4J77A

Crystal structure of beta'-cop/hwbp1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Wbp1
total genus 91
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j77A01
3PSLA 4A0BB 1JOFA 5FXYA 2P9UC 3SMRA 2AQ5A 2H9PA 3IJ0A 2CN3A 3OKWA 4GGCA 4I79A 3DXKC 2OIZA 1N6EA 2BCJB 3JPXA 5SXMA 2G9AA 2HJ4A 4Z8LA 3KRXB 4J77A 2GC7A 4CY5A 4H5IA 5H1MA 4PXWA 2H3XA 2PM7B 4ZOYA 3IJCA 2AGXA 4JT6C 1N6FA 4FB1D 2MTAH 4L9OA 2AGYA 4FAVD 3HFQA 3I7NA 4L1QD 4O3TB 3J81g 3MMYA 4OZUA 3RN1D 2YBAA 3VA6A 4CY1A 1NEXB 5EAPA 1Q47A 3MXXA 2CO0C 3MKSB 2OK4A 4U1EI 3K26A 4J0WA 2IURA 2P9IC 1JMXB 4GM9A 2B5MA 2W18A 5HE2B 3OKYB 4FWWA 2TRCB 2PBIB 2CN2A 4PBYA 1B9XA 5TDHB 5THAA 1R5MA 1SQ9A 3ORVD 5TF2A 4CI3A 3V5WB 1TYQC 3JROA 1GP2B 5C2VB 3ODTA 2H9NA 4JSXC 5CYKA 2I0SA 2GNQA 5HYNB 2XL2A 5IJ8E 2H9MA 4A7JA 1PI6A 4ZOVA 4JSNC 4J82A 5TEFA 4GZ8A 4A08A 1FWXA 5K1CC 5I5MA 4GM3A 3SLED 4J79A 4GGDA 4FA1D 3MZKA 4N14A 3V9FA 3RFHA 2P9PC 2HYEA 1XIPA 1P22A 2P9KC 4H5JA 3AL8A 4J8GA 3RN0D 4D6VA 3B7FA 4J78A 3UVNA 2PM9B 3UVMA 5EMJB 3I7KA 5I5IA 3KRWB 2HJBA 5IJ7E 3RLMD 4CZYA 4XYIA 4ZN4A 3FRXA 5HE1B 2H13A 4K3JB 3C99A 4BH6A 3EI3B 4Y5RD 2PM9A 4A0BA 4X3EA 3J80g 5FLXg 2OJYA 4J86A 3PSCB 5EARA 3I7OA 1PEVA 2OVQB 2UZYB 5IC7A 3F3FA 4CC9A 3E0CA 4CY2A 2B4EA 1L0QA 4FHLA 1XHMA 3C9CA 3DM0A 1MG3A 2CNXA 2I3SA 4L3HD 4AOWA 3I7HA 2YNOA 2P9LC 3N0EA 3PXWD 5I5JA 4GQ1A 5H14A 1JMZB 3MZLA 5GSAA 5FQDA 4PNKB 4X63B 3EG6A 2IWKA 5IT9g 1GG2B 4ZOZA 4ESGA 1U2VC 4QRJA 4G56B 4GQBB 1B9YA 3UVOA 5H17A 3L4MD 5HQGA 3FM0A 2B5LA 4CI1A 3K27A 3BWSA 1YFQA 3CFVA 3OKYA 3SN6B 4A0AB 4E5ZA 3PXSD 3SWSD 3I7LA 3BG0A 3GREA 3PVWB 4AEZA 3ZWLB 4IMMA 3EI4A 3W15A 3PVUB 2CE8A 5EM2B 4BL0A 1GXRA 3ULEC 4QQEA 4GMBA 4GM8A 4A09B 2YNPA 4NSXA 2H47A 3U4YA 2EBSA 4L3GD 4U7AA 3UKRC 5HE0B 2Z2OA 5C2WB 3V7DB 4A0AA 3MKQA 2H6QA 2I0TA 1PBYB 2AGWA 3JRPA 2XL3A 3SBPA 4XEIC 3EI4B 3F3PA 1N6DA 4QT8A 3EI2A 1S4UX 5KDOB 1QNIA 3RMZD 5GXHA 2J56H 3IKOA 2BBKH 4QL1A 4Y7RA 3SJLD 2J55H 2P9NC 5FKQA 5FKSA 3SHFA 3A0FA 5C9ZB 1A0RB 1K32A 4XYHA 2AGLA 4PC0A 3VH0A 3GFCA 2AH0A 2P9SC 4K3ID 5EMKB 2UZXB 3EI2B 2PM6B 5TEEA 4GGAA 2YMUA 2CE9A 3DXMC 3EI1A 4EWRA 4J81A 3SBRA 1TBGA 3JZHA 4O1QD 2HESX 5CXCA 3DWLC 3AH8B 3IIWA 2QXVA 2Z2PA 5FA5B 4GQ2P 5JWZA 2XYIA 4O3UB 2GC4A 4CZXA 4JSVC 4A2MA 3L4OD 2OVRB 2AGZA 1RI6A 3EMHA 4HDJA 3I7PA 3IIYA 4A11B 5EMLB 3PXTD 1MG2A 1SQJA 2XU7A 2IUQA 4FA9D 2YB8B 4PSXB 4R7AB 3F3GA 4J87A 5K19A 3SXTD 4BUJC 1ERJA 4A11A 1PGUA 1OMWB 4FAND 2B5NA 1SHYB 4OWRA 4PSWB 4IA9A 3NVQA 4ZOXA 2OVPB 3RFGA 3SFZA 5HE3B 3NVNA 3BG1A 3OTTA 5IGOA 3AL9A 4CY3A 3JAMg 4ERZA 2H9LA 2I3TA 5FKRA 3RRMC 4UI9R 1GOTB 4J0XA 3FGBA 5A2Qg 4TZ4A 4X61B 3JZNA 4CZVA 1VYHC 3CFSB 3DSMA 3SBQA 4J73A 3UVLA 4JT5C 3JZGA 4ERQA 2Q7QA 3OL2A 4JXMA 5GMKn 4LGNA 2H68A 3I2NA 4LG9A 3UKUC 2YNNA 4A2LA 1MDAH 5FKTA 2IAAA 4A09A 2IUPA 3OL2B 3C5MA 4MK0B 4D0KA 3IJ1A 1NR0A 3I89A 3P4FA 5CYKB 1K8KC 2IWFA 2HKRA 3NVXA 4KFMB 5GXIA 3SCYA 4O9DA 5CXBA 4E54B 1XKSA 3UR4A 3OW8A 5EMMB 2IUVA 4FA4D 4CI8A 2Z2NA 3AFCA 4A08B 1OLZA 4FA5D 3N0DA 4E5ZB 2H14A 2G99A 5B4WA 4JD2C 5AMSA 3C75H 5AJAA 5CXBB 5EM2A 4E54A 3CIKB 4YVDA 2HKMA 4CI2A 4J8BA 4ERYA 5EAMA 3EWEA 3UVKA 1U4CA 3AL8B 4ES0A 3SVWD 4X60B 5EALA 4JSPC 2H6KA 5AFU3 4PBZA 3EI1B 5CXCB 2HXCA 3I8EA 4J84A 2H6NA 3EU7A 3VGZA 5IGQA 2CO0A 3OKTA 2J57G 2OK6A 4LG8A 3I8CA 2I0RA 1JJUB 2O9KA 3JB9L 4O45A 2AH1A 3RSEC 3PE7A 3EI3A 2QC5A
