4J77A

Crystal structure of beta'-cop/hwbp1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
300
structure length
300
Chain Sequence
b'KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Wbp1
molecule tags Protein transport
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 91
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j77A01
2YNPA 3I2NA 3SVWD 5EMMB 5I5JA 3SFZA 1SQ9A 4A11B 3P4FA 4EWRA 3JZNA 4GMBA 1JJUB 4CI8A 4BUJC 2Z2OA 4QT8A 4H5JA 4IA9A 4CZYA 5FLXg 2AGWA 3PSLA 4J81A 4D0KA 1ERJA 4A7JA 2YNNA 3KRWB 5TDHB 2UZXB 3JZHA 3DM0A 1U2VC 5CYKA 2HYEA 3UVLA 3DWLC 4O1QD 4CI3A 1TYQC 3RN0D 3OL2B 4GM8A 3EI1A 3PXWD 3U4YA 2MTAH 2XU7A 2I0SA 1QNIA 4JSNC 4L1QD 1YFQA 2PM9B 5FKRA 2PM7B 3AL9A 3PXSD 5EMJB 3BG0A 3NVQA 3SLED 3EI4A 3AFCA 2HJ4A 2OJYA 3ULEC 4Y5RD 3KRXB 4L3HD 4LG9A 3RLMD 4GM3A 4BL0A 1L0QA 4CY3A 3GREA 5IT9g 3OL2A 2XL3A 5CXBB 1JMZB 5EAMA 5K1CC 5GXHA 3FM0A 5H17A 3OKWA 1MG3A 5IGOA 2IUVA 1R5MA 4A09A 3L4MD 2PM9A 4A0AB 3MXXA 3DSMA 2QC5A 3IJCA 1U4CA 5THAA 3I7KA 4PNKB 3EI1B 5EARA 4PSXB 2B5LA 5H1MA 1N6DA 4A11A 2IAAA 4GZ8A 4OZUA 5IJ7E 2HXCA 3OTTA 2HKMA 4AOWA 2CN2A 4Z8LA 5K19A 2XL2A 3CFVA 1K8KC 3I89A 4A0BB 1NEXB 1S4UX 1XHMA 2CO0A 4A0AA 4JXMA 2P9KC 3BWSA 4FA1D 1RI6A 4J79A 4N14A 4FA4D 4HDJA 2HESX 3C5MA 4CZXA 3EI3B 5C2VB 2Q7QA 4PBYA 3JAMg 5FA5B 5TEEA 5JWZA 3MMYA 3DXMC 3FGBA 3SJLD 5FKSA 4ZOXA 3F3GA 4J0XA 3B7FA 4GQ2P 4QRJA 2B4EA 4YVDA 3I7HA 3UKUC 4E5ZB 3J81g 4NSXA 3VGZA 4XYIA 3AH8B 2HJBA 5I5MA 4QQEA 1GG2B 2GC7A 3I8CA 4TZ4A 4GGDA 4JT5C 2P9LC 3RSEC 1MDAH 2H9NA 4J8GA 5H14A 5TEFA 3VH0A 2H68A 4A2LA 3V9FA 4X3EA 3UVMA 2H6KA 4GM9A 4GGCA 5IC7A 3SBRA 5IJ8E 3ODTA 3F3PA 4ZOZA 2P9IC 4PBZA 3V5WB 3RFGA 5FKTA 3SMRA 4O9DA 1B9XA 4A08A 2H9PA 3AL8A 4LG8A 4CY1A 4CI1A 5EM2B 2GC4A 2TRCB 3F3FA 4CI2A 1PBYB 3HFQA 1JOFA 2B5NA 3EI2B 4ZOYA 2CO0C 3I7OA 2H9LA 5IGQA 2B5MA 2P9NC 3VA6A 5FXYA 1MG2A 3E0CA 3IJ1A 2J55H 4JT6C 3SCYA 2AH0A 1FWXA 4J77A 2P9SC 5A2Qg 4PXWA 3A0FA 3W15A 2H6QA 4A08B 5GXIA 4J86A 2H3XA 3EWEA 2OIZA 3EI2A 4Y7RA 4O45A 3UVNA 3JPXA 5HE3B 2I0TA 1A0RB 5FQDA 1JMXB 4AEZA 4FA5D 2CE8A 2YBAA 5CXCA 3EU7A 2AGLA 5FKQA 3SBQA 5AMSA 3N0DA 4ERQA 2BCJB 3SWSD 2QXVA 2Z2PA 3UR4A 2PBIB 3EG6A 4E54A 4E54B 2EBSA 3J80g 2CN3A 4JSXC 4CY5A 4L9OA 2BBKH 5EAPA 3C75H 4J73A 3PVUB 3CIKB 4L3GD 4FWWA 4J0WA 2IUQA 2IURA 4PC0A 2OK6A 1TBGA 1VYHC 2YNOA 4JD2C 4OWRA 3IIYA 1SHYB 1K32A 4GQBB 4CZVA 2GNQA 5B4WA 3PE7A 3I7NA 3OW8A 2AGYA 4K3ID 1GXRA 3ORVD 1GOTB 2AH1A 2G99A 1PGUA 2J57G 5CYKB 3RMZD 3C9CA 1XKSA 3L4OD 5I5IA 4J87A 4U1EI 4QL1A 3I7LA 2CNXA 3SXTD 4JSPC 4GQ1A 5HE2B 3RFHA 3PXTD 3EMHA 5C9ZB 5TF2A 3MZLA 4ERYA 4J84A 5EM2A 3FRXA 3MKQA 4XEIC 2O9KA 4A0BA 2YMUA 1B9YA 4FA9D 5HYNB 2H14A 4FAND 1PI6A 4G56B 3CFSB 3K26A 4X61B 2OK4A 5EMKB 3BG1A 3RRMC 4U7AA 3C99A 2IUPA 5EMLB 2P9UC 3UKRC 2OVQB 2W18A 2Z2NA 3AL8B 4FHLA 5EALA 4FB1D 4A09B 3IJ0A 3N0EA 5C2WB 4X60B 3IIWA 4GGAA 5GMKn 1OMWB 5HE1B 2XYIA 3V7DB 3JROA 2I3TA 4IMMA 1N6EA 3ZWLB 2J56H 3SHFA 3I7PA 3EI3A 4ZN4A 1OLZA 2IWKA 4CY2A 3EI4B 3GFCA 2AQ5A 2CE9A 3JZGA 4R7AB 4BH6A 1GP2B 4MK0B 4FAVD 3SN6B 2PM6B 2OVPB 3PVWB 2AGXA 4UI9R 5CXBA 2P9PC 3SBPA 1XIPA 4E5ZA 2IWFA 4XYHA 2UZYB 2H47A 4J78A 1Q47A 4JSVC 3JB9L 2H6NA 4LGNA 2AGZA 5KDOB 2I0RA 4ZOVA 3OKYB 5CXCB 2YB8B 4O3TB 1NR0A 4K3JB 4ES0A 4J8BA 1PEVA 2G9AA 1P22A 3MKSB 2HKRA 2H9MA 5SXMA 4O3UB 1N6FA 1SQJA 3I8EA 3MZKA 3NVNA 4H5IA 3K27A 2H13A 4KFMB 4I79A 4ERZA 5GSAA 3IKOA 3NVXA 5HQGA 5AJAA 4CC9A 3DXKC 2I3SA 4PSWB 3JRPA 3UVKA 5AFU3 3PSCB 4A2MA 5HE0B 3UVOA 4ESGA 3OKYA 2OVRB 3OKTA 3RN1D 4X63B 4D6VA 4J82A
