4K3ID

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug, c2 space group
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
publication title Structures of MauG in complex with quinol and quinone MADH.
pubmed doi rcsb
total genus 99
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4k3iD00
4PC0A 2P9UC 4BL0A 4A08B 3EG6A 3IIYA 3AL8B 1Q47A 4Y5RD 5TEFA 3UVOA 3OKWA 1N6FA 1RI6A 4J0XA 3EMHA 3SMRA 2YBAA 1A0RB 1PEVA 3JZNA 2G9AA 2CNXA 4CZYA 3I7NA 4O3UB 5IJ8E 2H9NA 4J8GA 3RFGA 2CE9A 3PSLA 3K27A 4CI2A 2UZYB 4J81A 4ZOYA 2P9SC 5C2WB 2HESX 2PM7B 2P9NC 3MZLA 3SBQA 3EI4A 1L0QA 1SHYB 5I5MA 3I7HA 2CO0A 4JT6C 3J80g 2XL3A 2PM6B 4J84A 5H1MA 3MMYA 4CC9A 4X61B 3OL2A 5CYKA 2H3XA 3P4FA 2Q7QA 4NSXA 3J81g 2IUVA 4GM8A 3V9FA 4Y7RA 2OVQB 5GXHA 4JSNC 5HYNB 5FKTA 2B5LA 4A2LA 5EAMA 3UKRC 4A0BA 2H6NA 1GP2B 2OJYA 3C5MA 4J79A 2HJBA 4PSXB 2AGYA 2IURA 2PM9B 3K26A 4JSVC 1MDAH 3OL2B 4JXMA 4E54A 2H9MA 5FKSA 3EI1A 3RMZD 1B9XA 5EMMB 3IKOA 3RLMD 1YFQA 3AH8B 4GZ8A 3BG0A 4CI8A 4A0AA 1SQ9A 5B4WA 1XKSA 5IT9g 4GGDA 5C2VB 3NVNA 3UVMA 2YNPA 4GM9A 5FKQA 4PBZA 1PGUA 2IWKA 3BG1A 2QC5A 3ODTA 3L4MD 5AMSA 1S4UX 2J57G 2W18A 3NVQA 2XYIA 3MKQA 3EI4B 4X3EA 4E54B 1MG2A 2HYEA 3U4YA 3F3FA 3I8CA 3E0CA 3SBRA 4TZ4A 5IGOA 2OVRB 5CXCB 2EBSA 3AFCA 4ERQA 2I0TA 4L3HD 3GREA 2G99A 4CY1A 2HKRA 1U4CA 3OW8A 4A08A 5IGQA 2OK6A 2CE8A 4PSWB 4ZN4A 5K1CC 2Z2NA 3EI2B 2QXVA 3V7DB 5HE3B 4OZUA 4PBYA 2PM9A 2GNQA 3IJCA 5H14A 5CXCA 5AFU3 2IAAA 4A11A 3KRXB 4A09B 2H68A 2XL2A 4CI1A 4CY2A 3UVLA 4D6VA 4FB1D 3OKYB 5H17A 5FXYA 5K19A 4G56B 1N6DA 4X63B 2H13A 5TDHB 3SJLD 3RN1D 5EM2A 4AEZA 4YVDA 1XHMA 4J87A 4E5ZA 4IMMA 4FA5D 3EI2A 5EMLB 5FKRA 4J77A 4QL1A 4ZOXA 4A11B 4AOWA 4JT5C 4QT8A 4CI3A 3UKUC 2H6QA 4GMBA 5FLXg 2I0RA 2OVPB 4X60B 4QRJA 2IUPA 3JZGA 5FQDA 2Z2OA 1JJUB 4BUJC 4L1QD 3VGZA 4CZVA 3C75H 3PXSD 3EI3B 4GGCA 4CY5A 1OMWB 3I7KA 2P9KC 4QQEA 1K32A 5I5JA 4GQBB 4J0WA 3DXKC 2YNOA 5FA5B 3MZKA 3MKSB 4ES0A 1MG3A 2Z2PA 4D0KA 3PSCB 3RSEC 4K3ID 5JWZA 3FRXA 5HE2B 3JROA 2TRCB 2AGXA 4CZXA 3FM0A 5IC7A 3DXMC 3B7FA 3SLED 4L3GD 4K3JB 5EARA 4IA9A 4Z8LA 4XYHA 1P22A 4E5ZB 5EAPA 1ERJA 2CN3A 2YB8B 5I5IA 5EM2B 4FHLA 4CY3A 3SHFA 2B5MA 2CO0C 3DM0A 3OTTA 4GGAA 5SXMA 1GXRA 3FGBA 4OWRA 1GOTB 4U1EI 3C9CA 3CIKB 1VYHC 2J56H 3EWEA 3UVKA 1JOFA 3F3GA 2OK4A 5CXBA 4H5IA 4O1QD 2BBKH 2I0SA 3CFVA 3CFSB 3OKTA 3ORVD 1TYQC 4O3TB 5TF2A 5HE0B 4JD2C 4ERYA 2UZXB 3JPXA 2H6KA 2P9PC 5HQGA 2P9LC 2HKMA 1GG2B 2YNNA 4ZOVA 3ZWLB 4XEIC 1NEXB 4R7AB 3NVXA 1TBGA 2HJ4A 4FAND 4EWRA 2GC7A 1K8KC 3C99A 3W15A 4ERZA 3PXWD 3I7OA 5GMKn 2P9IC 4U7AA 2CN2A 5EMKB 4L9OA 5EALA 5KDOB 3ULEC 4LG8A 3RFHA 2H47A 3PVWB 4BH6A 3RRMC 4ESGA 3I2NA 1OLZA 4XYIA 3SN6B 2J55H 4A0AB 3IIWA 3F3PA 5HE1B 1B9YA 4LGNA 5A2Qg 5TEEA 2PBIB 3PXTD 3DWLC 2YMUA 4O45A 5CXBB 1R5MA 4J73A 5GXIA 3SCYA 3JRPA 2IUQA 1JMXB 4FA1D 2B4EA 4FWWA 3UVNA 2I3TA 3SFZA 2AGLA 3SWSD 4FA4D 4A0BB 3RN0D 2MTAH 2H9PA 4O9DA 4A7JA 3PE7A 5THAA 4HDJA 2BCJB 5IJ7E 3EI1B 3N0DA 3SBPA 4ZOZA 3I8EA 2AH0A 5C9ZB 2XU7A 4UI9R 3VH0A 1PI6A 2GC4A 2IWFA 1QNIA 3MXXA 4LG9A 4GQ1A 5AJAA 4JSXC 3UR4A 2HXCA 2B5NA 2O9KA 3I7LA 2OIZA 4FAVD 3KRWB 4MK0B 4PNKB 3BWSA 2AH1A 3VA6A 4FA9D 1PBYB 4A09A 3EI3A 4H5JA 3JZHA 1XIPA 1NR0A 3N0EA 4J86A 4J78A 4PXWA 2H9LA 3EU7A 5CYKB 5EMJB 4KFMB 4J82A 3JB9L 3PVUB 4GQ2P 4JSPC 2I3SA 3OKYA 3I7PA 3IJ1A 3IJ0A 1JMZB 1SQJA 2AGZA 3SVWD 3DSMA 3I89A 3SXTD 3AL9A 2H14A 3AL8A 3GFCA 3V5WB 3HFQA 3L4OD 1N6EA 4GM3A 2AGWA 4I79A 4A2MA 2AQ5A 4N14A 4J8BA 5GSAA 1FWXA 3A0FA 3JAMg 1U2VC
