3ZE1A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 100
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze1A00
3NIDA 3ZDYA 3K6SA 4MMXA 4WJKA 4Z7OA 2VDRA 4G1EA 4G1MA 4O02A 3IJEA 1TYEA 4UM8A 4WK2A 2VDPA 3V4PA 3VI4A 1L5GA 2VC2A 4WK4A 4MMYA 2VDLA 2VDNA 3T3MA 1U8CA 4Z7QA 4Z7NA 3VI3A 5E6UA 4WK0A 4NENA 4MMZA 3T3PA 3ZDXA 3ZE2A 4IRZA 3FCSA 3K72A 3ZE0A 2VDQA 3NIFA 3ZDZA 1JV2A 3V4VA 2VDMA 3K71A 1M1XA 4UM9A 5FFOA 3NIGA 3ZE1A 5HDBA 2VDKA 5FFGA 2VDOA 5E6SA 3FCUA 5E6RA
chains in the Genus database with same CATH superfamily
5TDHB 5EMKB 4BP9A 5TF2A 2H9LA 3MUNA 4G1MA 4PNKB 1U4CA 2G9AA 3IJEA 5C2VB 5M5VA 4J8BA 2QR5A 2AQ5A 2P9IC 3PXSD 3MUOA 4JSNC 2TRCB 4CI2A 5AMSA 3QI0A 4NSXA 4GMBA 2EICA 3EI1A 3O4IA 3EQ7A 3EWEA 3L4MD 5IGOA 5E6RA 2PBIB 3VH0A 1YFQA 4FHLA 5TEFA 5HE3B 1JMZB 5FXYA 2IUQA 1K8KC 5EMLB 1VZ2A 3V4PA 3VI4A 1GOTB 3I7HA 4X61B 2HJ4A 4FAVD 3MZKA 4JSVC 5IJ8E 1U8CA 1XHMA 3PXWD 2CE8A 1A0RB 1XIPA 2BKLA 4QT8A 4IRZA 4HDJA 3FCSA 3A0FA 3FRXA 3ZE0A 3IUNA 2YBAA 3I7KA 3IJCA 3DM0A 3IUQA 2H14A 4DNUA 2VDKA 2CN2A 2HU8A 4R7AB 4A0BA 1OMWB 4U7AA 5CXCA 1TBGA 4Z8LA 5FKRA 3SBRA 2B5NA 4WJKA 4A09A 3JZHA 4ZOYA 2AH0A 2PM6B 3JROA 4BP8A 3I89A 4Z7NA 2H6NA 5GXIA 3FM0A 2H9NA 1JTDB 4IA9A 4E5ZA 3EG6A 3NVXA 2HKMA 3IKOA 4D9SA 2OIZA 1E8MA 4QL1A 2P9SC 5CYKB 4A2LA 3ZDZA 4J79A 4A08B 3PVUB 3ZE1A 4J8GA 2H47A 3GREA 3UKUC 3T3MA 3NIDA 3OKTA 3PVWB 1JMXB 4MMXA 1UOOA 2H6QA 3NVQA 4AN1A 4FA9D 1H2ZA 4U1EI 4WK2A 2CN3A 1E8NA 4AOWA 4AMYA 2I3SA 4DNVA 4Z7QA 5M5TA 2I3TA 4FA4D 3ODTA 3K72A 3PSCB 3SN6B 3BG1A 3SLED 4BUJC 4FWWA 1P22A 3KRWB 1GXRA 2H9MA 2O9KA 3F3GA 4JSXC 4NAAA 3UVLA 3NVNA 2HYEA 5H17A 5EMMB 2H9PA 3V7DB 3FCUA 3K6SA 3BWSA 1E5TA 3EQ9A 4TZ4A 3ZDYA 4GGAA 4H5JA 2I0RA 4QQEA 4A7JA 2YMUA 3RRMC 3EI4B 4O02A 2EBSA 1O6FA 3E0CA 1H2WA 3I8CA 4K3JB 4Y5RD 4E54A 5THAA 2AGWA 3C99A 3EMHA 4BCCA 4CZVA 3OTTA 2YNPA 3OL2B 5H14A 5HYNB 3MZLA 4GM3A 3IULA 2QZPA 4CY2A 2EIBA 4L1MA 1JV2A 