chains in the Genus database with same CATH superfamily
2XDWA 2YNPA 3K6SA 3T3PA 3I2NA 3SVWD 5EMMB 4UM9A 5I5JA 3SFZA 1SQ9A 4A11B 3P4FA 4EWRA 1L5GA 1A12A 3JZNA 4GMBA 1JJUB 4CI8A 4BUJC 2Z2OA 4AN0A 2VZ1A 4QT8A 4H5JA 4IA9A 4CZYA 5M5UA 5FLXg 2AGWA 3PSLA 4J81A 3FCSA 4D0KA 1ERJA 4A7JA 3GC3B 4Z7NA 2YNNA 3KRWB 5TDHB 2UZXB 3JZHA 3DM0A 3NIGA 3IURA 1U2VC 5CYKA 3ZE2A 2HYEA 3UVLA 4G1MA 3DWLC 4O1QD 4CI3A 1TYQC 3RN0D 3OL2B 4GM8A 3EI1A 3PXWD 3U4YA 2MTAH 2XU7A 2I0SA 1QNIA 3IVMA 4Z7OA 4JSNC 4L1QD 1YFQA 2PM9B 5FKRA 2PM7B 3AL9A 3PXSD 5EMJB 3BG0A 3NVQA 3SLED 3EI4A 1JTDB 3AFCA 3MVDK 2HJ4A 3ZE1A 2OJYA 3ULEC 4Y5RD 3KRXB 4L3HD 4LG9A 3RLMD 4GM3A 4WK0A 4BL0A 1UTCA 1L0QA 4CY3A 3GREA 5IT9g 3QI0A 3OL2A 2XL3A 5CXBB 1JMZB 5EAMA 1C9LA 5K1CC 5GXHA 3FM0A 5H17A 3OKWA 1MG3A 2EIDA 3IUQA 1QFMA 3MUOA 5IGOA 2IUVA 1R5MA 4A09A 4NC4A 1VE6A 3L4MD 2PM9A 4A0AB 3MXXA 3DSMA 2XZGA 2QC5A 3O4JA 3IJCA 1U4CA 5THAA 3I7KA 4PNKB 3EI1B 5EARA 4PSXB 2B5LA 5H1MA 2VDLA 1N6DA 4A11A 2IAAA 2VDPA 4GZ8A 4OZUA 5IJ7E 2EIBA 2HXCA 3OTTA 2EICA 2HKMA 5M5RA 4AOWA 2CN2A 4L1MA 4Z8LA 5K19A 2XL2A 3CFVA 1K8KC 3I89A 4A0BB 1GOHA 1NEXB 1GOGA 1S4UX 1U8CA 5E6SA 1XHMA 2CO0A 4A0AA 4JXMA 2P9KC 3BWSA 4FA1D 1RI6A 4AN1A 1VE7A 4J79A 4O02A 4N14A 4FA4D 4HDJA 2HESX 3C5MA 4CZXA 1E8NA 3EI3B 5C2VB 2Q7QA 4AMYA 3O4GA 4PBYA 3T3MA 3JAMg 3DDUA 5FA5B 5TEEA 5JWZA 3MMYA 3DXMC 3ZDXA 3FGBA 3SJLD 4BCBA 3IUNA 5FKSA 4ZOXA 3F3GA 4J0XA 3B7FA 4GQ2P 4QRJA 1VZ3A 2B4EA 4YVDA 3I7HA 3UKUC 4E5ZB 5E6UA 3J81g 4NSXA 3VGZA 4XYIA 3AH8B 2HJBA 5I5MA 1VZ2A 4QQEA 2HU8A 3ZDYA 1GG2B 2GC7A 1TYEA 3I8CA 4GGDA 4JT5C 4NBMA 4TZ4A 2P9LC 3RSEC 1MDAH 2H9NA 2VDNA 4J8GA 5H14A 5TEFA 3VH0A 2H68A 4A2LA 3V9FA 4X3EA 3UVMA 2H6KA 4GM9A 4GGCA 5IC7A 4IRZA 3SBRA 5IJ8E 3ODTA 3F3PA 4ZOZA 2P9IC 4PBZA 3V5WB 3RFGA 5FKTA 3SMRA 1T2XA 1B9XA 3OF7A 4O9DA 4A08A 2H9PA 3AL8A 4LG8A 4CY1A 4CI1A 1O6GA 5EM2B 2GC4A 2TRCB 3F3FA 4CI2A 1PBYB 3HFQA 1JOFA 2VDQA 5M5VA 2B5NA 4MMYA 3EI2B 4ZOYA 3IJEA 2CO0C 3I7OA 2H9LA 5IGQA 2B5MA 2P9NC 1UOQA 3VA6A 1BPOA 5FXYA 1JV2A 1MG2A 3E0CA 3IJ1A 2J55H 4JT6C 3SCYA 2AH0A 1FWXA 4J77A 2P9SC 5A2Qg 1UOOA 3NIFA 4PXWA 3A0FA 5FFGA 2H6QA 3W15A 4A08B 3O4HA 5GXIA 4J86A 4BP8A 4Z7QA 2H3XA 2QZPA 3EWEA 2OIZA 4WK2A 3EI2A 4Y7RA 4O45A 3UVNA 3VI3A 4MMZA 3JPXA 5HE3B 2I0TA 1A0RB 5FQDA 1JMXB 4AEZA 1H2YA 4FA5D 2CE8A 4AMZA 1M1XA 2YBAA 5CXCA 3EU7A 2AGLA 5FKQA 3SBQA 1K3IA 5AMSA 2VDKA 3K71A 3N0DA 3FCUA 2BCJB 3SWSD 4ERQA 2QXVA 2Z2PA 3UR4A 2PBIB 4NAAA 5C92A 3EG6A 4E54A 4MMXA 4E54B 2EBSA 3J80g 5M61A 2CN3A 4JSXC 4CY5A 4L9OA 2BBKH 5EAPA 3C75H 4G55A 4J73A 3PVUB 3CIKB 3EQ7A 5M5SA 4UM8A 4L3GD 4FWWA 4J0WA 2IUQA 2IURA 4PC0A 2OK6A 1TBGA 1VYHC 4O2WA 2YNOA 1O6FA 4DNUA 4JD2C 4OWRA 4DNWA 3IIYA 1SHYB 1K32A 2QR5A 4GQBB 4CZVA 3GD1I 2GNQA 3NIDA 5B4WA 1QFSA 3PE7A 5FFOA 3I7NA 3OW8A 2AGYA 4K3ID 1GXRA 1GOFA 3ORVD 1GOTB 2AH1A 3EQ9A 4D9SA 2BKLA 2G99A 4G1EA 5E6RA 1PGUA 2J57G 3V4VA 3EQ8A 5CYKB 2VDRA 1I2MB 3RMZD 3C9CA 1XKSA 3L4OD 5I5IA 3K72A 4J87A 4U1EI 4QL1A 3I7LA 2CNXA 3SXTD 4JSPC 4GQ1A 5HE2B 3RFHA 3PXTD 2HU7A 3EMHA 5C9ZB 5TF2A 3MZLA 4ERYA 4J84A 5EM2A 3IULA 3FRXA 3MKQA 4XEIC 2O9KA 4A0BA 2YMUA 1B9YA 4FA9D 5HYNB 2H14A 4FAND 5M5TA 3ZDZA 1PI6A 4G56B 3CFSB 3K26A 4X61B 2OK4A 4BCCA 5EMKB 2JKXA 5HDBA 3BG1A 