4PSW B;  4Z7O A;  4A0B B;  4QT8 A;  5FXY A;  3KRX B;  2P9L C;  3F3F A;  2P9I C;  2OK6 A;  5M5R A;  4G55 A;  1JMX B;  1B9X A;  2HYE A;  4E54 A;  2UZX B;  4L9O A;  2YNO A;  2PBI B;  2H14 A;  1UOP A;  3C75 H;  4G1M A;  4MMY A;  5C92 A;  3IIY A;  4GM3 A;  4UM8 A;  3KCI A;  4NEN A;  4A0B A;  4AOW A;  2VDR A;  3HFQ A;  1JMZ B;  2B5L A;  5EMJ B;  4J8G A;  2H9N A;  3ZDY A;  4DNW A;  5EAL A;  5H17 A;  3MZL A;  2OVP B;  5HDB A;  2B4E A;  4QAM A;  2VDO A;  4PBY A;  2I0T A;  4A2M A;  4O9D A;  1TYQ C;  3O4H A;  4UM9 A;  2B5N A;  5THA A;  5SXM A;  1U2V C;  1E5T A;  3VH0 A;  3I7O A;  2MTA H;  2G9A A;  4CY1 A;  3MZK A;  3FCU A;  5K1C C;  4L3G D;  3ZDX A;  4FA4 D;  1S4U X;  3K27 A;  3C9C A;  3RFG A;  4JSX C;  3DM0 A;  4FAV D;  4X63 B;  1PBY B;  3FCS A;  2H6Q A;  3RMZ D;  4JHN A;  3PE7 A;  4PNK B;  4CI8 A;  4J0W A;  4NSX A;  4ERZ A;  3EMH A;  3AL9 A;  2G99 A;  4A11 B;  2J55 H;  2HES X;  3ULE C;  2HJ4 A;  4A08 B;  2CE8 A;  2I0S A;  2QXV A;  2H68 A;  5FKS A;  3UKR C;  1MG3 A;  4WK2 A;  4J73 A;  3ZE2 A;  1YR2 A;  3EI4 B;  1ERJ A;  4O45 A;  5HE0 B;  4MK0 B;  3PXT D;  4A7J A;  4AX4 A;  4NAA A;  4AMZ A;  5TF2 A;  4A11 A;  4IA9 A;  3SMR A;  3O4I A;  3BG1 A;  3EQ7 A;  4A08 A;  5AMS A;  5KDO B;  5EML B;  2EIB A;  3DDU A;  4K3J B;  4LG8 A;  3RRM C;  4RE6 A;  4CY3 A;  2TRC B;  4L1Q D;  5EMM B;  3MKQ A;  3SXT D;  1XKS A;  1MDA H;  1L5G A;  3FGB A;  3EI4 A;  1XIP A;  4WK0 A;  3CFV A;  4CY2 A;  1H2W A;  3OKW A;  3I89 A;  5FFO A;  4JSP C;  4AN0 A;  4WJK A;  2HXC A;  4PSX B;  3CFS B;  3E0C A;  1C9L A;  4ZOX A;  2H9L A;  1YFQ A;  3NIG A;  4TZ4 A;  4CC9 A;  4FA9 D;  5FQD A;  3F3P A;  2VZ1 A;  3MUO A;  2CE9 A;  2BCJ B;  2QR5 A;  5C86 A;  1JOF A;  1H2Z A;  3DSM A;  4JSN C;  3JB9 L;  3QHY B;  5AJA A;  1A12 A;  2AGX A;  2VDN A;  3IJE A;  4Y7R A;  2EIE A;  4FA5 D;  2VDP A;  3MKS B;  2IUV A;  3VA6 A;  3UKU C;  3IJC A;  1N6D A;  2HKM A;  2HU8 A;  2CO0 C;  3I7P A;  2AH0 A;  2Z2O A;  4BCB A;  3MUN A;  3K71 A;  1JV2 A;  4XEI C;  4D9S A;  4A09 B;  2IWK A;  4I79 A;  4OZU A;  5I5J A;  4CZY A;  3V4V A;  4H5I A;  5M5V A;  2P9N C;  3DXK C;  5E6S A;  4N14 A;  4O3T B;  3GFC A;  3FRX A;  4E5Z B;  4J0X A;  3JRO A;  3V4P A;  5TDH B;  3VI3 A;  5M5S A;  2CN2 A;  2Q7Q A;  1PGU A;  5AFU 3;  1T2X A;  3JRP A;  1A0R B;  4A09 A;  3N0E A;  4YVD A;  3J80 g;  3U4Y A;  4PBZ A;  4GQ1 A;  2CO0 A;  5HE3 B;  5HQG A;  4DNU A;  1VZ3 A;  4ZOV A;  4Y5R D;  1VYH C;  4A0A B;  2YNP A;  2AGZ A;  4E5Z A;  4CI1 A;  2PM9 B;  2H47 A;  3IVM A;  2XL3 A; 