chains in the Genus database with same CATH superfamily
3PSLA 4A0BB 1JOFA 5FXYA 2P9UC 2VDRA 3SMRA 2AQ5A 4IRZA 1T2XA 3O4GA 2H9PA 3IJ0A 2CN3A 3OKWA 4GGCA 4I79A 4DNVA 3DXKC 2OIZA 1N6EA 2BCJB 4BP8A 3JPXA 5SXMA 3KCIA 2G9AA 2HJ4A 4Z8LA 3KRXB 4J77A 2GC7A 1E5TA 4H5IA 3NIDA 4MMYA 5H1MA 4CY5A 4PXWA 2H3XA 2PM7B 4JHNA 4ZOYA 3IJCA 2AGXA 4JT6C 1N6FA 4FB1D 2MTAH 4L9OA 2AGYA 5M5VA 4FAVD 2EICA 3HFQA 3I7NA 4L1QD 4O3TB 3J81g 3MMYA 4OZUA 3RN1D 2YBAA 3VA6A 4CY1A 1NEXB 5EAPA 1Q47A 3MXXA 2CO0C 3MKSB 2OK4A 4U1EI 3K26A 3MUNA 1UOPA 4J0WA 2IURA 2P9IC 3O4HA 1JMXB 2B5MA 4GM9A 2W18A 5HE2B 1GOGA 3OKYB 4FWWA 2TRCB 4WK4A 2JKXA 2EIEA 2PBIB 2VDLA 2CN2A 3V4PA 4PBYA 1QFSA 1B9XA 5TDHB 3NIFA 5THAA 1I2MB 1R5MA 1UOOA 1SQ9A 3ORVD 5TF2A 4CI3A 3T3MA 3V5WB 1TYQC 3FCSA 4AN0A 3JROA 1GP2B 5C2VB 3VI4A 5FFGA 3ODTA 1UOQA 2H9NA 4JSXC 5CYKA 2I0SA 1E8MA 2GNQA 5HYNB 2XL2A 4BP9A 5IJ8E 2H9MA 1VZ2A 4A7JA 3QI0A 1PI6A 3QHYB 4ZOVA 3T3PA 4JSNC 4J82A 5TEFA 4GZ8A 4A08A 1FWXA 1C9IA 5K1CC 5I5MA 4GM3A 3SLED 4J79A 4GGDA 4FA1D 3ZDXA 1QFMA 3MZKA 4N14A 3V9FA 3RFHA 2P9PC 2HYEA 1XIPA 1P22A 2P9KC 4H5JA 3AL8A 4RE5A 2XZGA 3IULA 4J8GA 3RN0D 4D6VA 3B7FA 4J78A 3UVNA 2PM9B 3UVMA 5EMJB 3I7KA 5I5IA 3KRWB 2BKLA 2HJBA 5IJ7E 3FCUA 3RLMD 4CZYA 1GOFA 4XYIA 4ZN4A 3FRXA 5HE1B 2H13A 4K3JB 3C99A 5E6UA 4BH6A 3EI3B 4Y5RD 2PM9A 4A0BA 4X3EA 3J80g 5FLXg 2OJYA 4G1MA 4J86A 3PSCB 1H2YA 5EARA 3I7OA 1PEVA 2OVQB 2UZYB 5IC7A 3F3FA 4AX4A 4CC9A 1JV2A 3E0CA 3IJEA 3GC3B 2B4EA 2QZPA 1L0QA 4CY2A 4FHLA 4AMZA 1XHMA 3C9CA 2VDMA 3DM0A 1MG3A 2CNXA 2I3SA 4L3HD 4AOWA 3I7HA 4AN1A 2YNOA 2P9LC 3N0EA 3PXWD 1L5GA 5I5JA 4WJKA 4GQ1A 5E6SA 5H14A 3ZDZA 1JMZB 1JTDB 3MZLA 1K3IA 5GSAA 5FQDA 4PNKB 4X63B 3ZE0A 3MUOA 3EG6A 4UM8A 2IWKA 3O4JA 5IT9g 1GG2B 4ZOZA 4ESGA 1U2VC 4QRJA 5M61A 4G56B 4GQBB 2HU5A 1B9YA 3UVOA 4MMZA 5H17A 3L4MD 2VDOA 5HDBA 2XE4A 5HQGA 3NIGA 3FM0A 2B5LA 4BCBA 4CI1A 3K27A 1VZ3A 3BWSA 1YFQA 3CFVA 3ZDYA 3OKYA 3SN6B 4A0AB 3IUJA 1O6GA 5M5TA 4E5ZA 4MMXA 3PXSD 3SWSD 3I7LA 3BG0A 3GREA 1O6FA 3PVWB 3ZWLB 4AEZA 2VDKA 4IMMA 3IUQA 3EI4A 4NBMA 3W15A 2VDNA 3PVUB 2CE8A 4BL0A 5EM2B 3K71A 1GXRA 3ULEC 4QQEA 4GMBA 4GM8A 4A09B 2YNPA 4NSXA 2H47A 3U4YA 2EBSA 4L3GD 4U7AA 3IUNA 3UKRC 5HE0B 2Z2OA 5C2WB 3V7DB 4A0AA 3MKQA 2H6QA 2I0TA 1PBYB 2AGWA 3JRPA 2XL3A 3SBPA 4XEIC 3EI4B 3F3PA 1UTCA 1N6DA 4QT8A 3EI2A 3EQ9A 1TYEA 1S4UX 1BPOA 5KDOB 1QNIA 3RMZD 5GXHA 2J56H 3IKOA 2BBKH 4QL1A 4Y7RA 3SJLD 2J55H 5M5UA 2P9NC 5FKQA 5FKSA 3SHFA 3A0FA 5C9ZB 4DNWA 4DNUA 1A0RB 3GD1I 2HU8A 1K32A 4XYHA 3IURA 2AGLA 4PC0A 3VH0A 3GFCA 2AH0A 2P9SC 2QR5A 3OF7A 2UZXB 4K3ID 5EMKB 3EI2B 3IVMA 2PM6B 5TEEA 4GGAA 2YMUA 2CE9A 3DXMC 3EI1A 4EWRA 4J81A 3SBRA 1TBGA 3JZHA 2HESX 4O1QD 5CXCA 5FFOA 3DWLC 3MVDK 4NC4A 3AH8B 3K6SA 3IIWA 2QXVA 2Z2PA 5FA5B 4GQ2P 5JWZA 4WK0A 1H2XA 1VE6A 2XYIA 5E6RA 4O3UB 2GC4A 4CZXA 1M1XA 4NENA 4NAAA 4JSVC 4A2MA 1U8CA 2OVRB 3L4OD 2AGZA 4O02A 1A12A 1RI6A 3EMHA 4HDJA 3I7PA 3IIYA 4A11B 4AMYA 2WQ8A 5EMLB 3PXTD 1MG2A 5C86A 1SQJA 2XU7A 2VDQA 5M5RA 2IUQA 4FA9D 2YB8B 1H2WA 4PSXB 3ZE2A 4R7AB 3F3GA 4J87A 5K19A 3SXTD 4BUJC 4Z7NA 2XDWA 1ERJA 4G1EA 4A11A 1PGUA 1OMWB 4FAND 2B5NA 1SHYB 4OWRA 2VZ3A 4BCCA 4PSWB 4UM9A 4IA9A 3NVQA 4ZOXA 2OVPB 3RFGA 3SFZA 5HE3B 1YR2A 3NVNA 3BG1A 3OTTA 5IGOA 3AL9A 4CY3A 3JAMg 3IUMA 4ERZA 2H9LA 4JHPC 2I3TA 5FKRA 3RRMC 5C92A 4G55A 4UI9R 1GOTB 4J0XA 3FGBA 5A2Qg 4TZ4A 4X61B 1GOHA 