3RRMC 4AX4A 3IUMA 4U7AA 3C99A 1YR2A 2IUPA 4WJKA 1H2XA 5EMLB 2WQ8A 2P9UC 3UKRC 2OVQB 2W18A 2Z2NA 3AL8B 4FHLA 5EALA 4FB1D 4A09B 3V4PA 3IJ0A 3N0EA 5C2WB 3O4IA 4X60B 1H2WA 3IIWA 4GGAA 5GMKn 1C9IA 1OMWB 5HE1B 2XYIA 3V7DB 3JROA 2I3TA 4IMMA 1N6EA 3ZWLB 2J56H 3SHFA 4WK4A 3IUJA 3I7PA 3EI3A 4ZN4A 1OLZA 2IWKA 4CY2A 3EI4B 3GFCA 2AQ5A 2CE9A 3JZGA 4R7AB 4BH6A 2XE4A 1GP2B 4MK0B 4FAVD 1UOPA 4QAMA 3SN6B 2PM6B 2OVPB 3PVWB 4BP9A 2AGXA 4UI9R 5CXBA 2P9PC 4JHNA 3SBPA 4RE5A 1XIPA 4E5ZA 2IWFA 4XYHA 4RE6A 5C86A 3KCIA 3VI4A 2UZYB 2H47A 4J78A 1Q47A 4JSVC 3JB9L 2H6NA 4LGNA 2AGZA 5KDOB 4DNVA 2I0RA 3MUNA 3OKYB 4ZOVA 5CXCB 2YB8B 4O3TB 2VDOA 2HU5A 1NR0A 4K3JB 4ES0A 4J8BA 1PEVA 2VC2A 2G9AA 1P22A 2VDMA 3MKSB 2HKRA 2H9MA 5SXMA 4O3UB 1N6FA 1SQJA 3NVNA 3I8EA 3MZKA 2VZ3A 3K27A 2H13A 4H5IA 4KFMB 3ZE0A 4I79A 4ERZA 4JHPC 3IKOA 3NVXA 5HQGA 5GSAA 5AJAA 3QHYB 1H2ZA 4CC9A 3DXKC 2I3SA 4PSWB 3JRPA 3UVKA 5AFU3 3PSCB 4A2MA 4BCDA 5HE0B 3UVOA 4ESGA 3OKYA 1E5TA 2OVRB 3OKTA 1E8MA 2EIEA 3RN1D 4X63B 4NENA 4D6VA 4J82A
chains in the Genus database with same CATH topology
2YNPA 3I2NA 3SVWD 5EMMB 5I5JA 3SFZA 1SQ9A 4A11B 3P4FA 4EWRA 3JZNA 4GMBA 1JJUB 4CI8A 4BUJC 2Z2OA 4QT8A 4H5JA 4IA9A 4CZYA 5FLXg 2AGWA 3PSLA 4J81A 4D0KA 1ERJA 4A7JA 2YNNA 3KRWB 5TDHB 2UZXB 3JZHA 3DM0A 1U2VC 5CYKA 2HYEA 3UVLA 3DWLC 4O1QD 4CI3A 1TYQC 3RN0D 3OL2B 4GM8A 3EI1A 3PXWD 3U4YA 2MTAH 2XU7A 2I0SA 1QNIA 4JSNC 4L1QD 1YFQA 2PM9B 5FKRA 2PM7B 3AL9A 3PXSD 5EMJB 3BG0A 3NVQA 3SLED 3EI4A 3AFCA 2HJ4A 2OJYA 3ULEC 4Y5RD 3KRXB 4L3HD 4LG9A 3RLMD 4GM3A 4BL0A 1L0QA 4CY3A 3GREA 5IT9g 3OL2A 2XL3A 5CXBB 1JMZB 5EAMA 5K1CC 5GXHA 3FM0A 5H17A 3OKWA 1MG3A 5IGOA 2IUVA 1R5MA 4A09A 3L4MD 2PM9A 4A0AB 3MXXA 3DSMA 2QC5A 3IJCA 1U4CA 5THAA 3I7KA 4PNKB 3EI1B 5EARA 4PSXB 2B5LA 5H1MA 1N6DA 4A11A 2IAAA 4GZ8A 4OZUA 5IJ7E 2HXCA 3OTTA 2HKMA 4AOWA 2CN2A 4Z8LA 5K19A 2XL2A 3CFVA 1K8KC 3I89A 4A0BB 1NEXB 1S4UX 1XHMA 2CO0A 4A0AA 4JXMA 2P9KC 3BWSA 4FA1D 1RI6A 4J79A 4N14A 4FA4D 4HDJA 2HESX 3C5MA 4CZXA 3EI3B 5C2VB 2Q7QA 4PBYA 3JAMg 5FA5B 5TEEA 5JWZA 3MMYA 3DXMC 3FGBA 3SJLD 5FKSA 4ZOXA 3F3GA 4J0XA 3B7FA 4GQ2P 4QRJA 2B4EA 4YVDA 3I7HA 3UKUC 4E5ZB 3J81g 4NSXA 3VGZA 4XYIA 3AH8B 2HJBA 5I5MA 4QQEA 1GG2B 2GC7A 3I8CA 4TZ4A 4GGDA 4JT5C 2P9LC 3RSEC 1MDAH 2H9NA 4J8GA 5H14A 5TEFA 3VH0A 2H68A 4A2LA 3V9FA 4X3EA 3UVMA 2H6KA 4GM9A 4GGCA 5IC7A 3SBRA 5IJ8E 3ODTA 3F3PA 4ZOZA 2P9IC 4PBZA 3V5WB 3RFGA 5FKTA 3SMRA 4O9DA 1B9XA 4A08A 2H9PA 3AL8A 4LG8A 4CY1A 4CI1A 5EM2B 2GC4A 2TRCB 3F3FA 4CI2A 1PBYB 3HFQA 1JOFA 2B5NA 3EI2B 4ZOYA 2CO0C 3I7OA 2H9LA 5IGQA 2B5MA 2P9NC 3VA6A 5FXYA 1MG2A 3E0CA 3IJ1A 2J55H 4JT6C 3SCYA 2AH0A 1FWXA 4J77A 2P9SC 5A2Qg 4PXWA 3A0FA 3W15A 2H6QA 4A08B 5GXIA 4J86A 2H3XA 3EWEA 2OIZA 3EI2A 4Y7RA 4O45A 3UVNA 3JPXA 5HE3B 2I0TA 1A0RB 5FQDA 1JMXB 4AEZA 4FA5D 2CE8A 2YBAA 5CXCA 3EU7A 2AGLA 5FKQA 3SBQA 5AMSA 3N0DA 4ERQA 2BCJB 3SWSD 2QXVA 2Z2PA 3UR4A 2PBIB 3EG6A 4E54A 4E54B 2EBSA 3J80g 2CN3A 4JSXC 4CY5A 4L9OA 2BBKH 5EAPA 3C75H 4J73A 3PVUB 3CIKB 4L3GD 4FWWA 4J0WA 2IUQA 2IURA 4PC0A 2OK6A 1TBGA 1VYHC 2YNOA 4JD2C 4OWRA 3IIYA 1SHYB 1K32A 4GQBB 4CZVA 2GNQA 5B4WA 3PE7A 3I7NA 3OW8A 2AGYA 4K3ID 1GXRA 3ORVD 1GOTB 2AH1A 2G99A 1PGUA 2J57G 5CYKB 3RMZD 3C9CA 1XKSA 3L4OD 5I5IA 4J87A 4U1EI 4QL1A 3I7LA 2CNXA 3SXTD 4JSPC 4GQ1A 5HE2B 3RFHA 3PXTD 3EMHA 5C9ZB 5TF2A 3MZLA 4ERYA 4J84A 5EM2A 3FRXA 3MKQA 4XEIC 2O9KA 4A0BA 