chains in the Genus database with same CATH superfamily
4PC0A 2P9UC 4BL0A 4A08B 3EG6A 3IIYA 3AL8B 1Q47A 4Y5RD 5TEFA 3UVOA 3OKWA 3IUJA 1N6FA 3FCSA 1RI6A 4J0XA 3EMHA 3SMRA 2YBAA 1A0RB 1PEVA 3JZNA 2G9AA 2CNXA 4CZYA 1E8NA 2JKXA 3I7NA 4WK4A 4O3UB 5IJ8E 2H9NA 4J8GA 3RFGA 2CE9A 3PSLA 3K27A 4CI2A 2UZYB 4J81A 4Z7NA 4ZOYA 2P9SC 4L1MA 5C2WB 2HESX 2PM7B 2P9NC 3MZLA 3SBQA 3EI4A 1L0QA 1SHYB 5I5MA 3I7HA 2CO0A 4JT6C 3J80g 2XL3A 2PM6B 4J84A 2BKLA 5H1MA 3NIDA 4AN0A 3ZDXA 3MMYA 4CC9A 4X61B 3OL2A 5CYKA 2H3XA 3P4FA 2Q7QA 4NSXA 3J81g 2IUVA 4GM8A 3V9FA 4Y7RA 2OVQB 5GXHA 4JSNC 5HYNB 2VZ1A 5FKTA 1E8MA 2B5LA 3K72A 3O4JA 4A2LA 2VDOA 5EAMA 1JTDB 4MMYA 3UKRC 5M5VA 2H6NA 4A0BA 1GP2B 3QHYB 2OJYA 1VE6A 3C5MA 4J79A 2HJBA 2AGYA 2IURA 2PM9B 3K26A 4PSXB 4JSVC 1MDAH 3OL2B 4JXMA 4E54A 2H9MA 5FKSA 3EI1A 3RMZD 1B9XA 3EQ9A 5EMMB 3T3MA 3IKOA 3RLMD 1YFQA 3AH8B 3BG0A 4GZ8A 4CI8A 4A0AA 1SQ9A 5B4WA 1XKSA 5IT9g 2XZGA 3DDUA 3NIGA 4GGDA 5C2VB 3O4IA 5M5TA 3NVNA 4NENA 3UVMA 2YNPA 4GM9A 3O4HA 5FKQA 4PBZA 1PGUA 2IWKA 3BG1A 4G1MA 4DNWA 2QC5A 3ODTA 4AMYA 2VC2A 3L4MD 5AMSA 1S4UX 2J57G 2W18A 3NVQA 2XYIA 3MKQA 3EI4B 4X3EA 4E54B 1MG2A 2HYEA 3U4YA 3F3FA 3I8CA 3E0CA 4WK2A 3SBRA 4TZ4A 5IGOA 2OVRB 4BP9A 3OF7A 2VDQA 5CXCB 3EQ8A 2EBSA 3AFCA 4ERQA 2I0TA 4L3HD 3GREA 4G1EA 3K71A 2G99A 2HU5A 4CY1A 2HKRA 1U4CA 3OW8A 4A08A 2XDWA 2OK6A 5IGQA 2CE8A 4PSWB 4ZN4A 5K1CC 2Z2NA 3EI2B 5E6SA 2HU8A 2QXVA 4UM8A 3V7DB 1GOHA 5HE3B 3ZE1A 4OZUA 5M61A 2PM9A 4PBYA 2GNQA 3IJCA 4NC4A 1H2WA 4NAAA 5H14A 5CXCA 5AFU3 2IAAA 4A11A 3KRXB 4A09B 2H68A 3IJEA 2XL2A 4CI1A 4CY2A 3UVLA 4D6VA 4FB1D 5C86A 3OKYB 5H17A 5FXYA 5K19A 4G56B 1K3IA 2VDRA 1N6DA 4X63B 2H13A 5TDHB 3SJLD 2VDPA 3RN1D 5EM2A 3ZDYA 5FFGA 4AEZA 4YVDA 1O6GA 1XHMA 4J87A 4E5ZA 4IMMA 4FA5D 3EI2A 5EMLB 1L5GA 5FKRA 3GD1I 4J77A 4QL1A 4ZOXA 4A11B 4AOWA 4O02A 2WQ8A 4JT5C 4QT8A 4CI3A 3UKUC 2H6QA 1UOQA 4GMBA 5FLXg 2I0RA 2VDNA 2OVPB 4X60B 3ZE2A 4QRJA 2IUPA 3JZGA 4WJKA 5FQDA 4RE6A 2Z2OA 3MUNA 1UTCA 1JJUB 1I2MB 4BUJC 4L1QD 3VGZA 4CZVA 3C75H 3PXSD 3EI3B 1A12A 5E6UA 4GGCA 4CY5A 1OMWB 2EIBA 2P9KC 3I7KA 4MMZA 4QQEA 1K32A 5I5JA 4DNUA 4GQBB 1TYEA 4J0WA 3DXKC 4AX4A 2YNOA 2HU7A 4UM9A 3IUQA 5E6RA 5FA5B 4BCDA 3MZKA 3MKSB 4ES0A 1MG3A 2EICA 2Z2PA 3PSCB 3RSEC 1T2XA 4D0KA 4K3ID 5JWZA 1H2YA 4O2WA 3FRXA 3MVDK 4Z7OA 5M5SA 5HE2B 3GC3B 3JROA 2TRCB 2AGXA 4CZXA 3FM0A 5IC7A 3DXMC 3B7FA 3SLED 4L3GD 4K3JB 5EARA 4IA9A 4Z8LA 5FFOA 4XYHA 1P22A 4E5ZB 1GOFA 5EAPA 1H2XA 1ERJA 4MMXA 2CN3A 1VZ2A 2YB8B 2VDKA 4DNVA 1M1XA 5I5IA 5EM2B 3O4GA 4FHLA 4CY3A 3SHFA 2B5MA 2CO0C 3DM0A 3OTTA 4GGAA 5SXMA 1GXRA 3FGBA 4OWRA 1GOTB 4U1EI 3IVMA 3C9CA 3CIKB 1VYHC 2J56H 3EWEA 3UVKA 1JOFA 3F3GA 2OK4A 3VI3A 1VE7A 5CXBA 4H5IA 4O1QD 2BBKH 2I0SA 3CFVA 3CFSB 3ORVD 3OKTA 1C9IA 1TYQC 4O3TB 3EQ7A 1JV2A 5TF2A 5HE0B 4AN1A 4JD2C 4ERYA 2UZXB 3JPXA 2H6KA 4D9SA 2P9PC 5HQGA 4AMZA 2P9LC 2HKMA 3ZE0A 1GG2B 2YNNA 4ZOVA 1H2ZA 3ZWLB 4XEIC 1UOPA 1NEXB 4R7AB 3NVXA 1TBGA 2HJ4A 3NIFA 3MUOA 2EIEA 4FAND 4EWRA 1C9LA 2GC7A 1K8KC 3C99A 4NBMA 3W15A 4RE5A 4ERZA 3PXWD 3IURA 3I7OA 2XE4A 5GMKn 4JHPC 3VI4A 2P9IC 4U7AA 2CN2A 5EMKB 1QFSA 4L9OA 5EALA 5KDOB 3ULEC 4LG8A 3RFHA 3IULA 2H47A 3PVWB 4BH6A 4IRZA 3RRMC 4ESGA 3I2NA 1OLZA 4XYIA 3SN6B 2J55H 2VDLA 5C92A 3K6SA 1YR2A 4A0AB 3IIWA 