3JZNA 4CZVA 1VYHC 3CFSB 3DSMA 3SBQA 4J73A 3UVLA 4JT5C 3JZGA 4ERQA 2Q7QA 3OL2A 4JXMA 5GMKn 4LGNA 2H68A 3I2NA 5M5SA 1H2ZA 4LG9A 3UKUC 2YNNA 4A2LA 1MDAH 5FKTA 4WK2A 2IAAA 4A09A 3K72A 2IUPA 3OL2B 3C5MA 4QAMA 4Z7QA 1E8NA 4MK0B 2EIDA 4D0KA 3IJ1A 1NR0A 4RE6A 3I89A 2HU7A 3P4FA 5CYKB 1K8KC 3V4VA 2IWFA 2HKRA 3NVXA 1VE7A 4KFMB 3DDUA 4BCDA 5GXIA 3SCYA 4O9DA 5CXBA 4E54B 1XKSA 3ZE1A 3UR4A 3OW8A 5EMMB 3VI3A 2IUVA 4FA4D 4CI8A 2Z2NA 3AFCA 4A08B 1OLZA 4FA5D 3N0DA 4E5ZB 2H14A 2G99A 5B4WA 4JD2C 5AMSA 3C75H 5AJAA 5CXBB 5EM2A 4E54A 3CIKB 4YVDA 4Z7OA 2HKMA 4CI2A 4J8BA 4ERYA 5EAMA 3EWEA 3UVKA 1U4CA 3AL8B 4ES0A 3SVWD 4X60B 2VDPA 5EALA 4JSPC 3O4IA 2H6KA 5AFU3 4PBZA 3EI1B 5CXCB 2HXCA 3I8EA 4J84A 2H6NA 3EQ7A 4L1MA 3EU7A 3EQ8A 3VGZA 5IGQA 4O2WA 2CO0A 3OKTA 2EIBA 2J57G 2OK6A 1C9LA 4LG8A 2VC2A 2I0RA 3I8CA 1JJUB 2O9KA 3JB9L 4O45A 2AH1A 4D9SA 3RSEC 3PE7A 2VZ1A 3EI3A 2QC5A
chains in the Genus database with same CATH topology
3PSLA 4A0BB 1JOFA 5FXYA 2P9UC 3SMRA 2AQ5A 2H9PA 3IJ0A 2CN3A 3OKWA 4GGCA 4I79A 3DXKC 2OIZA 1N6EA 2BCJB 3JPXA 5SXMA 2G9AA 2HJ4A 4Z8LA 3KRXB 4J77A 2GC7A 4CY5A 4H5IA 5H1MA 4PXWA 2H3XA 2PM7B 4ZOYA 3IJCA 2AGXA 4JT6C 1N6FA 4FB1D 2MTAH 4L9OA 2AGYA 4FAVD 3HFQA 3I7NA 4L1QD 4O3TB 3J81g 3MMYA 4OZUA 3RN1D 2YBAA 3VA6A 4CY1A 1NEXB 5EAPA 1Q47A 3MXXA 2CO0C 3MKSB 2OK4A 4U1EI 3K26A 4J0WA 2IURA 2P9IC 1JMXB 4GM9A 2B5MA 2W18A 5HE2B 3OKYB 4FWWA 2TRCB 2PBIB 2CN2A 4PBYA 1B9XA 5TDHB 5THAA 1R5MA 1SQ9A 3ORVD 5TF2A 4CI3A 3V5WB 1TYQC 3JROA 1GP2B 5C2VB 3ODTA 2H9NA 4JSXC 5CYKA 2I0SA 2GNQA 5HYNB 2XL2A 5IJ8E 2H9MA 4A7JA 1PI6A 4ZOVA 4JSNC 4J82A 5TEFA 4GZ8A 4A08A 1FWXA 5K1CC 5I5MA 4GM3A 3SLED 4J79A 4GGDA 4FA1D 3MZKA 4N14A 3V9FA 3RFHA 2P9PC 2HYEA 1XIPA 1P22A 2P9KC 4H5JA 3AL8A 4J8GA 3RN0D 4D6VA 3B7FA 4J78A 3UVNA 2PM9B 3UVMA 5EMJB 3I7KA 5I5IA 3KRWB 2HJBA 5IJ7E 3RLMD 4CZYA 4XYIA 4ZN4A 3FRXA 5HE1B 2H13A 4K3JB 3C99A 4BH6A 3EI3B 4Y5RD 2PM9A 4A0BA 4X3EA 3J80g 5FLXg 2OJYA 4J86A 3PSCB 5EARA 3I7OA 1PEVA 2OVQB 2UZYB 5IC7A 3F3FA 4CC9A 3E0CA 4CY2A 2B4EA 1L0QA 4FHLA 1XHMA 3C9CA 3DM0A 1MG3A 2CNXA 2I3SA 4L3HD 4AOWA 3I7HA 2YNOA 2P9LC 3N0EA 3PXWD 5I5JA 4GQ1A 5H14A 1JMZB 3MZLA 5GSAA 5FQDA 4PNKB 4X63B 3EG6A 2IWKA 5IT9g 1GG2B 4ZOZA 4ESGA 1U2VC 4QRJA 4G56B 4GQBB 1B9YA 3UVOA 5H17A 3L4MD 5HQGA 3FM0A 2B5LA 4CI1A 3K27A 3BWSA 1YFQA 3CFVA 3OKYA 3SN6B 4A0AB 4E5ZA 3PXSD 3SWSD 3I7LA 3BG0A 3GREA 3PVWB 4AEZA 3ZWLB 4IMMA 3EI4A 3W15A 3PVUB 2CE8A 5EM2B 4BL0A 1GXRA 3ULEC 4QQEA 4GMBA 4GM8A 4A09B 2YNPA 4NSXA 2H47A 3U4YA 2EBSA 4L3GD 4U7AA 3UKRC 5HE0B 2Z2OA 5C2WB 3V7DB 4A0AA 3MKQA 2H6QA 2I0TA 1PBYB 2AGWA 3JRPA 2XL3A 3SBPA 4XEIC 3EI4B 3F3PA 1N6DA 4QT8A 3EI2A 1S4UX 5KDOB 1QNIA 3RMZD 5GXHA 2J56H 3IKOA 2BBKH 4QL1A 4Y7RA 3SJLD 2J55H 2P9NC 5FKQA 5FKSA 3SHFA 3A0FA 5C9ZB 1A0RB 1K32A 4XYHA 2AGLA 4PC0A 3VH0A 3GFCA 2AH0A 2P9SC 4K3ID 5EMKB 2UZXB 3EI2B 2PM6B 5TEEA 4GGAA 2YMUA 2CE9A 3DXMC 3EI1A 4EWRA 4J81A 3SBRA 1TBGA 3JZHA 4O1QD 2HESX 5CXCA 3DWLC 3AH8B 3IIWA 2QXVA 2Z2PA 5FA5B 4GQ2P 5JWZA 2XYIA 4O3UB 2GC4A 4CZXA 4JSVC 4A2MA 3L4OD 2OVRB 2AGZA 1RI6A 3EMHA 4HDJA 3I7PA 3IIYA 4A11B 5EMLB 3PXTD 1MG2A 1SQJA 2XU7A 2IUQA 4FA9D 2YB8B 4PSXB 4R7AB 3F3GA 4J87A 5K19A 3SXTD 4BUJC 1ERJA 4A11A 1PGUA 1OMWB 4FAND 2B5NA 1SHYB 4OWRA 4PSWB 4IA9A 3NVQA 4ZOXA 2OVPB 3RFGA 3SFZA 5HE3B 3NVNA 3BG1A 3OTTA 5IGOA 3AL9A 4CY3A 3JAMg 4ERZA 2H9LA 2I3TA 5FKRA 3RRMC 