2YMUA 1B9YA 4FA9D 5HYNB 2H14A 4FAND 1PI6A 4G56B 3CFSB 3K26A 4X61B 2OK4A 5EMKB 3BG1A 3RRMC 4U7AA 3C99A 2IUPA 5EMLB 2P9UC 3UKRC 2OVQB 2W18A 2Z2NA 3AL8B 4FHLA 5EALA 4FB1D 4A09B 3IJ0A 3N0EA 5C2WB 4X60B 3IIWA 4GGAA 5GMKn 1OMWB 5HE1B 2XYIA 3V7DB 3JROA 2I3TA 4IMMA 1N6EA 3ZWLB 2J56H 3SHFA 3I7PA 3EI3A 4ZN4A 1OLZA 2IWKA 4CY2A 3EI4B 3GFCA 2AQ5A 2CE9A 3JZGA 4R7AB 4BH6A 1GP2B 4MK0B 4FAVD 3SN6B 2PM6B 2OVPB 3PVWB 2AGXA 4UI9R 5CXBA 2P9PC 3SBPA 1XIPA 4E5ZA 2IWFA 4XYHA 2UZYB 2H47A 4J78A 1Q47A 4JSVC 3JB9L 2H6NA 4LGNA 2AGZA 5KDOB 2I0RA 4ZOVA 3OKYB 5CXCB 2YB8B 4O3TB 1NR0A 4K3JB 4ES0A 4J8BA 1PEVA 2G9AA 1P22A 3MKSB 2HKRA 2H9MA 5SXMA 4O3UB 1N6FA 1SQJA 3I8EA 3MZKA 3NVNA 4H5IA 3K27A 2H13A 4KFMB 4I79A 4ERZA 5GSAA 3IKOA 3NVXA 5HQGA 5AJAA 4CC9A 3DXKC 2I3SA 4PSWB 3JRPA 3UVKA 5AFU3 3PSCB 4A2MA 5HE0B 3UVOA 4ESGA 3OKYA 2OVRB 3OKTA 3RN1D 4X63B 4D6VA 4J82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNP A;  3I2N A;  3SVW D;  5EMM B;  5I5J A;  3SFZ A;  1SQ9 A;  4A11 B;  3P4F A;  4EWR A;  3JZN A;  4GMB A;  1JJU B;  4CI8 A;  4BUJ C;  2Z2O A;  4QT8 A;  4H5J A;  4IA9 A;  4CZY A;  5FLX g;  2AGW A;  3PSL A;  4J81 A;  4D0K A;  1ERJ A;  4A7J A;  2YNN A;  3KRW B;  5TDH B;  2UZX B;  3JZH A;  3DM0 A;  1U2V C;  5CYK A;  2HYE A;  3UVL A;  3DWL C;  4O1Q D;  4CI3 A;  1TYQ C;  3RN0 D;  3OL2 B;  4GM8 A;  3EI1 A;  3PXW D;  3U4Y A;  2MTA H;  2XU7 A;  2I0S A;  1QNI A;  4JSN C;  4L1Q D;  1YFQ A;  2PM9 B;  5FKR A;  2PM7 B;  3AL9 A;  3PXS D;  5EMJ B;  3BG0 A;  3NVQ A;  3SLE D;  3EI4 A;  3AFC A;  2HJ4 A;  2OJY A;  3ULE C;  4Y5R D;  3KRX B;  4L3H D;  4LG9 A;  3RLM D;  4GM3 A;  4BL0 A;  1L0Q A;  4CY3 A;  3GRE A;  5IT9 g;  3OL2 A;  2XL3 A;  5CXB B;  1JMZ B;  5EAM A;  5K1C C;  5GXH A;  3FM0 A;  5H17 A;  3OKW A;  1MG3 A;  5IGO A;  2IUV A;  1R5M A;  4A09 A;  3L4M D;  2PM9 A;  4A0A B;  3MXX A;  3DSM A;  2QC5 A;  3IJC A;  1U4C A;  5THA A;  3I7K A;  4PNK B;  3EI1 B;  5EAR A;  4PSX B;  2B5L A;  5H1M A;  1N6D A;  4A11 A;  2IAA A;  4GZ8 A;  4OZU A;  5IJ7 E;  2HXC A;  3OTT A;  2HKM A;  4AOW A;  2CN2 A;  4Z8L A;  5K19 A;  2XL2 A;  3CFV A;  1K8K C;  3I89 A;  4A0B B;  1NEX B;  1S4U X;  1XHM A;  2CO0 A;  4A0A A;  4JXM A;  2P9K C;  3BWS A;  4FA1 D;  1RI6 A;  4J79 A;  4N14 A;  4FA4 D;  4HDJ A;  2HES X;  3C5M A;  4CZX A;  3EI3 B;  5C2V B;  2Q7Q A;  4PBY A;  3JAM g;  5FA5 B;  5TEE A;  5JWZ A;  3MMY A;  3DXM C;  3FGB A;  3SJL D;  5FKS A;  4ZOX A;  3F3G A;  4J0X A;  3B7F A;  4GQ2 P;  4QRJ A;  2B4E A;  4YVD A;  3I7H A;  3UKU C;  4E5Z B;  3J81 g;  4NSX A;  3VGZ A;  4XYI A;  3AH8 B;  2HJB A;  5I5M A;  4QQE A;  1GG2 B;  2GC7 A;  3I8C A;  4TZ4 A;  4GGD A;  4JT5 C;  2P9L C;  3RSE C;  1MDA H;  2H9N A;  4J8G A;  5H14 A;  5TEF A;  3VH0 A;  2H68 A;  4A2L A;  3V9F A;  4X3E A;  3UVM A;  2H6K A;  4GM9 A;  4GGC A;  5IC7 A;  3SBR A;  5IJ8 E;  3ODT A;  3F3P A;  4ZOZ A;  2P9I C;  4PBZ A;  3V5W B;  3RFG A;  5FKT A;  3SMR A;  4O9D A;  1B9X A;  4A08 A;  2H9P A;  3AL8 A;  4LG8 A;  4CY1 A;  4CI1 A;  5EM2 B;  2GC4 A;  2TRC B;  3F3F A;  4CI2 A;  1PBY B;  3HFQ A;  1JOF A;  2B5N A;  3EI2 B;  4ZOY A;  2CO0 C;  3I7O A;  2H9L A;  5IGQ A;  2B5M A;  2P9N C;  3VA6 A;  5FXY A;  1MG2 A;  3E0C A;  3IJ1 A;  2J55 H;  4JT6 C;  3SCY A;  2AH0 A;  1FWX A;  4J77 A;  2P9S C;  5A2Q g;  4PXW A;  3A0F A;  3W15 A;  2H6Q A;  4A08 B;  5GXI A;  4J86 A;  2H3X A;  3EWE A;  2OIZ A;  3EI2 A;  4Y7R A;  4O45 A;  3UVN A;  3JPX A;  5HE3 B;  2I0T A;  1A0R B;  5FQD A;  1JMX B;  4AEZ A;  4FA5 D;  2CE8 A;  2YBA A;  5CXC A;  3EU7 A;  2AGL A;  5FKQ A;  3SBQ A;  5AMS A;  3N0D A;  4ERQ A;  2BCJ B;  3SWS D;  2QXV A;  2Z2P A;  3UR4 A;  2PBI B;  3EG6 A;  4E54 A;  4E54 B;  2EBS A;  3J80 g;  2CN3 A;  4JSX C;  4CY5 A;  4L9O A;  2BBK H;  5EAP A;  3C75 H;  4J73 A;  3PVU B;  3CIK B;  4L3G D;  4FWW A;  4J0W A;  2IUQ A;  2IUR A;  4PC0 A;  2OK6 A;  1TBG A;  1VYH C;  2YNO A;  4JD2 C;  4OWR A;  3IIY A;  1SHY B;  1K32 A;  4GQB B;  4CZV A;  2GNQ A;  5B4W A;  3PE7 A;  3I7N A;  3OW8 A;  2AGY A;  4K3I D;  1GXR A;  3ORV D;  1GOT B;  2AH1 A;  2G99 A;  1PGU A;  2J57 G;  5CYK B;  3RMZ D;  3C9C A;  1XKS A;  3L4O D;  5I5I A;  4J87 A;  4U1E I;  4QL1 A;  3I7L A;  2CNX A;  3SXT D;  4JSP C;  4GQ1 A;  5HE2 B;  3RFH A;  3PXT D;  3EMH A;  5C9Z B;  5TF2 A;  3MZL A;  4ERY A;  4J84 A;  5EM2 A;  3FRX A;  3MKQ A;  4XEI C;  2O9K A;  4A0B A;  2YMU A;  1B9Y A;  4FA9 D;  5HYN B;  2H14 A;  4FAN D;  1PI6 A;  4G56 B;  3CFS B;  3K26 A;  4X61 B;  2OK4 A;  5EMK B;  3BG1 A;  3RRM C;  4U7A A;  3C99 A;  2IUP A;  5EML B;  2P9U C;  3UKR C;  2OVQ B;  2W18 A;  2Z2N A;  3AL8 B;  4FHL A;  5EAL A;  4FB1 D;  4A09 B;  3IJ0 A;  3N0E A;  5C2W B;  4X60 B;  3IIW A;  4GGA A;  5GMK n;  1OMW B;  5HE1 B;  2XYI A;  3V7D B;  3JRO A;  2I3T A;  4IMM A;  1N6E A;  3ZWL B;  2J56 H;  3SHF A;  3I7P A;  3EI3 A;  4ZN4 A;  1OLZ A;  2IWK A;  4CY2 A;  3EI4 B;  3GFC A;  2AQ5 A;  2CE9 A;  3JZG A;  4R7A B;  4BH6 A;  1GP2 B;  4MK0 B;  4FAV D;  3SN6 B;  2PM6 B;  2OVP B;  3PVW B;  2AGX A;  4UI9 R;  5CXB A;  2P9P C;  3SBP A;  1XIP A;  4E5Z A;  2IWF A;  4XYH A;  2UZY B;  2H47 A;  4J78 A;  1Q47 A;  4JSV C;  3JB9 L;  2H6N A;  4LGN A;  2AGZ A;  5KDO B;  2I0R A;  4ZOV A;  3OKY B;  5CXC B;  2YB8 B;  4O3T B;  1NR0 A;  4K3J B;  4ES0 A;  4J8B A;  1PEV A;  2G9A A;  1P22 A;  3MKS B;  2HKR A;  2H9M A;  5SXM A;  4O3U B;  1N6F A;  1SQJ A;  3I8E A;  3MZK A;  3NVN A;  4H5I A;  3K27 A;  2H13 A;  4KFM B;  4I79 A;  4ERZ A;  5GSA A;  3IKO A;  3NVX A;  5HQG A;  5AJA A;  4CC9 A;  3DXK C;  2I3S A;  4PSW B;  3JRP A;  3UVK A;  5AFU 3;  3PSC B;  4A2M A;  5HE0 B;  3UVO A;  4ESG A;  3OKY A;  2OVR B;  3OKT A;  3RN1 D;  4X63 B;  4D6V A;  4J82 A; 
#chains in the Genus database with same CATH topology
 2XDW A;  2YNP A;  3K6S A;  3T3P A;  3I2N A;  3SVW D;  5EMM B;  4UM9 A;  5I5J A;  3SFZ A;  1SQ9 A;  4A11 B;  3P4F A;  4EWR A;  1L5G A;  1A12 A;  3JZN A;  4GMB A;  1JJU B;  4CI8 A;  4BUJ C;  2Z2O A;  4AN0 A;  2VZ1 A;  4QT8 A;  4H5J A;  4IA9 A;  4CZY A;  5M5U A;  5FLX g;  2AGW A;  3PSL A;  4J81 A;  3FCS A;  4D0K A;  1ERJ A;  4A7J A;  3GC3 B;  4Z7N A;  2YNN A;  3KRW B;  5TDH B;  2UZX B;  3JZH A;  3DM0 A;  3NIG A;  3IUR A;  1U2V C;  5CYK A;  3ZE2 A;  2HYE A;  3UVL A;  4G1M A;  3DWL C;  4O1Q D;  4CI3 A;  1TYQ C;  3RN0 D;  3OL2 B;  4GM8 A;  3EI1 A;  3PXW D;  3U4Y A;  2MTA H;  2XU7 A;  2I0S A;  1QNI A;  3IVM A;  4Z7O A;  4JSN C;  4L1Q D;  1YFQ A;  2PM9 B;  5FKR A;  2PM7 B;  3AL9 A;  3PXS D;  5EMJ B;  3BG0 A;  3NVQ A;  3SLE D;  3EI4 A;  1JTD B;  3AFC A;  3MVD K;  2HJ4 A;  3ZE1 A;  2OJY A;  3ULE C;  4Y5R D;  3KRX B;  4L3H D;  4LG9 A;  3RLM D;  4GM3 A;  4WK0 A;  4BL0 A;  1UTC A;  1L0Q A;  4CY3 A;  3GRE A;  5IT9 g;  3QI0 A;  3OL2 A;  2XL3 A;  5CXB B;  1JMZ B;  5EAM