4K3ID

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug, c2 space group
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Structures of MauG in complex with quinol and quinone MADH.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 99
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4k3iD00
3OL2B 2HKRA 1U2VC 4NSXA 4BL0A 1MDAH 1XHMA 1U4CA 3GREA 2G99A 4ESGA 2YB8B 4D6VA 4PC0A 2PM9B 4QRJA 4L3GD 2CN3A 3SFZA 3UVKA 3C75H 3C99A 5IJ7E 4ZOVA 1NR0A 1TBGA 1OMWB 4GQBB 4ZOZA 3ORVD 3DWLC 4J86A 3EI1A 5FA5B 2XL3A 4GM8A 4Z8LA 2YNPA 5I5JA 4EWRA 2H6KA 3CFSB 3EI4B 5H1MA 3EI2B 3OKWA 2EBSA 3JRPA 5HE0B 2GNQA 2HXCA 3K27A 5CYKA 2J56H 3OKYA 2I3SA 2I3TA 3BG0A 3HFQA 3SJLD 3N0EA 3N0DA 3SCYA 3AL9A 2P9NC 2OK6A 3RSEC 5EMMB 4N14A 2I0TA 2AH1A 4GM9A 3MKSB 1SQ9A 2BCJB 1JMZB 4IMMA 3UKUC 2H3XA 2J57G 4MK0B 4GQ1A 3MZKA 5GMKn 4LG9A 3PXTD 4ERQA 4J8GA 4A7JA 2P9KC 1MG3A 3SHFA 1OLZA 5EALA 4D0KA 2B5MA 3PVWB 5CXCB 4CZVA 3I7PA 2OJYA 4AOWA 5EM2A 4CY1A 4CI3A 3FGBA 5HE3B 1R5MA 5EARA 2TRCB 2IAAA 3E0CA 4ERYA 2QC5A 4XEIC 3JZNA 3CFVA 3MZLA 4O9DA 5IGOA 5IGQA 4TZ4A 2PM7B 5FQDA 3U4YA 3SLED 3RN0D 3PXWD 3SBPA 4CZYA 3JPXA 4L3HD 3SMRA 5HYNB 1N6EA 2IWKA 2HESX 3NVNA 2Z2NA 4PSWB 3EI1B 2H13A 5K19A 1MG2A 3I7HA 5C9ZB 5KDOB 3DM0A 3SWSD 5K1CC 2AGXA 4HDJA 4X63B 5H17A 3UVNA 3V5WB 3SN6B 5IJ8E 1RI6A 2AGYA 2CO0C 5IT9g 3P4FA 2PM6B 5CYKB 3ODTA 2B5LA 3OKYB 3C5MA 3SBQA 3BWSA 3UR4A 2AGZA 4QL1A 1ERJA 3UVLA 3MMYA 4BH6A 4J0WA 1NEXB 4FWWA 2OVPB 5EMLB 1YFQA 4ERZA 3IJ1A 3VH0A 4J0XA 4JSXC 5FXYA 4J87A 3OW8A 5AMSA 3AH8B 3F3FA 4PXWA 3B7FA 3V7DB 5GXIA 3I7NA 5TEEA 3J80g 2P9UC 4E54A 1QNIA 3RN1D 1N6DA 3BG1A 4CC9A 2YNNA 2H6QA 5TEFA 3VGZA 3IJCA 5EAPA 5AJAA 5EM2B 4CZXA 3ZWLB 2I0RA 1JOFA 1XIPA 1K32A 4FAND 4CY3A 3OKTA 4CI1A 2YMUA 4JT5C 2Z2OA 3SXTD 3I89A 2Q7QA 3V9FA 4FHLA 3IIYA 2IUPA 4JSVC 3FRXA 3EI3A 4A08A 1JMXB 2AGWA 4J78A 3EMHA 4CY2A 2H14A 1GG2B 5TDHB 1B9YA 4E5ZA 4GGCA 4LG8A 4H5JA 3JZGA 4A09A 4Y7RA 4U7AA 4FAVD 4O3UB 5SXMA 2UZYB 2B5NA 2J55H 4X60B 4YVDA 2UZXB 4CY5A 4GGAA 5AFU3 3OTTA 3IKOA 2H9LA 5FKRA 3RFHA 1XKSA 2CE9A 3KRXB 3SBRA 4OWRA 5THAA 4JD2C 3J81g 1FWXA 2P9IC 4GZ8A 2YNOA 4J81A 4H5IA 3RFGA 2H9MA 3UKRC 1L0QA 2B4EA 2H6NA 5FKQA 4GGDA 4A0AA 2I0SA 2IUVA 3AL8A 3RRMC 2OK4A 4LGNA 4O45A 3FM0A 5TF2A 5FLXg 3F3PA 4J73A 4JT6C 5B4WA 2AGLA 5CXBA 5JWZA 3C9CA 4E54B 1K8KC 4FB1D 2YBAA 2CNXA 4FA1D 2H9NA 4FA4D 4A0BA 3JZHA 3PXSD 4X61B 1GXRA 1GOTB 3DXMC 4G56B 4R7AB 2HYEA 5HQGA 4O3TB 4O1QD 4XYIA 4J77A 4XYHA 4FA5D 2GC4A 2XL2A 4QQEA 2P9LC 5GXHA 2PBIB 2H47A 3MKQA 2AQ5A 4AEZA 3EI3B 4QT8A 3I7OA 3NVXA 4A11B 4A08B 3EG6A 3PE7A 1Q47A 4ES0A 2HJBA 3MXXA 4KFMB 3I7LA 4A2MA 1SQJA 3JAMg 5EMJB 4J82A 4E5ZB 4UI9R 5A2Qg 3NVQA 3IIWA 3L4MD 3OL2A 5H14A 4A09B 4L9OA 2OVQB 1SHYB 5C2WB 3I8CA 2IUQA 3L4OD 3GFCA 1GP2B 5GSAA 2HKMA 5EMKB 3RMZD 2PM9A 5I5IA 3JROA 2AH0A 3DSMA 3PSLA 4A11A 4FA9D 4OZUA 4JXMA 2CE8A 2G9AA 3I2NA 4JSPC 4PBZA 1PEVA 2W18A 3PSCB 1VYHC 4K3ID 3UVMA 3W15A 4L1QD 2OVRB 2P9PC 2OIZA 3ULEC 1S4UX 3EI4A 3EI2A 4A0AB 2XYIA 3AL8B 3CIKB 4K3JB 4J84A 3I8EA 1B9XA 4GQ2P 3EU7A 4U1EI 4J79A 2CN2A 2P9SC 3UVOA 5IC7A 3VA6A 2O9KA 5HE2B 4ZN4A 4X3EA 5CXBB 2MTAH 3DXKC 2Z2PA 3AFCA 4ZOXA 3F3GA 1P22A 3PVUB 5FKSA 5I5MA 5EAMA 4A0BB 2IWFA 3KRWB 5FKTA 2IURA 2GC7A 1TYQC 3K26A 4JSNC 3JB9L 3A0FA 4GMBA 3EWEA 3I7KA 5HE1B 2BBKH 1PBYB 3SVWD 1JJUB 1N6FA 2XU7A 4I79A 4CI8A 2CO0A 1PI6A 4A2LA 2HJ4A 4IA9A 5C2VB 2QXVA 2H68A 3RLMD 2H9PA 1PGUA 4CI2A 4J8BA 3IJ0A 1A0RB 4PSXB 4PBYA 4PNKB 5CXCA 4GM3A 4BUJC 4Y5RD 4ZOYA