4UI9R 1GOTB 4J0XA 3FGBA 5A2Qg 4TZ4A 4X61B 3JZNA 4CZVA 1VYHC 3CFSB 3DSMA 3SBQA 4J73A 3UVLA 4JT5C 3JZGA 4ERQA 2Q7QA 3OL2A 4JXMA 5GMKn 4LGNA 2H68A 3I2NA 4LG9A 3UKUC 2YNNA 4A2LA 1MDAH 5FKTA 2IAAA 4A09A 2IUPA 3OL2B 3C5MA 4MK0B 4D0KA 3IJ1A 1NR0A 3I89A 3P4FA 5CYKB 1K8KC 2IWFA 2HKRA 3NVXA 4KFMB 5GXIA 3SCYA 4O9DA 5CXBA 4E54B 1XKSA 3UR4A 3OW8A 5EMMB 2IUVA 4FA4D 4CI8A 2Z2NA 3AFCA 4A08B 1OLZA 4FA5D 3N0DA 4E5ZB 2H14A 2G99A 5B4WA 4JD2C 5AMSA 3C75H 5AJAA 5CXBB 5EM2A 4E54A 3CIKB 4YVDA 2HKMA 4CI2A 4J8BA 4ERYA 5EAMA 3EWEA 3UVKA 1U4CA 3AL8B 4ES0A 3SVWD 4X60B 5EALA 4JSPC 2H6KA 5AFU3 4PBZA 3EI1B 5CXCB 2HXCA 3I8EA 4J84A 2H6NA 3EU7A 3VGZA 5IGQA 2CO0A 3OKTA 2J57G 2OK6A 4LG8A 3I8CA 2I0RA 1JJUB 2O9KA 3JB9L 4O45A 2AH1A 3RSEC 3PE7A 3EI3A 2QC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSL A;  4A0B B;  1JOF A;  5FXY A;  2P9U C;  3SMR A;  2AQ5 A;  2H9P A;  3IJ0 A;  2CN3 A;  3OKW A;  4GGC A;  4I79 A;  3DXK C;  2OIZ A;  1N6E A;  2BCJ B;  3JPX A;  5SXM A;  2G9A A;  2HJ4 A;  4Z8L A;  3KRX B;  4J77 A;  2GC7 A;  4CY5 A;  4H5I A;  5H1M A;  4PXW A;  2H3X A;  2PM7 B;  4ZOY A;  3IJC A;  2AGX A;  4JT6 C;  1N6F A;  4FB1 D;  2MTA H;  4L9O A;  2AGY A;  4FAV D;  3HFQ A;  3I7N A;  4L1Q D;  4O3T B;  3J81 g;  3MMY A;  4OZU A;  3RN1 D;  2YBA A;  3VA6 A;  4CY1 A;  1NEX B;  5EAP A;  1Q47 A;  3MXX A;  2CO0 C;  3MKS B;  2OK4 A;  4U1E I;  3K26 A;  4J0W A;  2IUR A;  2P9I C;  1JMX B;  4GM9 A;  2B5M A;  2W18 A;  5HE2 B;  3OKY B;  4FWW A;  2TRC B;  2PBI B;  2CN2 A;  4PBY A;  1B9X A;  5TDH B;  5THA A;  1R5M A;  1SQ9 A;  3ORV D;  5TF2 A;  4CI3 A;  3V5W B;  1TYQ C;  3JRO A;  1GP2 B;  5C2V B;  3ODT A;  2H9N A;  4JSX C;  5CYK A;  2I0S A;  2GNQ A;  5HYN B;  2XL2 A;  5IJ8 E;  2H9M A;  4A7J A;  1PI6 A;  4ZOV A;  4JSN C;  4J82 A;  5TEF A;  4GZ8 A;  4A08 A;  1FWX A;  5K1C C;  5I5M A;  4GM3 A;  3SLE D;  4J79 A;  4GGD A;  4FA1 D;  3MZK A;  4N14 A;  3V9F A;  3RFH A;  2P9P C;  2HYE A;  1XIP A;  1P22 A;  2P9K C;  4H5J A;  3AL8 A;  4J8G A;  3RN0 D;  4D6V A;  3B7F A;  4J78 A;  3UVN A;  2PM9 B;  3UVM A;  5EMJ B;  3I7K A;  5I5I A;  3KRW B;  2HJB A;  5IJ7 E;  3RLM D;  4CZY A;  4XYI A;  4ZN4 A;  3FRX A;  5HE1 B;  2H13 A;  4K3J B;  3C99 A;  4BH6 A;  3EI3 B;  4Y5R D;  2PM9 A;  4A0B A;  4X3E A;  3J80 g;  5FLX g;  2OJY A;  4J86 A;  3PSC B;  5EAR A;  3I7O A;  1PEV A;  2OVQ B;  2UZY B;  5IC7 A;  3F3F A;  4CC9 A;  3E0C A;  4CY2 A;  2B4E A;  1L0Q A;  4FHL A;  1XHM A;  3C9C A;  3DM0 A;  1MG3 A;  2CNX A;  2I3S A;  4L3H D;  4AOW A;  3I7H A;  2YNO A;  2P9L C;  3N0E A;  3PXW D;  5I5J A;  4GQ1 A;  5H14 A;  1JMZ B;  3MZL A;  5GSA A;  5FQD A;  4PNK B;  4X63 B;  3EG6 A;  2IWK A;  5IT9 g;  1GG2 B;  4ZOZ A;  4ESG A;  1U2V C;  4QRJ A;  4G56 B;  4GQB B;  1B9Y A;  3UVO A;  5H17 A;  3L4M D;  5HQG A;  3FM0 A;  2B5L A;  4CI1 A;  3K27 A;  3BWS A;  1YFQ A;  3CFV A;  3OKY A;  3SN6 B;  4A0A B;  4E5Z A;  3PXS D;  3SWS D;  3I7L A;  3BG0 A;  3GRE A;  3PVW B;  4AEZ A;  3ZWL B;  4IMM A;  3EI4 A;  3W15 A;  3PVU B;  2CE8 A;  5EM2 B;  4BL0 A;  1GXR A;  3ULE C;  4QQE A;  4GMB A;  4GM8 A;  4A09 B;  2YNP A;  4NSX A;  2H47 A;  3U4Y A;  2EBS A;  4L3G D;  4U7A A;  3UKR C;  5HE0 B;  2Z2O A;  5C2W B;  3V7D B;  4A0A A;  3MKQ A;  2H6Q A;  2I0T A;  1PBY B;  2AGW A;  3JRP A;  2XL3 A;  3SBP A;  4XEI C;  3EI4 B;  3F3P A;  1N6D A;  4QT8 A;  3EI2 A;  