A;  1C9L A;  5K1C C;  5GXH A;  3FM0 A;  5H17 A;  3OKW A;  1MG3 A;  2EID A;  3IUQ A;  1QFM A;  3MUO A;  5IGO A;  2IUV A;  1R5M A;  4A09 A;  4NC4 A;  1VE6 A;  3L4M D;  2PM9 A;  4A0A B;  3MXX A;  3DSM A;  2XZG A;  2QC5 A;  3O4J A;  3IJC A;  1U4C A;  5THA A;  3I7K A;  4PNK B;  3EI1 B;  5EAR A;  4PSX B;  2B5L A;  5H1M A;  2VDL A;  1N6D A;  4A11 A;  2IAA A;  2VDP A;  4GZ8 A;  4OZU A;  5IJ7 E;  2EIB A;  2HXC A;  3OTT A;  2EIC A;  2HKM A;  5M5R A;  4AOW A;  2CN2 A;  4L1M A;  4Z8L A;  5K19 A;  2XL2 A;  3CFV A;  1K8K C;  3I89 A;  4A0B B;  1GOH A;  1NEX B;  1GOG A;  1S4U X;  1U8C A;  5E6S A;  1XHM A;  2CO0 A;  4A0A A;  4JXM A;  2P9K C;  3BWS A;  4FA1 D;  1RI6 A;  4AN1 A;  1VE7 A;  4J79 A;  4O02 A;  4N14 A;  4FA4 D;  4HDJ A;  2HES X;  3C5M A;  4CZX A;  1E8N A;  3EI3 B;  5C2V B;  2Q7Q A;  4AMY A;  3O4G A;  4PBY A;  3T3M A;  3JAM g;  3DDU A;  5FA5 B;  5TEE A;  5JWZ A;  3MMY A;  3DXM C;  3ZDX A;  3FGB A;  3SJL D;  4BCB A;  3IUN A;  5FKS A;  4ZOX A;  3F3G A;  4J0X A;  3B7F A;  4GQ2 P;  4QRJ A;  1VZ3 A;  2B4E A;  4YVD A;  3I7H A;  3UKU C;  4E5Z B;  5E6U A;  3J81 g;  4NSX A;  3VGZ A;  4XYI A;  3AH8 B;  2HJB A;  5I5M A;  1VZ2 A;  4QQE A;  2HU8 A;  3ZDY A;  1GG2 B;  2GC7 A;  1TYE A;  3I8C A;  4GGD A;  4JT5 C;  4NBM A;  4TZ4 A;  2P9L C;  3RSE C;  1MDA H;  2H9N A;  2VDN A;  4J8G A;  5H14 A;  5TEF A;  3VH0 A;  2H68 A;  4A2L A;  3V9F A;  4X3E A;  3UVM A;  2H6K A;  4GM9 A;  4GGC A;  5IC7 A;  4IRZ A;  3SBR A;  5IJ8 E;  3ODT A;  3F3P A;  4ZOZ A;  2P9I C;  4PBZ A;  3V5W B;  3RFG A;  5FKT A;  3SMR A;  1T2X A;  1B9X A;  3OF7 A;  4O9D A;  4A08 A;  2H9P A;  3AL8 A;  4LG8 A;  4CY1 A;  4CI1 A;  1O6G A;  5EM2 B;  2GC4 A;  2TRC B;  3F3F A;  4CI2 A;  1PBY B;  3HFQ A;  1JOF A;  2VDQ A;  5M5V A;  2B5N A;  4MMY A;  3EI2 B;  4ZOY A;  3IJE A;  2CO0 C;  3I7O A;  2H9L A;  5IGQ A;  2B5M A;  2P9N C;  1UOQ A;  3VA6 A;  1BPO A;  5FXY A;  1JV2 A;  1MG2 A;  3E0C A;  3IJ1 A;  2J55 H;  4JT6 C;  3SCY A;  2AH0 A;  1FWX A;  4J77 A;  2P9S C;  5A2Q g;  1UOO A;  3NIF A;  4PXW A;  3A0F A;  5FFG A;  2H6Q A;  3W15 A;  4A08 B;  3O4H A;  5GXI A;  4J86 A;  4BP8 A;  4Z7Q A;  2H3X A;  2QZP A;  3EWE A;  2OIZ A;  4WK2 A;  3EI2 A;  4Y7R A;  4O45 A;  3UVN A;  3VI3 A;  4MMZ A;  3JPX A;  5HE3 B;  2I0T A;  1A0R B;  5FQD A;  1JMX B;  4AEZ A;  1H2Y A;  4FA5 D;  2CE8 A;  4AMZ A;  1M1X A;  2YBA A;  5CXC A;  3EU7 A;  2AGL A;  5FKQ A;  3SBQ A;  1K3I A;  5AMS A;  2VDK A;  3K71 A;  3N0D A;  3FCU A;  2BCJ B;  3SWS D;  4ERQ A;  2QXV A;  2Z2P A;  3UR4 A;  2PBI B;  4NAA A;  5C92 A;  3EG6 A;  4E54 A;  4MMX A;  4E54 B;  2EBS A;  3J80 g;  5M61 A;  2CN3 A;  4JSX C;  4CY5 A;  4L9O A;  2BBK H;  5EAP A;  3C75 H;  4G55 A;  4J73 A;  3PVU B;  3CIK B;  3EQ7 A;  5M5S A;  4UM8 A;  4L3G D;  4FWW A;  4J0W A;  2IUQ A;  2IUR A;  4PC0 A;  2OK6 A;  1TBG A;  1VYH C;  4O2W A;  2YNO A;  1O6F A;  4DNU A;  4JD2 C;  4OWR A;  4DNW A;  3IIY A;  1SHY B;  1K32 A;  2QR5 A;  4GQB B;  4CZV A;  3GD1 I;  2GNQ A;  3NID A;  5B4W A;  1QFS A;  3PE7 A;  5FFO A;  3I7N A;  3OW8 A;  2AGY A;  4K3I D;  1GXR A;  1GOF A;  3ORV D;  1GOT B;  2AH1 A;  3EQ9 A;  4D9S A;  2BKL A;  2G99 A;  4G1E A;  5E6R A;  1PGU A;  2J57 G;  3V4V A;  3EQ8 A;  5CYK B;  2VDR A;  1I2M B;  3RMZ D;  3C9C A;  1XKS A;  3L4O D;  5I5I A;  3K72 A;  4J87 A;  4U1E I;  4QL1 A;  3I7L A;  2CNX A;  3SXT D;  4JSP C;  