4CI1A 3PXTD 2OVRB 4PSXB 4CZYA 3BG0A 4MK0B 5M61A 2PM9A 3UR4A 2I0SA 3OKYA 2VDRA 4GZ8A 2YNNA 2P9LC 5I5MA 1QNIA 2PM7B 4PSWB 4Y7RA 5I5JA 2MTAH 5AFU3 1MG2A 1K32A 3UKRC 2VDNA 4LG9A 4K3ID 4D6VA 1PEVA 4RE5A 1S4UX 2P9UC 2BCJB 4ZOXA 4JD2C 1TYQC 4X3EA 4GM9A 4PXWA 4GM8A 3HFQA 3NIGA 4CY5A 5CXBB 3J81g 3RN1D 1GOFA 2EIDA 5E6SA 1VE6A 2OJYA 3RFGA 1ERJA 3O4GA 2CE9A 4ERZA 5H1MA 1RI6A 2XYIA 4CI3A 4MMYA 5K19A 3V9FA 1GOHA 5FLXg 3VGZA 5GXHA 3I7PA 3I7LA 2HU5A 3DSMA 3ZE2A 2AGXA 3MKQA 2Z2OA 1VE7A 4X60B 5HE1B 4O45A 3ULEC 2IUPA 2J55H 2P9KC 4NC4A 1NR0A 4O1QD 3AL8A 4FA5D 2IWFA 3MXXA 5FA5B 2B4EA 4Z7OA 3P4FA 3GD1I 4NBMA 2Q7QA 4J86A 5M5SA 3F3FA 5GMKn 2OK4A 4GQ2P 3N0EA 5EAMA 4J77A 1JOFA 4JT6C 3MMYA 4A11A 3JAMg 5B4WA 3RLMD 4XYHA 3NIFA 5EM2A 5EAPA 2IWKA 3UVNA 2YB8B 4H5IA 4I79A 4FA1D 3EI1B 4BCBA 2P9NC 1UOPA 3MKSB 5I5IA 2EIEA 3N0DA 4A0AB 2IUVA 4JT5C 4L3GD 3KCIA 1A12A 3IURA 4ZOVA 1L5GA 2OK6A 5M5UA 2VDLA 1QFMA 1SHYB 3OL2A 4O3UB 1MG3A 4NENA 2GNQA 2XZGA 3T3PA 1UTCA 5K1CC 3DDUA 2GC7A 1C9IA 2XL3A 4N14A 1M1XA 1H2XA 2XE4A 5FFOA 5HE2B 5HDBA 5HE0B 3U4YA 2J57G 2WQ8A 3GC3B 2HXCA 2H3XA 4A0BB 3SHFA 1Q47A 2Z2PA 5SXMA 4L9OA 3RFHA 5AJAA 1TYEA 4CY1A 4ERYA 3PE7A 4O2WA 2QXVA 4GGDA 4EWRA 1N6EA 3IVMA 3J80g 4IMMA 3VI3A 4O3TB 2H68A 4PC0A 4AEZA 5FKTA 3VA6A 1PGUA 3K27A 2IURA 3SBPA 3IJ0A 4BL0A 3JRPA 2H13A 2XDWA 5IC7A 3SFZA 4BCDA 2HESX 3QHYB 4UM8A 1I2MB 4G56B 4GQ1A 4WK4A 2XU7A 2B5MA 3I7NA 2H6KA 4ESGA 4JHNA 4J0WA 2HU7A 4L1QD 3EI2B 2IAAA 2HJBA 1O6GA 2VDQA 3C9CA 2J56H 3K71A 1GG2B 3I2NA 4PBZA 1PBYB 2GC4A 4ZOZA 5EALA 2AGLA 5EARA 4AX4A 3JZGA 5IT9g 1GP2B 3EI3B 3K26A 3UVOA 3UVMA 4L3HD 2G99A 3CIKB 3I7OA 3OW8A 4OZUA 4J78A 4E54B 5IGQA 2UZYB 3EU7A 4MMZA 4QAMA 5CYKA 4CI8A 3I8EA 4A08A 2AH1A 2BBKH 3AH8B 3IJ1A 4UM9A 1B9YA 4ERQA 3C5MA 4DNWA 3DWLC 2CO0A 2Z2NA 4J73A 1VZ3A 3MVDK 4A0AA 3C75H 3F3PA 5GSAA 2PM9B 1GOGA 4G1EA 3SMRA 3OKYB 2VDPA 3JZNA 3OKWA 4RE6A 3SXTD 3W15A 2W18A 1OLZA 2I0TA 4OWRA 