1S4U X;  5KDO B;  1QNI A;  3RMZ D;  5GXH A;  2J56 H;  3IKO A;  2BBK H;  4QL1 A;  4Y7R A;  3SJL D;  2J55 H;  2P9N C;  5FKQ A;  5FKS A;  3SHF A;  3A0F A;  5C9Z B;  1A0R B;  1K32 A;  4XYH A;  2AGL A;  4PC0 A;  3VH0 A;  3GFC A;  2AH0 A;  2P9S C;  4K3I D;  5EMK B;  2UZX B;  3EI2 B;  2PM6 B;  5TEE A;  4GGA A;  2YMU A;  2CE9 A;  3DXM C;  3EI1 A;  4EWR A;  4J81 A;  3SBR A;  1TBG A;  3JZH A;  4O1Q D;  2HES X;  5CXC A;  3DWL C;  3AH8 B;  3IIW A;  2QXV A;  2Z2P A;  5FA5 B;  4GQ2 P;  5JWZ A;  2XYI A;  4O3U B;  2GC4 A;  4CZX A;  4JSV C;  4A2M A;  3L4O D;  2OVR B;  2AGZ A;  1RI6 A;  3EMH A;  4HDJ A;  3I7P A;  3IIY A;  4A11 B;  5EML B;  3PXT D;  1MG2 A;  1SQJ A;  2XU7 A;  2IUQ A;  4FA9 D;  2YB8 B;  4PSX B;  4R7A B;  3F3G A;  4J87 A;  5K19 A;  3SXT D;  4BUJ C;  1ERJ A;  4A11 A;  1PGU A;  1OMW B;  4FAN D;  2B5N A;  1SHY B;  4OWR A;  4PSW B;  4IA9 A;  3NVQ A;  4ZOX A;  2OVP B;  3RFG A;  3SFZ A;  5HE3 B;  3NVN A;  3BG1 A;  3OTT A;  5IGO A;  3AL9 A;  4CY3 A;  3JAM g;  4ERZ A;  2H9L A;  2I3T A;  5FKR A;  3RRM C;  4UI9 R;  1GOT B;  4J0X A;  3FGB A;  5A2Q g;  4TZ4 A;  4X61 B;  3JZN A;  4CZV A;  1VYH C;  3CFS B;  3DSM A;  3SBQ A;  4J73 A;  3UVL A;  4JT5 C;  3JZG A;  4ERQ A;  2Q7Q A;  3OL2 A;  4JXM A;  5GMK n;  4LGN A;  2H68 A;  3I2N A;  4LG9 A;  3UKU C;  2YNN A;  4A2L A;  1MDA H;  5FKT A;  2IAA A;  4A09 A;  2IUP A;  3OL2 B;  3C5M A;  4MK0 B;  4D0K A;  3IJ1 A;  1NR0 A;  3I89 A;  3P4F A;  5CYK B;  1K8K C;  2IWF A;  2HKR A;  3NVX A;  4KFM B;  5GXI A;  3SCY A;  4O9D A;  5CXB A;  4E54 B;  1XKS A;  3UR4 A;  3OW8 A;  5EMM B;  2IUV A;  4FA4 D;  4CI8 A;  2Z2N A;  3AFC A;  4A08 B;  1OLZ A;  4FA5 D;  3N0D A;  4E5Z B;  2H14 A;  2G99 A;  5B4W A;  4JD2 C;  5AMS A;  3C75 H;  5AJA A;  5CXB B;  5EM2 A;  4E54 A;  3CIK B;  4YVD A;  2HKM A;  4CI2 A;  4J8B A;  4ERY A;  5EAM A;  3EWE A;  3UVK A;  1U4C A;  3AL8 B;  4ES0 A;  3SVW D;  4X60 B;  5EAL A;  4JSP C;  2H6K A;  5AFU 3;  4PBZ A;  3EI1 B;  5CXC B;  2HXC A;  3I8E A;  4J84 A;  2H6N A;  3EU7 A;  3VGZ A;  5IGQ A;  2CO0 A;  3OKT A;  2J57 G;  2OK6 A;  4LG8 A;  3I8C A;  2I0R A;  1JJU B;  2O9K A;  3JB9 L;  4O45 A;  2AH1 A;  3RSE C;  3PE7 A;  3EI3 A;  2QC5 A; 
#chains in the Genus database with same CATH topology
 3PSL A;  4A0B B;  1JOF A;  5FXY A;  2P9U C;  2VDR A;  3SMR A;  2AQ5 A;  4IRZ A;  1T2X A;  3O4G A;  2H9P A;  3IJ0 A;  2CN3 A;  3OKW A;  4GGC A;  4I79 A;  4DNV A;  3DXK C;  2OIZ A;  1N6E A;  2BCJ B;  4BP8 A;  3JPX A;  5SXM A;  3KCI A;  2G9A A;  2HJ4 A;  4Z8L A;  3KRX B;  4J77 A;  2GC7 A;  1E5T A;  4H5I A;  3NID A;  4MMY A;  5H1M A;  4CY5 A;  4PXW A;  2H3X A;  2PM7 B;  4JHN A;  4ZOY A;  3IJC A;  2AGX A;  4JT6 C;  1N6F A;  4FB1 D;  2MTA H;  4L9O A;  2AGY A;  5M5V A;  4FAV D;  2EIC A;  3HFQ A;  3I7N A;  4L1Q D;  4O3T B;  3J81 g;  3MMY A;  4OZU A;  3RN1 D;  2YBA A;  3VA6 A;  4CY1 A;  1NEX B;  5EAP A;  1Q47 A;  3MXX A;  2CO0 C;  3MKS B;  2OK4 A;  4U1E I;  3K26 A;  3MUN A;  1UOP A;  4J0W A;  2IUR A;  2P9I C;  3O4H A;  1JMX B;  2B5M A;  4GM9 A;  2W18 A;  5HE2 B;  1GOG A;  3OKY B;  4FWW A;  2TRC B;  4WK4 A;  2JKX A;  2EIE A;  2PBI B;  2VDL A;  2CN2 A;  3V4P A;  4PBY A;  1QFS A;  1B9X A;  5TDH B;  3NIF A;  5THA A;  1I2M B;  1R5M A;  1UOO A;  1SQ9 A;  3ORV D;  5TF2 A;  4CI3 A;  3T3M A;  3V5W B;  1TYQ C;  3FCS A;  4AN0 A;  3JRO A;  