4K3ID

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug, c2 space group
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
publication title Structures of MauG in complex with quinol and quinone MADH.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 99
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4k3iD00
1MG2A 1PEVA 4Y5RD 3FGBA 5EMMB 4J73A 2AQ5A 2H9PA 2OK4A 3I7OA 1U2VC 2P9UC 4ZOYA 3K27A 2YNNA 4KFMB 2IUPA 4PSXB 3B7FA 2P9LC 5K1CC 4XYIA 5FKQA 3OKWA 5AJAA 5H14A 4CI3A 4ES0A 5I5IA 4ERYA 3CFSB 3J81g 4A09A 2XU7A 4OWRA 4EWRA 5HE3B 2IAAA 3P4FA 4GQ1A 3RMZD 5EAPA 4YVDA 4CZXA 3EI2B 5CXCB 2H3XA 4X3EA 4IMMA 4NSXA 2H6QA 5FKSA 3RLMD 2CN2A 5EARA 3L4OD 2MTAH 4Y7RA 4BUJC 2I0SA 4FA4D 2OVRB 4O1QD 5JWZA 3EU7A 4CZVA 1PGUA 2GC7A 2AH0A 1N6DA 2EBSA 2XYIA 5EMJB 1XIPA 1SHYB 2GC4A 2AGZA 2HJBA 2CN3A 2H14A 2PM9B 5GXIA 2HKRA 4A08A 4PC0A 3I89A 2QC5A 3OL2B 4GGCA 1PBYB 5IJ8E 4U1EI 3OKTA 5C2VB 2GNQA 4E54A 2BBKH 3SN6B 3KRWB 3EI1A 3MKSB 4CZYA 4LG9A 4I79A 5FKRA 5C2WB 3UVMA 4H5IA 5EM2B 2AH1A 3I7NA 4PBYA 2H6NA 3SJLD 3IKOA 4E5ZA 4J79A 4FA9D 3C5MA 3SCYA 2J56H 3EMHA 4K3JB 5SXMA 4J8BA 1OMWB 4J86A 3OKYB 5I5JA 2AGLA 2UZXB 2IUQA 3RSEC 3N0EA 5I5MA 5FA5B 4LG8A 3JB9L 5GSAA 4GM9A 2P9PC 3U4YA 4PNKB 3EI3A 2YMUA 3OKYA 2BCJB 2I3TA 4A0BB 4CI8A 1K8KC 3UR4A 4QQEA 3SFZA 4J0WA 4A0AA 5AFU3 1NEXB 4X63B 2YB8B 4Z8LA 3JRPA 4PBZA 2IWFA 3C9CA 2H47A 3V9FA 3FM0A 5HE1B 2G9AA 3RFGA 5IC7A 5HE2B 3PSLA 3EI4A 3V7DB 4AOWA 3DXMC 5CYKB 2OVQB 3AL9A 5TEEA 5GMKn 4JSXC 4A2MA 2HJ4A 2B5NA 1XHMA 3SBRA 4FA5D 1PI6A 2OK6A 4X60B 5FQDA 1N6FA 5CYKA 2Z2OA 4GQBB 4G56B 3A0FA 3F3GA 3SBQA 2I0RA 4MK0B 4PSWB 4FB1D 5THAA 4GM3A 4CY5A 3JROA 3IIWA 3N0DA 4CI1A 2OVPB 3F3FA 3ORVD 2H68A 3NVXA 3ODTA 4A2LA 4J78A 3ULEC 1SQ9A 4O45A 1SQJA 5EMKB 3SVWD 5HQGA 2CO0A 3IJCA 3GFCA 1B9YA 4L1QD 2TRCB 3SBPA 3UKRC 4X61B 4FAND 1JMZB 2PM7B 4FHLA 3EI2A 2HKMA 5CXCA 3SXTD 3BWSA 4JSPC 3EWEA 3JZHA 4CY3A 2I0TA 2PBIB 3I7KA 4FWWA 3DWLC 3SLED 4O9DA 3AL8B 3RN0D 3I7PA 2XL3A 3OW8A 3NVNA 1GP2B 1YFQA 3HFQA 3KRXB 3IJ1A 2PM9A 1MDAH 2CE8A 5TDHB 4JT6C 3UVLA 1B9XA 3AL8A 2H13A 3OL2A 2P9IC 4L3HD 3UVKA 1GG2B 1K32A 5IT9g 3DM0A 2H9LA 3VGZA 2I3SA 1NR0A 1MG3A 2OJYA 4GGDA 4CI2A 3PXSD 5EM2A 3UKUC 4BH6A 2YNPA 2B4EA 4IA9A 3I8CA 3F3PA 3C99A 2Q7QA 3J80g 2Z2NA 4J81A 2OIZA 2YBAA 4GGAA 2P9SC 5B4WA 3IIYA 3PE7A 4L3GD 4A11B 3RFHA 4OZUA 3JAMg 2Z2PA 2HXCA 4QL1A 1P22A 5HYNB 4A0BA 2HYEA 4J84A 3PXWD 4BL0A 2UZYB 4O3TB 4HDJA 4JXMA 2AGWA 2CE9A 4U7AA 2P9NC 4LGNA 4JD2C 5H1MA 4D6VA 4XYHA 3ZWLB 4D0KA 3SWSD 3MZKA 2B5LA 4JSNC 1ERJA 2CNXA 4UI9R 1A0RB 5FXYA 4J77A 4GZ8A 3PXTD 4A09B 4GQ2P 4QRJA 1S4UX 5FKTA 3I7LA 4ZOVA 3RRMC 3NVQA 4CC9A 2PM6B 3UVOA 3BG1A 3C75H 3L4MD 3RN1D 5IGQA 3BG0A 1VYHC 3K26A 1U4CA 4GMBA 4FA1D 4JT5C 2H6KA 4H5JA 1L0QA 2H9NA 5A2Qg 3CFVA 2J57G 4ZOXA 5HE0B 1RI6A 2HESX 4L9OA 3EG6A 4AEZA 3E0CA 3I2NA 2QXVA 2CO0C 5TEFA 5CXBB 1QNIA 3MXXA 2J55H 3CIKB 3OTTA 4TZ4A 2O9KA 4A08B 3AH8B 1R5MA 3UVNA 4CY1A 4N14A 2B5MA 3MKQA 4A7JA 1XKSA 3W15A 4E54B 3MZLA 2AGYA 3I8EA 5C9ZB 3EI1B 1GOTB 4ZOZA 4ERZA 5CXBA 2YNOA 5EALA 3GREA 2P9KC 3SHFA 4E5ZB 4J87A 5EAMA 2XL2A 4ESGA 4K3ID 4JSVC 2IUVA 3PVWB 1TYQC 4ZN4A 3JZGA 3I7HA 2AGXA 5FLXg 4ERQA 4J8GA 4GM8A 3AFCA 3PVUB 5TF2A 2IWKA 5K19A 2W18A 4XEIC 3JPXA 5AMSA 1OLZA 1JJUB 3EI3B 1Q47A 5GXHA 2G99A 4FAVD 1GXRA 2H9MA 4A0AB 3V5WB 1TBGA 1FWXA 3VA6A 4PXWA 5EMLB 3PSCB 3VH0A 3IJ0A 5IGOA 4CY2A 5KDOB 3SMRA 3JZNA 4A11A 4J82A 4O3UB 2IURA 4J0XA 3MMYA 5H17A 1JMXB 3DSMA 4QT8A 1JOFA 4R7AB 3EI4B 3DXKC 5IJ7E 1N6EA 3FRXA