chains in the Genus database with same CATH superfamily
3OL2B 2HKRA 1U2VC 3GC3B 4NSXA 4BL0A 1MDAH 1XHMA 1U4CA 4NBMA 3GREA 2G99A 4ESGA 2YB8B 4NENA 4D6VA 4PC0A 2PM9B 4QRJA 4L3GD 2CN3A 3SFZA 3UVKA 1T2XA 3C75H 2VDQA 3C99A 5IJ7E 4ZOVA 1NR0A 3EQ8A 1TBGA 1OMWB 4GQBB 4DNVA 4ZOZA 3ORVD 4Z7NA 3DWLC 3ZDXA 4J86A 3EI1A 5FA5B 2XL3A 4GM8A 4JHPC 4BCCA 4Z8LA 2YNPA 5I5JA 4EWRA 2H6KA 4BP9A 3CFSB 3EI4B 5H1MA 5M5VA 3EI2B 3OKWA 2EBSA 3JRPA 5HE0B 3FCUA 2GNQA 2HXCA 3K27A 5CYKA 2J56H 3OKYA 2I3SA 2I3TA 3BG0A 3HFQA 3SJLD 5E6UA 3K6SA 3N0EA 3N0DA 3SCYA 3AL9A 5E6RA 2P9NC 2OK6A 3RSEC 5EMMB 4N14A 2I0TA 2AH1A 4GM9A 3MKSB 1SQ9A 2BCJB 3EQ7A 1JMZB 4IMMA 2VDMA 3UKUC 2H3XA 2J57G 1L5GA 4L1MA 2HU8A 1JV2A 4MK0B 3FCSA 4GQ1A 3MZKA 5GMKn 2EIBA 4LG9A 2VZ1A 3PXTD 4ERQA 3MUNA 4J8GA 5E6SA 4A7JA 2P9KC 4RE5A 4D9SA 1MG3A 2EIDA 4G1EA 4WK2A 3SHFA 1OLZA 5EALA 4O02A 4D0KA 2B5MA 2XZGA 3PVWB 5CXCB 3QHYB 4CZVA 3I7PA 2EICA 2OJYA 4AN1A 3O4IA 4AOWA 5EM2A 4CY1A 4CI3A 3FGBA 5HE3B 1GOGA 1R5MA 1BPOA 5EARA 2TRCB 2IAAA 3E0CA 4ERYA 2QC5A 4XEIC 3V4PA 3JZNA 3CFVA 3MZLA 4O9DA 5IGOA 5IGQA 4TZ4A 2PM7B 5FQDA 3U4YA 3SLED 3RN0D 3OF7A 3PXWD 3SBPA 4CZYA 4DNWA 3JPXA 4L3HD 3SMRA 5HYNB 1N6EA 2IWKA 4Z7OA 2HESX 3NVNA 2Z2NA 1C9LA 4PSWB 3ZE2A 3EI1B 2H13A 5K19A 1MG2A 3I7HA 5C9ZB 5KDOB 3DM0A 3SWSD 2JKXA 5K1CC 2AGXA 4HDJA 4X63B 5H17A 3UVNA 3V5WB 3IUMA 3SN6B 5M5SA 5IJ8E 1RI6A 2AGYA 2CO0C 5M5UA 5IT9g 3P4FA 2PM6B 5CYKB 3ODTA 2B5LA 3OKYB 3C5MA 3SBQA 3BWSA 3KCIA 4WJKA 3UR4A 2AGZA 4QL1A 1ERJA 3UVLA 3QI0A 3MMYA 4BH6A 4J0WA 1NEXB 2BKLA 2OVPB 4FWWA 5EMLB 1YFQA 4ERZA 3IJ1A 2XDWA 3VH0A 4J0XA 4NC4A 1JTDB 4JSXC 5FXYA 1C9IA 2HU7A 4J87A 2QR5A 3OW8A 5AMSA 3AH8B 3F3FA 4PXWA 3B7FA 1H2YA 3V7DB 5GXIA 3I7NA 1UOOA 5TEEA 3J80g 2P9UC 4E54A 1QNIA 3T3MA 3RN1D 1N6DA 3BG1A 4CC9A 4JHNA 2YNNA 2H6QA 5TEFA 3VGZA 3IJCA 3IURA 1YR2A 5AJAA 5EAPA 5EM2B 4CZXA 3ZWLB 1O6GA 1UOQA 2I0RA 1JOFA 1XIPA 4Z7QA 1K32A 4FAND 2VDKA 4CY3A 3OKTA 4CI1A 2YMUA 4JT5C 2Z2OA 4G1MA 2VDNA 3SXTD 5HDBA 3I89A 5C92A 3MUOA 2Q7QA 3NIGA 3V9FA 4FHLA 3IIYA 1VZ2A 1U8CA 2IUPA 4JSVC 5M5TA 3FRXA 3EI3A 1UTCA 4AX4A 3IUNA 4A08A 1JMXB 1E8NA 2AGWA 4J78A 3GD1I 3EMHA 4CY2A 2H14A 1H2ZA 1GG2B 5TDHB 1B9YA 5C86A 4E5ZA 4GGCA 1GOHA 4LG8A 4H5JA 3VI4A 4BCDA 3JZGA 4A09A 4Y7RA 1GOFA 4WK4A 4U7AA 4FAVD 4O3UB 5SXMA 2UZYB 2B5NA 2J55H 2XE4A 4X60B 4YVDA 1I2MB 2QZPA 4AMZA 2UZXB 4CY5A 4GGAA 5AFU3 3OTTA 3IKOA 2H9LA 3VI3A 4BCBA 1K3IA 3IULA 5FKRA 3RFHA 1XKSA 1A12A 2CE9A 3KRXB 3IJEA 3SBRA 1M1XA 4OWRA 5THAA 3O4HA 4JD2C 3J81g 1FWXA 2VDOA 2P9IC 4GZ8A 2YNOA 4J81A 2VC2A 4H5IA 3RFGA 2H9MA 3UKRC 1L0QA 2B4EA 2H6NA 5FKQA 4GGDA 4A0AA 2I0SA 2IUVA 3AL8A 3RRMC 2OK4A 4LGNA 4O2WA 4O45A 3FM0A 5TF2A 5FLXg 3F3PA 4J73A 4JT6C 5B4WA 2AGLA 5CXBA 4QAMA 5JWZA 3C9CA 4E54B 1K8KC 4FB1D 2YBAA 2CNXA 4FA1D 5FFOA 4MMXA 2H9NA 3NIDA 4FA4D 4A0BA 3JZHA 3PXSD 4X61B 2VZ3A 1GXRA 1GOTB 3DXMC 4G56B 4IRZA 4R7AB 2HYEA 5HQGA 4O3TB 4WK0A 4O1QD 3ZDZA 4XYIA 4J77A 4XYHA 4BP8A 4FA5D 2GC4A 2XL2A 4QQEA 3ZDYA 3O4JA 2P9LC 5GXHA 1VE7A 2PBIB 2H47A 3MKQA 2AQ5A 4AEZA 3EI3B 4QT8A 3I7OA 3NVXA 5M61A 1H2WA 4A11B 4A08B 3EG6A 3PE7A 1Q47A 4ES0A 2HJBA 3MXXA 4KFMB 3I7LA 4A2MA 1SQJA 4MMYA 3JAMg 5EMJB 4J82A 4E5ZB 4UI9R 5A2Qg 3NVQA 3IIWA 3L4MD 3OL2A 5H14A 3IUQA 4A09B 4L9OA 2OVQB 1SHYB 