4J77A

Crystal structure of beta'-cop/hwbp1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Wbp1
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 91
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j77A01
2HXCA 3JZNA 5FQDA 3PSLA 3MMYA 4H5IA 1MG2A 5HE0B 1U2VC 4A08B 4J73A 4OZUA 5EARA 4IMMA 5C2WB 4FHLA 3VH0A 1JOFA 1OLZA 2PM7B 4GGCA 4I79A 4ESGA 3EG6A 1MDAH 3RLMD 3K27A 3OL2A 2UZXB 4PC0A 3MKSB 3IKOA 5EMJB 4D6VA 4J82A 3HFQA 5K1CC 3PXSD 4GQBB 4X63B 4PNKB 3A0FA 4CI8A 1OMWB 3I7NA 3V9FA 3U4YA 2AH0A 3I7HA 3UVLA 4J0WA 4ERZA 3ULEC 4GGAA 5EM2A 4QQEA 4AOWA 2P9IC 4A0AB 4U1EI 5EMLB 4CC9A 3RFGA 3W15A 2AGZA 3UKRC 2QXVA 2CN3A 2H68A 4A09B 4A08A 4O1QD 4GQ1A 3JROA 2G99A 4H5JA 4EWRA 1JMZB 5TDHB 3AH8B 2PM6B 3RMZD 1N6EA 5TEEA 3SLED 3C99A 5CXCB 4Y5RD 2XU7A 4L3GD 5EALA 2IWFA 4OWRA 3SJLD 4CI3A 4CY2A 5FXYA 4X3EA 1B9XA 2HJBA 2OVQB 4AEZA 4BL0A 2AGLA 3SMRA 2OVPB 4LG8A 4ZOXA 1TYQC 5I5JA 4ZOZA 4FB1D 1K8KC 1B9YA 2AQ5A 3I8CA 3SBPA 2XYIA 1RI6A 4K3JB 3RRMC 2XL3A 4JSNC 4PBZA 3EI2B 4J0XA 3JRPA 2GC4A 4FA9D 4QRJA 3UVKA 4A7JA 2W18A 4FWWA 3V7DB 2YBAA 4A0AA 1P22A 5KDOB 1GOTB 4A11B 1FWXA 5FA5B 2YMUA 4A09A 2P9LC 5FKQA 4ZN4A 1SQ9A 3P4FA 2J55H 5I5IA 4JT5C 5HQGA 5HYNB 1K32A 2B5NA 3EI1B 3SWSD 3MZLA 4KFMB 5EMMB 3PE7A 4Z8LA 2H9NA 3IIYA 3K26A 1SQJA 2YB8B 3OKYB 1N6DA 1TBGA 4X61B 3OKTA 3DSMA 5H1MA 5SXMA 3FM0A 4JSVC 2I0SA 4ERYA 2EBSA 5FKTA 2H6NA 4TZ4A 4CZYA 1JMXB 2H47A 2Z2NA 3F3FA 4L1QD 3AFCA 4J84A 1MG3A 5HE3B 2CE8A 5TEFA 3L4MD 4PSXB 4J81A 3EI2A 3KRXB 2H9LA 3NVNA 3SBQA 3SXTD 3JB9L 3JAMg 3UKUC 4NSXA 2AGWA 5CXBA 1S4UX 2B5MA 2HYEA 4J86A 4L3HD 2I3SA 4XYIA 3PXWD 3RSEC 2AGYA 4J77A 4A11A 3JPXA 3NVXA 2Q7QA 1NEXB 2H3XA 3PSCB 2H9MA 2UZYB 5EMKB 4Y7RA 3EU7A 2P9PC 3CIKB 2G9AA 2OK4A 2PM9B 2XL2A 2YNOA 3ZWLB 4UI9R 4E5ZB 3UVOA 3DXKC 3SVWD 3RN0D 4G56B 2AH1A 3FGBA 4J8GA 3NVQA 3OKYA 3C5MA 1NR0A 5TF2A 2J57G 2B4EA 2HJ4A 4CZXA 3I7OA 2CN2A 4O3UB 1PEVA 3SCYA 4ES0A 3PVWB 1VYHC 4K3ID 4LG9A 4D0KA 2H13A 2HESX 3I2NA 4PBYA 1GXRA 5I5MA 5AJAA 3EWEA 4O45A 3BG1A 2H6KA 3EMHA 3I7PA 5GXHA 5EAPA 5AFU3 5EAMA 3F3GA 4YVDA 4GM9A 2CE9A 4J78A 3OTTA 2O9KA 2IWKA 1GP2B 2PM9A 1YFQA 1U4CA 2OVRB 2YNPA 4GM8A 2BBKH 4FA5D 4GZ8A 4HDJA 3SN6B 4X60B 2GC7A 5FKSA 1XKSA 1XHMA 2Z2PA 1JJUB 4JSPC 2GNQA 2I3TA 2MTAH 5CXCA 4ZOYA 2PBIB 3DWLC 3C75H 3FRXA 3ORVD 1PBYB 3BWSA 3L4OD 5AMSA 3PVUB 2I0RA 3BG0A 5B4WA 2OJYA 4GQ2P 4JXMA 4FAND 4XEIC 4R7AB 4BH6A 1N6FA 4JD2C 5IT9g 4FA4D 5GMKn 3V5WB 5JWZA 2OIZA 3RFHA 5K19A 4GGDA 4LGNA 2H6QA 3N0EA 3E0CA 5H14A 3DM0A 2CNXA 3N0DA 3CFVA 4J8BA 4JSXC 4CY1A 2AGXA 2IUPA 2P9SC 4GM3A 4ERQA 3MZKA 4J79A 4E54B 2YNNA 1PGUA 3IIWA 1GG2B 4A0BB 5IC7A 4J87A 1SHYB 2CO0A 3GREA 4N14A 4BUJC 4QL1A 3OW8A 4CI1A 4PXWA 3AL9A 4FA1D 4JT6C 3EI1A 3CFSB 3SHFA 3RN1D 3IJ1A 3C9CA 2HKRA 5GXIA 4U7AA 3JZHA 4O3TB 5IGQA 1R5MA 1Q47A 5IJ8E 3EI3B 5HE2B 3VGZA 3UVMA 5IJ7E 2IUQA 3JZGA 2CO0C 5CYKB 3I7LA 2P9NC 3EI4B 3OKWA 2I0TA 3AL8B 3IJCA 3J80g 2P9UC 2B5LA 4XYHA 5A2Qg 5C2VB 2Z2OA 3MXXA 3PXTD 3J81g 2OK6A 5FKRA 4E54A 5FLXg 2HKMA 3B7FA 3DXMC 1L0QA 3SBRA 2H9PA 3GFCA 2IURA 4A0BA 1PI6A 2IAAA 4CY5A 3I89A 3ODTA 5H17A 2TRCB 4IA9A 1ERJA 4GMBA 2QC5A 3VA6A 3UR4A 2P9KC 5C9ZB 3I8EA 5IGOA 4QT8A 3SFZA 4E5ZA 2H14A 3I7KA 3F3PA 5THAA 4FAVD 3OL2B 4CY3A 3IJ0A 1XIPA 4PSWB 4A2LA 3EI3A 2IUVA 5HE1B 5GSAA 4L9OA 2J56H 5CXBB 5CYKA 4O9DA 3EI4A 4A2MA 4CZVA 4MK0B 2BCJB 3AL8A 3UVNA 3MKQA 4CI2A 1A0RB 4ZOVA 1QNIA 3KRWB 5EM2B