1GP2 B;  5C2V B;  3VI4 A;  5FFG A;  3ODT A;  1UOQ A;  2H9N A;  4JSX C;  5CYK A;  2I0S A;  1E8M A;  2GNQ A;  5HYN B;  2XL2 A;  4BP9 A;  5IJ8 E;  2H9M A;  1VZ2 A;  4A7J A;  3QI0 A;  1PI6 A;  3QHY B;  4ZOV A;  3T3P A;  4JSN C;  4J82 A;  5TEF A;  4GZ8 A;  4A08 A;  1FWX A;  1C9I A;  5K1C C;  5I5M A;  4GM3 A;  3SLE D;  4J79 A;  4GGD A;  4FA1 D;  3ZDX A;  1QFM A;  3MZK A;  4N14 A;  3V9F A;  3RFH A;  2P9P C;  2HYE A;  1XIP A;  1P22 A;  2P9K C;  4H5J A;  3AL8 A;  4RE5 A;  2XZG A;  3IUL A;  4J8G A;  3RN0 D;  4D6V A;  3B7F A;  4J78 A;  3UVN A;  2PM9 B;  3UVM A;  5EMJ B;  3I7K A;  5I5I A;  3KRW B;  2BKL A;  2HJB A;  5IJ7 E;  3FCU A;  3RLM D;  4CZY A;  1GOF A;  4XYI A;  4ZN4 A;  3FRX A;  5HE1 B;  2H13 A;  4K3J B;  3C99 A;  5E6U A;  4BH6 A;  3EI3 B;  4Y5R D;  2PM9 A;  4A0B A;  4X3E A;  3J80 g;  5FLX g;  2OJY A;  4G1M A;  4J86 A;  3PSC B;  1H2Y A;  5EAR A;  3I7O A;  1PEV A;  2OVQ B;  2UZY B;  5IC7 A;  3F3F A;  4AX4 A;  4CC9 A;  1JV2 A;  3E0C A;  3IJE A;  3GC3 B;  2B4E A;  2QZP A;  1L0Q A;  4CY2 A;  4FHL A;  4AMZ A;  1XHM A;  3C9C A;  2VDM A;  3DM0 A;  1MG3 A;  2CNX A;  2I3S A;  4L3H D;  4AOW A;  3I7H A;  4AN1 A;  2YNO A;  2P9L C;  3N0E A;  3PXW D;  1L5G A;  5I5J A;  4WJK A;  4GQ1 A;  5E6S A;  5H14 A;  3ZDZ A;  1JMZ B;  1JTD B;  3MZL A;  1K3I A;  5GSA A;  5FQD A;  4PNK B;  4X63 B;  3ZE0 A;  3MUO A;  3EG6 A;  4UM8 A;  2IWK A;  3O4J A;  5IT9 g;  1GG2 B;  4ZOZ A;  4ESG A;  1U2V C;  4QRJ A;  5M61 A;  4G56 B;  4GQB B;  2HU5 A;  1B9Y A;  3UVO A;  4MMZ A;  5H17 A;  3L4M D;  2VDO A;  5HDB A;  2XE4 A;  5HQG A;  3NIG A;  3FM0 A;  2B5L A;  4BCB A;  4CI1 A;  3K27 A;  1VZ3 A;  3BWS A;  1YFQ A;  3CFV A;  3ZDY A;  3OKY A;  3SN6 B;  4A0A B;  3IUJ A;  1O6G A;  5M5T A;  4E5Z A;  4MMX A;  3PXS D;  3SWS D;  3I7L A;  3BG0 A;  3GRE A;  1O6F A;  3PVW B;  3ZWL B;  4AEZ A;  2VDK A;  4IMM A;  3IUQ A;  3EI4 A;  4NBM A;  3W15 A;  2VDN A;  3PVU B;  2CE8 A;  4BL0 A;  5EM2 B;  3K71 A;  1GXR A;  3ULE C;  4QQE A;  4GMB A;  4GM8 A;  4A09 B;  2YNP A;  4NSX A;  2H47 A;  3U4Y A;  2EBS A;  4L3G D;  4U7A A;  3IUN A;  3UKR C;  5HE0 B;  2Z2O A;  5C2W B;  3V7D B;  4A0A A;  3MKQ A;  2H6Q A;  2I0T A;  1PBY B;  2AGW A;  3JRP A;  2XL3 A;  3SBP A;  4XEI C;  3EI4 B;  3F3P A;  1UTC A;  1N6D A;  4QT8 A;  3EI2 A;  3EQ9 A;  1TYE A;  1S4U X;  1BPO A;  5KDO B;  1QNI A;  3RMZ D;  5GXH A;  2J56 H;  3IKO A;  2BBK H;  4QL1 A;  4Y7R A;  3SJL D;  2J55 H;  5M5U A;  2P9N C;  5FKQ A;  5FKS A;  3SHF A;  3A0F A;  5C9Z B;  4DNW A;  4DNU A;  1A0R B;  3GD1 I;  2HU8 A;  1K32 A;  4XYH A;  3IUR A;  2AGL A;  4PC0 A;  3VH0 A;  3GFC A;  2AH0 A;  2P9S C;  2QR5 A;  3OF7 A;  2UZX B;  4K3I D;  5EMK B;  3EI2 B;  3IVM A;  2PM6 B;  5TEE A;  4GGA A;  2YMU A;  2CE9 A;  3DXM C;  3EI1 A;  4EWR A;  4J81 A;  3SBR A;  1TBG A;  3JZH A;  2HES X;  4O1Q D;  5CXC A;  5FFO A;  3DWL C;  3MVD K;  4NC4 A;  3AH8 B;  3K6S A;  3IIW A;  2QXV A;  2Z2P A;  5FA5 B;  4GQ2 P;  5JWZ A;  4WK0 A;  1H2X A;  1VE6 A;  2XYI A;  5E6R A;  4O3U B;  2GC4 A;  4CZX A;  1M1X A;  4NEN A;  4NAA A;  4JSV C;  4A2M A;  1U8C A;  2OVR B;  3L4O D;  2AGZ A;  4O02 A;  1A12 A;  1RI6 A;  3EMH A;  4HDJ A;  3I7P A;  3IIY A;  4A11 B;  4AMY A;  2WQ8 A;  5EML B;  3PXT D;  1MG2 A;  5C86 A;  1SQJ A;  2XU7 A;  2VDQ A;  5M5R A;  2IUQ A;  4FA9 D;  2YB8 B;  1H2W A;  4PSX B;  3ZE2 A;  