3IUJA 5C2WB 3I8CA 3EQ9A 1UOPA 2EIEA 2IUQA 3L4OD 3GFCA 1GP2B 3K72A 5FFGA 5GSAA 4MMZA 2HKMA 5EMKB 3RMZD 2PM9A 5I5IA 3JROA 3O4GA 4AN0A 2AH0A 3DSMA 3PSLA 4A11A 1QFSA 4FA9D 4OZUA 4JXMA 2CE8A 2G9AA 3I2NA 4JSPC 4PBZA 1PEVA 3V4VA 2HU5A 1E8MA 1O6FA 2W18A 3PSCB 1VYHC 4K3ID 3UVMA 3W15A 4L1QD 2OVRB 2P9PC 1VE6A 2VDPA 2OIZA 3ULEC 1S4UX 3EI4A 3EI2A 4A0AB 2XYIA 3AL8B 4UM9A 3CIKB 4K3JB 4J84A 3K71A 3I8EA 1B9XA 4GQ2P 3EU7A 4U1EI 2CN2A 2P9SC 4J79A 3UVOA 5IC7A 3VA6A 4RE6A 2O9KA 5HE2B 4NAAA 4ZN4A 1E5TA 4X3EA 5CXBB 1QFMA 2MTAH 3DXKC 2Z2PA 3AFCA 4ZOXA 3F3GA 1P22A 4AMYA 3IVMA 1VZ3A 3PVUB 5FKSA 5I5MA 5EAMA 4DNUA 4A0BB 2IWFA 3KRWB 3NIFA 5FKTA 2IURA 2GC7A 1TYQC 3T3PA 3K26A 3MVDK 4JSNC 3JB9L 3ZE1A 3A0FA 4GMBA 3EWEA 3I7KA 5HE1B 2BBKH 1PBYB 3ZE0A 1JJUB 1N6FA 2XU7A 4I79A 3SVWD 2WQ8A 4CI8A 2CO0A 1PI6A 4A2LA 1H2XA 5M5RA 2HJ4A 2VDRA 4IA9A 5C2VB 4UM8A 2QXVA 2H68A 3RLMD 2H9PA 1PGUA 1TYEA 4J8BA 4CI2A 3IJ0A 1A0RB 4PSXB 4PBYA 4G55A 4PNKB 5CXCA 4GM3A 4BUJC 2VDLA 3DDUA 4Y5RD 4ZOYA
chains in the Genus database with same CATH topology
3OL2B 2HKRA 1U2VC 4NSXA 4BL0A 1MDAH 1XHMA 1U4CA 3GREA 2G99A 4ESGA 2YB8B 4D6VA 4PC0A 2PM9B 4QRJA 4L3GD 2CN3A 3SFZA 3UVKA 3C75H 3C99A 5IJ7E 4ZOVA 1NR0A 1TBGA 1OMWB 4GQBB 4ZOZA 3ORVD 3DWLC 4J86A 3EI1A 5FA5B 2XL3A 4GM8A 4Z8LA 2YNPA 5I5JA 4EWRA 2H6KA 3CFSB 3EI4B 5H1MA 3EI2B 3OKWA 2EBSA 3JRPA 5HE0B 2GNQA 2HXCA 3K27A 5CYKA 2J56H 3OKYA 2I3SA 2I3TA 3BG0A 3HFQA 3SJLD 3N0EA 3N0DA 3SCYA 3AL9A 2P9NC 2OK6A 3RSEC 5EMMB 4N14A 2I0TA 2AH1A 4GM9A 3MKSB 1SQ9A 2BCJB 1JMZB 4IMMA 3UKUC 2H3XA 2J57G 4MK0B 4GQ1A 3MZKA 5GMKn 4LG9A 3PXTD 4ERQA 4J8GA 4A7JA 2P9KC 1MG3A 3SHFA 1OLZA 5EALA 4D0KA 2B5MA 3PVWB 5CXCB 4CZVA 3I7PA 2OJYA 4AOWA 5EM2A 4CY1A 4CI3A 3FGBA 5HE3B 1R5MA 5EARA 2TRCB 2IAAA 3E0CA 4ERYA 2QC5A 4XEIC 3JZNA 3CFVA 3MZLA 4O9DA 5IGOA 5IGQA 4TZ4A 2PM7B 5FQDA 3U4YA 3SLED 3RN0D 3PXWD 3SBPA 4CZYA 3JPXA 4L3HD 3SMRA 5HYNB 1N6EA 2IWKA 2HESX 3NVNA 2Z2NA 4PSWB 3EI1B 2H13A 5K19A 1MG2A 3I7HA 5C9ZB 5KDOB 3DM0A 3SWSD 5K1CC 2AGXA 4HDJA 4X63B 5H17A 3UVNA 3V5WB 3SN6B 5IJ8E 1RI6A 2AGYA 2CO0C 5IT9g 3P4FA 2PM6B 5CYKB 3ODTA 2B5LA 3OKYB 3C5MA 3SBQA 3BWSA 3UR4A 2AGZA 4QL1A 1ERJA 3UVLA 3MMYA 4BH6A 4J0WA 1NEXB 4FWWA 2OVPB 5EMLB 1YFQA 4ERZA 3IJ1A 3VH0A 4J0XA 4JSXC 5FXYA 4J87A 3OW8A 5AMSA 3AH8B 3F3FA 4PXWA 3B7FA 3V7DB 5GXIA 3I7NA 5TEEA 3J80g 2P9UC 4E54A 1QNIA 3RN1D 1N6DA 3BG1A 4CC9A 2YNNA 2H6QA 5TEFA 3VGZA 3IJCA 5EAPA 5AJAA 5EM2B 4CZXA 3ZWLB 2I0RA 1JOFA 1XIPA 1K32A 4FAND 4CY3A 3OKTA 4CI1A 2YMUA 4JT5C 2Z2OA 3SXTD 3I89A 2Q7QA 3V9FA 4FHLA 3IIYA 2IUPA 4JSVC 3FRXA 3EI3A 4A08A 1JMXB 2AGWA 4J78A 3EMHA 4CY2A 2H14A 1GG2B 5TDHB 1B9YA 4E5ZA 4GGCA 4LG8A 4H5JA 3JZGA 4A09A 4Y7RA 4U7AA 4FAVD 4O3UB 5SXMA 2UZYB 2B5NA 2J55H 4X60B 4YVDA 2UZXB 4CY5A 4GGAA 5AFU3 3OTTA 3IKOA 2H9LA 5FKRA 3RFHA 1XKSA 2CE9A 3KRXB 3SBRA 4OWRA 5THAA 4JD2C 3J81g 1FWXA 2P9IC 4GZ8A 2YNOA 4J81A 4H5IA 3RFGA 2H9MA 3UKRC 1L0QA 2B4EA 2H6NA 5FKQA 4GGDA 4A0AA 2I0SA 2IUVA 3AL8A 3RRMC 2OK4A 4LGNA 4O45A 3FM0A 5TF2A 5FLXg 3F3PA 4J73A 4JT6C 5B4WA 2AGLA 5CXBA 5JWZA 3C9CA 4E54B 1K8KC 4FB1D 2YBAA 2CNXA 4FA1D 2H9NA 4FA4D 4A0BA 3JZHA 3PXSD 4X61B 1GXRA 1GOTB 3DXMC 4G56B 4R7AB 2HYEA 5HQGA 4O3TB 4O1QD 4XYIA 4J77A 4XYHA 4FA5D 2GC4A 2XL2A 4QQEA 2P9LC 5GXHA 2PBIB 2H47A 3MKQA 2AQ5A 4AEZA 3EI3B 4QT8A 3I7OA 3NVXA 4A11B 4A08B 3EG6A 3PE7A 1Q47A 4ES0A 2HJBA 3MXXA 4KFMB 3I7LA 4A2MA 