3F3PA 5HE1B 1B9YA 4LGNA 5A2Qg 5TEEA 3FCUA 2PBIB 3PXTD 3DWLC 2YMUA 4O45A 5CXBB 1R5MA 4J73A 5GXIA 3SCYA 3JRPA 2IUQA 1JMXB 4FA1D 3T3PA 2B4EA 4FWWA 3UVNA 2I3TA 3SFZA 2EIDA 1E5TA 2AGLA 3SWSD 3V4VA 2VZ3A 1O6FA 4Z7QA 4FA4D 3QI0A 4A0BB 3RN0D 1BPOA 2MTAH 2VDMA 4WK0A 2H9PA 4O9DA 4A7JA 3PE7A 5THAA 4G55A 4HDJA 2QR5A 2BCJB 5IJ7E 3EI1B 3N0DA 3SBPA 4ZOZA 3KCIA 3I8EA 2AH0A 5C9ZB 2XU7A 4JHNA 4UI9R 3VH0A 1U8CA 3ZDZA 1PI6A 5HDBA 2GC4A 1VZ3A 2IWFA 1QNIA 3MXXA 4LG9A 5M5RA 4BP8A 4GQ1A 5AJAA 4JSXC 3UR4A 5M5UA 2HXCA 2B5NA 2O9KA 3I7LA 4BCCA 2OIZA 4FAVD 3KRWB 3V4PA 4MK0B 4PNKB 3BWSA 2AH1A 3VA6A 4BCBA 4FA9D 1PBYB 4A09A 3EI3A 4H5JA 3JZHA 1XIPA 1NR0A 3N0EA 4J86A 4J78A 4PXWA 2H9LA 3EU7A 5CYKB 5EMJB 2QZPA 4KFMB 4J82A 3JB9L 3PVUB 4GQ2P 4JSPC 2I3SA 1GOGA 3OKYA 3I7PA 3IJ1A 3IJ0A 1JMZB 1SQJA 2AGZA 3SVWD 3DSMA 3I89A 3IUNA 3SXTD 3AL9A 2H14A 3AL8A 3GFCA 3V5WB 3HFQA 3L4OD 1N6EA 4GM3A 4QAMA 2AGWA 4I79A 4A2MA 1QFMA 1UOOA 2AQ5A 4J8BA 4N14A 5GSAA 1FWXA 3A0FA 3JAMg 1U2VC 3IUMA
chains in the Genus database with same CATH topology
4PC0A 2P9UC 4BL0A 4A08B 3EG6A 3IIYA 3AL8B 1Q47A 4Y5RD 5TEFA 3UVOA 3OKWA 1N6FA 1RI6A 4J0XA 3EMHA 3SMRA 2YBAA 1A0RB 1PEVA 3JZNA 2G9AA 2CNXA 4CZYA 3I7NA 4O3UB 5IJ8E 2H9NA 4J8GA 3RFGA 2CE9A 3PSLA 3K27A 4CI2A 2UZYB 4J81A 4ZOYA 2P9SC 5C2WB 2HESX 2PM7B 2P9NC 3MZLA 3SBQA 3EI4A 1L0QA 1SHYB 5I5MA 3I7HA 2CO0A 4JT6C 3J80g 2XL3A 2PM6B 4J84A 5H1MA 3MMYA 4CC9A 4X61B 3OL2A 5CYKA 2H3XA 3P4FA 2Q7QA 4NSXA 3J81g 2IUVA 4GM8A 3V9FA 4Y7RA 2OVQB 5GXHA 4JSNC 5HYNB 5FKTA 2B5LA 4A2LA 5EAMA 3UKRC 4A0BA 2H6NA 1GP2B 2OJYA 3C5MA 4J79A 2HJBA 4PSXB 2AGYA 2IURA 2PM9B 3K26A 4JSVC 1MDAH 3OL2B 4JXMA 4E54A 2H9MA 5FKSA 3EI1A 3RMZD 1B9XA 5EMMB 3IKOA 3RLMD 1YFQA 3AH8B 4GZ8A 3BG0A 4CI8A 4A0AA 1SQ9A 5B4WA 1XKSA 5IT9g 4GGDA 5C2VB 3NVNA 3UVMA 2YNPA 4GM9A 5FKQA 4PBZA 1PGUA 2IWKA 3BG1A 2QC5A 3ODTA 3L4MD 5AMSA 1S4UX 2J57G 2W18A 3NVQA 2XYIA 3MKQA 3EI4B 4X3EA 4E54B 1MG2A 2HYEA 3U4YA 3F3FA 3I8CA 3E0CA 3SBRA 4TZ4A 5IGOA 2OVRB 5CXCB 2EBSA 3AFCA 4ERQA 2I0TA 4L3HD 3GREA 2G99A 4CY1A 2HKRA 1U4CA 3OW8A 4A08A 5IGQA 2OK6A 2CE8A 4PSWB 4ZN4A 5K1CC 2Z2NA 3EI2B 2QXVA 3V7DB 5HE3B 4OZUA 4PBYA 2PM9A 2GNQA 3IJCA 5H14A 5CXCA 5AFU3 2IAAA 4A11A 3KRXB 4A09B 2H68A 2XL2A 4CI1A 4CY2A 3UVLA 4D6VA 4FB1D 3OKYB 5H17A 5FXYA 5K19A 4G56B 1N6DA 4X63B 2H13A 5TDHB 3SJLD 3RN1D 5EM2A 4AEZA 4YVDA 1XHMA 4J87A 4E5ZA 4IMMA 4FA5D 3EI2A 5EMLB 5FKRA 4J77A 4QL1A 4ZOXA 4A11B 4AOWA 4JT5C 4QT8A 4CI3A 3UKUC 2H6QA 4GMBA 5FLXg 2I0RA 2OVPB 4X60B 4QRJA 2IUPA 3JZGA 5FQDA 2Z2OA 1JJUB 4BUJC 4L1QD 3VGZA 4CZVA 3C75H 3PXSD 3EI3B 4GGCA 4CY5A 1OMWB 3I7KA 2P9KC 4QQEA 1K32A 5I5JA 4GQBB 4J0WA 3DXKC 2YNOA 5FA5B 3MZKA 3MKSB 4ES0A 1MG3A 2Z2PA 4D0KA 3PSCB 3RSEC 4K3ID 5JWZA 3FRXA 5HE2B 3JROA 2TRCB 2AGXA 4CZXA 3FM0A 5IC7A 3DXMC 3B7FA 3SLED 4L3GD 4K3JB 5EARA 4IA9A 4Z8LA 4XYHA 1P22A 4E5ZB 5EAPA 1ERJA 2CN3A 2YB8B 5I5IA 5EM2B 4FHLA 4CY3A 3SHFA 2B5MA 2CO0C 3DM0A 3OTTA 4GGAA 5SXMA 1GXRA 3FGBA 4OWRA 1GOTB 4U1EI 3C9CA 3CIKB 1VYHC 2J56H 3EWEA 3UVKA 1JOFA 3F3GA 2OK4A 5CXBA 4H5IA 4O1QD 2BBKH 2I0SA 3CFVA 3CFSB 3OKTA 3ORVD 1TYQC 4O3TB 5TF2A 5HE0B 4JD2C 4ERYA 2UZXB 3JPXA 2H6KA 2P9PC 5HQGA 2P9LC 2HKMA 1GG2B 2YNNA 4ZOVA 3ZWLB 4XEIC 1NEXB 4R7AB 3NVXA 1TBGA 2HJ4A 4FAND 4EWRA 2GC7A 1K8KC 3C99A 3W15A 4ERZA 3PXWD 3I7OA 5GMKn 2P9IC 4U7AA 2CN2A 5EMKB 4L9OA 5EALA 5KDOB 3ULEC 4LG8A 3RFHA 2H47A 3PVWB 4BH6A 