chains in the Genus database with same CATH superfamily
2VDLA 1MG2A 4G1MA 1PEVA 4Y5RD 2VC2A 3FGBA 5EMMB 4J73A 4AN1A 2AQ5A 4BCBA 1E5TA 2H9PA 2OK4A 3I7OA 1U2VC 2P9UC 2BKLA 3K27A 2YNNA 4ZOYA 2VZ1A 4BCDA 3O4IA 4KFMB 2IUPA 4PSXB 3B7FA 2P9LC 5K1CC 1H2XA 4XYIA 5FKQA 3OKWA 5AJAA 5H14A 1JTDB 4CI3A 4ES0A 5I5IA 4ERYA 3CFSB 1UOQA 3J81g 4A09A 2XU7A 4OWRA 4EWRA 5HE3B 1YR2A 2IAAA 3P4FA 3IJEA 2HU8A 4GQ1A 1M1XA 3EQ8A 4BCCA 4NBMA 5FFOA 3RMZD 5EAPA 4YVDA 4CZXA 2VDRA 3VI3A 3EI2B 5E6UA 5CXCB 2H3XA 4X3EA 4IMMA 4NSXA 2H6QA 5FKSA 3RLMD 2CN2A 5EARA 3L4OD 2MTAH 4Y7RA 4BUJC 3T3PA 2I0SA 3EQ9A 4O2WA 4FA4D 2OVRB 4O1QD 5JWZA 2VDMA 3EU7A 1O6GA 1PGUA 2GC7A 2AH0A 3MUNA 4CZVA 1N6DA 3NIGA 2EBSA 4NAAA 2XYIA 5EMJB 1XIPA 4G55A 5E6SA 1SHYB 2GC4A 2AGZA 2HJBA 2CN3A 2H14A 4AMYA 2PM9B 5GXIA 2HKRA 3GD1I 1A12A 3K72A 4A08A 4PC0A 4DNVA 3I89A 2QC5A 3OL2B 4GGCA 1PBYB 5IJ8E 4U1EI 4IRZA 3OKTA 5C2VB 2GNQA 4E54A 2BBKH 3SN6B 4AX4A 1VE7A 3KRWB 3EI1A 3MKSB 4CZYA 4LG9A 4I79A 5FKRA 3ZE1A 5C2WB 3UVMA 4H5IA 5EM2B 2AH1A 3I7NA 4PBYA 2H6NA 1BPOA 3SJLD 3IKOA 4E5ZA 4J79A 4FA9D 3C5MA 3SCYA 3V4VA 2J56H 3EMHA 4K3JB 4WK0A 5SXMA 4D9SA 4J8BA 1OMWB 4G1EA 4J86A 3OKYB 5I5JA 2AGLA 2UZXB 2IUQA 3RSEC 3N0EA 5I5MA 5FA5B 4LG8A 3JB9L 5FFGA 5GSAA 4DNUA 4GM9A 2P9PC 3U4YA 4QAMA 4PNKB 3EI3A 2YMUA 3OKYA 2BCJB 2I3TA 4A0BB 4CI8A 1K8KC 3UR4A 4QQEA 3SFZA 4J0WA 4A0AA 5AFU3 1NEXB 4X63B 2YB8B 3DDUA 4BP9A 4Z8LA 3JRPA 2JKXA 2IWFA 3C9CA 2H47A 4PBZA 3V9FA 3FM0A 3FCUA 5HE1B 2G9AA 3RFGA 5IC7A 5HE2B 3PSLA 3EI4A 4WK2A 5HDBA 3V7DB 4AOWA 3DXMC 5CYKB 1UOPA 2OVQB 3AL9A 5TEEA 5GMKn 1U8CA 4JSXC 4A2MA 4MMXA 2HJ4A 2B5NA 1XHMA 3SBRA 3NIDA 1T2XA 4FA5D 1PI6A 2OK6A 4X60B 5FQDA 1N6FA 5CYKA 2Z2OA 2VDQA 4G56B 4GQBB 3QI0A 3A0FA 3V4PA 1TYEA 3F3GA 4BP8A 3SBQA 2I0RA 4MK0B 4PSWB 4FB1D 5THAA 4GM3A 4CY5A 3JROA 3IIWA 3N0DA 4CI1A 3ZE2A 3ZDZA 2OVPB 3F3FA 3ORVD 2H68A 3NVXA 3ODTA 1C9IA 4A2LA 1VE6A 2XZGA 4J78A 1H2YA 3ULEC 1GOFA 1SQ9A 4O45A 1SQJA 5EMKB 3SVWD 5HQGA 2CO0A 3IJCA 3GFCA 1B9YA 4L1QD 2TRCB 3SBPA 3UKRC 4X61B 4FAND 1JMZB 4Z7QA 3OF7A 2PM7B 4FHLA 1I2MB 5M5VA 3EI2A 2HKMA 4JHNA 5CXCA 3SXTD 3BWSA 4JSPC 3EWEA 3JZHA 1E8MA 4CY3A 2I0TA 2PBIB 3I7KA 4FWWA 3DWLC 3SLED 1QFMA 4O9DA 3AL8B 3RN0D 3I7PA 2XL3A 3IUNA 3OW8A 1UOOA 3NVNA 1GP2B 1YFQA 5M5UA 3HFQA 3KRXB 3IJ1A 2PM9A 1MDAH 2CE8A 5TDHB 4JT6C 3KCIA 3UVLA 1B9XA 1K3IA 3AL8A 1GOGA 2H13A 1JV2A 2XE4A 3OL2A 2P9IC 4L3HD 3UVKA 3FCSA 1GG2B 4NC4A 1K32A 5IT9g 3DM0A 2H9LA 2XDWA 3VGZA 2I3SA 5M5SA 1NR0A 1MG3A 2EICA 2OJYA 4GGDA 4CI2A 3PXSD 5EM2A 4WK4A 5C86A 3UKUC 4BH6A 2YNPA 4UM8A 5M5TA 2B4EA 4IA9A 3I8CA 1O6FA 3F3PA 3C99A 2Q7QA 3QHYB 4JHPC 1L5GA 2Z2NA 3J80g 3ZDYA 4J81A 2OIZA 2YBAA 4GGAA 2P9SC 5B4WA 3IIYA 3PE7A 4L3GD 4AMZA 4A11B 3RFHA 4OZUA 3IURA 3JAMg 3EQ7A 2Z2PA 2HXCA 4QL1A 3MVDK 1P22A 5HYNB 4A0BA 2HYEA 3IUQA 2VZ3A 4J84A 3PXWD 3K71A 3IUMA 3VI4A 4BL0A 2UZYB 4HDJA 4O3TB 4JXMA 2AGWA 2CE9A 4U7AA 4AN0A 2P9NC 2VDNA 4LGNA 4JD2C 5H1MA 3O4HA 2EIEA 4MMZA 4D6VA 5M61A 4XYHA 3ZWLB 4D0KA 3GC3B 3MZKA 3SWSD 2B5LA 1E8NA 4JSNC 5C92A 1ERJA 2CNXA 1VZ2A 4UI9R 1A0RB 5FXYA 4J77A 4GZ8A 2HU7A 3PXTD 4A09B 4GQ2P 4QRJA 1S4UX 5FKTA 3I7LA 4ZOVA 3IULA 3RRMC 3NVQA 4CC9A 2PM6B 4WJKA 3UVOA 3IVMA 3BG1A 3C75H 3L4MD 1H2ZA 3RN1D 5IGQA 3T3MA 3BG0A 1VYHC 