1SQJA 3JAMg 5EMJB 4J82A 4E5ZB 4UI9R 5A2Qg 3NVQA 3IIWA 3L4MD 3OL2A 5H14A 4A09B 4L9OA 2OVQB 1SHYB 5C2WB 3I8CA 2IUQA 3L4OD 3GFCA 1GP2B 5GSAA 2HKMA 5EMKB 3RMZD 2PM9A 5I5IA 3JROA 2AH0A 3DSMA 3PSLA 4A11A 4FA9D 4OZUA 4JXMA 2CE8A 2G9AA 3I2NA 4JSPC 4PBZA 1PEVA 2W18A 3PSCB 1VYHC 4K3ID 3UVMA 3W15A 4L1QD 2OVRB 2P9PC 2OIZA 3ULEC 1S4UX 3EI4A 3EI2A 4A0AB 2XYIA 3AL8B 3CIKB 4K3JB 4J84A 3I8EA 1B9XA 4GQ2P 3EU7A 4U1EI 4J79A 2CN2A 2P9SC 3UVOA 5IC7A 3VA6A 2O9KA 5HE2B 4ZN4A 4X3EA 5CXBB 2MTAH 3DXKC 2Z2PA 3AFCA 4ZOXA 3F3GA 1P22A 3PVUB 5FKSA 5I5MA 5EAMA 4A0BB 2IWFA 3KRWB 5FKTA 2IURA 2GC7A 1TYQC 3K26A 4JSNC 3JB9L 3A0FA 4GMBA 3EWEA 3I7KA 5HE1B 2BBKH 1PBYB 3SVWD 1JJUB 1N6FA 2XU7A 4I79A 4CI8A 2CO0A 1PI6A 4A2LA 2HJ4A 4IA9A 5C2VB 2QXVA 2H68A 3RLMD 2H9PA 1PGUA 4CI2A 4J8BA 3IJ0A 1A0RB 4PSXB 4PBYA 4PNKB 5CXCA 4GM3A 4BUJC 4Y5RD 4ZOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL2 B;  2HKR A;  1U2V C;  4NSX A;  4BL0 A;  1MDA H;  1XHM A;  1U4C A;  3GRE A;  2G99 A;  4ESG A;  2YB8 B;  4D6V A;  4PC0 A;  2PM9 B;  4QRJ A;  4L3G D;  2CN3 A;  3SFZ A;  3UVK A;  3C75 H;  3C99 A;  5IJ7 E;  4ZOV A;  1NR0 A;  1TBG A;  1OMW B;  4GQB B;  4ZOZ A;  3ORV D;  3DWL C;  4J86 A;  3EI1 A;  5FA5 B;  2XL3 A;  4GM8 A;  4Z8L A;  2YNP A;  5I5J A;  4EWR A;  2H6K A;  3CFS B;  3EI4 B;  5H1M A;  3EI2 B;  3OKW A;  2EBS A;  3JRP A;  5HE0 B;  2GNQ A;  2HXC A;  3K27 A;  5CYK A;  2J56 H;  3OKY A;  2I3S A;  2I3T A;  3BG0 A;  3HFQ A;  3SJL D;  3N0E A;  3N0D A;  3SCY A;  3AL9 A;  2P9N C;  2OK6 A;  3RSE C;  5EMM B;  4N14 A;  2I0T A;  2AH1 A;  4GM9 A;  3MKS B;  1SQ9 A;  2BCJ B;  1JMZ B;  4IMM A;  3UKU C;  2H3X A;  2J57 G;  4MK0 B;  4GQ1 A;  3MZK A;  5GMK n;  4LG9 A;  3PXT D;  4ERQ A;  4J8G A;  4A7J A;  2P9K C;  1MG3 A;  3SHF A;  1OLZ A;  5EAL A;  4D0K A;  2B5M A;  3PVW B;  5CXC B;  4CZV A;  3I7P A;  2OJY A;  4AOW A;  5EM2 A;  4CY1 A;  4CI3 A;  3FGB A;  5HE3 B;  1R5M A;  5EAR A;  2TRC B;  2IAA A;  3E0C A;  4ERY A;  2QC5 A;  4XEI C;  3JZN A;  3CFV A;  3MZL A;  4O9D A;  5IGO A;  5IGQ A;  4TZ4 A;  2PM7 B;  5FQD A;  3U4Y A;  3SLE D;  3RN0 D;  3PXW D;  3SBP A;  4CZY A;  3JPX A;  4L3H D;  3SMR A;  5HYN B;  1N6E A;  2IWK A;  2HES X;  3NVN A;  2Z2N A;  4PSW B;  3EI1 B;  2H13 A;  5K19 A;  1MG2 A;  3I7H A;  5C9Z B;  5KDO B;  3DM0 A;  3SWS D;  5K1C C;  2AGX A;  4HDJ A;  4X63 B;  5H17 A;  3UVN A;  3V5W B;  3SN6 B;  5IJ8 E;  1RI6 A;  2AGY A;  2CO0 C;  5IT9 g;  3P4F A;  2PM6 B;  5CYK B;  3ODT A;  2B5L A;  3OKY B;  3C5M A;  3SBQ A;  3BWS A;  3UR4 A;  2AGZ A;  4QL1 A;  1ERJ A;  3UVL A;  3MMY A;  4BH6 A;  4J0W A;  1NEX B;  4FWW A;  2OVP B;  5EML B;  1YFQ A;  4ERZ A;  3IJ1 A;  3VH0 A;  4J0X A;  4JSX C;  5FXY A;  4J87 A;  3OW8 A;  5AMS A;  3AH8 B;  3F3F A;  4PXW A;  3B7F A;  3V7D B;  5GXI A;  3I7N A;  5TEE A;  3J80 g;  2P9U C;  4E54 A;  1QNI A;  3RN1 D;  1N6D A;  3BG1 A;  4CC9 A;  2YNN A;  2H6Q A;  5TEF A;  3VGZ A;  3IJC A;  5EAP A;  5AJA A;  5EM2 B;  4CZX A;  3ZWL B;  2I0R A;  1JOF A;  1XIP A;  1K32 A;  4FAN D;  4CY3 A;  3OKT A;  4CI1 A;  2YMU A;  4JT5 C;  2Z2O A;  3SXT D;  3I89 A;  2Q7Q A;  3V9F A;  4FHL A;  3IIY A;  2IUP A;  4JSV C;  3FRX A;  3EI3 A;  4A08 A;  1JMX B;  2AGW A;  4J78 A;  3EMH A;  4CY2 A;  2H14 A;  1GG2 B;  5TDH B;  1B9Y A;  4E5Z A;  4GGC A;  4LG8 A;  4H5J A;  3JZG A;  4A09 A;  4Y7R A;  4U7A A;  4FAV D;  4O3U B;  5SXM