3RRMC 4ESGA 3I2NA 1OLZA 4XYIA 3SN6B 2J55H 4A0AB 3IIWA 3F3PA 5HE1B 1B9YA 4LGNA 5A2Qg 5TEEA 2PBIB 3PXTD 3DWLC 2YMUA 4O45A 5CXBB 1R5MA 4J73A 5GXIA 3SCYA 3JRPA 2IUQA 1JMXB 4FA1D 2B4EA 4FWWA 3UVNA 2I3TA 3SFZA 2AGLA 3SWSD 4FA4D 4A0BB 3RN0D 2MTAH 2H9PA 4O9DA 4A7JA 3PE7A 5THAA 4HDJA 2BCJB 5IJ7E 3EI1B 3N0DA 3SBPA 4ZOZA 3I8EA 2AH0A 5C9ZB 2XU7A 4UI9R 3VH0A 1PI6A 2GC4A 2IWFA 1QNIA 3MXXA 4LG9A 4GQ1A 5AJAA 4JSXC 3UR4A 2HXCA 2B5NA 2O9KA 3I7LA 2OIZA 4FAVD 3KRWB 4MK0B 4PNKB 3BWSA 2AH1A 3VA6A 4FA9D 1PBYB 4A09A 3EI3A 4H5JA 3JZHA 1XIPA 1NR0A 3N0EA 4J86A 4J78A 4PXWA 2H9LA 3EU7A 5CYKB 5EMJB 4KFMB 4J82A 3JB9L 3PVUB 4GQ2P 4JSPC 2I3SA 3OKYA 3I7PA 3IJ1A 3IJ0A 1JMZB 1SQJA 2AGZA 3SVWD 3DSMA 3I89A 3SXTD 3AL9A 2H14A 3AL8A 3GFCA 3V5WB 3HFQA 3L4OD 1N6EA 4GM3A 2AGWA 4I79A 4A2MA 2AQ5A 4N14A 4J8BA 5GSAA 1FWXA 3A0FA 3JAMg 1U2VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PC0 A;  2P9U C;  4BL0 A;  4A08 B;  3EG6 A;  3IIY A;  3AL8 B;  1Q47 A;  4Y5R D;  5TEF A;  3UVO A;  3OKW A;  1N6F A;  1RI6 A;  4J0X A;  3EMH A;  3SMR A;  2YBA A;  1A0R B;  1PEV A;  3JZN A;  2G9A A;  2CNX A;  4CZY A;  3I7N A;  4O3U B;  5IJ8 E;  2H9N A;  4J8G A;  3RFG A;  2CE9 A;  3PSL A;  3K27 A;  4CI2 A;  2UZY B;  4J81 A;  4ZOY A;  2P9S C;  5C2W B;  2HES X;  2PM7 B;  2P9N C;  3MZL A;  3SBQ A;  3EI4 A;  1L0Q A;  1SHY B;  5I5M A;  3I7H A;  2CO0 A;  4JT6 C;  3J80 g;  2XL3 A;  2PM6 B;  4J84 A;  5H1M A;  3MMY A;  4CC9 A;  4X61 B;  3OL2 A;  5CYK A;  2H3X A;  3P4F A;  2Q7Q A;  4NSX A;  3J81 g;  2IUV A;  4GM8 A;  3V9F A;  4Y7R A;  2OVQ B;  5GXH A;  4JSN C;  5HYN B;  5FKT A;  2B5L A;  4A2L A;  5EAM A;  3UKR C;  4A0B A;  2H6N A;  1GP2 B;  2OJY A;  3C5M A;  4J79 A;  2HJB A;  4PSX B;  2AGY A;  2IUR A;  2PM9 B;  3K26 A;  4JSV C;  1MDA H;  3OL2 B;  4JXM A;  4E54 A;  2H9M A;  5FKS A;  3EI1 A;  3RMZ D;  1B9X A;  5EMM B;  3IKO A;  3RLM D;  1YFQ A;  3AH8 B;  4GZ8 A;  3BG0 A;  4CI8 A;  4A0A A;  1SQ9 A;  5B4W A;  1XKS A;  5IT9 g;  4GGD A;  5C2V B;  3NVN A;  3UVM A;  2YNP A;  4GM9 A;  5FKQ A;  4PBZ A;  1PGU A;  2IWK A;  3BG1 A;  2QC5 A;  3ODT A;  3L4M D;  5AMS A;  1S4U X;  2J57 G;  2W18 A;  3NVQ A;  2XYI A;  3MKQ A;  3EI4 B;  4X3E A;  4E54 B;  1MG2 A;  2HYE A;  3U4Y A;  3F3F A;  3I8C A;  3E0C A;  3SBR A;  4TZ4 A;  5IGO A;  2OVR B;  5CXC B;  2EBS A;  3AFC A;  4ERQ A;  2I0T A;  4L3H D;  3GRE A;  2G99 A;  4CY1 A;  2HKR A;  1U4C A;  3OW8 A;  4A08 A;  5IGQ A;  2OK6 A;  2CE8 A;  4PSW B;  4ZN4 A;  5K1C C;  2Z2N A;  3EI2 B;  2QXV A;  3V7D B;  5HE3 B;  4OZU A;  4PBY A;  2PM9 A;  2GNQ A;  3IJC A;  5H14 A;  5CXC A;  5AFU 3;  2IAA A;  4A11 A;  3KRX B;  4A09 B;  2H68 A;  2XL2 A;  4CI1 A;  4CY2 A;  3UVL A;  4D6V A;  4FB1 D;  3OKY B;  5H17 A;  5FXY A;  5K19 A;  4G56 B;  1N6D A;  4X63 B;  2H13 A;  5TDH B;  3SJL D;  3RN1 D;  5EM2 A;  4AEZ A;  4YVD A;  1XHM A;  4J87 A;  4E5Z A;  4IMM A;  4FA5 D;  3EI2 A;  5EML B;  5FKR A;  4J77 A;  4QL1 A;  4ZOX A;  4A11 B;  4AOW A;  4JT5 C;  4QT8 A;  4CI3 A;  3UKU C;  2H6Q A;  4GMB A;  5FLX g;  2I0R A;  2OVP B;  4X60 B;  4QRJ A;  2IUP A;  3JZG A;  5FQD A;  2Z2O A;  1JJU B;  4BUJ C;  4L1Q D;  3VGZ A;  4CZV A;  3C75 H;  3PXS D;  3EI3 B;  4GGC A;  4CY5 A;  1OMW B;  3I7K A;  2P9K C;  4QQE A;  1K32 A;  5I5J A;  4GQB B;  4J0W A;  3DXK C;  2YNO A;  5FA5 B;  3MZK A;  3MKS B;  4ES0 A;  1MG3 A;  2Z2P A;  4D0K A;  3PSC B;  