3K26A 1U4CA 3NIFA 4GMBA 4FA1D 4JT5C 1GOHA 2H6KA 4H5JA 4RE5A 1L0QA 2EIDA 2H9NA 4RE6A 5A2Qg 3CFVA 2J57G 5M5RA 4ZOXA 5HE0B 1RI6A 2HESX 4L9OA 3EG6A 4AEZA 3E0CA 3I2NA 2QXVA 2CO0C 5TEFA 4MMYA 5CXBB 4Z7OA 1QNIA 3MXXA 3CIKB 2J55H 3OTTA 4TZ4A 2O9KA 5E6RA 4A08B 3AH8B 1R5MA 3UVNA 4CY1A 1C9LA 4N14A 3ZDXA 2B5MA 4NENA 3IUJA 3MKQA 4A7JA 1XKSA 3W15A 2VDPA 4E54B 3MZLA 2AGYA 3I8EA 2QR5A 5C9ZB 3EI1B 1GOTB 4ZOZA 4ERZA 5CXBA 2YNOA 3O4GA 5EALA 3GREA 2P9KC 3SHFA 4E5ZB 4J87A 5EAMA 1VZ3A 2XL2A 4ESGA 2HU5A 4K3ID 4JSVC 2IUVA 3PVWB 1TYQC 4UM9A 4ZN4A 3JZGA 3I7HA 2AGXA 1QFSA 4ERQA 5FLXg 4J8GA 4GM8A 3AFCA 3PVUB 5TF2A 2IWKA 3K6SA 5K19A 2W18A 4XEIC 2EIBA 3JPXA 1OLZA 1JJUB 5AMSA 3EI3B 1Q47A 5GXHA 2G99A 3O4JA 4FAVD 1GXRA 2H9MA 4A0AB 3V5WB 4L1MA 1TBGA 1FWXA 2VDKA 3VA6A 3ZE0A 4O02A 4PXWA 5EMLB 3PSCB 3VH0A 3IJ0A 5IGOA 4CY2A 4Z7NA 1UTCA 3MUOA 3SMRA 3JZNA 5KDOB 4A11A 4J82A 4O3UB 2IURA 2VDOA 3MMYA 4J0XA 5H17A 1JMXB 2WQ8A 3DSMA 4QT8A 1JOFA 4R7AB 4DNWA 3EI4B 3DXKC 5IJ7E 2QZPA 1H2WA 1N6EA 3FRXA
chains in the Genus database with same CATH topology
1MG2A 1PEVA 4Y5RD 3FGBA 5EMMB 4J73A 2AQ5A 2H9PA 2OK4A 3I7OA 1U2VC 2P9UC 4ZOYA 3K27A 2YNNA 4KFMB 2IUPA 4PSXB 3B7FA 2P9LC 5K1CC 4XYIA 5FKQA 3OKWA 5AJAA 5H14A 4CI3A 4ES0A 5I5IA 4ERYA 3CFSB 3J81g 4A09A 2XU7A 4OWRA 4EWRA 5HE3B 2IAAA 3P4FA 4GQ1A 3RMZD 5EAPA 4YVDA 4CZXA 3EI2B 5CXCB 2H3XA 4X3EA 4IMMA 4NSXA 2H6QA 5FKSA 3RLMD 2CN2A 5EARA 3L4OD 2MTAH 4Y7RA 4BUJC 2I0SA 4FA4D 2OVRB 4O1QD 5JWZA 3EU7A 4CZVA 1PGUA 2GC7A 2AH0A 1N6DA 2EBSA 2XYIA 5EMJB 1XIPA 1SHYB 2GC4A 2AGZA 2HJBA 2CN3A 2H14A 2PM9B 5GXIA 2HKRA 4A08A 4PC0A 3I89A 2QC5A 3OL2B 4GGCA 1PBYB 5IJ8E 4U1EI 3OKTA 5C2VB 2GNQA 4E54A 2BBKH 3SN6B 3KRWB 3EI1A 3MKSB 4CZYA 4LG9A 4I79A 5FKRA 5C2WB 3UVMA 4H5IA 5EM2B 2AH1A 3I7NA 4PBYA 2H6NA 3SJLD 3IKOA 4E5ZA 4J79A 4FA9D 3C5MA 3SCYA 2J56H 3EMHA 4K3JB 5SXMA 4J8BA 1OMWB 4J86A 3OKYB 5I5JA 2AGLA 2UZXB 2IUQA 3RSEC 3N0EA 5I5MA 5FA5B 4LG8A 3JB9L 5GSAA 4GM9A 2P9PC 3U4YA 4PNKB 3EI3A 2YMUA 3OKYA 2BCJB 2I3TA 4A0BB 4CI8A 1K8KC 3UR4A 4QQEA 3SFZA 4J0WA 4A0AA 5AFU3 1NEXB 4X63B 2YB8B 4Z8LA 3JRPA 4PBZA 2IWFA 3C9CA 2H47A 3V9FA 3FM0A 5HE1B 2G9AA 3RFGA 5IC7A 5HE2B 3PSLA 3EI4A 3V7DB 4AOWA 3DXMC 5CYKB 2OVQB 3AL9A 5TEEA 5GMKn 4JSXC 4A2MA 2HJ4A 2B5NA 1XHMA 3SBRA 4FA5D 1PI6A 2OK6A 4X60B 5FQDA 1N6FA 5CYKA 2Z2OA 4GQBB 4G56B 3A0FA 3F3GA 3SBQA 2I0RA 4MK0B 4PSWB 4FB1D 5THAA 4GM3A 4CY5A 3JROA 3IIWA 3N0DA 4CI1A 2OVPB 3F3FA 3ORVD 2H68A 3NVXA 3ODTA 4A2LA 4J78A 3ULEC 1SQ9A 4O45A 1SQJA 5EMKB 3SVWD 5HQGA 2CO0A 3IJCA 3GFCA 1B9YA 4L1QD 2TRCB 3SBPA 3UKRC 4X61B 4FAND 1JMZB 2PM7B 4FHLA 3EI2A 2HKMA 5CXCA 3SXTD 3BWSA 4JSPC 3EWEA 3JZHA 4CY3A 2I0TA 2PBIB 3I7KA 4FWWA 3DWLC 3SLED 4O9DA 3AL8B 3RN0D 3I7PA 2XL3A 3OW8A 3NVNA 1GP2B 1YFQA 3HFQA 3KRXB 3IJ1A 2PM9A 1MDAH 2CE8A 5TDHB 4JT6C 3UVLA 1B9XA 3AL8A 2H13A 3OL2A 2P9IC 4L3HD 3UVKA 1GG2B 1K32A 5IT9g 3DM0A 2H9LA 3VGZA 2I3SA 1NR0A 1MG3A 2OJYA 4GGDA 4CI2A 3PXSD 5EM2A 3UKUC 4BH6A 2YNPA 2B4EA 4IA9A 3I8CA 3F3PA 3C99A 2Q7QA 3J80g 2Z2NA 4J81A 2OIZA 2YBAA 4GGAA 2P9SC 5B4WA 3IIYA 3PE7A 4L3GD 4A11B 3RFHA 4OZUA 3JAMg 2Z2PA 2HXCA 4QL1A 1P22A 5HYNB 4A0BA 2HYEA 4J84A 3PXWD 4BL0A 2UZYB 4O3TB 4HDJA 4JXMA 2AGWA 2CE9A 4U7AA 2P9NC 4LGNA 4JD2C 5H1MA 4D6VA 4XYHA 3ZWLB 4D0KA 3SWSD 3MZKA 2B5LA 4JSNC 1ERJA 2CNXA 4UI9R 1A0RB 5FXYA 4J77A 4GZ8A 3PXTD 4A09B 4GQ2P 4QRJA 1S4UX 5FKTA 3I7LA 4ZOVA 3RRMC 