A;  2UZY B;  2B5N A;  2J55 H;  4X60 B;  4YVD A;  2UZX B;  4CY5 A;  4GGA A;  5AFU 3;  3OTT A;  3IKO A;  2H9L A;  5FKR A;  3RFH A;  1XKS A;  2CE9 A;  3KRX B;  3SBR A;  4OWR A;  5THA A;  4JD2 C;  3J81 g;  1FWX A;  2P9I C;  4GZ8 A;  2YNO A;  4J81 A;  4H5I A;  3RFG A;  2H9M A;  3UKR C;  1L0Q A;  2B4E A;  2H6N A;  5FKQ A;  4GGD A;  4A0A A;  2I0S A;  2IUV A;  3AL8 A;  3RRM C;  2OK4 A;  4LGN A;  4O45 A;  3FM0 A;  5TF2 A;  5FLX g;  3F3P A;  4J73 A;  4JT6 C;  5B4W A;  2AGL A;  5CXB A;  5JWZ A;  3C9C A;  4E54 B;  1K8K C;  4FB1 D;  2YBA A;  2CNX A;  4FA1 D;  2H9N A;  4FA4 D;  4A0B A;  3JZH A;  3PXS D;  4X61 B;  1GXR A;  1GOT B;  3DXM C;  4G56 B;  4R7A B;  2HYE A;  5HQG A;  4O3T B;  4O1Q D;  4XYI A;  4J77 A;  4XYH A;  4FA5 D;  2GC4 A;  2XL2 A;  4QQE A;  2P9L C;  5GXH A;  2PBI B;  2H47 A;  3MKQ A;  2AQ5 A;  4AEZ A;  3EI3 B;  4QT8 A;  3I7O A;  3NVX A;  4A11 B;  4A08 B;  3EG6 A;  3PE7 A;  1Q47 A;  4ES0 A;  2HJB A;  3MXX A;  4KFM B;  3I7L A;  4A2M A;  1SQJ A;  3JAM g;  5EMJ B;  4J82 A;  4E5Z B;  4UI9 R;  5A2Q g;  3NVQ A;  3IIW A;  3L4M D;  3OL2 A;  5H14 A;  4A09 B;  4L9O A;  2OVQ B;  1SHY B;  5C2W B;  3I8C A;  2IUQ A;  3L4O D;  3GFC A;  1GP2 B;  5GSA A;  2HKM A;  5EMK B;  3RMZ D;  2PM9 A;  5I5I A;  3JRO A;  2AH0 A;  3DSM A;  3PSL A;  4A11 A;  4FA9 D;  4OZU A;  4JXM A;  2CE8 A;  2G9A A;  3I2N A;  4JSP C;  4PBZ A;  1PEV A;  2W18 A;  3PSC B;  1VYH C;  4K3I D;  3UVM A;  3W15 A;  4L1Q D;  2OVR B;  2P9P C;  2OIZ A;  3ULE C;  1S4U X;  3EI4 A;  3EI2 A;  4A0A B;  2XYI A;  3AL8 B;  3CIK B;  4K3J B;  4J84 A;  3I8E A;  1B9X A;  4GQ2 P;  3EU7 A;  4U1E I;  4J79 A;  2CN2 A;  2P9S C;  3UVO A;  5IC7 A;  3VA6 A;  2O9K A;  5HE2 B;  4ZN4 A;  4X3E A;  5CXB B;  2MTA H;  3DXK C;  2Z2P A;  3AFC A;  4ZOX A;  3F3G A;  1P22 A;  3PVU B;  5FKS A;  5I5M A;  5EAM A;  4A0B B;  2IWF A;  3KRW B;  5FKT A;  2IUR A;  2GC7 A;  1TYQ C;  3K26 A;  4JSN C;  3JB9 L;  3A0F A;  4GMB A;  3EWE A;  3I7K A;  5HE1 B;  2BBK H;  1PBY B;  3SVW D;  1JJU B;  1N6F A;  2XU7 A;  4I79 A;  4CI8 A;  2CO0 A;  1PI6 A;  4A2L A;  2HJ4 A;  4IA9 A;  5C2V B;  2QXV A;  2H68 A;  3RLM D;  2H9P A;  1PGU A;  4CI2 A;  4J8B A;  3IJ0 A;  1A0R B;  4PSX B;  4PBY A;  4PNK B;  5CXC A;  4GM3 A;  4BUJ C;  4Y5R D;  4ZOY A; 
#chains in the Genus database with same CATH topology
 3OL2 B;  2HKR A;  1U2V C;  3GC3 B;  4NSX A;  4BL0 A;  1MDA H;  1XHM A;  1U4C A;  4NBM A;  3GRE A;  2G99 A;  4ESG A;  2YB8 B;  4NEN A;  4D6V A;  4PC0 A;  2PM9 B;  4QRJ A;  4L3G D;  2CN3 A;  3SFZ A;  3UVK A;  1T2X A;  3C75 H;  2VDQ A;  3C99 A;  5IJ7 E;  4ZOV A;  1NR0 A;  3EQ8 A;  1TBG A;  1OMW B;  4GQB B;  4DNV A;  4ZOZ A;  3ORV D;  4Z7N A;  3DWL C;  3ZDX A;  4J86 A;  3EI1 A;  5FA5 B;  2XL3 A;  4GM8 A;  4JHP C;  4BCC A;  4Z8L A;  2YNP A;  5I5J A;  4EWR A;  2H6K A;  4BP9 A;  3CFS B;  3EI4 B;  5H1M A;  5M5V A;  3EI2 B;  3OKW A;  2EBS A;  3JRP A;  5HE0 B;  3FCU A;  2GNQ A;  2HXC A;  3K27 A;  5CYK A;  2J56 H;  3OKY A;  2I3S A;  2I3T A;  3BG0 A;  3HFQ A;  3SJL D;  5E6U A;  3K6S A;  3N0E A;  3N0D A;  3SCY A;  3AL9 A;  5E6R A;  2P9N C;  2OK6 A;  3RSE C;  5EMM B;  4N14 A;  2I0T A;  2AH1 A;  4GM9 A;  3MKS B;  1SQ9 A;  2BCJ B;  3EQ7 A;  1JMZ B;  4IMM A;  2VDM A;  3UKU C;  2H3X A;  2J57 G;  1L5G A;  4L1M A;  2HU8 A;  1JV2 A;  4MK0 B;  3FCS A;  4GQ1 A;  3MZK A;  5GMK n;  2EIB A;  4LG9 