#chains in the Genus database with same CATH homology
 5FKT A;  5C2V B;  5FA5 B;  3SLE D;  3EI2 B;  3SCY A;  3SWS D;  2P9U C;  5I5I A;  2XU7 A;  3C5M A;  3DWL C;  4O3U B;  4UI9 R;  4AEZ A;  5GXH A;  3P4F A;  4ZN4 A;  4A0A A;  3EU7 A;  3DXM C;  3V5W B;  3I7K A;  2PM9 A;  5H14 A;  3I7L A;  4LG9 A;  5GXI A;  4X3E A;  4QL1 A;  4J77 A;  3I8C A;  4J78 A;  2GC4 A;  3EI2 A;  5IGO A;  3RFH A;  5H1M A;  5IGQ A;  3EG6 A;  3CIK B;  1SQ9 A;  5B4W A;  2CNX A;  3RLM D;  1L0Q A;  4G56 B;  2XL2 A;  2AQ5 A;  4GGD A;  5FKR A;  1K32 A;  1XHM A;  2BBK H;  1MG2 A;  3NVQ A;  4ERY A;  3F3G A;  3OKT A;  3UVL A;  2J56 H;  4KFM B;  2H3X A;  4ZOY A;  4GM8 A;  3PVU B;  5I5M A;  3V9F A;  4J84 A;  3UVM A;  3AL8 B;  3OKY B;  3JZN A;  2YBA A;  2PM6 B;  3JPX A;  5EAP A;  3J81 g;  4ERQ A;  3SHF A;  3GRE A;  2I0R A;  3NVN A;  2H13 A;  3IJ1 A;  3UR4 A;  2IUR A;  2H9P A;  5A2Q g;  3SBR A;  1P22 A;  5C9Z B;  1OLZ A;  3AL8 A;  3OKY A;  3PVW B;  3BWS A;  3V7D B;  4LGN A;  3MMY A;  3BG0 A;  4U7A A;  3UVO A;  4J81 A;  3PXW D;  3SBP A;  2OK4 A;  5IJ7 E;  4Z8L A;  2P9P C;  2J57 G;  4J86 A;  3MXX A;  4EWR A;  4CI3 A;  3K26 A;  3RN0 D;  3AFC A;  3L4O D;  4GGA A;  3IJ0 A;  4JT5 C;  5CXB B;  3JZG A;  5EAM A;  3IIW A;  1TBG A;  5GSA A;  2EBS A;  4JXM A;  4HDJ A;  4JD2 C;  4GM9 A;  1NEX B;  2PM7 B;  2YMU A;  3SBQ A;  4CI2 A;  1PEV A;  1RI6 A;  2GC7 A;  5K19 A;  4J79 A;  3RN1 D;  2AGL A;  3NVX A;  5CXB A;  1GOT B;  4FHL A;  2CN3 A;  4R7A B;  5HE1 B;  4GGC A;  1JJU B;  2Z2N A;  5EMK B;  4U1E I;  4X61 B;  2I3S A;  5CXC B;  3EI3 B;  3I8E A;  5FKQ A;  4FAN D;  2P9K C;  3B7F A;  4L3H D;  5EM2 B;  4JT6 C;  1Q47 A;  1K8K C;  5EAR A;  5FLX g;  5CYK B;  4PC0 A;  4CZX A;  3N0D A;  2IWF A;  1U4C A;  2H6N A;  2IAA A;  3L4M D;  1OMW B;  4JSV C;  1R5M A;  4H5J A;  4QQE A;  4BL0 A;  5CXC A;  3EI3 A;  3OTT A;  2UZY B;  2OVR B;  3I7N A;  4IMM A;  2I3T A;  3FM0 A;  2B5M A;  5EM2 A;  4OWR A;  5CYK A;  4K3I D;  2AGY A;  5GMK n;  3PSC B;  2O9K A;  2OJY A;  3PXS D;  3A0F A;  2AGW A;  3ZWL B;  5IJ8 E;  1N6E A;  2QC5 A;  4A2L A;  1GP2 B;  3I2N A;  3JZH A;  4O1Q D;  2AH1 A;  4XYH A;  2H6K A;  4FB1 D;  4J87 A;  3SVW D;  4BUJ C;  5IT9 g;  3OW8 A;  1PI6 A;  1QNI A;  3EI1 B;  3ORV D;  2YNN A;  3PSL A;  3VGZ A;  1SQJ A;  3SJL D;  4GMB A;  3KRW B;  4FWW A;  2YB8 B;  5TEF A;  4D0K A;  3I7H A;  4BH6 A;  2GNQ A;  2HJB