3NVQA 4CC9A 2PM6B 3UVOA 3BG1A 3C75H 3L4MD 3RN1D 5IGQA 3BG0A 1VYHC 3K26A 1U4CA 4GMBA 4FA1D 4JT5C 2H6KA 4H5JA 1L0QA 2H9NA 5A2Qg 3CFVA 2J57G 4ZOXA 5HE0B 1RI6A 2HESX 4L9OA 3EG6A 4AEZA 3E0CA 3I2NA 2QXVA 2CO0C 5TEFA 5CXBB 1QNIA 3MXXA 2J55H 3CIKB 3OTTA 4TZ4A 2O9KA 4A08B 3AH8B 1R5MA 3UVNA 4CY1A 4N14A 2B5MA 3MKQA 4A7JA 1XKSA 3W15A 4E54B 3MZLA 2AGYA 3I8EA 5C9ZB 3EI1B 1GOTB 4ZOZA 4ERZA 5CXBA 2YNOA 5EALA 3GREA 2P9KC 3SHFA 4E5ZB 4J87A 5EAMA 2XL2A 4ESGA 4K3ID 4JSVC 2IUVA 3PVWB 1TYQC 4ZN4A 3JZGA 3I7HA 2AGXA 5FLXg 4ERQA 4J8GA 4GM8A 3AFCA 3PVUB 5TF2A 2IWKA 5K19A 2W18A 4XEIC 3JPXA 5AMSA 1OLZA 1JJUB 3EI3B 1Q47A 5GXHA 2G99A 4FAVD 1GXRA 2H9MA 4A0AB 3V5WB 1TBGA 1FWXA 3VA6A 4PXWA 5EMLB 3PSCB 3VH0A 3IJ0A 5IGOA 4CY2A 5KDOB 3SMRA 3JZNA 4A11A 4J82A 4O3UB 2IURA 4J0XA 3MMYA 5H17A 1JMXB 3DSMA 4QT8A 1JOFA 4R7AB 3EI4B 3DXKC 5IJ7E 1N6EA 3FRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG2 A;  1PEV A;  4Y5R D;  3FGB A;  5EMM B;  4J73 A;  2AQ5 A;  2H9P A;  2OK4 A;  3I7O A;  1U2V C;  2P9U C;  4ZOY A;  3K27 A;  2YNN A;  4KFM B;  2IUP A;  4PSX B;  3B7F A;  2P9L C;  5K1C C;  4XYI A;  5FKQ A;  3OKW A;  5AJA A;  5H14 A;  4CI3 A;  4ES0 A;  5I5I A;  4ERY A;  3CFS B;  3J81 g;  4A09 A;  2XU7 A;  4OWR A;  4EWR A;  5HE3 B;  2IAA A;  3P4F A;  4GQ1 A;  3RMZ D;  5EAP A;  4YVD A;  4CZX A;  3EI2 B;  5CXC B;  2H3X A;  4X3E A;  4IMM A;  4NSX A;  2H6Q A;  5FKS A;  3RLM D;  2CN2 A;  5EAR A;  3L4O D;  2MTA H;  4Y7R A;  4BUJ C;  2I0S A;  4FA4 D;  2OVR B;  4O1Q D;  5JWZ A;  3EU7 A;  4CZV A;  1PGU A;  2GC7 A;  2AH0 A;  1N6D A;  2EBS A;  2XYI A;  5EMJ B;  1XIP A;  1SHY B;  2GC4 A;  2AGZ A;  2HJB A;  2CN3 A;  2H14 A;  2PM9 B;  5GXI A;  2HKR A;  4A08 A;  4PC0 A;  3I89 A;  2QC5 A;  3OL2 B;  4GGC A;  1PBY B;  5IJ8 E;  4U1E I;  3OKT A;  5C2V B;  2GNQ A;  4E54 A;  2BBK H;  3SN6 B;  3KRW B;  3EI1 A;  3MKS B;  4CZY A;  4LG9 A;  4I79 A;  5FKR A;  5C2W B;  3UVM A;  4H5I A;  5EM2 B;  2AH1 A;  3I7N A;  4PBY A;  2H6N A;  3SJL D;  3IKO A;  4E5Z A;  4J79 A;  4FA9 D;  3C5M A;  3SCY A;  2J56 H;  3EMH A;  4K3J B;  5SXM A;  4J8B A;  1OMW B;  4J86 A;  3OKY B;  5I5J A;  2AGL A;  2UZX B;  2IUQ A;  3RSE C;  3N0E A;  5I5M A;  5FA5 B;  4LG8 A;  3JB9 L;  5GSA A;  4GM9 A;  2P9P C;  3U4Y A;  4PNK B;  3EI3 A;  2YMU A;  3OKY A;  2BCJ B;  2I3T A;  4A0B B;  4CI8 A;  1K8K C;  3UR4 A;  4QQE A;  3SFZ A;  4J0W A;  4A0A A;  5AFU 3;  1NEX B;  4X63 B;  2YB8 B;  4Z8L A;  3JRP A;  4PBZ A;  2IWF A;  3C9C A;  2H47 A;  3V9F A;  3FM0 A;  5HE1 B;  2G9A A;  3RFG A;  5IC7 A;  5HE2 B;  3PSL A;  3EI4 A;  3V7D B;  4AOW A;  3DXM C;  5CYK B;  2OVQ B;  3AL9 A;  5TEE A;  5GMK n;  4JSX C;  4A2M A;  2HJ4 A;  2B5N A;  1XHM A;  3SBR A;  4FA5 D;  1PI6 A;  2OK6 A;  4X60 B;  5FQD A;  1N6F A;  5CYK A;  2Z2O A;  4GQB B;  4G56 B;  3A0F A;  3F3G A;  3SBQ A;  2I0R A;  4MK0 B;  4PSW B;  4FB1 D;  5THA A;  4GM3 A;  4CY5 A;  3JRO A;  3IIW A;  3N0D A;  4CI1 A;  2OVP B;  3F3F A;  3ORV D;  2H68 A;  3NVX A;  3ODT A;  4A2L A;  4J78 A;  3ULE C;  1SQ9 A;  4O45 A;  1SQJ A;  5EMK B;  3SVW D;  5HQG A;  2CO0 A;  3IJC A;  3GFC A;  1B9Y A;  4L1Q D;  2TRC B;  3SBP A;  3UKR C;  4X61 B;  4FAN D;  1JMZ B;  2PM7 B;  4FHL A;  3EI2 A;  2HKM A;  5CXC A;  3SXT D;  3BWS A;  4JSP C;  3EWE A;  3JZH A;  4CY3 A;  2I0T A;  2PBI B;  3I7K A;  4FWW A;  3DWL C;  3SLE D;  4O9D A;  3AL8 B;  3RN0 D;  3I7P