A;  2VZ1 A;  3PXT D;  4ERQ A;  3MUN A;  4J8G A;  5E6S A;  4A7J A;  2P9K C;  4RE5 A;  4D9S A;  1MG3 A;  2EID A;  4G1E A;  4WK2 A;  3SHF A;  1OLZ A;  5EAL A;  4O02 A;  4D0K A;  2B5M A;  2XZG A;  3PVW B;  5CXC B;  3QHY B;  4CZV A;  3I7P A;  2EIC A;  2OJY A;  4AN1 A;  3O4I A;  4AOW A;  5EM2 A;  4CY1 A;  4CI3 A;  3FGB A;  5HE3 B;  1GOG A;  1R5M A;  1BPO A;  5EAR A;  2TRC B;  2IAA A;  3E0C A;  4ERY A;  2QC5 A;  4XEI C;  3V4P A;  3JZN A;  3CFV A;  3MZL A;  4O9D A;  5IGO A;  5IGQ A;  4TZ4 A;  2PM7 B;  5FQD A;  3U4Y A;  3SLE D;  3RN0 D;  3OF7 A;  3PXW D;  3SBP A;  4CZY A;  4DNW A;  3JPX A;  4L3H D;  3SMR A;  5HYN B;  1N6E A;  2IWK A;  4Z7O A;  2HES X;  3NVN A;  2Z2N A;  1C9L A;  4PSW B;  3ZE2 A;  3EI1 B;  2H13 A;  5K19 A;  1MG2 A;  3I7H A;  5C9Z B;  5KDO B;  3DM0 A;  3SWS D;  2JKX A;  5K1C C;  2AGX A;  4HDJ A;  4X63 B;  5H17 A;  3UVN A;  3V5W B;  3IUM A;  3SN6 B;  5M5S A;  5IJ8 E;  1RI6 A;  2AGY A;  2CO0 C;  5M5U A;  5IT9 g;  3P4F A;  2PM6 B;  5CYK B;  3ODT A;  2B5L A;  3OKY B;  3C5M A;  3SBQ A;  3BWS A;  3KCI A;  4WJK A;  3UR4 A;  2AGZ A;  4QL1 A;  1ERJ A;  3UVL A;  3QI0 A;  3MMY A;  4BH6 A;  4J0W A;  1NEX B;  2BKL A;  2OVP B;  4FWW A;  5EML B;  1YFQ A;  4ERZ A;  3IJ1 A;  2XDW A;  3VH0 A;  4J0X A;  4NC4 A;  1JTD B;  4JSX C;  5FXY A;  1C9I A;  2HU7 A;  4J87 A;  2QR5 A;  3OW8 A;  5AMS A;  3AH8 B;  3F3F A;  4PXW A;  3B7F A;  1H2Y A;  3V7D B;  5GXI A;  3I7N A;  1UOO A;  5TEE A;  3J80 g;  2P9U C;  4E54 A;  1QNI A;  3T3M A;  3RN1 D;  1N6D A;  3BG1 A;  4CC9 A;  4JHN A;  2YNN A;  2H6Q A;  5TEF A;  3VGZ A;  3IJC A;  3IUR A;  1YR2 A;  5AJA A;  5EAP A;  5EM2 B;  4CZX A;  3ZWL B;  1O6G A;  1UOQ A;  2I0R A;  1JOF A;  1XIP A;  4Z7Q A;  1K32 A;  4FAN D;  2VDK A;  4CY3 A;  3OKT A;  4CI1 A;  2YMU A;  4JT5 C;  2Z2O A;  4G1M A;  2VDN A;  3SXT D;  5HDB A;  3I89 A;  5C92 A;  3MUO A;  2Q7Q A;  3NIG A;  3V9F A;  4FHL A;  3IIY A;  1VZ2 A;  1U8C A;  2IUP A;  4JSV C;  5M5T A;  3FRX A;  3EI3 A;  1UTC A;  4AX4 A;  3IUN A;  4A08 A;  1JMX B;  1E8N A;  2AGW A;  4J78 A;  3GD1 I;  3EMH A;  4CY2 A;  2H14 A;  1H2Z A;  1GG2 B;  5TDH B;  1B9Y A;  5C86 A;  4E5Z A;  4GGC A;  1GOH A;  4LG8 A;  4H5J A;  3VI4 A;  4BCD A;  3JZG A;  4A09 A;  4Y7R A;  1GOF A;  4WK4 A;  4U7A A;  4FAV D;  4O3U B;  5SXM A;  2UZY B;  2B5N A;  2J55 H;  2XE4 A;  4X60 B;  4YVD A;  1I2M B;  2QZP A;  4AMZ A;  2UZX B;  4CY5 A;  4GGA A;  5AFU 3;  3OTT A;  3IKO A;  2H9L A;  3VI3 A;  4BCB A;  1K3I A;  3IUL A;  5FKR A;  3RFH A;  1XKS A;  1A12 A;  2CE9 A;  3KRX B;  3IJE A;  3SBR A;  1M1X A;  4OWR A;  5THA A;  3O4H A;  4JD2 C;  3J81 g;  1FWX A;  2VDO A;  2P9I C;  4GZ8 A;  2YNO A;  4J81 A;  2VC2 A;  4H5I A;  3RFG A;  2H9M A;  3UKR C;  1L0Q A;  2B4E A;  2H6N A;  5FKQ A;  4GGD A;  4A0A A;  2I0S A;  2IUV A;  3AL8 A;  3RRM C;  2OK4 A;  4LGN A;  4O2W A;  4O45 A;  3FM0 A;  5TF2 A;  5FLX g;  3F3P A;  4J73 A;  4JT6 C;  5B4W A;  2AGL A;  5CXB A;  4QAM A;  5JWZ A;  3C9C A;  4E54 B;  1K8K C;  4FB1 D;  2YBA A;  2CNX A;  4FA1 D;  5FFO A;  4MMX A;  2H9N A;  3NID A;  4FA4 D;  4A0B A;  3JZH A;  3PXS D;  4X61 B;  2VZ3 A;  1GXR A;  1GOT B;  3DXM C;  4G56 B;  4IRZ A;  4R7A B;  2HYE A;  5HQG A;  4O3T B;  4WK0 A;  4O1Q D;  3ZDZ A;  4XYI A;  4J77 A;  4XYH A;  4BP8 A;  4FA5 D;  2GC4 A;  2XL2 A;  4QQE A;  3ZDY A;  3O4J A;  2P9L C;  5GXH A;  1VE7 A;  