chains in the Genus database with same CATH superfamily
2HXCA 3JZNA 5FQDA 3PSLA 3MMYA 4H5IA 3GD1I 1UTCA 1MG2A 5HE0B 1U2VC 4Z7QA 4A08B 4J73A 3T3PA 4OZUA 5EARA 4IMMA 5C2WB 4FHLA 3VH0A 1JOFA 1OLZA 2PM7B 3DDUA 4GGCA 4I79A 4ESGA 3GC3B 3EG6A 1MDAH 4NAAA 4DNUA 3RLMD 3K27A 3OL2A 2UZXB 4PC0A 3MKSB 3ZE1A 3NIDA 4DNVA 3IKOA 3EQ7A 3O4GA 5EMJB 1U8CA 4D6VA 4J82A 3HFQA 5M5RA 5K1CC 3PXSD 4GQBB 4X63B 4PNKB 3A0FA 4CI8A 1OMWB 3I7NA 3V9FA 3U4YA 2AH0A 3I7HA 3UVLA 4J0WA 4ERZA 1QFMA 1VZ3A 3ULEC 4GGAA 5EM2A 3QHYB 4QQEA 4AOWA 3FCUA 2P9IC 3QI0A 4A0AB 4U1EI 5EMLB 4CC9A 3RFGA 3W15A 2AGZA 3UKRC 2QXVA 2CN3A 3K71A 2H68A 4A09B 4A08A 4O1QD 4GQ1A 3JROA 2G99A 4H5JA 4EWRA 1JMZB 5E6UA 5TDHB 4WK2A 3AH8B 4AN0A 2VZ3A 2PM6B 3RMZD 1N6EA 5TEEA 3SLED 3C99A 5CXCB 4Y5RD 2XU7A 4L3GD 5EALA 2IWFA 4OWRA 3SJLD 4CI3A 4CY2A 4D9SA 3MVDK 5FXYA 4X3EA 1B9XA 2HJBA 2OVQB 4AEZA 4BL0A 2AGLA 3SMRA 3VI4A 2OVPB 4LG8A 4ZOXA 1TYQC 5I5JA 4ZOZA 4FB1D 5M5TA 4G55A 1K8KC 1B9YA 2AQ5A 3I8CA 2VDOA 3SBPA 2XYIA 1RI6A 4K3JB 3RRMC 3IJEA 3KCIA 2XL3A 4O2WA 1M1XA 3OF7A 4JSNC 4PBZA 3EI2B 4J0XA 3JRPA 1H2YA 2GC4A 4FA9D 4QRJA 4IRZA 3V4PA 3UVKA 4O02A 4A7JA 2W18A 4FWWA 3V7DB 2YBAA 4A0AA 1K3IA 1P22A 4MMXA 5KDOB 1GOTB 4A11B 1FWXA 3ZDYA 5FA5B 2YMUA 4A09A 2P9LC 5FKQA 4ZN4A 1SQ9A 3EQ8A 3P4FA 2J55H 5I5IA 4JT5C 1VE7A 5HQGA 5HYNB 3K6SA 1K32A 2B5NA 3EI1B 3SWSD 3MZLA 4KFMB 1A12A 1TYEA 3PE7A 5EMMB 4Z8LA 2H9NA 3IIYA 3K26A 1SQJA 2YB8B 3OKYB 4G1EA 1N6DA 1TBGA 5C86A 1C9LA 1H2WA 4X61B 3OKTA 3DSMA 5H1MA 5SXMA 3FM0A 4JSVC 2I0SA 4JHPC 4ERYA 2EBSA 5M61A 5FKTA 2H6NA 4TZ4A 4CZYA 1JMXB 2H47A 2Z2NA 3F3FA 4L1QD 4AX4A 3AFCA 4J84A 1MG3A 5HE3B 2CE8A 5TEFA 3L4MD 1O6GA 4PSXB 4J81A 3EI2A 3KRXB 2H9LA 3NVNA 3SBQA 3SXTD 3JB9L 3JAMg 3UKUC 2VDMA 4NSXA 2AGWA 5CXBA 2VDQA 1S4UX 2B5MA 2HYEA 4J86A 4L3HD 2I3SA 4XYIA 4NBMA 3PXWD 3RSEC 2AGYA 1JV2A 4J77A 4JHNA 4A11A 3JPXA 3NVXA 4G1MA 4BCDA 2Q7QA 1NEXB 2XE4A 5M5SA 1UOOA 2H3XA 4NENA 3PSCB 2H9MA 2UZYB 5EMKB 2VDNA 3EU7A 2P9PC 3CIKB 4Y7RA 2G9AA 2QZPA 2OK4A 2PM9B 2XL2A 2YNOA 3ZWLB 4UI9R 2WQ8A 4E5ZB 3UVOA 3DXKC 3SVWD 3RN0D 4G56B 2AH1A 2EIDA 3FGBA 4J8GA 3MUOA 3NVQA 3OKYA 3C5MA 1NR0A 5TF2A 2J57G 1I2MB 2B4EA 2HJ4A 4CZXA 3I7OA 2VDKA 3NIGA 2CN2A 4O3UB 1PEVA 3SCYA 4MMZA 4ES0A 2VC2A 3PVWB 1VYHC 4K3ID 4LG9A 5E6RA 4D0KA 2H13A 2HESX 3I2NA 4PBYA 1GXRA 5I5MA 4AN1A 5AJAA 3EWEA 4O45A 3BG1A 2H6KA 3EMHA 1GOFA 3I7PA 5GXHA 3O4IA 5EAPA 5AFU3 5EAMA 3F3GA 2HU7A 1UOPA 3MUNA 5M5VA 4UM9A 1T2XA 2HU5A 5M5UA 4YVDA 4GM9A 2CE9A 4BCCA 4J78A 3IUJA 2VZ1A 3OTTA 2VDRA 2O9KA 2IWKA 1GP2B 2PM9A 1YFQA 1U4CA 2OVRB 1E5TA 2YNPA 1BPOA 4GM8A 2BBKH 1O6FA 4FA5D 4GZ8A 4HDJA 1C9IA 3SN6B 4X60B 3ZDXA 2XDWA 2GC7A 5FKSA 1VE6A 1XKSA 1XHMA 5HDBA 2Z2PA 4L1MA 1JJUB 4JSPC 3IURA 2GNQA 2I3TA 4AMZA 4MMYA 2HU8A 2MTAH 5CXCA 4ZOYA 2PBIB 3DWLC 3C75H 3FRXA 3ORVD 1PBYB 3BWSA 3L4OD 5AMSA 3PVUB 2I0RA 3BG0A 5B4WA 2OJYA 4GQ2P 4JXMA 4FAND 4XEIC 4R7AB 4BH6A 1N6FA 4JD2C 3IULA 5IT9g 1E8NA 4FA4D 5GMKn 3V5WB 5JWZA 2OIZA 3RFHA 5K19A 4GGDA 4BP8A 4LGNA 2H6QA 2VDLA 3N0EA 5FFOA 3E0CA 5H14A 3DM0A 2CNXA 3N0DA 3CFVA 3IUNA 4J8BA 4JSXC 4CY1A 3O4HA 2AGXA 2IUPA 2P9SC 4GM3A 4ERQA 3MZKA 4J79A 4E54B 2VDPA 4AMYA 2YNNA 1PGUA 1JTDB 3IIWA 4QAMA 1GG2B 4A0BB 5IC7A 4J87A 1SHYB 2CO0A 4RE6A 3T3MA 3GREA 4N14A 4Z7NA 4BUJC 2EIBA 3OW8A 4QL1A 4CI1A 4WJKA 4PXWA 3AL9A 4FA1D 4JT6C 3EI1A 3IUQA 