A;  2XL3 A;  3OW8 A;  3NVN A;  1GP2 B;  1YFQ A;  3HFQ A;  3KRX B;  3IJ1 A;  2PM9 A;  1MDA H;  2CE8 A;  5TDH B;  4JT6 C;  3UVL A;  1B9X A;  3AL8 A;  2H13 A;  3OL2 A;  2P9I C;  4L3H D;  3UVK A;  1GG2 B;  1K32 A;  5IT9 g;  3DM0 A;  2H9L A;  3VGZ A;  2I3S A;  1NR0 A;  1MG3 A;  2OJY A;  4GGD A;  4CI2 A;  3PXS D;  5EM2 A;  3UKU C;  4BH6 A;  2YNP A;  2B4E A;  4IA9 A;  3I8C A;  3F3P A;  3C99 A;  2Q7Q A;  3J80 g;  2Z2N A;  4J81 A;  2OIZ A;  2YBA A;  4GGA A;  2P9S C;  5B4W A;  3IIY A;  3PE7 A;  4L3G D;  4A11 B;  3RFH A;  4OZU A;  3JAM g;  2Z2P A;  2HXC A;  4QL1 A;  1P22 A;  5HYN B;  4A0B A;  2HYE A;  4J84 A;  3PXW D;  4BL0 A;  2UZY B;  4O3T B;  4HDJ A;  4JXM A;  2AGW A;  2CE9 A;  4U7A A;  2P9N C;  4LGN A;  4JD2 C;  5H1M A;  4D6V A;  4XYH A;  3ZWL B;  4D0K A;  3SWS D;  3MZK A;  2B5L A;  4JSN C;  1ERJ A;  2CNX A;  4UI9 R;  1A0R B;  5FXY A;  4J77 A;  4GZ8 A;  3PXT D;  4A09 B;  4GQ2 P;  4QRJ A;  1S4U X;  5FKT A;  3I7L A;  4ZOV A;  3RRM C;  3NVQ A;  4CC9 A;  2PM6 B;  3UVO A;  3BG1 A;  3C75 H;  3L4M D;  3RN1 D;  5IGQ A;  3BG0 A;  1VYH C;  3K26 A;  1U4C A;  4GMB A;  4FA1 D;  4JT5 C;  2H6K A;  4H5J A;  1L0Q A;  2H9N A;  5A2Q g;  3CFV A;  2J57 G;  4ZOX A;  5HE0 B;  1RI6 A;  2HES X;  4L9O A;  3EG6 A;  4AEZ A;  3E0C A;  3I2N A;  2QXV A;  2CO0 C;  5TEF A;  5CXB B;  1QNI A;  3MXX A;  2J55 H;  3CIK B;  3OTT A;  4TZ4 A;  2O9K A;  4A08 B;  3AH8 B;  1R5M A;  3UVN A;  4CY1 A;  4N14 A;  2B5M A;  3MKQ A;  4A7J A;  1XKS A;  3W15 A;  4E54 B;  3MZL A;  2AGY A;  3I8E A;  5C9Z B;  3EI1 B;  1GOT B;  4ZOZ A;  4ERZ A;  5CXB A;  2YNO A;  5EAL A;  3GRE A;  2P9K C;  3SHF A;  4E5Z B;  4J87 A;  5EAM A;  2XL2 A;  4ESG A;  4K3I D;  4JSV C;  2IUV A;  3PVW B;  1TYQ C;  4ZN4 A;  3JZG A;  3I7H A;  2AGX A;  5FLX g;  4ERQ A;  4J8G A;  4GM8 A;  3AFC A;  3PVU B;  5TF2 A;  2IWK A;  5K19 A;  2W18 A;  4XEI C;  3JPX A;  5AMS A;  1OLZ A;  1JJU B;  3EI3 B;  1Q47 A;  5GXH A;  2G99 A;  4FAV D;  1GXR A;  2H9M A;  4A0A B;  3V5W B;  1TBG A;  1FWX A;  3VA6 A;  4PXW A;  5EML B;  3PSC B;  3VH0 A;  3IJ0 A;  5IGO A;  4CY2 A;  5KDO B;  3SMR A;  3JZN A;  4A11 A;  4J82 A;  4O3U B;  2IUR A;  4J0X A;  3MMY A;  5H17 A;  1JMX B;  3DSM A;  4QT8 A;  1JOF A;  4R7A B;  3EI4 B;  3DXK C;  5IJ7 E;  1N6E A;  3FRX A; 
#chains in the Genus database with same CATH topology
 2VDL A;  1MG2 A;  4G1M A;  1PEV A;  4Y5R D;  2VC2 A;  3FGB A;  5EMM B;  4J73 A;  4AN1 A;  2AQ5 A;  4BCB A;  1E5T A;  2H9P A;  2OK4 A;  3I7O A;  1U2V C;  2P9U C;  2BKL A;  3K27 A;  2YNN A;  4ZOY A;  2VZ1 A;  4BCD A;  3O4I A;  4KFM B;  2IUP A;  4PSX B;  3B7F A;  2P9L C;  5K1C C;  1H2X A;  4XYI A;  5FKQ A;  3OKW A;  5AJA A;  5H14 A;  1JTD B;  4CI3 A;  4ES0 A;  5I5I A;  4ERY A;  3CFS B;  1UOQ A;  3J81 g;  4A09 A;  2XU7 A;  4OWR A;  4EWR A;  5HE3 B;  1YR2 A;  2IAA A;  3P4F A;  3IJE A;  2HU8 A;  4GQ1 A;  1M1X A;  3EQ8 A;  4BCC A;  4NBM A;  5FFO A;  3RMZ D;  5EAP A;  4YVD A;  4CZX A;  2VDR A;  3VI3 A;  3EI2 B;  5E6U A;  5CXC B;  2H3X A;  4X3E A;  4IMM A;  4NSX A;  2H6Q A;  5FKS A;  3RLM D;  2CN2 A;  5EAR A;  3L4O D;  2MTA H;  4Y7R A;  4BUJ C;  3T3P A;  2I0S A;  3EQ9 A;  4O2W A;  4FA4 D;  2OVR B;  4O1Q D;  5JWZ A;  2VDM A;  3EU7 A;  1O6G A;  1PGU A;  2GC7 A;  2AH0 A;  3MUN A;  4CZV A;  1N6D A;  3NIG A;  2EBS A;  4NAA A;  2XYI A;  5EMJ B;  1XIP A;  4G55 A;  5E6S A;  1SHY