4R7A B;  3F3G A;  4J87 A;  5K19 A;  3SXT D;  4BUJ C;  4Z7N A;  2XDW A;  1ERJ A;  4G1E A;  4A11 A;  1PGU A;  1OMW B;  4FAN D;  2B5N A;  1SHY B;  4OWR A;  2VZ3 A;  4BCC A;  4PSW B;  4UM9 A;  4IA9 A;  3NVQ A;  4ZOX A;  2OVP B;  3RFG A;  3SFZ A;  5HE3 B;  1YR2 A;  3NVN A;  3BG1 A;  3OTT A;  5IGO A;  3AL9 A;  4CY3 A;  3JAM g;  3IUM A;  4ERZ A;  2H9L A;  4JHP C;  2I3T A;  5FKR A;  3RRM C;  5C92 A;  4G55 A;  4UI9 R;  1GOT B;  4J0X A;  3FGB A;  5A2Q g;  4TZ4 A;  4X61 B;  1GOH A;  3JZN A;  4CZV A;  1VYH C;  3CFS B;  3DSM A;  3SBQ A;  4J73 A;  3UVL A;  4JT5 C;  3JZG A;  4ERQ A;  2Q7Q A;  3OL2 A;  4JXM A;  5GMK n;  4LGN A;  2H68 A;  3I2N A;  5M5S A;  1H2Z A;  4LG9 A;  3UKU C;  2YNN A;  4A2L A;  1MDA H;  5FKT A;  4WK2 A;  2IAA A;  4A09 A;  3K72 A;  2IUP A;  3OL2 B;  3C5M A;  4QAM A;  4Z7Q A;  1E8N A;  4MK0 B;  2EID A;  4D0K A;  3IJ1 A;  1NR0 A;  4RE6 A;  3I89 A;  2HU7 A;  3P4F A;  5CYK B;  1K8K C;  3V4V A;  2IWF A;  2HKR A;  3NVX A;  1VE7 A;  4KFM B;  3DDU A;  4BCD A;  5GXI A;  3SCY A;  4O9D A;  5CXB A;  4E54 B;  1XKS A;  3ZE1 A;  3UR4 A;  3OW8 A;  5EMM B;  3VI3 A;  2IUV A;  4FA4 D;  4CI8 A;  2Z2N A;  3AFC A;  4A08 B;  1OLZ A;  4FA5 D;  3N0D A;  4E5Z B;  2H14 A;  2G99 A;  5B4W A;  4JD2 C;  5AMS A;  3C75 H;  5AJA A;  5CXB B;  5EM2 A;  4E54 A;  3CIK B;  4YVD A;  4Z7O A;  2HKM A;  4CI2 A;  4J8B A;  4ERY A;  5EAM A;  3EWE A;  3UVK A;  1U4C A;  3AL8 B;  4ES0 A;  3SVW D;  4X60 B;  2VDP A;  5EAL A;  4JSP C;  3O4I A;  2H6K A;  5AFU 3;  4PBZ A;  3EI1 B;  5CXC B;  2HXC A;  3I8E A;  4J84 A;  2H6N A;  3EQ7 A;  4L1M A;  3EU7 A;  3EQ8 A;  3VGZ A;  5IGQ A;  4O2W A;  2CO0 A;  3OKT A;  2EIB A;  2J57 G;  2OK6 A;  1C9L A;  4LG8 A;  2VC2 A;  2I0R A;  3I8C A;  1JJU B;  2O9K A;  3JB9 L;  4O45 A;  2AH1 A;  4D9S A;  3RSE C;  3PE7 A;  2VZ1 A;  3EI3 A;  2QC5 A; 
#chains in the Genus database with same CATH homology
 3PSL A;  4A0B B;  1JOF A;  5FXY A;  2P9U C;  3SMR A;  2AQ5 A;  2H9P A;  3IJ0 A;  2CN3 A;  3OKW A;  4GGC A;  4I79 A;  3DXK C;  2OIZ A;  1N6E A;  2BCJ B;  3JPX A;  5SXM A;  2G9A A;  2HJ4 A;  4Z8L A;  3KRX B;  4J77 A;  2GC7 A;  4CY5 A;  4H5I A;  5H1M A;  4PXW A;  2H3X A;  2PM7 B;  4ZOY A;  3IJC A;  2AGX A;  4JT6 C;  1N6F A;  4FB1 D;  2MTA H;  4L9O A;  2AGY A;  4FAV D;  3HFQ A;  3I7N A;  4L1Q D;  4O3T B;  3J81 g;  3MMY A;  4OZU A;  3RN1 D;  2YBA A;  3VA6 A;  4CY1 A;  1NEX B;  5EAP A;  1Q47 A;  3MXX A;  2CO0 C;  3MKS B;  2OK4 A;  4U1E I;  3K26 A;  4J0W A;  2IUR A;  2P9I C;  1JMX B;  4GM9 A;  2B5M A;  2W18 A;  5HE2 B;  3OKY B;  4FWW A;  2TRC B;  2PBI B;  2CN2 A;  4PBY A;  1B9X A;  5TDH B;  5THA A;  1R5M A;  1SQ9 A;  3ORV D;  5TF2 A;  4CI3 A;  3V5W B;  1TYQ C;  3JRO A;  1GP2 B;  5C2V B;  3ODT A;  2H9N A;  4JSX C;  5CYK A;  2I0S A;  2GNQ A;  5HYN B;  2XL2 A;  5IJ8 E;  2H9M A;  4A7J A;  1PI6 A;  4ZOV A;  4JSN C;  4J82 A;  5TEF A;  4GZ8 A;  4A08 A;  1FWX A;  5K1C C;  5I5M A;  4GM3 A;  3SLE D;  4J79 A;  4GGD A;  4FA1 D;  3MZK A;  4N14 A;  3V9F A;  3RFH A;  2P9P C;  2HYE A;  1XIP A;  1P22 A;  2P9K C;  4H5J A;  3AL8 A;  4J8G A;  3RN0 D;  4D6V A;  3B7F A;  4J78 A;  3UVN A;  2PM9 B;  3UVM A;  5EMJ B;  3I7K A;  5I5I A;  3KRW B;  2HJB A;  5IJ7 E;  3RLM D;  4CZY A;  4XYI A;  4ZN4 A;  3FRX A;  5HE1 B;  2H13 A;  4K3J B;  3C99 A;  4BH6 A;  3EI3 B;  4Y5R D;  2PM9 A;  4A0B