3CFSB 1L5GA 3SHFA 3RN1D 3IJ1A 3C9CA 2HKRA 5GXIA 4U7AA 3ZE0A 3JZHA 3IVMA 4O3TB 5IGQA 1R5MA 1GOHA 1Q47A 5IJ8E 3EI3B 5HE2B 3VGZA 3O4JA 3UVMA 2XZGA 2BKLA 4BP9A 5IJ7E 5C92A 2IUQA 4BCBA 3ZDZA 3JZGA 2CO0C 5CYKB 3I7LA 3VI3A 4Z7OA 2P9NC 4WK4A 3EI4B 3OKWA 2I0TA 3AL8B 3IJCA 3J80g 2P9UC 2B5LA 4XYHA 5A2Qg 2JKXA 2Z2OA 2EICA 3MXXA 5C2VB 3PXTD 3J81g 2OK6A 5FKRA 4E54A 5FLXg 4NC4A 2HKMA 3B7FA 3NIFA 3DXMC 1L0QA 3SBRA 2H9PA 3GFCA 2IURA 4A0BA 1PI6A 1VZ2A 1H2XA 2IAAA 4CY5A 3V4VA 3I89A 4DNWA 3ODTA 5E6SA 5H17A 3EQ9A 2TRCB 4IA9A 1ERJA 4UM8A 4GMBA 2QC5A 3VA6A 3UR4A 2P9KC 5C9ZB 3I8EA 5IGOA 4QT8A 1E8MA 3SFZA 4E5ZA 2H14A 3I7KA 2EIEA 3F3PA 5FFGA 5THAA 4FAVD 3OL2B 4CY3A 3IJ0A 1UOQA 1XIPA 4PSWB 4A2LA 3EI3A 2IUVA 1H2ZA 3IUMA 3FCSA 4WK0A 5HE1B 5GSAA 4L9OA 2J56H 5CXBB 3K72A 5CYKA 4O9DA 3ZE2A 3EI4A 4A2MA 2QR5A 4CZVA 4MK0B 4RE5A 2BCJB 3AL8A 3UVNA 3MKQA 4CI2A 1A0RB 4ZOVA 1GOGA 1YR2A 1QFSA 1QNIA 3KRWB 5EM2B
chains in the Genus database with same CATH topology
2HXCA 3JZNA 5FQDA 3PSLA 3MMYA 4H5IA 1MG2A 5HE0B 1U2VC 4A08B 4J73A 4OZUA 5EARA 4IMMA 5C2WB 4FHLA 3VH0A 1JOFA 1OLZA 2PM7B 4GGCA 4I79A 4ESGA 3EG6A 1MDAH 3RLMD 3K27A 3OL2A 2UZXB 4PC0A 3MKSB 3IKOA 5EMJB 4D6VA 4J82A 3HFQA 5K1CC 3PXSD 4GQBB 4X63B 4PNKB 3A0FA 4CI8A 1OMWB 3I7NA 3V9FA 3U4YA 2AH0A 3I7HA 3UVLA 4J0WA 4ERZA 3ULEC 4GGAA 5EM2A 4QQEA 4AOWA 2P9IC 4A0AB 4U1EI 5EMLB 4CC9A 3RFGA 3W15A 2AGZA 3UKRC 2QXVA 2CN3A 2H68A 4A09B 4A08A 4O1QD 4GQ1A 3JROA 2G99A 4H5JA 4EWRA 1JMZB 5TDHB 3AH8B 2PM6B 3RMZD 1N6EA 5TEEA 3SLED 3C99A 5CXCB 4Y5RD 2XU7A 4L3GD 5EALA 2IWFA 4OWRA 3SJLD 4CI3A 4CY2A 5FXYA 4X3EA 1B9XA 2HJBA 2OVQB 4AEZA 4BL0A 2AGLA 3SMRA 2OVPB 4LG8A 4ZOXA 1TYQC 5I5JA 4ZOZA 4FB1D 1K8KC 1B9YA 2AQ5A 3I8CA 3SBPA 2XYIA 1RI6A 4K3JB 3RRMC 2XL3A 4JSNC 4PBZA 3EI2B 4J0XA 3JRPA 2GC4A 4FA9D 4QRJA 3UVKA 4A7JA 2W18A 4FWWA 3V7DB 2YBAA 4A0AA 1P22A 5KDOB 1GOTB 4A11B 1FWXA 5FA5B 2YMUA 4A09A 2P9LC 5FKQA 4ZN4A 1SQ9A 3P4FA 2J55H 5I5IA 4JT5C 5HQGA 5HYNB 1K32A 2B5NA 3EI1B 3SWSD 3MZLA 4KFMB 5EMMB 3PE7A 4Z8LA 2H9NA 3IIYA 3K26A 1SQJA 2YB8B 3OKYB 1N6DA 1TBGA 4X61B 3OKTA 3DSMA 5H1MA 5SXMA 3FM0A 4JSVC 2I0SA 4ERYA 2EBSA 5FKTA 2H6NA 4TZ4A 4CZYA 1JMXB 2H47A 2Z2NA 3F3FA 4L1QD 3AFCA 4J84A 1MG3A 5HE3B 2CE8A 5TEFA 3L4MD 4PSXB 4J81A 3EI2A 3KRXB 2H9LA 3NVNA 3SBQA 3SXTD 3JB9L 3JAMg 3UKUC 4NSXA 2AGWA 5CXBA 1S4UX 2B5MA 2HYEA 4J86A 4L3HD 2I3SA 4XYIA 3PXWD 3RSEC 2AGYA 4J77A 4A11A 3JPXA 3NVXA 2Q7QA 1NEXB 2H3XA 3PSCB 2H9MA 2UZYB 5EMKB 4Y7RA 3EU7A 2P9PC 3CIKB 2G9AA 2OK4A 2PM9B 2XL2A 2YNOA 3ZWLB 4UI9R 4E5ZB 3UVOA 3DXKC 3SVWD 3RN0D 4G56B 2AH1A 3FGBA 4J8GA 3NVQA 3OKYA 3C5MA 1NR0A 5TF2A 2J57G 2B4EA 2HJ4A 4CZXA 3I7OA 2CN2A 4O3UB 1PEVA 3SCYA 4ES0A 3PVWB 1VYHC 4K3ID 4LG9A 4D0KA 2H13A 2HESX 3I2NA 4PBYA 1GXRA 5I5MA 5AJAA 3EWEA 4O45A 3BG1A 2H6KA 3EMHA 3I7PA 5GXHA 5EAPA 5AFU3 5EAMA 3F3GA 4YVDA 4GM9A 2CE9A 4J78A 3OTTA 2O9KA 2IWKA 1GP2B 2PM9A 1YFQA 1U4CA 2OVRB 2YNPA 4GM8A 2BBKH 4FA5D 4GZ8A 4HDJA 3SN6B 4X60B 2GC7A 5FKSA 1XKSA 1XHMA 2Z2PA 1JJUB 4JSPC 2GNQA 2I3TA 2MTAH 5CXCA 4ZOYA 2PBIB 3DWLC 3C75H 3FRXA 3ORVD 1PBYB 3BWSA 3L4OD 5AMSA 3PVUB 2I0RA 3BG0A 5B4WA 2OJYA 4GQ2P 4JXMA 4FAND 4XEIC 4R7AB 4BH6A 1N6FA 4JD2C 5IT9g 4FA4D 5GMKn 3V5WB 5JWZA 2OIZA 3RFHA 5K19A 4GGDA 4LGNA 2H6QA 3N0EA 3E0CA 5H14A 3DM0A 2CNXA 3N0DA 3CFVA 4J8BA 4JSXC 4CY1A 2AGXA 2IUPA 2P9SC 4GM3A 4ERQA 3MZKA 4J79A 4E54B 2YNNA 1PGUA 