3RSE C;  4K3I D;  5JWZ A;  3FRX A;  5HE2 B;  3JRO A;  2TRC B;  2AGX A;  4CZX A;  3FM0 A;  5IC7 A;  3DXM C;  3B7F A;  3SLE D;  4L3G D;  4K3J B;  5EAR A;  4IA9 A;  4Z8L A;  4XYH A;  1P22 A;  4E5Z B;  5EAP A;  1ERJ A;  2CN3 A;  2YB8 B;  5I5I A;  5EM2 B;  4FHL A;  4CY3 A;  3SHF A;  2B5M A;  2CO0 C;  3DM0 A;  3OTT A;  4GGA A;  5SXM A;  1GXR A;  3FGB A;  4OWR A;  1GOT B;  4U1E I;  3C9C A;  3CIK B;  1VYH C;  2J56 H;  3EWE A;  3UVK A;  1JOF A;  3F3G A;  2OK4 A;  5CXB A;  4H5I A;  4O1Q D;  2BBK H;  2I0S A;  3CFV A;  3CFS B;  3OKT A;  3ORV D;  1TYQ C;  4O3T B;  5TF2 A;  5HE0 B;  4JD2 C;  4ERY A;  2UZX B;  3JPX A;  2H6K A;  2P9P C;  5HQG A;  2P9L C;  2HKM A;  1GG2 B;  2YNN A;  4ZOV A;  3ZWL B;  4XEI C;  1NEX B;  4R7A B;  3NVX A;  1TBG A;  2HJ4 A;  4FAN D;  4EWR A;  2GC7 A;  1K8K C;  3C99 A;  3W15 A;  4ERZ A;  3PXW D;  3I7O A;  5GMK n;  2P9I C;  4U7A A;  2CN2 A;  5EMK B;  4L9O A;  5EAL A;  5KDO B;  3ULE C;  4LG8 A;  3RFH A;  2H47 A;  3PVW B;  4BH6 A;  3RRM C;  4ESG A;  3I2N A;  1OLZ A;  4XYI A;  3SN6 B;  2J55 H;  4A0A B;  3IIW A;  3F3P A;  5HE1 B;  1B9Y A;  4LGN A;  5A2Q g;  5TEE A;  2PBI B;  3PXT D;  3DWL C;  2YMU A;  4O45 A;  5CXB B;  1R5M A;  4J73 A;  5GXI A;  3SCY A;  3JRP A;  2IUQ A;  1JMX B;  4FA1 D;  2B4E A;  4FWW A;  3UVN A;  2I3T A;  3SFZ A;  2AGL A;  3SWS D;  4FA4 D;  4A0B B;  3RN0 D;  2MTA H;  2H9P A;  4O9D A;  4A7J A;  3PE7 A;  5THA A;  4HDJ A;  2BCJ B;  5IJ7 E;  3EI1 B;  3N0D A;  3SBP A;  4ZOZ A;  3I8E A;  2AH0 A;  5C9Z B;  2XU7 A;  4UI9 R;  3VH0 A;  1PI6 A;  2GC4 A;  2IWF A;  1QNI A;  3MXX A;  4LG9 A;  4GQ1 A;  5AJA A;  4JSX C;  3UR4 A;  2HXC A;  2B5N A;  2O9K A;  3I7L A;  2OIZ A;  4FAV D;  3KRW B;  4MK0 B;  4PNK B;  3BWS A;  2AH1 A;  3VA6 A;  4FA9 D;  1PBY B;  4A09 A;  3EI3 A;  4H5J A;  3JZH A;  1XIP A;  1NR0 A;  3N0E A;  4J86 A;  4J78 A;  4PXW A;  2H9L A;  3EU7 A;  5CYK B;  5EMJ B;  4KFM B;  4J82 A;  3JB9 L;  3PVU B;  4GQ2 P;  4JSP C;  2I3S A;  3OKY A;  3I7P A;  3IJ1 A;  3IJ0 A;  1JMZ B;  1SQJ A;  2AGZ A;  3SVW D;  3DSM A;  3I89 A;  3SXT D;  3AL9 A;  2H14 A;  3AL8 A;  3GFC A;  3V5W B;  3HFQ A;  3L4O D;  1N6E A;  4GM3 A;  2AGW A;  4I79 A;  4A2M A;  2AQ5 A;  4N14 A;  4J8B A;  5GSA A;  1FWX A;  3A0F A;  3JAM g;  1U2V C; 
#chains in the Genus database with same CATH topology
 4PC0 A;  2P9U C;  4BL0 A;  4A08 B;  3EG6 A;  3IIY A;  3AL8 B;  1Q47 A;  4Y5R D;  5TEF A;  3UVO A;  3OKW A;  3IUJ A;  1N6F A;  3FCS A;  1RI6 A;  4J0X A;  3EMH A;  3SMR A;  2YBA A;  1A0R B;  1PEV A;  3JZN A;  2G9A A;  2CNX A;  4CZY A;  1E8N A;  2JKX A;  3I7N A;  4WK4 A;  4O3U B;  5IJ8 E;  2H9N A;  4J8G A;  3RFG A;  2CE9 A;  3PSL A;  3K27 A;  4CI2 A;  2UZY B;  4J81 A;  4Z7N A;  4ZOY A;  2P9S C;  4L1M A;  5C2W B;  2HES X;  2PM7 B;  2P9N C;  3MZL A;  3SBQ A;  3EI4 A;  1L0Q A;  1SHY B;  5I5M A;  3I7H A;  2CO0 A;  4JT6 C;  3J80 g;  2XL3 A;  2PM6 B;  4J84 A;  2BKL A;  5H1M A;  3NID A;  4AN0 A;  3ZDX A;  3MMY A;  4CC9 A;  4X61 B;  3OL2 A;  5CYK A;  2H3X A;  3P4F A;  2Q7Q A;  4NSX A;  3J81 g;  2IUV A;  4GM8 A;  3V9F A;  4Y7R A;  2OVQ B;  5GXH A;  4JSN C;  5HYN B;  2VZ1 A;  5FKT A;  1E8M A;  2B5L A;  3K72 A;  3O4J A;  4A2L A;  2VDO A;  5EAM A;  1JTD B;  4MMY A;  3UKR C;  5M5V A;  2H6N A;  4A0B A;  1GP2 B;  3QHY B;  2OJY A;  1VE6 A;  3C5M A;  4J79 A;  2HJB A;  2AGY A;  2IUR A;  2PM9 