2PBI B;  2H47 A;  3MKQ A;  2AQ5 A;  4AEZ A;  3EI3 B;  4QT8 A;  3I7O A;  3NVX A;  5M61 A;  1H2W A;  4A11 B;  4A08 B;  3EG6 A;  3PE7 A;  1Q47 A;  4ES0 A;  2HJB A;  3MXX A;  4KFM B;  3I7L A;  4A2M A;  1SQJ A;  4MMY A;  3JAM g;  5EMJ B;  4J82 A;  4E5Z B;  4UI9 R;  5A2Q g;  3NVQ A;  3IIW A;  3L4M D;  3OL2 A;  5H14 A;  3IUQ A;  4A09 B;  4L9O A;  2OVQ B;  1SHY B;  3IUJ A;  5C2W B;  3I8C A;  3EQ9 A;  1UOP A;  2EIE A;  2IUQ A;  3L4O D;  3GFC A;  1GP2 B;  3K72 A;  5FFG A;  5GSA A;  4MMZ A;  2HKM A;  5EMK B;  3RMZ D;  2PM9 A;  5I5I A;  3JRO A;  3O4G A;  4AN0 A;  2AH0 A;  3DSM A;  3PSL A;  4A11 A;  1QFS A;  4FA9 D;  4OZU A;  4JXM A;  2CE8 A;  2G9A A;  3I2N A;  4JSP C;  4PBZ A;  1PEV A;  3V4V A;  2HU5 A;  1E8M A;  1O6F A;  2W18 A;  3PSC B;  1VYH C;  4K3I D;  3UVM A;  3W15 A;  4L1Q D;  2OVR B;  2P9P C;  1VE6 A;  2VDP A;  2OIZ A;  3ULE C;  1S4U X;  3EI4 A;  3EI2 A;  4A0A B;  2XYI A;  3AL8 B;  4UM9 A;  3CIK B;  4K3J B;  4J84 A;  3K71 A;  3I8E A;  1B9X A;  4GQ2 P;  3EU7 A;  4U1E I;  2CN2 A;  2P9S C;  4J79 A;  3UVO A;  5IC7 A;  3VA6 A;  4RE6 A;  2O9K A;  5HE2 B;  4NAA A;  4ZN4 A;  1E5T A;  4X3E A;  5CXB B;  1QFM A;  2MTA H;  3DXK C;  2Z2P A;  3AFC A;  4ZOX A;  3F3G A;  1P22 A;  4AMY A;  3IVM A;  1VZ3 A;  3PVU B;  5FKS A;  5I5M A;  5EAM A;  4DNU A;  4A0B B;  2IWF A;  3KRW B;  3NIF A;  5FKT A;  2IUR A;  2GC7 A;  1TYQ C;  3T3P A;  3K26 A;  3MVD K;  4JSN C;  3JB9 L;  3ZE1 A;  3A0F A;  4GMB A;  3EWE A;  3I7K A;  5HE1 B;  2BBK H;  1PBY B;  3ZE0 A;  1JJU B;  1N6F A;  2XU7 A;  4I79 A;  3SVW D;  2WQ8 A;  4CI8 A;  2CO0 A;  1PI6 A;  4A2L A;  1H2X A;  5M5R A;  2HJ4 A;  2VDR A;  4IA9 A;  5C2V B;  4UM8 A;  2QXV A;  2H68 A;  3RLM D;  2H9P A;  1PGU A;  1TYE A;  4J8B A;  4CI2 A;  3IJ0 A;  1A0R B;  4PSX B;  4PBY A;  4G55 A;  4PNK B;  5CXC A;  4GM3 A;  4BUJ C;  2VDL A;  3DDU A;  4Y5R D;  4ZOY A; 
#chains in the Genus database with same CATH homology
 3OL2 B;  2HKR A;  1U2V C;  4NSX A;  4BL0 A;  1MDA H;  1XHM A;  1U4C A;  3GRE A;  2G99 A;  4ESG A;  2YB8 B;  4D6V A;  4PC0 A;  2PM9 B;  4QRJ A;  4L3G D;  2CN3 A;  3SFZ A;  3UVK A;  3C75 H;  3C99 A;  5IJ7 E;  4ZOV A;  1NR0 A;  1TBG A;  1OMW B;  4GQB B;  4ZOZ A;  3ORV D;  3DWL C;  4J86 A;  3EI1 A;  5FA5 B;  2XL3 A;  4GM8 A;  4Z8L A;  2YNP A;  5I5J A;  4EWR A;  2H6K A;  3CFS B;  3EI4 B;  5H1M A;  3EI2 B;  3OKW A;  2EBS A;  3JRP A;  5HE0 B;  2GNQ A;  2HXC A;  3K27 A;  5CYK A;  2J56 H;  3OKY A;  2I3S A;  2I3T A;  3BG0 A;  3HFQ A;  3SJL D;  3N0E A;  3N0D A;  3SCY A;  3AL9 A;  2P9N C;  2OK6 A;  3RSE C;  5EMM B;  4N14 A;  2I0T A;  2AH1 A;  4GM9 A;  3MKS B;  1SQ9 A;  2BCJ B;  1JMZ B;  4IMM A;  3UKU C;  2H3X A;  2J57 G;  4MK0 B;  4GQ1 A;  3MZK A;  5GMK n;  4LG9 A;  3PXT D;  4ERQ A;  4J8G A;  4A7J A;  2P9K C;  1MG3 A;  3SHF A;  1OLZ A;  5EAL A;  4D0K A;  2B5M A;  3PVW B;  5CXC B;  4CZV A;  3I7P A;  2OJY A;  4AOW A;  5EM2 A;  4CY1 A;  4CI3 A;  3FGB A;  5HE3 B;  1R5M A;  5EAR A;  2TRC B;  2IAA A;  3E0C A;  4ERY A;  2QC5 A;  4XEI C;  3JZN A;  3CFV A;  3MZL A;  4O9D A;  5IGO A;  5IGQ A;  4TZ4 A;  2PM7 B;  5FQD A;  3U4Y A;  3SLE D;  3RN0 D;  3PXW D;  3SBP A;  4CZY A;  3JPX A;  4L3H D;  3SMR A;  5HYN B;  1N6E A;  2IWK A;  2HES X;  3NVN A;  2Z2N A;  4PSW B;  3EI1 B;  2H13 A;  5K19 A;  1MG2 A;  3I7H A;  5C9Z B;  5KDO B;  3DM0 A;  3SWS D;  5K1C C;  2AGX