3IIWA 1GG2B 4A0BB 5IC7A 4J87A 1SHYB 2CO0A 3GREA 4N14A 4BUJC 4QL1A 3OW8A 4CI1A 4PXWA 3AL9A 4FA1D 4JT6C 3EI1A 3CFSB 3SHFA 3RN1D 3IJ1A 3C9CA 2HKRA 5GXIA 4U7AA 3JZHA 4O3TB 5IGQA 1R5MA 1Q47A 5IJ8E 3EI3B 5HE2B 3VGZA 3UVMA 5IJ7E 2IUQA 3JZGA 2CO0C 5CYKB 3I7LA 2P9NC 3EI4B 3OKWA 2I0TA 3AL8B 3IJCA 3J80g 2P9UC 2B5LA 4XYHA 5A2Qg 5C2VB 2Z2OA 3MXXA 3PXTD 3J81g 2OK6A 5FKRA 4E54A 5FLXg 2HKMA 3B7FA 3DXMC 1L0QA 3SBRA 2H9PA 3GFCA 2IURA 4A0BA 1PI6A 2IAAA 4CY5A 3I89A 3ODTA 5H17A 2TRCB 4IA9A 1ERJA 4GMBA 2QC5A 3VA6A 3UR4A 2P9KC 5C9ZB 3I8EA 5IGOA 4QT8A 3SFZA 4E5ZA 2H14A 3I7KA 3F3PA 5THAA 4FAVD 3OL2B 4CY3A 3IJ0A 1XIPA 4PSWB 4A2LA 3EI3A 2IUVA 5HE1B 5GSAA 4L9OA 2J56H 5CXBB 5CYKA 4O9DA 3EI4A 4A2MA 4CZVA 4MK0B 2BCJB 3AL8A 3UVNA 3MKQA 4CI2A 1A0RB 4ZOVA 1QNIA 3KRWB 5EM2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXC A;  3JZN A;  5FQD A;  3PSL A;  3MMY A;  4H5I A;  1MG2 A;  5HE0 B;  1U2V C;  4A08 B;  4J73 A;  4OZU A;  5EAR A;  4IMM A;  5C2W B;  4FHL A;  3VH0 A;  1JOF A;  1OLZ A;  2PM7 B;  4GGC A;  4I79 A;  4ESG A;  3EG6 A;  1MDA H;  3RLM D;  3K27 A;  3OL2 A;  2UZX B;  4PC0 A;  3MKS B;  3IKO A;  5EMJ B;  4D6V A;  4J82 A;  3HFQ A;  5K1C C;  3PXS D;  4GQB B;  4X63 B;  4PNK B;  3A0F A;  4CI8 A;  1OMW B;  3I7N A;  3V9F A;  3U4Y A;  2AH0 A;  3I7H A;  3UVL A;  4J0W A;  4ERZ A;  3ULE C;  4GGA A;  5EM2 A;  4QQE A;  4AOW A;  2P9I C;  4A0A B;  4U1E I;  5EML B;  4CC9 A;  3RFG A;  3W15 A;  2AGZ A;  3UKR C;  2QXV A;  2CN3 A;  2H68 A;  4A09 B;  4A08 A;  4O1Q D;  4GQ1 A;  3JRO A;  2G99 A;  4H5J A;  4EWR A;  1JMZ B;  5TDH B;  3AH8 B;  2PM6 B;  3RMZ D;  1N6E A;  5TEE A;  3SLE D;  3C99 A;  5CXC B;  4Y5R D;  2XU7 A;  4L3G D;  5EAL A;  2IWF A;  4OWR A;  3SJL D;  4CI3 A;  4CY2 A;  5FXY A;  4X3E A;  1B9X A;  2HJB A;  2OVQ B;  4AEZ A;  4BL0 A;  2AGL A;  3SMR A;  2OVP B;  4LG8 A;  4ZOX A;  1TYQ C;  5I5J A;  4ZOZ A;  4FB1 D;  1K8K C;  1B9Y A;  2AQ5 A;  3I8C A;  3SBP A;  2XYI A;  1RI6 A;  4K3J B;  3RRM C;  2XL3 A;  4JSN C;  4PBZ A;  3EI2 B;  4J0X A;  3JRP A;  2GC4 A;  4FA9 D;  4QRJ A;  3UVK A;  4A7J A;  2W18 A;  4FWW A;  3V7D B;  2YBA A;  4A0A A;  1P22 A;  5KDO B;  1GOT B;  4A11 B;  1FWX A;  5FA5 B;  2YMU A;  4A09 A;  2P9L C;  5FKQ A;  4ZN4 A;  1SQ9 A;  3P4F A;  2J55 H;  5I5I A;  4JT5 C;  5HQG A;  5HYN B;  1K32 A;  2B5N A;  3EI1 B;  3SWS D;  3MZL A;  4KFM B;  5EMM B;  3PE7 A;  4Z8L A;  2H9N A;  3IIY A;  3K26 A;  1SQJ A;  2YB8 B;  3OKY B;  1N6D A;  1TBG A;  4X61 B;  3OKT A;  3DSM A;  5H1M A;  5SXM A;  3FM0 A;  4JSV C;  2I0S A;  4ERY A;  2EBS A;  5FKT A;  2H6N A;  4TZ4 A;  4CZY A;  1JMX B;  2H47 A;  2Z2N A;  3F3F A;  4L1Q D;  3AFC A;  4J84 A;  1MG3 A;  5HE3 B;  2CE8 A;  5TEF A;  3L4M D;  4PSX B;  4J81 A;  3EI2 A;  3KRX B;  2H9L A;  3NVN A;  3SBQ A;  3SXT D;  3JB9 L;  3JAM g;  3UKU C;  4NSX A;  2AGW A;  5CXB A;  1S4U X;  2B5M A;  2HYE A;  4J86 A;  4L3H D;  2I3S A;  4XYI A;  3PXW D;  3RSE C;  2AGY A;  4J77 A;  4A11 A;  3JPX A;  3NVX A;  2Q7Q A;  1NEX B;  2H3X A;  3PSC B;  2H9M A;  2UZY B;  5EMK B;  4Y7R A;  3EU7 A;  2P9P C;  3CIK B;  2G9A A;  2OK4 A;  2PM9 B;  2XL2 A;  2YNO A;  3ZWL B;  4UI9 R;  4E5Z B;  3UVO A;  3DXK C;  3SVW D;  3RN0 D;  4G56 B;  2AH1 A;  3FGB A;  4J8G A;  3NVQ A;  3OKY A;  3C5M A;  1NR0 A;  5TF2 A;  2J57 G;  2B4E A;  2HJ4 A;  4CZX A;  3I7O A;  2CN2 A;  4O3U B;  1PEV