A;  4GQ2 P;  1N6F A;  3EI1 A;  3SN6 B;  4ESG A;  4X60 B;  3RSE C;  4PXW A;  4ZOZ A;  2IUP A;  3UVN A;  3EWE A;  4J8B A;  2OVQ B;  4XYI A;  5JWZ A;  3UVK A;  1FWX A;  2OIZ A;  5HYN B;  3OL2 B;  4GQB B;  2P9S C;  4ES0 A;  3ODT A;  4FA1 D;  5TEE A;  2Z2P A;  2IUQ A;  1NR0 A;  3AH8 B;  4GZ8 A;  4QRJ A;  3C99 A;  4CY5 A;  5C2W B;  4D6V A;  1SHY B;  3JAM g;  2W18 A;  2H9M A;  4CZV A;  2HKR A;  5HE2 B;  1GXR A;  3OL2 A;  5IC7 A;  4E54 B;  1B9Y A;  3SFZ A;  3IKO A;  3W15 A;  2XYI A;  1GG2 B;  4J82 A;  4PSW B;  4A0B B;  4QT8 A;  5FXY A;  3KRX B;  2P9L C;  3F3F A;  2P9I C;  2OK6 A;  1JMX B;  1B9X A;  2HYE A;  4E54 A;  2UZX B;  4L9O A;  2YNO A;  2PBI B;  2H14 A;  3C75 H;  3IIY A;  4GM3 A;  4A0B A;  4AOW A;  3HFQ A;  1JMZ B;  2B5L A;  5EMJ B;  4J8G A;  2H9N A;  5EAL A;  5H17 A;  3MZL A;  2OVP B;  2B4E A;  4PBY A;  2I0T A;  4A2M A;  4O9D A;  1TYQ C;  2B5N A;  5THA A;  5SXM A;  1U2V C;  3VH0 A;  3I7O A;  2MTA H;  2G9A A;  4CY1 A;  3MZK A;  5K1C C;  4L3G D;  4FA4 D;  1S4U X;  3K27 A;  3C9C A;  3RFG A;  4JSX C;  3DM0 A;  4FAV D;  4X63 B;  1PBY B;  2H6Q A;  3RMZ D;  3PE7 A;  4PNK B;  4CI8 A;  4J0W A;  4NSX A;  4ERZ A;  3EMH A;  3AL9 A;  2G99 A;  4A11 B;  2J55 H;  2HES X;  3ULE C;  2HJ4 A;  4A08 B;  2CE8 A;  2I0S A;  2QXV A;  2H68 A;  5FKS A;  3UKR C;  1MG3 A;  4J73 A;  3EI4 B;  1ERJ A;  4O45 A;  5HE0 B;  4MK0 B;  3PXT D;  4A7J A;  5TF2 A;  4A11 A;  4IA9 A;  3SMR A;  3BG1 A;  4A08 A;  5AMS A;  5KDO B;  5EML B;  4K3J B;  4LG8 A;  3RRM C;  4CY3 A;  2TRC B;  4L1Q D;  5EMM B;  3MKQ A;  3SXT D;  1XKS A;  1MDA H;  3FGB A;  3EI4 A;  1XIP A;  3CFV A;  4CY2 A;  3OKW A;  3I89 A;  4JSP C;  2HXC A;  4PSX B;  3CFS B;  3E0C A;  4ZOX A;  2H9L A;  1YFQ A;  4TZ4 A;  4CC9 A;  4FA9 D;  5FQD A;  3F3P A;  2CE9 A;  2BCJ B;  1JOF A;  3DSM A;  4JSN C;  3JB9 L;  5AJA A;  2AGX A;  4Y7R A;  4FA5 D;  3MKS B;  2IUV A;  3VA6 A;  3UKU C;  3IJC A;  1N6D A;  2HKM A;  2CO0 C;  3I7P A;  2AH0 A;  2Z2O A;  4XEI C;  4A09 B;  2IWK A;  4I79 A;  4OZU A;  5I5J A;  4CZY A;  4H5I A;  2P9N C;  3DXK C;  4N14 A;  4O3T B;  3GFC A;  3FRX A;  4E5Z B;  4J0X A;  3JRO A;  5TDH B;  2CN2 A;  2Q7Q A;  1PGU A;  5AFU 3;  3JRP A;  1A0R B;  4A09 A;  3N0E A;  4YVD A;  3J80 g;  3U4Y A;  4PBZ A;  4GQ1 A;  2CO0 A;  5HE3 B;  5HQG A;  4ZOV A;  4Y5R D;  1VYH C;  4A0A B;  2YNP A;  2AGZ A;  4E5Z A;  4CI1 A;  2PM9 B;  2H47 A;  2XL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...