B;  3K26 A;  4PSX B;  4JSV C;  1MDA H;  3OL2 B;  4JXM A;  4E54 A;  2H9M A;  5FKS A;  3EI1 A;  3RMZ D;  1B9X A;  3EQ9 A;  5EMM B;  3T3M A;  3IKO A;  3RLM D;  1YFQ A;  3AH8 B;  3BG0 A;  4GZ8 A;  4CI8 A;  4A0A A;  1SQ9 A;  5B4W A;  1XKS A;  5IT9 g;  2XZG A;  3DDU A;  3NIG A;  4GGD A;  5C2V B;  3O4I A;  5M5T A;  3NVN A;  4NEN A;  3UVM A;  2YNP A;  4GM9 A;  3O4H A;  5FKQ A;  4PBZ A;  1PGU A;  2IWK A;  3BG1 A;  4G1M A;  4DNW A;  2QC5 A;  3ODT A;  4AMY A;  2VC2 A;  3L4M D;  5AMS A;  1S4U X;  2J57 G;  2W18 A;  3NVQ A;  2XYI A;  3MKQ A;  3EI4 B;  4X3E A;  4E54 B;  1MG2 A;  2HYE A;  3U4Y A;  3F3F A;  3I8C A;  3E0C A;  4WK2 A;  3SBR A;  4TZ4 A;  5IGO A;  2OVR B;  4BP9 A;  3OF7 A;  2VDQ A;  5CXC B;  3EQ8 A;  2EBS A;  3AFC A;  4ERQ A;  2I0T A;  4L3H D;  3GRE A;  4G1E A;  3K71 A;  2G99 A;  2HU5 A;  4CY1 A;  2HKR A;  1U4C A;  3OW8 A;  4A08 A;  2XDW A;  2OK6 A;  5IGQ A;  2CE8 A;  4PSW B;  4ZN4 A;  5K1C C;  2Z2N A;  3EI2 B;  5E6S A;  2HU8 A;  2QXV A;  4UM8 A;  3V7D B;  1GOH A;  5HE3 B;  3ZE1 A;  4OZU A;  5M61 A;  2PM9 A;  4PBY A;  2GNQ A;  3IJC A;  4NC4 A;  1H2W A;  4NAA A;  5H14 A;  5CXC A;  5AFU 3;  2IAA A;  4A11 A;  3KRX B;  4A09 B;  2H68 A;  3IJE A;  2XL2 A;  4CI1 A;  4CY2 A;  3UVL A;  4D6V A;  4FB1 D;  5C86 A;  3OKY B;  5H17 A;  5FXY A;  5K19 A;  4G56 B;  1K3I A;  2VDR A;  1N6D A;  4X63 B;  2H13 A;  5TDH B;  3SJL D;  2VDP A;  3RN1 D;  5EM2 A;  3ZDY A;  5FFG A;  4AEZ A;  4YVD A;  1O6G A;  1XHM A;  4J87 A;  4E5Z A;  4IMM A;  4FA5 D;  3EI2 A;  5EML B;  1L5G A;  5FKR A;  3GD1 I;  4J77 A;  4QL1 A;  4ZOX A;  4A11 B;  4AOW A;  4O02 A;  2WQ8 A;  4JT5 C;  4QT8 A;  4CI3 A;  3UKU C;  2H6Q A;  1UOQ A;  4GMB A;  5FLX g;  2I0R A;  2VDN A;  2OVP B;  4X60 B;  3ZE2 A;  4QRJ A;  2IUP A;  3JZG A;  4WJK A;  5FQD A;  4RE6 A;  2Z2O A;  3MUN A;  1UTC A;  1JJU B;  1I2M B;  4BUJ C;  4L1Q D;  3VGZ A;  4CZV A;  3C75 H;  3PXS D;  3EI3 B;  1A12 A;  5E6U A;  4GGC A;  4CY5 A;  1OMW B;  2EIB A;  2P9K C;  3I7K A;  4MMZ A;  4QQE A;  1K32 A;  5I5J A;  4DNU A;  4GQB B;  1TYE A;  4J0W A;  3DXK C;  4AX4 A;  2YNO A;  2HU7 A;  4UM9 A;  3IUQ A;  5E6R A;  5FA5 B;  4BCD A;  3MZK A;  3MKS B;  4ES0 A;  1MG3 A;  2EIC A;  2Z2P A;  3PSC B;  3RSE C;  1T2X A;  4D0K A;  4K3I D;  5JWZ A;  1H2Y A;  4O2W A;  3FRX A;  3MVD K;  4Z7O A;  5M5S A;  5HE2 B;  3GC3 B;  3JRO A;  2TRC B;  2AGX A;  4CZX A;  3FM0 A;  5IC7 A;  3DXM C;  3B7F A;  3SLE D;  4L3G D;  4K3J B;  5EAR A;  4IA9 A;  4Z8L A;  5FFO A;  4XYH A;  1P22 A;  4E5Z B;  1GOF A;  5EAP A;  1H2X A;  1ERJ A;  4MMX A;  2CN3 A;  1VZ2 A;  2YB8 B;  2VDK A;  4DNV A;  1M1X A;  5I5I A;  5EM2 B;  3O4G A;  4FHL A;  4CY3 A;  3SHF A;  2B5M A;  2CO0 C;  3DM0 A;  3OTT A;  4GGA A;  5SXM A;  1GXR A;  3FGB A;  4OWR A;  1GOT B;  4U1E I;  3IVM A;  3C9C A;  3CIK B;  1VYH C;  2J56 H;  3EWE A;  3UVK A;  1JOF A;  3F3G A;  2OK4 A;  3VI3 A;  1VE7 A;  5CXB A;  4H5I A;  4O1Q D;  2BBK H;  2I0S A;  3CFV A;  3CFS B;  3ORV D;  3OKT A;  1C9I A;  1TYQ C;  4O3T B;  3EQ7 A;  1JV2 A;  5TF2 A;  5HE0 B;  4AN1 A;  4JD2 C;  4ERY A;  2UZX B;  3JPX A;  2H6K A;  4D9S A;  2P9P C;  5HQG A;  4AMZ A;  2P9L C;  2HKM A;  3ZE0 A;  1GG2 B;  2YNN A;  4ZOV A;  1H2Z A;  3ZWL B;  4XEI C;  1UOP A;  1NEX B;  4R7A B;  3NVX A;  1TBG A;  2HJ4 A;  3NIF A;  3MUO A;  2EIE A;  4FAN D;  4EWR A;  1C9L A;  2GC7 A;  1K8K C;  3C99 