B;  2GC4 A;  2AGZ A;  2HJB A;  2CN3 A;  2H14 A;  4AMY A;  2PM9 B;  5GXI A;  2HKR A;  3GD1 I;  1A12 A;  3K72 A;  4A08 A;  4PC0 A;  4DNV A;  3I89 A;  2QC5 A;  3OL2 B;  4GGC A;  1PBY B;  5IJ8 E;  4U1E I;  4IRZ A;  3OKT A;  5C2V B;  2GNQ A;  4E54 A;  2BBK H;  3SN6 B;  4AX4 A;  1VE7 A;  3KRW B;  3EI1 A;  3MKS B;  4CZY A;  4LG9 A;  4I79 A;  5FKR A;  3ZE1 A;  5C2W B;  3UVM A;  4H5I A;  5EM2 B;  2AH1 A;  3I7N A;  4PBY A;  2H6N A;  1BPO A;  3SJL D;  3IKO A;  4E5Z A;  4J79 A;  4FA9 D;  3C5M A;  3SCY A;  3V4V A;  2J56 H;  3EMH A;  4K3J B;  4WK0 A;  5SXM A;  4D9S A;  4J8B A;  1OMW B;  4G1E A;  4J86 A;  3OKY B;  5I5J A;  2AGL A;  2UZX B;  2IUQ A;  3RSE C;  3N0E A;  5I5M A;  5FA5 B;  4LG8 A;  3JB9 L;  5FFG A;  5GSA A;  4DNU A;  4GM9 A;  2P9P C;  3U4Y A;  4QAM A;  4PNK B;  3EI3 A;  2YMU A;  3OKY A;  2BCJ B;  2I3T A;  4A0B B;  4CI8 A;  1K8K C;  3UR4 A;  4QQE A;  3SFZ A;  4J0W A;  4A0A A;  5AFU 3;  1NEX B;  4X63 B;  2YB8 B;  3DDU A;  4BP9 A;  4Z8L A;  3JRP A;  2JKX A;  2IWF A;  3C9C A;  2H47 A;  4PBZ A;  3V9F A;  3FM0 A;  3FCU A;  5HE1 B;  2G9A A;  3RFG A;  5IC7 A;  5HE2 B;  3PSL A;  3EI4 A;  4WK2 A;  5HDB A;  3V7D B;  4AOW A;  3DXM C;  5CYK B;  1UOP A;  2OVQ B;  3AL9 A;  5TEE A;  5GMK n;  1U8C A;  4JSX C;  4A2M A;  4MMX A;  2HJ4 A;  2B5N A;  1XHM A;  3SBR A;  3NID A;  1T2X A;  4FA5 D;  1PI6 A;  2OK6 A;  4X60 B;  5FQD A;  1N6F A;  5CYK A;  2Z2O A;  2VDQ A;  4G56 B;  4GQB B;  3QI0 A;  3A0F A;  3V4P A;  1TYE A;  3F3G A;  4BP8 A;  3SBQ A;  2I0R A;  4MK0 B;  4PSW B;  4FB1 D;  5THA A;  4GM3 A;  4CY5 A;  3JRO A;  3IIW A;  3N0D A;  4CI1 A;  3ZE2 A;  3ZDZ A;  2OVP B;  3F3F A;  3ORV D;  2H68 A;  3NVX A;  3ODT A;  1C9I A;  4A2L A;  1VE6 A;  2XZG A;  4J78 A;  1H2Y A;  3ULE C;  1GOF A;  1SQ9 A;  4O45 A;  1SQJ A;  5EMK B;  3SVW D;  5HQG A;  2CO0 A;  3IJC A;  3GFC A;  1B9Y A;  4L1Q D;  2TRC B;  3SBP A;  3UKR C;  4X61 B;  4FAN D;  1JMZ B;  4Z7Q A;  3OF7 A;  2PM7 B;  4FHL A;  1I2M B;  5M5V A;  3EI2 A;  2HKM A;  4JHN A;  5CXC A;  3SXT D;  3BWS A;  4JSP C;  3EWE A;  3JZH A;  1E8M A;  4CY3 A;  2I0T A;  2PBI B;  3I7K A;  4FWW A;  3DWL C;  3SLE D;  1QFM A;  4O9D A;  3AL8 B;  3RN0 D;  3I7P A;  2XL3 A;  3IUN A;  3OW8 A;  1UOO A;  3NVN A;  1GP2 B;  1YFQ A;  5M5U A;  3HFQ A;  3KRX B;  3IJ1 A;  2PM9 A;  1MDA H;  2CE8 A;  5TDH B;  4JT6 C;  3KCI A;  3UVL A;  1B9X A;  1K3I A;  3AL8 A;  1GOG A;  2H13 A;  1JV2 A;  2XE4 A;  3OL2 A;  2P9I C;  4L3H D;  3UVK A;  3FCS A;  1GG2 B;  4NC4 A;  1K32 A;  5IT9 g;  3DM0 A;  2H9L A;  2XDW A;  3VGZ A;  2I3S A;  5M5S A;  1NR0 A;  1MG3 A;  2EIC A;  2OJY A;  4GGD A;  4CI2 A;  3PXS D;  5EM2 A;  4WK4 A;  5C86 A;  3UKU C;  4BH6 A;  2YNP A;  4UM8 A;  5M5T A;  2B4E A;  4IA9 A;  3I8C A;  1O6F A;  3F3P A;  3C99 A;  2Q7Q A;  3QHY B;  4JHP C;  1L5G A;  2Z2N A;  3J80 g;  3ZDY A;  4J81 A;  2OIZ A;  2YBA A;  4GGA A;  2P9S C;  5B4W A;  3IIY A;  3PE7 A;  4L3G D;  4AMZ A;  4A11 B;  3RFH A;  4OZU A;  3IUR A;  3JAM g;  3EQ7 A;  2Z2P A;  2HXC A;  4QL1 A;  3MVD K;  1P22 A;  5HYN B;  4A0B A;  2HYE A;  3IUQ A;  2VZ3 A;  4J84 A;  3PXW D;  3K71 A;  3IUM A;  3VI4 A;  4BL0 A;  2UZY B;  4HDJ A;  4O3T B;  4JXM A;  2AGW A;  2CE9 A;  4U7A A;  4AN0 A;  2P9N C;  2VDN A;  4LGN A;  4JD2 C;  5H1M A;  3O4H A;  2EIE A;  4MMZ A;  4D6V A;  5M61 A;  4XYH A;  3ZWL B;  4D0K A;  3GC3 B;  3MZK A;  3SWS