A;  3SCY A;  4ES0 A;  3PVW B;  1VYH C;  4K3I D;  4LG9 A;  4D0K A;  2H13 A;  2HES X;  3I2N A;  4PBY A;  1GXR A;  5I5M A;  5AJA A;  3EWE A;  4O45 A;  3BG1 A;  2H6K A;  3EMH A;  3I7P A;  5GXH A;  5EAP A;  5AFU 3;  5EAM A;  3F3G A;  4YVD A;  4GM9 A;  2CE9 A;  4J78 A;  3OTT A;  2O9K A;  2IWK A;  1GP2 B;  2PM9 A;  1YFQ A;  1U4C A;  2OVR B;  2YNP A;  4GM8 A;  2BBK H;  4FA5 D;  4GZ8 A;  4HDJ A;  3SN6 B;  4X60 B;  2GC7 A;  5FKS A;  1XKS A;  1XHM A;  2Z2P A;  1JJU B;  4JSP C;  2GNQ A;  2I3T A;  2MTA H;  5CXC A;  4ZOY A;  2PBI B;  3DWL C;  3C75 H;  3FRX A;  3ORV D;  1PBY B;  3BWS A;  3L4O D;  5AMS A;  3PVU B;  2I0R A;  3BG0 A;  5B4W A;  2OJY A;  4GQ2 P;  4JXM A;  4FAN D;  4XEI C;  4R7A B;  4BH6 A;  1N6F A;  4JD2 C;  5IT9 g;  4FA4 D;  5GMK n;  3V5W B;  5JWZ A;  2OIZ A;  3RFH A;  5K19 A;  4GGD A;  4LGN A;  2H6Q A;  3N0E A;  3E0C A;  5H14 A;  3DM0 A;  2CNX A;  3N0D A;  3CFV A;  4J8B A;  4JSX C;  4CY1 A;  2AGX A;  2IUP A;  2P9S C;  4GM3 A;  4ERQ A;  3MZK A;  4J79 A;  4E54 B;  2YNN A;  1PGU A;  3IIW A;  1GG2 B;  4A0B B;  5IC7 A;  4J87 A;  1SHY B;  2CO0 A;  3GRE A;  4N14 A;  4BUJ C;  4QL1 A;  3OW8 A;  4CI1 A;  4PXW A;  3AL9 A;  4FA1 D;  4JT6 C;  3EI1 A;  3CFS B;  3SHF A;  3RN1 D;  3IJ1 A;  3C9C A;  2HKR A;  5GXI A;  4U7A A;  3JZH A;  4O3T B;  5IGQ A;  1R5M A;  1Q47 A;  5IJ8 E;  3EI3 B;  5HE2 B;  3VGZ A;  3UVM A;  5IJ7 E;  2IUQ A;  3JZG A;  2CO0 C;  5CYK B;  3I7L A;  2P9N C;  3EI4 B;  3OKW A;  2I0T A;  3AL8 B;  3IJC A;  3J80 g;  2P9U C;  2B5L A;  4XYH A;  5A2Q g;  5C2V B;  2Z2O A;  3MXX A;  3PXT D;  3J81 g;  2OK6 A;  5FKR A;  4E54 A;  5FLX g;  2HKM A;  3B7F A;  3DXM C;  1L0Q A;  3SBR A;  2H9P A;  3GFC A;  2IUR A;  4A0B A;  1PI6 A;  2IAA A;  4CY5 A;  3I89 A;  3ODT A;  5H17 A;  2TRC B;  4IA9 A;  1ERJ A;  4GMB A;  2QC5 A;  3VA6 A;  3UR4 A;  2P9K C;  5C9Z B;  3I8E A;  5IGO A;  4QT8 A;  3SFZ A;  4E5Z A;  2H14 A;  3I7K A;  3F3P A;  5THA A;  4FAV D;  3OL2 B;  4CY3 A;  3IJ0 A;  1XIP A;  4PSW B;  4A2L A;  3EI3 A;  2IUV A;  5HE1 B;  5GSA A;  4L9O A;  2J56 H;  5CXB B;  5CYK A;  4O9D A;  3EI4 A;  4A2M A;  4CZV A;  4MK0 B;  2BCJ B;  3AL8 A;  3UVN A;  3MKQ A;  4CI2 A;  1A0R B;  4ZOV A;  1QNI A;  3KRW B;  5EM2 B; 
#chains in the Genus database with same CATH topology
 2HXC A;  3JZN A;  5FQD A;  3PSL A;  3MMY A;  4H5I A;  3GD1 I;  1UTC A;  1MG2 A;  5HE0 B;  1U2V C;  4Z7Q A;  4A08 B;  4J73 A;  3T3P A;  4OZU A;  5EAR A;  4IMM A;  5C2W B;  4FHL A;  3VH0 A;  1JOF A;  1OLZ A;  2PM7 B;  3DDU A;  4GGC A;  4I79 A;  4ESG A;  3GC3 B;  3EG6 A;  1MDA H;  4NAA A;  4DNU A;  3RLM D;  3K27 A;  3OL2 A;  2UZX B;  4PC0 A;  3MKS B;  3ZE1 A;  3NID A;  4DNV A;  3IKO A;  3EQ7 A;  3O4G A;  5EMJ B;  1U8C A;  4D6V A;  4J82 A;  3HFQ A;  5M5R A;  5K1C C;  3PXS D;  4GQB B;  4X63 B;  4PNK B;  3A0F A;  4CI8 A;  1OMW B;  3I7N A;  3V9F A;  3U4Y A;  2AH0 A;  3I7H A;  3UVL A;  4J0W A;  4ERZ A;  1QFM A;  1VZ3 A;  3ULE C;  4GGA A;  5EM2 A;  3QHY B;  4QQE A;  4AOW A;  3FCU A;  2P9I C;  3QI0 A;  4A0A B;  4U1E I;  5EML B;  4CC9 A;  3RFG A;  3W15 A;  2AGZ A;  3UKR C;  2QXV A;  2CN3 A;  3K71 A;  2H68 A;  4A09 B;  4A08 A;  4O1Q D;  4GQ1 A;  3JRO A;  2G99 A;  4H5J A;  4EWR A;  1JMZ B;  5E6U A;  5TDH B;  4WK2 A;  3AH8 B;  4AN0 A;  2VZ3 A;  2PM6 B;  3RMZ D;  1N6E A;  5TEE A;  3SLE D;  3C99 A;  5CXC B;  4Y5R D;  