A;  4NBM A;  3W15 A;  4RE5 A;  4ERZ A;  3PXW D;  3IUR A;  3I7O A;  2XE4 A;  5GMK n;  4JHP C;  3VI4 A;  2P9I C;  4U7A A;  2CN2 A;  5EMK B;  1QFS A;  4L9O A;  5EAL A;  5KDO B;  3ULE C;  4LG8 A;  3RFH A;  3IUL A;  2H47 A;  3PVW B;  4BH6 A;  4IRZ A;  3RRM C;  4ESG A;  3I2N A;  1OLZ A;  4XYI A;  3SN6 B;  2J55 H;  2VDL A;  5C92 A;  3K6S A;  1YR2 A;  4A0A B;  3IIW A;  3F3P A;  5HE1 B;  1B9Y A;  4LGN A;  5A2Q g;  5TEE A;  3FCU A;  2PBI B;  3PXT D;  3DWL C;  2YMU A;  4O45 A;  5CXB B;  1R5M A;  4J73 A;  5GXI A;  3SCY A;  3JRP A;  2IUQ A;  1JMX B;  4FA1 D;  3T3P A;  2B4E A;  4FWW A;  3UVN A;  2I3T A;  3SFZ A;  2EID A;  1E5T A;  2AGL A;  3SWS D;  3V4V A;  2VZ3 A;  1O6F A;  4Z7Q A;  4FA4 D;  3QI0 A;  4A0B B;  3RN0 D;  1BPO A;  2MTA H;  2VDM A;  4WK0 A;  2H9P A;  4O9D A;  4A7J A;  3PE7 A;  5THA A;  4G55 A;  4HDJ A;  2QR5 A;  2BCJ B;  5IJ7 E;  3EI1 B;  3N0D A;  3SBP A;  4ZOZ A;  3KCI A;  3I8E A;  2AH0 A;  5C9Z B;  2XU7 A;  4JHN A;  4UI9 R;  3VH0 A;  1U8C A;  3ZDZ A;  1PI6 A;  5HDB A;  2GC4 A;  1VZ3 A;  2IWF A;  1QNI A;  3MXX A;  4LG9 A;  5M5R A;  4BP8 A;  4GQ1 A;  5AJA A;  4JSX C;  3UR4 A;  5M5U A;  2HXC A;  2B5N A;  2O9K A;  3I7L A;  4BCC A;  2OIZ A;  4FAV D;  3KRW B;  3V4P A;  4MK0 B;  4PNK B;  3BWS A;  2AH1 A;  3VA6 A;  4BCB A;  4FA9 D;  1PBY B;  4A09 A;  3EI3 A;  4H5J A;  3JZH A;  1XIP A;  1NR0 A;  3N0E A;  4J86 A;  4J78 A;  4PXW A;  2H9L A;  3EU7 A;  5CYK B;  5EMJ B;  2QZP A;  4KFM B;  4J82 A;  3JB9 L;  3PVU B;  4GQ2 P;  4JSP C;  2I3S A;  1GOG A;  3OKY A;  3I7P A;  3IJ1 A;  3IJ0 A;  1JMZ B;  1SQJ A;  2AGZ A;  3SVW D;  3DSM A;  3I89 A;  3IUN A;  3SXT D;  3AL9 A;  2H14 A;  3AL8 A;  3GFC A;  3V5W B;  3HFQ A;  3L4O D;  1N6E A;  4GM3 A;  4QAM A;  2AGW A;  4I79 A;  4A2M A;  1QFM A;  1UOO A;  2AQ5 A;  4J8B A;  4N14 A;  5GSA A;  1FWX A;  3A0F A;  3JAM g;  1U2V C;  3IUM A; 
#chains in the Genus database with same CATH homology
 4PC0 A;  2P9U C;  4BL0 A;  4A08 B;  3EG6 A;  3IIY A;  3AL8 B;  1Q47 A;  4Y5R D;  5TEF A;  3UVO A;  3OKW A;  1N6F A;  1RI6 A;  4J0X A;  3EMH A;  3SMR A;  2YBA A;  1A0R B;  1PEV A;  3JZN A;  2G9A A;  2CNX A;  4CZY A;  3I7N A;  4O3U B;  5IJ8 E;  2H9N A;  4J8G A;  3RFG A;  2CE9 A;  3PSL A;  3K27 A;  4CI2 A;  2UZY B;  4J81 A;  4ZOY A;  2P9S C;  5C2W B;  2HES X;  2PM7 B;  2P9N C;  3MZL A;  3SBQ A;  3EI4 A;  1L0Q A;  1SHY B;  5I5M A;  3I7H A;  2CO0 A;  4JT6 C;  3J80 g;  2XL3 A;  2PM6 B;  4J84 A;  5H1M A;  3MMY A;  4CC9 A;  4X61 B;  3OL2 A;  5CYK A;  2H3X A;  3P4F A;  2Q7Q A;  4NSX A;  3J81 g;  2IUV A;  4GM8 A;  3V9F A;  4Y7R A;  2OVQ B;  5GXH A;  4JSN C;  5HYN B;  5FKT A;  2B5L A;  4A2L A;  5EAM A;  3UKR C;  4A0B A;  2H6N A;  1GP2 B;  2OJY A;  3C5M A;  4J79 A;  2HJB A;  4PSX B;  2AGY A;  2IUR A;  2PM9 B;  3K26 A;  4JSV C;  1MDA H;  3OL2 B;  4JXM A;  4E54 A;  2H9M A;  5FKS A;  3EI1 A;  3RMZ D;  1B9X A;  5EMM B;  3IKO A;  3RLM D;  1YFQ A;  3AH8 B;  4GZ8 A;  3BG0 A;  4CI8 A;  4A0A A;  1SQ9 A;  5B4W A;  1XKS A;  5IT9 g;  4GGD A;  5C2V B;  3NVN A;  3UVM A;  2YNP A;  4GM9 A;  5FKQ A;  4PBZ A;  1PGU A;  2IWK A;  3BG1 A;  2QC5 A;  3ODT A;  3L4M D;  5AMS A;  1S4U X;  2J57 G;  2W18 A;  3NVQ A;  2XYI A;  3MKQ A;  3EI4 B;  4X3E A;  4E54 B;  1MG2 A;  2HYE A;  3U4Y A;  3F3F A;  3I8C A;  3E0C A;  3SBR A;  4TZ4 A;  5IGO A;  2OVR B;  5CXC B;  2EBS A;  3AFC A;  