D;  2B5L A;  1E8N A;  4JSN C;  5C92 A;  1ERJ A;  2CNX A;  1VZ2 A;  4UI9 R;  1A0R B;  5FXY A;  4J77 A;  4GZ8 A;  2HU7 A;  3PXT D;  4A09 B;  4GQ2 P;  4QRJ A;  1S4U X;  5FKT A;  3I7L A;  4ZOV A;  3IUL A;  3RRM C;  3NVQ A;  4CC9 A;  2PM6 B;  4WJK A;  3UVO A;  3IVM A;  3BG1 A;  3C75 H;  3L4M D;  1H2Z A;  3RN1 D;  5IGQ A;  3T3M A;  3BG0 A;  1VYH C;  3K26 A;  1U4C A;  3NIF A;  4GMB A;  4FA1 D;  4JT5 C;  1GOH A;  2H6K A;  4H5J A;  4RE5 A;  1L0Q A;  2EID A;  2H9N A;  4RE6 A;  5A2Q g;  3CFV A;  2J57 G;  5M5R A;  4ZOX A;  5HE0 B;  1RI6 A;  2HES X;  4L9O A;  3EG6 A;  4AEZ A;  3E0C A;  3I2N A;  2QXV A;  2CO0 C;  5TEF A;  4MMY A;  5CXB B;  4Z7O A;  1QNI A;  3MXX A;  3CIK B;  2J55 H;  3OTT A;  4TZ4 A;  2O9K A;  5E6R A;  4A08 B;  3AH8 B;  1R5M A;  3UVN A;  4CY1 A;  1C9L A;  4N14 A;  3ZDX A;  2B5M A;  4NEN A;  3IUJ A;  3MKQ A;  4A7J A;  1XKS A;  3W15 A;  2VDP A;  4E54 B;  3MZL A;  2AGY A;  3I8E A;  2QR5 A;  5C9Z B;  3EI1 B;  1GOT B;  4ZOZ A;  4ERZ A;  5CXB A;  2YNO A;  3O4G A;  5EAL A;  3GRE A;  2P9K C;  3SHF A;  4E5Z B;  4J87 A;  5EAM A;  1VZ3 A;  2XL2 A;  4ESG A;  2HU5 A;  4K3I D;  4JSV C;  2IUV A;  3PVW B;  1TYQ C;  4UM9 A;  4ZN4 A;  3JZG A;  3I7H A;  2AGX A;  1QFS A;  4ERQ A;  5FLX g;  4J8G A;  4GM8 A;  3AFC A;  3PVU B;  5TF2 A;  2IWK A;  3K6S A;  5K19 A;  2W18 A;  4XEI C;  2EIB A;  3JPX A;  1OLZ A;  1JJU B;  5AMS A;  3EI3 B;  1Q47 A;  5GXH A;  2G99 A;  3O4J A;  4FAV D;  1GXR A;  2H9M A;  4A0A B;  3V5W B;  4L1M A;  1TBG A;  1FWX A;  2VDK A;  3VA6 A;  3ZE0 A;  4O02 A;  4PXW A;  5EML B;  3PSC B;  3VH0 A;  3IJ0 A;  5IGO A;  4CY2 A;  4Z7N A;  1UTC A;  3MUO A;  3SMR A;  3JZN A;  5KDO B;  4A11 A;  4J82 A;  4O3U B;  2IUR A;  2VDO A;  3MMY A;  4J0X A;  5H17 A;  1JMX B;  2WQ8 A;  3DSM A;  4QT8 A;  1JOF A;  4R7A B;  4DNW A;  3EI4 B;  3DXK C;  5IJ7 E;  2QZP A;  1H2W A;  1N6E A;  3FRX A; 
#chains in the Genus database with same CATH homology
 1MG2 A;  1PEV A;  4Y5R D;  3FGB A;  5EMM B;  4J73 A;  2AQ5 A;  2H9P A;  2OK4 A;  3I7O A;  1U2V C;  2P9U C;  4ZOY A;  3K27 A;  2YNN A;  4KFM B;  2IUP A;  4PSX B;  3B7F A;  2P9L C;  5K1C C;  4XYI A;  5FKQ A;  3OKW A;  5AJA A;  5H14 A;  4CI3 A;  4ES0 A;  5I5I A;  4ERY A;  3CFS B;  3J81 g;  4A09 A;  2XU7 A;  4OWR A;  4EWR A;  5HE3 B;  2IAA A;  3P4F A;  4GQ1 A;  3RMZ D;  5EAP A;  4YVD A;  4CZX A;  3EI2 B;  5CXC B;  2H3X A;  4X3E A;  4IMM A;  4NSX A;  2H6Q A;  5FKS A;  3RLM D;  2CN2 A;  5EAR A;  3L4O D;  2MTA H;  4Y7R A;  4BUJ C;  2I0S A;  4FA4 D;  2OVR B;  4O1Q D;  5JWZ A;  3EU7 A;  4CZV A;  1PGU A;  2GC7 A;  2AH0 A;  1N6D A;  2EBS A;  2XYI A;  5EMJ B;  1XIP A;  1SHY B;  2GC4 A;  2AGZ A;  2HJB A;  2CN3 A;  2H14 A;  2PM9 B;  5GXI A;  2HKR A;  4A08 A;  4PC0 A;  3I89 A;  2QC5 A;  3OL2 B;  4GGC A;  1PBY B;  5IJ8 E;  4U1E I;  3OKT A;  5C2V B;  2GNQ A;  4E54 A;  2BBK H;  3SN6 B;  3KRW B;  3EI1 A;  3MKS B;  4CZY A;  4LG9 A;  4I79 A;  5FKR A;  5C2W B;  3UVM A;  4H5I A;  5EM2 B;  2AH1 A;  3I7N A;  4PBY A;  2H6N A;  3SJL D;  3IKO A;  4E5Z A;  4J79 A;  4FA9 D;  3C5M A;  3SCY A;  2J56 H;  3EMH A;  4K3J B;  5SXM A;  4J8B A;  1OMW B;  4J86 A;  3OKY B;  5I5J A;  2AGL A;  2UZX B;  2IUQ A;  3RSE C;  3N0E A;  5I5M A;  5FA5 B;  4LG8 A;  3JB9 L;  5GSA A;  4GM9 A;  2P9P C;  3U4Y A;  4PNK B;  3EI3 A;  2YMU A;  3OKY A;  2BCJ B;  2I3T A;  4A0B B;  4CI8 A;  1K8K