2XU7 A;  4L3G D;  5EAL A;  2IWF A;  4OWR A;  3SJL D;  4CI3 A;  4CY2 A;  4D9S A;  3MVD K;  5FXY A;  4X3E A;  1B9X A;  2HJB A;  2OVQ B;  4AEZ A;  4BL0 A;  2AGL A;  3SMR A;  3VI4 A;  2OVP B;  4LG8 A;  4ZOX A;  1TYQ C;  5I5J A;  4ZOZ A;  4FB1 D;  5M5T A;  4G55 A;  1K8K C;  1B9Y A;  2AQ5 A;  3I8C A;  2VDO A;  3SBP A;  2XYI A;  1RI6 A;  4K3J B;  3RRM C;  3IJE A;  3KCI A;  2XL3 A;  4O2W A;  1M1X A;  3OF7 A;  4JSN C;  4PBZ A;  3EI2 B;  4J0X A;  3JRP A;  1H2Y A;  2GC4 A;  4FA9 D;  4QRJ A;  4IRZ A;  3V4P A;  3UVK A;  4O02 A;  4A7J A;  2W18 A;  4FWW A;  3V7D B;  2YBA A;  4A0A A;  1K3I A;  1P22 A;  4MMX A;  5KDO B;  1GOT B;  4A11 B;  1FWX A;  3ZDY A;  5FA5 B;  2YMU A;  4A09 A;  2P9L C;  5FKQ A;  4ZN4 A;  1SQ9 A;  3EQ8 A;  3P4F A;  2J55 H;  5I5I A;  4JT5 C;  1VE7 A;  5HQG A;  5HYN B;  3K6S A;  1K32 A;  2B5N A;  3EI1 B;  3SWS D;  3MZL A;  4KFM B;  1A12 A;  1TYE A;  3PE7 A;  5EMM B;  4Z8L A;  2H9N A;  3IIY A;  3K26 A;  1SQJ A;  2YB8 B;  3OKY B;  4G1E A;  1N6D A;  1TBG A;  5C86 A;  1C9L A;  1H2W A;  4X61 B;  3OKT A;  3DSM A;  5H1M A;  5SXM A;  3FM0 A;  4JSV C;  2I0S A;  4JHP C;  4ERY A;  2EBS A;  5M61 A;  5FKT A;  2H6N A;  4TZ4 A;  4CZY A;  1JMX B;  2H47 A;  2Z2N A;  3F3F A;  4L1Q D;  4AX4 A;  3AFC A;  4J84 A;  1MG3 A;  5HE3 B;  2CE8 A;  5TEF A;  3L4M D;  1O6G A;  4PSX B;  4J81 A;  3EI2 A;  3KRX B;  2H9L A;  3NVN A;  3SBQ A;  3SXT D;  3JB9 L;  3JAM g;  3UKU C;  2VDM A;  4NSX A;  2AGW A;  5CXB A;  2VDQ A;  1S4U X;  2B5M A;  2HYE A;  4J86 A;  4L3H D;  2I3S A;  4XYI A;  4NBM A;  3PXW D;  3RSE C;  2AGY A;  1JV2 A;  4J77 A;  4JHN A;  4A11 A;  3JPX A;  3NVX A;  4G1M A;  4BCD A;  2Q7Q A;  1NEX B;  2XE4 A;  5M5S A;  1UOO A;  2H3X A;  4NEN A;  3PSC B;  2H9M A;  2UZY B;  5EMK B;  2VDN A;  3EU7 A;  2P9P C;  3CIK B;  4Y7R A;  2G9A A;  2QZP A;  2OK4 A;  2PM9 B;  2XL2 A;  2YNO A;  3ZWL B;  4UI9 R;  2WQ8 A;  4E5Z B;  3UVO A;  3DXK C;  3SVW D;  3RN0 D;  4G56 B;  2AH1 A;  2EID A;  3FGB A;  4J8G A;  3MUO A;  3NVQ A;  3OKY A;  3C5M A;  1NR0 A;  5TF2 A;  2J57 G;  1I2M B;  2B4E A;  2HJ4 A;  4CZX A;  3I7O A;  2VDK A;  3NIG A;  2CN2 A;  4O3U B;  1PEV A;  3SCY A;  4MMZ A;  4ES0 A;  2VC2 A;  3PVW B;  1VYH C;  4K3I D;  4LG9 A;  5E6R A;  4D0K A;  2H13 A;  2HES X;  3I2N A;  4PBY A;  1GXR A;  5I5M A;  4AN1 A;  5AJA A;  3EWE A;  4O45 A;  3BG1 A;  2H6K A;  3EMH A;  1GOF A;  3I7P A;  5GXH A;  3O4I A;  5EAP A;  5AFU 3;  5EAM A;  3F3G A;  2HU7 A;  1UOP A;  3MUN A;  5M5V A;  4UM9 A;  1T2X A;  2HU5 A;  5M5U A;  4YVD A;  4GM9 A;  2CE9 A;  4BCC A;  4J78 A;  3IUJ A;  2VZ1 A;  3OTT A;  2VDR A;  2O9K A;  2IWK A;  1GP2 B;  2PM9 A;  1YFQ A;  1U4C A;  2OVR B;  1E5T A;  2YNP A;  1BPO A;  4GM8 A;  2BBK H;  1O6F A;  4FA5 D;  4GZ8 A;  4HDJ A;  1C9I A;  3SN6 B;  4X60 B;  3ZDX A;  2XDW A;  2GC7 A;  5FKS A;  1VE6 A;  1XKS A;  1XHM A;  5HDB A;  2Z2P A;  4L1M A;  1JJU B;  4JSP C;  3IUR A;  2GNQ A;  2I3T A;  4AMZ A;  4MMY A;  2HU8 A;  2MTA H;  5CXC A;  4ZOY A;  2PBI B;  3DWL C;  3C75 H;  3FRX A;  3ORV D;  1PBY B;  3BWS A;  3L4O D;  5AMS A;  3PVU B;  2I0R A;  3BG0 A;  5B4W A;  2OJY A;  4GQ2 P;  4JXM A;  4FAN D;  4XEI C;  4R7A B;  4BH6 A;  1N6F A;  4JD2 C;  3IUL A;  5IT9 g;  1E8N A;  4FA4 D;  5GMK n;  3V5W B;  5JWZ A;  2OIZ A;  3RFH A;  5K19 A;  4GGD A;  4BP8 A;  4LGN A;  2H6Q A;  2VDL A;  3N0E A;  5FFO