4GQ1 A;  5HE2 B;  3RFH A;  3PXT D;  2HU7 A;  3EMH A;  5C9Z B;  5TF2 A;  3MZL A;  4ERY A;  4J84 A;  5EM2 A;  3IUL A;  3FRX A;  3MKQ A;  4XEI C;  2O9K A;  4A0B A;  2YMU A;  1B9Y A;  4FA9 D;  5HYN B;  2H14 A;  4FAN D;  5M5T A;  3ZDZ A;  1PI6 A;  4G56 B;  3CFS B;  3K26 A;  4X61 B;  2OK4 A;  4BCC A;  5EMK B;  2JKX A;  5HDB A;  3BG1 A;  3RRM C;  4AX4 A;  3IUM A;  4U7A A;  3C99 A;  1YR2 A;  2IUP A;  4WJK A;  1H2X A;  5EML B;  2WQ8 A;  2P9U C;  3UKR C;  2OVQ B;  2W18 A;  2Z2N A;  3AL8 B;  4FHL A;  5EAL A;  4FB1 D;  4A09 B;  3V4P A;  3IJ0 A;  3N0E A;  5C2W B;  3O4I A;  4X60 B;  1H2W A;  3IIW A;  4GGA A;  5GMK n;  1C9I A;  1OMW B;  5HE1 B;  2XYI A;  3V7D B;  3JRO A;  2I3T A;  4IMM A;  1N6E A;  3ZWL B;  2J56 H;  3SHF A;  4WK4 A;  3IUJ A;  3I7P A;  3EI3 A;  4ZN4 A;  1OLZ A;  2IWK A;  4CY2 A;  3EI4 B;  3GFC A;  2AQ5 A;  2CE9 A;  3JZG A;  4R7A B;  4BH6 A;  2XE4 A;  1GP2 B;  4MK0 B;  4FAV D;  1UOP A;  4QAM A;  3SN6 B;  2PM6 B;  2OVP B;  3PVW B;  4BP9 A;  2AGX A;  4UI9 R;  5CXB A;  2P9P C;  4JHN A;  3SBP A;  4RE5 A;  1XIP A;  4E5Z A;  2IWF A;  4XYH A;  4RE6 A;  5C86 A;  3KCI A;  3VI4 A;  2UZY B;  2H47 A;  4J78 A;  1Q47 A;  4JSV C;  3JB9 L;  2H6N A;  4LGN A;  2AGZ A;  5KDO B;  4DNV A;  2I0R A;  3MUN A;  3OKY B;  4ZOV A;  5CXC B;  2YB8 B;  4O3T B;  2VDO A;  2HU5 A;  1NR0 A;  4K3J B;  4ES0 A;  4J8B A;  1PEV A;  2VC2 A;  2G9A A;  1P22 A;  2VDM A;  3MKS B;  2HKR A;  2H9M A;  5SXM A;  4O3U B;  1N6F A;  1SQJ A;  3NVN A;  3I8E A;  3MZK A;  2VZ3 A;  3K27 A;  2H13 A;  4H5I A;  4KFM B;  3ZE0 A;  4I79 A;  4ERZ A;  4JHP C;  3IKO A;  3NVX A;  5HQG A;  5GSA A;  5AJA A;  3QHY B;  1H2Z A;  4CC9 A;  3DXK C;  2I3S A;  4PSW B;  3JRP A;  3UVK A;  5AFU 3;  3PSC B;  4A2M A;  4BCD A;  5HE0 B;  3UVO A;  4ESG A;  3OKY A;  1E5T A;  2OVR B;  3OKT A;  1E8M A;  2EIE A;  3RN1 D;  4X63 B;  4NEN A;  4D6V A;  4J82 A; 
#chains in the Genus database with same CATH homology
 2YNP A;  3I2N A;  3SVW D;  5EMM B;  5I5J A;  3SFZ A;  1SQ9 A;  4A11 B;  3P4F A;  4EWR A;  3JZN A;  4GMB A;  1JJU B;  4CI8 A;  4BUJ C;  2Z2O A;  4QT8 A;  4H5J A;  4IA9 A;  4CZY A;  5FLX g;  2AGW A;  3PSL A;  4J81 A;  4D0K A;  1ERJ A;  4A7J A;  2YNN A;  3KRW B;  5TDH B;  2UZX B;  3JZH A;  3DM0 A;  1U2V C;  5CYK A;  2HYE A;  3UVL A;  3DWL C;  4O1Q D;  4CI3 A;  1TYQ C;  3RN0 D;  3OL2 B;  4GM8 A;  3EI1 A;  3PXW D;  3U4Y A;  2MTA H;  2XU7 A;  2I0S A;  1QNI A;  4JSN C;  4L1Q D;  1YFQ A;  2PM9 B;  5FKR A;  2PM7 B;  3AL9 A;  3PXS D;  5EMJ B;  3BG0 A;  3NVQ A;  3SLE D;  3EI4 A;  3AFC A;  2HJ4 A;  2OJY A;  3ULE C;  4Y5R D;  3KRX B;  4L3H D;  4LG9 A;  3RLM D;  4GM3 A;  4BL0 A;  1L0Q A;  4CY3 A;  3GRE A;  5IT9 g;  3OL2 A;  2XL3 A;  5CXB B;  1JMZ B;  5EAM A;  5K1C C;  5GXH A;  3FM0 A;  5H17 A;  3OKW A;  1MG3 A;  5IGO A;  2IUV A;  1R5M A;  4A09 A;  3L4M D;  2PM9 A;  4A0A B;  3MXX A;  3DSM A;  2QC5 A;  3IJC A;  1U4C A;  5THA A;  3I7K A;  4PNK B;  3EI1 B;  5EAR A;  4PSX B;  2B5L A;  5H1M A;  1N6D A;  4A11 A;  2IAA A;  4GZ8 A;  4OZU A;  5IJ7 E;  2HXC A;  3OTT A;  2HKM A;  4AOW A;  2CN2 A;  4Z8L A;  5K19 A;  2XL2 A;  3CFV A;  1K8K C;  3I89 A;  4A0B B;  1NEX B;  1S4U X;  1XHM A;  2CO0 A;  4A0A A;  4JXM A;  2P9K C;  3BWS A;  4FA1 D;  1RI6 A;  4J79 A;  4N14 A;  4FA4 D;  4HDJ A;  2HES X;  3C5M A;  4CZX A;  3EI3 B;  5C2V B;  2Q7Q A;  4PBY A;  3JAM g;  5FA5 