4ERQ A;  2I0T A;  4L3H D;  3GRE A;  2G99 A;  4CY1 A;  2HKR A;  1U4C A;  3OW8 A;  4A08 A;  5IGQ A;  2OK6 A;  2CE8 A;  4PSW B;  4ZN4 A;  5K1C C;  2Z2N A;  3EI2 B;  2QXV A;  3V7D B;  5HE3 B;  4OZU A;  4PBY A;  2PM9 A;  2GNQ A;  3IJC A;  5H14 A;  5CXC A;  5AFU 3;  2IAA A;  4A11 A;  3KRX B;  4A09 B;  2H68 A;  2XL2 A;  4CI1 A;  4CY2 A;  3UVL A;  4D6V A;  4FB1 D;  3OKY B;  5H17 A;  5FXY A;  5K19 A;  4G56 B;  1N6D A;  4X63 B;  2H13 A;  5TDH B;  3SJL D;  3RN1 D;  5EM2 A;  4AEZ A;  4YVD A;  1XHM A;  4J87 A;  4E5Z A;  4IMM A;  4FA5 D;  3EI2 A;  5EML B;  5FKR A;  4J77 A;  4QL1 A;  4ZOX A;  4A11 B;  4AOW A;  4JT5 C;  4QT8 A;  4CI3 A;  3UKU C;  2H6Q A;  4GMB A;  5FLX g;  2I0R A;  2OVP B;  4X60 B;  4QRJ A;  2IUP A;  3JZG A;  5FQD A;  2Z2O A;  1JJU B;  4BUJ C;  4L1Q D;  3VGZ A;  4CZV A;  3C75 H;  3PXS D;  3EI3 B;  4GGC A;  4CY5 A;  1OMW B;  3I7K A;  2P9K C;  4QQE A;  1K32 A;  5I5J A;  4GQB B;  4J0W A;  3DXK C;  2YNO A;  5FA5 B;  3MZK A;  3MKS B;  4ES0 A;  1MG3 A;  2Z2P A;  4D0K A;  3PSC B;  3RSE C;  4K3I D;  5JWZ A;  3FRX A;  5HE2 B;  3JRO A;  2TRC B;  2AGX A;  4CZX A;  3FM0 A;  5IC7 A;  3DXM C;  3B7F A;  3SLE D;  4L3G D;  4K3J B;  5EAR A;  4IA9 A;  4Z8L A;  4XYH A;  1P22 A;  4E5Z B;  5EAP A;  1ERJ A;  2CN3 A;  2YB8 B;  5I5I A;  5EM2 B;  4FHL A;  4CY3 A;  3SHF A;  2B5M A;  2CO0 C;  3DM0 A;  3OTT A;  4GGA A;  5SXM A;  1GXR A;  3FGB A;  4OWR A;  1GOT B;  4U1E I;  3C9C A;  3CIK B;  1VYH C;  2J56 H;  3EWE A;  3UVK A;  1JOF A;  3F3G A;  2OK4 A;  5CXB A;  4H5I A;  4O1Q D;  2BBK H;  2I0S A;  3CFV A;  3CFS B;  3OKT A;  3ORV D;  1TYQ C;  4O3T B;  5TF2 A;  5HE0 B;  4JD2 C;  4ERY A;  2UZX B;  3JPX A;  2H6K A;  2P9P C;  5HQG A;  2P9L C;  2HKM A;  1GG2 B;  2YNN A;  4ZOV A;  3ZWL B;  4XEI C;  1NEX B;  4R7A B;  3NVX A;  1TBG A;  2HJ4 A;  4FAN D;  4EWR A;  2GC7 A;  1K8K C;  3C99 A;  3W15 A;  4ERZ A;  3PXW D;  3I7O A;  5GMK n;  2P9I C;  4U7A A;  2CN2 A;  5EMK B;  4L9O A;  5EAL A;  5KDO B;  3ULE C;  4LG8 A;  3RFH A;  2H47 A;  3PVW B;  4BH6 A;  3RRM C;  4ESG A;  3I2N A;  1OLZ A;  4XYI A;  3SN6 B;  2J55 H;  4A0A B;  3IIW A;  3F3P A;  5HE1 B;  1B9Y A;  4LGN A;  5A2Q g;  5TEE A;  2PBI B;  3PXT D;  3DWL C;  2YMU A;  4O45 A;  5CXB B;  1R5M A;  4J73 A;  5GXI A;  3SCY A;  3JRP A;  2IUQ A;  1JMX B;  4FA1 D;  2B4E A;  4FWW A;  3UVN A;  2I3T A;  3SFZ A;  2AGL A;  3SWS D;  4FA4 D;  4A0B B;  3RN0 D;  2MTA H;  2H9P A;  4O9D A;  4A7J A;  3PE7 A;  5THA A;  4HDJ A;  2BCJ B;  5IJ7 E;  3EI1 B;  3N0D A;  3SBP A;  4ZOZ A;  3I8E A;  2AH0 A;  5C9Z B;  2XU7 A;  4UI9 R;  3VH0 A;  1PI6 A;  2GC4 A;  2IWF A;  1QNI A;  3MXX A;  4LG9 A;  4GQ1 A;  5AJA A;  4JSX C;  3UR4 A;  2HXC A;  2B5N A;  2O9K A;  3I7L A;  2OIZ A;  4FAV D;  3KRW B;  4MK0 B;  4PNK B;  3BWS A;  2AH1 A;  3VA6 A;  4FA9 D;  1PBY B;  4A09 A;  3EI3 A;  4H5J A;  3JZH A;  1XIP A;  1NR0 A;  3N0E A;  4J86 A;  4J78 A;  4PXW A;  2H9L A;  3EU7 A;  5CYK B;  5EMJ B;  4KFM B;  4J82 A;  3JB9 L;  3PVU B;  4GQ2 P;  4JSP C;  2I3S A;  3OKY A;  3I7P A;  3IJ1 A;  3IJ0 A;  1JMZ B;  1SQJ A;  2AGZ A;  3SVW D;  3DSM A;  3I89 A;  3SXT D;  3AL9 A;  2H14 A;  3AL8 A;  3GFC A;  3V5W B;  3HFQ A;  3L4O D;  1N6E A;  4GM3 A;  2AGW A;  4I79 A;  4A2M A;  2AQ5 A;  4N14 A;  4J8B A;  5GSA A;  1FWX A;  3A0F A;  3JAM g;  1U2V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...