C;  3UR4 A;  4QQE A;  3SFZ A;  4J0W A;  4A0A A;  5AFU 3;  1NEX B;  4X63 B;  2YB8 B;  4Z8L A;  3JRP A;  4PBZ A;  2IWF A;  3C9C A;  2H47 A;  3V9F A;  3FM0 A;  5HE1 B;  2G9A A;  3RFG A;  5IC7 A;  5HE2 B;  3PSL A;  3EI4 A;  3V7D B;  4AOW A;  3DXM C;  5CYK B;  2OVQ B;  3AL9 A;  5TEE A;  5GMK n;  4JSX C;  4A2M A;  2HJ4 A;  2B5N A;  1XHM A;  3SBR A;  4FA5 D;  1PI6 A;  2OK6 A;  4X60 B;  5FQD A;  1N6F A;  5CYK A;  2Z2O A;  4GQB B;  4G56 B;  3A0F A;  3F3G A;  3SBQ A;  2I0R A;  4MK0 B;  4PSW B;  4FB1 D;  5THA A;  4GM3 A;  4CY5 A;  3JRO A;  3IIW A;  3N0D A;  4CI1 A;  2OVP B;  3F3F A;  3ORV D;  2H68 A;  3NVX A;  3ODT A;  4A2L A;  4J78 A;  3ULE C;  1SQ9 A;  4O45 A;  1SQJ A;  5EMK B;  3SVW D;  5HQG A;  2CO0 A;  3IJC A;  3GFC A;  1B9Y A;  4L1Q D;  2TRC B;  3SBP A;  3UKR C;  4X61 B;  4FAN D;  1JMZ B;  2PM7 B;  4FHL A;  3EI2 A;  2HKM A;  5CXC A;  3SXT D;  3BWS A;  4JSP C;  3EWE A;  3JZH A;  4CY3 A;  2I0T A;  2PBI B;  3I7K A;  4FWW A;  3DWL C;  3SLE D;  4O9D A;  3AL8 B;  3RN0 D;  3I7P A;  2XL3 A;  3OW8 A;  3NVN A;  1GP2 B;  1YFQ A;  3HFQ A;  3KRX B;  3IJ1 A;  2PM9 A;  1MDA H;  2CE8 A;  5TDH B;  4JT6 C;  3UVL A;  1B9X A;  3AL8 A;  2H13 A;  3OL2 A;  2P9I C;  4L3H D;  3UVK A;  1GG2 B;  1K32 A;  5IT9 g;  3DM0 A;  2H9L A;  3VGZ A;  2I3S A;  1NR0 A;  1MG3 A;  2OJY A;  4GGD A;  4CI2 A;  3PXS D;  5EM2 A;  3UKU C;  4BH6 A;  2YNP A;  2B4E A;  4IA9 A;  3I8C A;  3F3P A;  3C99 A;  2Q7Q A;  3J80 g;  2Z2N A;  4J81 A;  2OIZ A;  2YBA A;  4GGA A;  2P9S C;  5B4W A;  3IIY A;  3PE7 A;  4L3G D;  4A11 B;  3RFH A;  4OZU A;  3JAM g;  2Z2P A;  2HXC A;  4QL1 A;  1P22 A;  5HYN B;  4A0B A;  2HYE A;  4J84 A;  3PXW D;  4BL0 A;  2UZY B;  4O3T B;  4HDJ A;  4JXM A;  2AGW A;  2CE9 A;  4U7A A;  2P9N C;  4LGN A;  4JD2 C;  5H1M A;  4D6V A;  4XYH A;  3ZWL B;  4D0K A;  3SWS D;  3MZK A;  2B5L A;  4JSN C;  1ERJ A;  2CNX A;  4UI9 R;  1A0R B;  5FXY A;  4J77 A;  4GZ8 A;  3PXT D;  4A09 B;  4GQ2 P;  4QRJ A;  1S4U X;  5FKT A;  3I7L A;  4ZOV A;  3RRM C;  3NVQ A;  4CC9 A;  2PM6 B;  3UVO A;  3BG1 A;  3C75 H;  3L4M D;  3RN1 D;  5IGQ A;  3BG0 A;  1VYH C;  3K26 A;  1U4C A;  4GMB A;  4FA1 D;  4JT5 C;  2H6K A;  4H5J A;  1L0Q A;  2H9N A;  5A2Q g;  3CFV A;  2J57 G;  4ZOX A;  5HE0 B;  1RI6 A;  2HES X;  4L9O A;  3EG6 A;  4AEZ A;  3E0C A;  3I2N A;  2QXV A;  2CO0 C;  5TEF A;  5CXB B;  1QNI A;  3MXX A;  2J55 H;  3CIK B;  3OTT A;  4TZ4 A;  2O9K A;  4A08 B;  3AH8 B;  1R5M A;  3UVN A;  4CY1 A;  4N14 A;  2B5M A;  3MKQ A;  4A7J A;  1XKS A;  3W15 A;  4E54 B;  3MZL A;  2AGY A;  3I8E A;  5C9Z B;  3EI1 B;  1GOT B;  4ZOZ A;  4ERZ A;  5CXB A;  2YNO A;  5EAL A;  3GRE A;  2P9K C;  3SHF A;  4E5Z B;  4J87 A;  5EAM A;  2XL2 A;  4ESG A;  4K3I D;  4JSV C;  2IUV A;  3PVW B;  1TYQ C;  4ZN4 A;  3JZG A;  3I7H A;  2AGX A;  5FLX g;  4ERQ A;  4J8G A;  4GM8 A;  3AFC A;  3PVU B;  5TF2 A;  2IWK A;  5K19 A;  2W18 A;  4XEI C;  3JPX A;  5AMS A;  1OLZ A;  1JJU B;  3EI3 B;  1Q47 A;  5GXH A;  2G99 A;  4FAV D;  1GXR A;  2H9M A;  4A0A B;  3V5W B;  1TBG A;  1FWX A;  3VA6 A;  4PXW A;  5EML B;  3PSC B;  3VH0 A;  3IJ0 A;  5IGO A;  4CY2 A;  5KDO B;  3SMR A;  3JZN A;  4A11 A;  4J82 A;  4O3U B;  2IUR A;  4J0X A;  3MMY A;  5H17 A;  1JMX B;  3DSM A;  4QT8 A;  1JOF A;  4R7A B;  3EI4 B;  3DXK C;  5IJ7 E;  1N6E A;  3FRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...