A;  3E0C A;  5H14 A;  3DM0 A;  2CNX A;  3N0D A;  3CFV A;  3IUN A;  4J8B A;  4JSX C;  4CY1 A;  3O4H A;  2AGX A;  2IUP A;  2P9S C;  4GM3 A;  4ERQ A;  3MZK A;  4J79 A;  4E54 B;  2VDP A;  4AMY A;  2YNN A;  1PGU A;  1JTD B;  3IIW A;  4QAM A;  1GG2 B;  4A0B B;  5IC7 A;  4J87 A;  1SHY B;  2CO0 A;  4RE6 A;  3T3M A;  3GRE A;  4N14 A;  4Z7N A;  4BUJ C;  2EIB A;  3OW8 A;  4QL1 A;  4CI1 A;  4WJK A;  4PXW A;  3AL9 A;  4FA1 D;  4JT6 C;  3EI1 A;  3IUQ A;  3CFS B;  1L5G A;  3SHF A;  3RN1 D;  3IJ1 A;  3C9C A;  2HKR A;  5GXI A;  4U7A A;  3ZE0 A;  3JZH A;  3IVM A;  4O3T B;  5IGQ A;  1R5M A;  1GOH A;  1Q47 A;  5IJ8 E;  3EI3 B;  5HE2 B;  3VGZ A;  3O4J A;  3UVM A;  2XZG A;  2BKL A;  4BP9 A;  5IJ7 E;  5C92 A;  2IUQ A;  4BCB A;  3ZDZ A;  3JZG A;  2CO0 C;  5CYK B;  3I7L A;  3VI3 A;  4Z7O A;  2P9N C;  4WK4 A;  3EI4 B;  3OKW A;  2I0T A;  3AL8 B;  3IJC A;  3J80 g;  2P9U C;  2B5L A;  4XYH A;  5A2Q g;  2JKX A;  2Z2O A;  2EIC A;  3MXX A;  5C2V B;  3PXT D;  3J81 g;  2OK6 A;  5FKR A;  4E54 A;  5FLX g;  4NC4 A;  2HKM A;  3B7F A;  3NIF A;  3DXM C;  1L0Q A;  3SBR A;  2H9P A;  3GFC A;  2IUR A;  4A0B A;  1PI6 A;  1VZ2 A;  1H2X A;  2IAA A;  4CY5 A;  3V4V A;  3I89 A;  4DNW A;  3ODT A;  5E6S A;  5H17 A;  3EQ9 A;  2TRC B;  4IA9 A;  1ERJ A;  4UM8 A;  4GMB A;  2QC5 A;  3VA6 A;  3UR4 A;  2P9K C;  5C9Z B;  3I8E A;  5IGO A;  4QT8 A;  1E8M A;  3SFZ A;  4E5Z A;  2H14 A;  3I7K A;  2EIE A;  3F3P A;  5FFG A;  5THA A;  4FAV D;  3OL2 B;  4CY3 A;  3IJ0 A;  1UOQ A;  1XIP A;  4PSW B;  4A2L A;  3EI3 A;  2IUV A;  1H2Z A;  3IUM A;  3FCS A;  4WK0 A;  5HE1 B;  5GSA A;  4L9O A;  2J56 H;  5CXB B;  3K72 A;  5CYK A;  4O9D A;  3ZE2 A;  3EI4 A;  4A2M A;  2QR5 A;  4CZV A;  4MK0 B;  4RE5 A;  2BCJ B;  3AL8 A;  3UVN A;  3MKQ A;  4CI2 A;  1A0R B;  4ZOV A;  1GOG A;  1YR2 A;  1QFS A;  1QNI A;  3KRW B;  5EM2 B; 
#chains in the Genus database with same CATH homology
 2HXC A;  3JZN A;  5FQD A;  3PSL A;  3MMY A;  4H5I A;  1MG2 A;  5HE0 B;  1U2V C;  4A08 B;  4J73 A;  4OZU A;  5EAR A;  4IMM A;  5C2W B;  4FHL A;  3VH0 A;  1JOF A;  1OLZ A;  2PM7 B;  4GGC A;  4I79 A;  4ESG A;  3EG6 A;  1MDA H;  3RLM D;  3K27 A;  3OL2 A;  2UZX B;  4PC0 A;  3MKS B;  3IKO A;  5EMJ B;  4D6V A;  4J82 A;  3HFQ A;  5K1C C;  3PXS D;  4GQB B;  4X63 B;  4PNK B;  3A0F A;  4CI8 A;  1OMW B;  3I7N A;  3V9F A;  3U4Y A;  2AH0 A;  3I7H A;  3UVL A;  4J0W A;  4ERZ A;  3ULE C;  4GGA A;  5EM2 A;  4QQE A;  4AOW A;  2P9I C;  4A0A B;  4U1E I;  5EML B;  4CC9 A;  3RFG A;  3W15 A;  2AGZ A;  3UKR C;  2QXV A;  2CN3 A;  2H68 A;  4A09 B;  4A08 A;  4O1Q D;  4GQ1 A;  3JRO A;  2G99 A;  4H5J A;  4EWR A;  1JMZ B;  5TDH B;  3AH8 B;  2PM6 B;  3RMZ D;  1N6E A;  5TEE A;  3SLE D;  3C99 A;  5CXC B;  4Y5R D;  2XU7 A;  4L3G D;  5EAL A;  2IWF A;  4OWR A;  3SJL D;  4CI3 A;  4CY2 A;  5FXY A;  4X3E A;  1B9X A;  2HJB A;  2OVQ B;  4AEZ A;  4BL0 A;  2AGL A;  3SMR A;  2OVP B;  4LG8 A;  4ZOX A;  1TYQ C;  5I5J A;  4ZOZ A;  4FB1 D;  1K8K C;  1B9Y A;  2AQ5 A;  3I8C A;  3SBP A;  2XYI A;  1RI6 A;  4K3J B;  3RRM C;  2XL3 A;  4JSN C;  4PBZ A;  3EI2 B;  4J0X A;  3JRP A;  2GC4 A;  4FA9 D;  4QRJ A;  3UVK A;  4A7J A;  2W18 A;  4FWW A;  3V7D B;  2YBA A;  4A0A A;  1P22 A;  5KDO B;  1GOT B;  4A11 B;  1FWX A;  5FA5 B;  2YMU A;  4A09 A;  2P9L C;  5FKQ A;  4ZN4 A;  1SQ9 A;  3P4F A;  2J55 H;  5I5I A;  