A;  4X3E A;  3J80 g;  5FLX g;  2OJY A;  4J86 A;  3PSC B;  5EAR A;  3I7O A;  1PEV A;  2OVQ B;  2UZY B;  5IC7 A;  3F3F A;  4CC9 A;  3E0C A;  4CY2 A;  2B4E A;  1L0Q A;  4FHL A;  1XHM A;  3C9C A;  3DM0 A;  1MG3 A;  2CNX A;  2I3S A;  4L3H D;  4AOW A;  3I7H A;  2YNO A;  2P9L C;  3N0E A;  3PXW D;  5I5J A;  4GQ1 A;  5H14 A;  1JMZ B;  3MZL A;  5GSA A;  5FQD A;  4PNK B;  4X63 B;  3EG6 A;  2IWK A;  5IT9 g;  1GG2 B;  4ZOZ A;  4ESG A;  1U2V C;  4QRJ A;  4G56 B;  4GQB B;  1B9Y A;  3UVO A;  5H17 A;  3L4M D;  5HQG A;  3FM0 A;  2B5L A;  4CI1 A;  3K27 A;  3BWS A;  1YFQ A;  3CFV A;  3OKY A;  3SN6 B;  4A0A B;  4E5Z A;  3PXS D;  3SWS D;  3I7L A;  3BG0 A;  3GRE A;  3PVW B;  4AEZ A;  3ZWL B;  4IMM A;  3EI4 A;  3W15 A;  3PVU B;  2CE8 A;  5EM2 B;  4BL0 A;  1GXR A;  3ULE C;  4QQE A;  4GMB A;  4GM8 A;  4A09 B;  2YNP A;  4NSX A;  2H47 A;  3U4Y A;  2EBS A;  4L3G D;  4U7A A;  3UKR C;  5HE0 B;  2Z2O A;  5C2W B;  3V7D B;  4A0A A;  3MKQ A;  2H6Q A;  2I0T A;  1PBY B;  2AGW A;  3JRP A;  2XL3 A;  3SBP A;  4XEI C;  3EI4 B;  3F3P A;  1N6D A;  4QT8 A;  3EI2 A;  1S4U X;  5KDO B;  1QNI A;  3RMZ D;  5GXH A;  2J56 H;  3IKO A;  2BBK H;  4QL1 A;  4Y7R A;  3SJL D;  2J55 H;  2P9N C;  5FKQ A;  5FKS A;  3SHF A;  3A0F A;  5C9Z B;  1A0R B;  1K32 A;  4XYH A;  2AGL A;  4PC0 A;  3VH0 A;  3GFC A;  2AH0 A;  2P9S C;  4K3I D;  5EMK B;  2UZX B;  3EI2 B;  2PM6 B;  5TEE A;  4GGA A;  2YMU A;  2CE9 A;  3DXM C;  3EI1 A;  4EWR A;  4J81 A;  3SBR A;  1TBG A;  3JZH A;  4O1Q D;  2HES X;  5CXC A;  3DWL C;  3AH8 B;  3IIW A;  2QXV A;  2Z2P A;  5FA5 B;  4GQ2 P;  5JWZ A;  2XYI A;  4O3U B;  2GC4 A;  4CZX A;  4JSV C;  4A2M A;  3L4O D;  2OVR B;  2AGZ A;  1RI6 A;  3EMH A;  4HDJ A;  3I7P A;  3IIY A;  4A11 B;  5EML B;  3PXT D;  1MG2 A;  1SQJ A;  2XU7 A;  2IUQ A;  4FA9 D;  2YB8 B;  4PSX B;  4R7A B;  3F3G A;  4J87 A;  5K19 A;  3SXT D;  4BUJ C;  1ERJ A;  4A11 A;  1PGU A;  1OMW B;  4FAN D;  2B5N A;  1SHY B;  4OWR A;  4PSW B;  4IA9 A;  3NVQ A;  4ZOX A;  2OVP B;  3RFG A;  3SFZ A;  5HE3 B;  3NVN A;  3BG1 A;  3OTT A;  5IGO A;  3AL9 A;  4CY3 A;  3JAM g;  4ERZ A;  2H9L A;  2I3T A;  5FKR A;  3RRM C;  4UI9 R;  1GOT B;  4J0X A;  3FGB A;  5A2Q g;  4TZ4 A;  4X61 B;  3JZN A;  4CZV A;  1VYH C;  3CFS B;  3DSM A;  3SBQ A;  4J73 A;  3UVL A;  4JT5 C;  3JZG A;  4ERQ A;  2Q7Q A;  3OL2 A;  4JXM A;  5GMK n;  4LGN A;  2H68 A;  3I2N A;  4LG9 A;  3UKU C;  2YNN A;  4A2L A;  1MDA H;  5FKT A;  2IAA A;  4A09 A;  2IUP A;  3OL2 B;  3C5M A;  4MK0 B;  4D0K A;  3IJ1 A;  1NR0 A;  3I89 A;  3P4F A;  5CYK B;  1K8K C;  2IWF A;  2HKR A;  3NVX A;  4KFM B;  5GXI A;  3SCY A;  4O9D A;  5CXB A;  4E54 B;  1XKS A;  3UR4 A;  3OW8 A;  5EMM B;  2IUV A;  4FA4 D;  4CI8 A;  2Z2N A;  3AFC A;  4A08 B;  1OLZ A;  4FA5 D;  3N0D A;  4E5Z B;  2H14 A;  2G99 A;  5B4W A;  4JD2 C;  5AMS A;  3C75 H;  5AJA A;  5CXB B;  5EM2 A;  4E54 A;  3CIK B;  4YVD A;  2HKM A;  4CI2 A;  4J8B A;  4ERY A;  5EAM A;  3EWE A;  3UVK A;  1U4C A;  3AL8 B;  4ES0 A;  3SVW D;  4X60 B;  5EAL A;  4JSP C;  2H6K A;  5AFU 3;  4PBZ A;  3EI1 B;  5CXC B;  2HXC A;  3I8E A;  4J84 A;  2H6N A;  3EU7 A;  3VGZ A;  5IGQ A;  2CO0 A;  3OKT A;  2J57 G;  2OK6 A;  4LG8 A;  3I8C A;  2I0R A;  1JJU B;  2O9K A;  3JB9 L;  4O45 A;  2AH1 A;  3RSE C;  3PE7 A;  3EI3 A;  2QC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...