B;  5TEE A;  5JWZ A;  3MMY A;  3DXM C;  3FGB A;  3SJL D;  5FKS A;  4ZOX A;  3F3G A;  4J0X A;  3B7F A;  4GQ2 P;  4QRJ A;  2B4E A;  4YVD A;  3I7H A;  3UKU C;  4E5Z B;  3J81 g;  4NSX A;  3VGZ A;  4XYI A;  3AH8 B;  2HJB A;  5I5M A;  4QQE A;  1GG2 B;  2GC7 A;  3I8C A;  4TZ4 A;  4GGD A;  4JT5 C;  2P9L C;  3RSE C;  1MDA H;  2H9N A;  4J8G A;  5H14 A;  5TEF A;  3VH0 A;  2H68 A;  4A2L A;  3V9F A;  4X3E A;  3UVM A;  2H6K A;  4GM9 A;  4GGC A;  5IC7 A;  3SBR A;  5IJ8 E;  3ODT A;  3F3P A;  4ZOZ A;  2P9I C;  4PBZ A;  3V5W B;  3RFG A;  5FKT A;  3SMR A;  4O9D A;  1B9X A;  4A08 A;  2H9P A;  3AL8 A;  4LG8 A;  4CY1 A;  4CI1 A;  5EM2 B;  2GC4 A;  2TRC B;  3F3F A;  4CI2 A;  1PBY B;  3HFQ A;  1JOF A;  2B5N A;  3EI2 B;  4ZOY A;  2CO0 C;  3I7O A;  2H9L A;  5IGQ A;  2B5M A;  2P9N C;  3VA6 A;  5FXY A;  1MG2 A;  3E0C A;  3IJ1 A;  2J55 H;  4JT6 C;  3SCY A;  2AH0 A;  1FWX A;  4J77 A;  2P9S C;  5A2Q g;  4PXW A;  3A0F A;  3W15 A;  2H6Q A;  4A08 B;  5GXI A;  4J86 A;  2H3X A;  3EWE A;  2OIZ A;  3EI2 A;  4Y7R A;  4O45 A;  3UVN A;  3JPX A;  5HE3 B;  2I0T A;  1A0R B;  5FQD A;  1JMX B;  4AEZ A;  4FA5 D;  2CE8 A;  2YBA A;  5CXC A;  3EU7 A;  2AGL A;  5FKQ A;  3SBQ A;  5AMS A;  3N0D A;  4ERQ A;  2BCJ B;  3SWS D;  2QXV A;  2Z2P A;  3UR4 A;  2PBI B;  3EG6 A;  4E54 A;  4E54 B;  2EBS A;  3J80 g;  2CN3 A;  4JSX C;  4CY5 A;  4L9O A;  2BBK H;  5EAP A;  3C75 H;  4J73 A;  3PVU B;  3CIK B;  4L3G D;  4FWW A;  4J0W A;  2IUQ A;  2IUR A;  4PC0 A;  2OK6 A;  1TBG A;  1VYH C;  2YNO A;  4JD2 C;  4OWR A;  3IIY A;  1SHY B;  1K32 A;  4GQB B;  4CZV A;  2GNQ A;  5B4W A;  3PE7 A;  3I7N A;  3OW8 A;  2AGY A;  4K3I D;  1GXR A;  3ORV D;  1GOT B;  2AH1 A;  2G99 A;  1PGU A;  2J57 G;  5CYK B;  3RMZ D;  3C9C A;  1XKS A;  3L4O D;  5I5I A;  4J87 A;  4U1E I;  4QL1 A;  3I7L A;  2CNX A;  3SXT D;  4JSP C;  4GQ1 A;  5HE2 B;  3RFH A;  3PXT D;  3EMH A;  5C9Z B;  5TF2 A;  3MZL A;  4ERY A;  4J84 A;  5EM2 A;  3FRX A;  3MKQ A;  4XEI C;  2O9K A;  4A0B A;  2YMU A;  1B9Y A;  4FA9 D;  5HYN B;  2H14 A;  4FAN D;  1PI6 A;  4G56 B;  3CFS B;  3K26 A;  4X61 B;  2OK4 A;  5EMK B;  3BG1 A;  3RRM C;  4U7A A;  3C99 A;  2IUP A;  5EML B;  2P9U C;  3UKR C;  2OVQ B;  2W18 A;  2Z2N A;  3AL8 B;  4FHL A;  5EAL A;  4FB1 D;  4A09 B;  3IJ0 A;  3N0E A;  5C2W B;  4X60 B;  3IIW A;  4GGA A;  5GMK n;  1OMW B;  5HE1 B;  2XYI A;  3V7D B;  3JRO A;  2I3T A;  4IMM A;  1N6E A;  3ZWL B;  2J56 H;  3SHF A;  3I7P A;  3EI3 A;  4ZN4 A;  1OLZ A;  2IWK A;  4CY2 A;  3EI4 B;  3GFC A;  2AQ5 A;  2CE9 A;  3JZG A;  4R7A B;  4BH6 A;  1GP2 B;  4MK0 B;  4FAV D;  3SN6 B;  2PM6 B;  2OVP B;  3PVW B;  2AGX A;  4UI9 R;  5CXB A;  2P9P C;  3SBP A;  1XIP A;  4E5Z A;  2IWF A;  4XYH A;  2UZY B;  2H47 A;  4J78 A;  1Q47 A;  4JSV C;  3JB9 L;  2H6N A;  4LGN A;  2AGZ A;  5KDO B;  2I0R A;  4ZOV A;  3OKY B;  5CXC B;  2YB8 B;  4O3T B;  1NR0 A;  4K3J B;  4ES0 A;  4J8B A;  1PEV A;  2G9A A;  1P22 A;  3MKS B;  2HKR A;  2H9M A;  5SXM A;  4O3U B;  1N6F A;  1SQJ A;  3I8E A;  3MZK A;  3NVN A;  4H5I A;  3K27 A;  2H13 A;  4KFM B;  4I79 A;  4ERZ A;  5GSA A;  3IKO A;  3NVX A;  5HQG A;  5AJA A;  4CC9 A;  3DXK C;  2I3S A;  4PSW B;  3JRP A;  3UVK A;  5AFU 3;  3PSC B;  4A2M A;  5HE0 B;  3UVO A;  4ESG A;  3OKY A;  2OVR B;  3OKT A;  3RN1 D;  4X63 B;  4D6V A;  4J82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...