A;  4HDJ A;  4X63 B;  5H17 A;  3UVN A;  3V5W B;  3SN6 B;  5IJ8 E;  1RI6 A;  2AGY A;  2CO0 C;  5IT9 g;  3P4F A;  2PM6 B;  5CYK B;  3ODT A;  2B5L A;  3OKY B;  3C5M A;  3SBQ A;  3BWS A;  3UR4 A;  2AGZ A;  4QL1 A;  1ERJ A;  3UVL A;  3MMY A;  4BH6 A;  4J0W A;  1NEX B;  4FWW A;  2OVP B;  5EML B;  1YFQ A;  4ERZ A;  3IJ1 A;  3VH0 A;  4J0X A;  4JSX C;  5FXY A;  4J87 A;  3OW8 A;  5AMS A;  3AH8 B;  3F3F A;  4PXW A;  3B7F A;  3V7D B;  5GXI A;  3I7N A;  5TEE A;  3J80 g;  2P9U C;  4E54 A;  1QNI A;  3RN1 D;  1N6D A;  3BG1 A;  4CC9 A;  2YNN A;  2H6Q A;  5TEF A;  3VGZ A;  3IJC A;  5EAP A;  5AJA A;  5EM2 B;  4CZX A;  3ZWL B;  2I0R A;  1JOF A;  1XIP A;  1K32 A;  4FAN D;  4CY3 A;  3OKT A;  4CI1 A;  2YMU A;  4JT5 C;  2Z2O A;  3SXT D;  3I89 A;  2Q7Q A;  3V9F A;  4FHL A;  3IIY A;  2IUP A;  4JSV C;  3FRX A;  3EI3 A;  4A08 A;  1JMX B;  2AGW A;  4J78 A;  3EMH A;  4CY2 A;  2H14 A;  1GG2 B;  5TDH B;  1B9Y A;  4E5Z A;  4GGC A;  4LG8 A;  4H5J A;  3JZG A;  4A09 A;  4Y7R A;  4U7A A;  4FAV D;  4O3U B;  5SXM A;  2UZY B;  2B5N A;  2J55 H;  4X60 B;  4YVD A;  2UZX B;  4CY5 A;  4GGA A;  5AFU 3;  3OTT A;  3IKO A;  2H9L A;  5FKR A;  3RFH A;  1XKS A;  2CE9 A;  3KRX B;  3SBR A;  4OWR A;  5THA A;  4JD2 C;  3J81 g;  1FWX A;  2P9I C;  4GZ8 A;  2YNO A;  4J81 A;  4H5I A;  3RFG A;  2H9M A;  3UKR C;  1L0Q A;  2B4E A;  2H6N A;  5FKQ A;  4GGD A;  4A0A A;  2I0S A;  2IUV A;  3AL8 A;  3RRM C;  2OK4 A;  4LGN A;  4O45 A;  3FM0 A;  5TF2 A;  5FLX g;  3F3P A;  4J73 A;  4JT6 C;  5B4W A;  2AGL A;  5CXB A;  5JWZ A;  3C9C A;  4E54 B;  1K8K C;  4FB1 D;  2YBA A;  2CNX A;  4FA1 D;  2H9N A;  4FA4 D;  4A0B A;  3JZH A;  3PXS D;  4X61 B;  1GXR A;  1GOT B;  3DXM C;  4G56 B;  4R7A B;  2HYE A;  5HQG A;  4O3T B;  4O1Q D;  4XYI A;  4J77 A;  4XYH A;  4FA5 D;  2GC4 A;  2XL2 A;  4QQE A;  2P9L C;  5GXH A;  2PBI B;  2H47 A;  3MKQ A;  2AQ5 A;  4AEZ A;  3EI3 B;  4QT8 A;  3I7O A;  3NVX A;  4A11 B;  4A08 B;  3EG6 A;  3PE7 A;  1Q47 A;  4ES0 A;  2HJB A;  3MXX A;  4KFM B;  3I7L A;  4A2M A;  1SQJ A;  3JAM g;  5EMJ B;  4J82 A;  4E5Z B;  4UI9 R;  5A2Q g;  3NVQ A;  3IIW A;  3L4M D;  3OL2 A;  5H14 A;  4A09 B;  4L9O A;  2OVQ B;  1SHY B;  5C2W B;  3I8C A;  2IUQ A;  3L4O D;  3GFC A;  1GP2 B;  5GSA A;  2HKM A;  5EMK B;  3RMZ D;  2PM9 A;  5I5I A;  3JRO A;  2AH0 A;  3DSM A;  3PSL A;  4A11 A;  4FA9 D;  4OZU A;  4JXM A;  2CE8 A;  2G9A A;  3I2N A;  4JSP C;  4PBZ A;  1PEV A;  2W18 A;  3PSC B;  1VYH C;  4K3I D;  3UVM A;  3W15 A;  4L1Q D;  2OVR B;  2P9P C;  2OIZ A;  3ULE C;  1S4U X;  3EI4 A;  3EI2 A;  4A0A B;  2XYI A;  3AL8 B;  3CIK B;  4K3J B;  4J84 A;  3I8E A;  1B9X A;  4GQ2 P;  3EU7 A;  4U1E I;  4J79 A;  2CN2 A;  2P9S C;  3UVO A;  5IC7 A;  3VA6 A;  2O9K A;  5HE2 B;  4ZN4 A;  4X3E A;  5CXB B;  2MTA H;  3DXK C;  2Z2P A;  3AFC A;  4ZOX A;  3F3G A;  1P22 A;  3PVU B;  5FKS A;  5I5M A;  5EAM A;  4A0B B;  2IWF A;  3KRW B;  5FKT A;  2IUR A;  2GC7 A;  1TYQ C;  3K26 A;  4JSN C;  3JB9 L;  3A0F A;  4GMB A;  3EWE A;  3I7K A;  5HE1 B;  2BBK H;  1PBY B;  3SVW D;  1JJU B;  1N6F A;  2XU7 A;  4I79 A;  4CI8 A;  2CO0 A;  1PI6 A;  4A2L A;  2HJ4 A;  4IA9 A;  5C2V B;  2QXV A;  2H68 A;  3RLM D;  2H9P A;  1PGU A;  4CI2 A;  4J8B A;  3IJ0 A;  1A0R B;  4PSX B;  4PBY A;  4PNK B;  5CXC A;  4GM3 A;  4BUJ C;  4Y5R D;  4ZOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...