4JT5 C;  5HQG A;  5HYN B;  1K32 A;  2B5N A;  3EI1 B;  3SWS D;  3MZL A;  4KFM B;  5EMM B;  3PE7 A;  4Z8L A;  2H9N A;  3IIY A;  3K26 A;  1SQJ A;  2YB8 B;  3OKY B;  1N6D A;  1TBG A;  4X61 B;  3OKT A;  3DSM A;  5H1M A;  5SXM A;  3FM0 A;  4JSV C;  2I0S A;  4ERY A;  2EBS A;  5FKT A;  2H6N A;  4TZ4 A;  4CZY A;  1JMX B;  2H47 A;  2Z2N A;  3F3F A;  4L1Q D;  3AFC A;  4J84 A;  1MG3 A;  5HE3 B;  2CE8 A;  5TEF A;  3L4M D;  4PSX B;  4J81 A;  3EI2 A;  3KRX B;  2H9L A;  3NVN A;  3SBQ A;  3SXT D;  3JB9 L;  3JAM g;  3UKU C;  4NSX A;  2AGW A;  5CXB A;  1S4U X;  2B5M A;  2HYE A;  4J86 A;  4L3H D;  2I3S A;  4XYI A;  3PXW D;  3RSE C;  2AGY A;  4J77 A;  4A11 A;  3JPX A;  3NVX A;  2Q7Q A;  1NEX B;  2H3X A;  3PSC B;  2H9M A;  2UZY B;  5EMK B;  4Y7R A;  3EU7 A;  2P9P C;  3CIK B;  2G9A A;  2OK4 A;  2PM9 B;  2XL2 A;  2YNO A;  3ZWL B;  4UI9 R;  4E5Z B;  3UVO A;  3DXK C;  3SVW D;  3RN0 D;  4G56 B;  2AH1 A;  3FGB A;  4J8G A;  3NVQ A;  3OKY A;  3C5M A;  1NR0 A;  5TF2 A;  2J57 G;  2B4E A;  2HJ4 A;  4CZX A;  3I7O A;  2CN2 A;  4O3U B;  1PEV A;  3SCY A;  4ES0 A;  3PVW B;  1VYH C;  4K3I D;  4LG9 A;  4D0K A;  2H13 A;  2HES X;  3I2N A;  4PBY A;  1GXR A;  5I5M A;  5AJA A;  3EWE A;  4O45 A;  3BG1 A;  2H6K A;  3EMH A;  3I7P A;  5GXH A;  5EAP A;  5AFU 3;  5EAM A;  3F3G A;  4YVD A;  4GM9 A;  2CE9 A;  4J78 A;  3OTT A;  2O9K A;  2IWK A;  1GP2 B;  2PM9 A;  1YFQ A;  1U4C A;  2OVR B;  2YNP A;  4GM8 A;  2BBK H;  4FA5 D;  4GZ8 A;  4HDJ A;  3SN6 B;  4X60 B;  2GC7 A;  5FKS A;  1XKS A;  1XHM A;  2Z2P A;  1JJU B;  4JSP C;  2GNQ A;  2I3T A;  2MTA H;  5CXC A;  4ZOY A;  2PBI B;  3DWL C;  3C75 H;  3FRX A;  3ORV D;  1PBY B;  3BWS A;  3L4O D;  5AMS A;  3PVU B;  2I0R A;  3BG0 A;  5B4W A;  2OJY A;  4GQ2 P;  4JXM A;  4FAN D;  4XEI C;  4R7A B;  4BH6 A;  1N6F A;  4JD2 C;  5IT9 g;  4FA4 D;  5GMK n;  3V5W B;  5JWZ A;  2OIZ A;  3RFH A;  5K19 A;  4GGD A;  4LGN A;  2H6Q A;  3N0E A;  3E0C A;  5H14 A;  3DM0 A;  2CNX A;  3N0D A;  3CFV A;  4J8B A;  4JSX C;  4CY1 A;  2AGX A;  2IUP A;  2P9S C;  4GM3 A;  4ERQ A;  3MZK A;  4J79 A;  4E54 B;  2YNN A;  1PGU A;  3IIW A;  1GG2 B;  4A0B B;  5IC7 A;  4J87 A;  1SHY B;  2CO0 A;  3GRE A;  4N14 A;  4BUJ C;  4QL1 A;  3OW8 A;  4CI1 A;  4PXW A;  3AL9 A;  4FA1 D;  4JT6 C;  3EI1 A;  3CFS B;  3SHF A;  3RN1 D;  3IJ1 A;  3C9C A;  2HKR A;  5GXI A;  4U7A A;  3JZH A;  4O3T B;  5IGQ A;  1R5M A;  1Q47 A;  5IJ8 E;  3EI3 B;  5HE2 B;  3VGZ A;  3UVM A;  5IJ7 E;  2IUQ A;  3JZG A;  2CO0 C;  5CYK B;  3I7L A;  2P9N C;  3EI4 B;  3OKW A;  2I0T A;  3AL8 B;  3IJC A;  3J80 g;  2P9U C;  2B5L A;  4XYH A;  5A2Q g;  5C2V B;  2Z2O A;  3MXX A;  3PXT D;  3J81 g;  2OK6 A;  5FKR A;  4E54 A;  5FLX g;  2HKM A;  3B7F A;  3DXM C;  1L0Q A;  3SBR A;  2H9P A;  3GFC A;  2IUR A;  4A0B A;  1PI6 A;  2IAA A;  4CY5 A;  3I89 A;  3ODT A;  5H17 A;  2TRC B;  4IA9 A;  1ERJ A;  4GMB A;  2QC5 A;  3VA6 A;  3UR4 A;  2P9K C;  5C9Z B;  3I8E A;  5IGO A;  4QT8 A;  3SFZ A;  4E5Z A;  2H14 A;  3I7K A;  3F3P A;  5THA A;  4FAV D;  3OL2 B;  4CY3 A;  3IJ0 A;  1XIP A;  4PSW B;  4A2L A;  3EI3 A;  2IUV A;  5HE1 B;  5GSA A;  4L9O A;  2J56 H;  5CXB B;  5CYK A;  4O9D A;  3EI4 A;  4A2M A;  4CZV A;  4MK0 B;  2BCJ B;  3AL8 A;  3UVN A;  3MKQ A;  4CI2 A;  1A0R B;  4ZOV A;  1QNI A;  3KRW B;  5EM2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...