1U2VC 5FKSA 4LG8A 3AFCA 3L4OD 3UVKA 1VYHC 4GGCA 1C9LA 2B5LA 3IUMA 3O4JA 4CZXA 4CY3A 5FQDA 1T2XA 3ZWLB 1MDAH 4LGNA 4JSPC 4J87A 4FAND 4J84A 5FKQA 5C86A 1SQJA 4J82A 3SCYA 3EI4A 1K3IA 3IIYA 4J81A 5M5RA 4ZN4A 5C2WB 1H2YA 5EMJB 2VZ1A 2VC2A 3EQ8A 3DXMC 4YVDA 2OVPB 2CO0C 4ES0A 1N6FA 4AN0A 4BH6A 4CC9A 3FGBA 3OF7A 3CFSB 2VZ3A 2XL2A 5TEEA 4KFMB 5JWZA 2YNOA 5IJ7E 3RMZD 1FWXA 2HKRA 4QRJA 4JXMA 5FFGA 2VDOA 1YR2A 1B9XA 5C92A 1UOQA 4G55A 3AL8B 4UI9R 2AGZA 3DXKC 5CXCB 5HQGA 3SJLD 4PBYA 2P9PC 4A09B 3IUJA 1PI6A 4O9DA 3EI2A 4JHPC 4WK0A 5E6UA 3ZDXA 4J0XA 2OVQB 3SWSD 4X63B 3ORVD 4A11B 3RSEC 3B7FA 4E5ZB 3KRXB 5CXBA 3V4VA 2VDMA 3GFCA 5EM2B 3IIWA 4D0KA 2CNXA 3CFVA 3O4HA 3RN0D 3EI3A 4AMZA 2AGYA 3JPXA 4XEIC 5KDOB 1L0QA 2JKXA 1N6DA 1QFSA 2QC5A 4XYIA 3V5WB 3AL9A 4A2MA 4GQBB 3JB9L 1XKSA 3SBQA 5C9ZB 3SVWD 4FB1D 1R5MA 1SQ9A 1BPOA 1NEXB 2UZXB 3PSLA 1JJUB 5A2Qg
chains in the Genus database with same CATH topology
3NIDA 3ZDYA 3K6SA 4MMXA 4WJKA 4Z7OA 2VDRA 4G1EA 4G1MA 4O02A 3IJEA 1TYEA 4UM8A 4WK2A 2VDPA 3V4PA 3VI4A 1L5GA 2VC2A 4WK4A 4MMYA 2VDLA 2VDNA 3T3MA 1U8CA 4Z7QA 4Z7NA 3VI3A 5E6UA 4WK0A 4NENA 4MMZA 3T3PA 3ZDXA 3ZE2A 4IRZA 3FCSA 3K72A 3ZE0A 2VDQA 3NIFA 3ZDZA 1JV2A 3V4VA 2VDMA 3K71A 1M1XA 4UM9A 5FFOA 3NIGA 3ZE1A 5HDBA 2VDKA 5FFGA 2VDOA 5E6SA 3FCUA 5E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NID A;  3ZDY A;  3K6S A;  4MMX A;  4WJK A;  4Z7O A;  2VDR A;  4G1E A;  4G1M A;  4O02 A;  3IJE A;  1TYE A;  4UM8 A;  4WK2 A;  2VDP A;  3V4P A;  3VI4 A;  1L5G A;  2VC2 A;  4WK4 A;  4MMY A;  2VDL A;  2VDN A;  3T3M A;  1U8C A;  4Z7Q A;  4Z7N A;  3VI3 A;  5E6U A;  4WK0 A;  4NEN A;  4MMZ A;  3T3P A;  3ZDX A;  3ZE2 A;  4IRZ A;  3FCS A;  3K72 A;  3ZE0 A;  2VDQ A;  3NIF A;  3ZDZ A;  1JV2 A;  3V4V A;  2VDM A;  3K71 A;  1M1X A;  4UM9 A;  5FFO A;  3NIG A;  3ZE1 A;  5HDB A;  2VDK A;  5FFG A;  2VDO A;  5E6S A;  3FCU A;  5E6R A; 
#chains in the Genus database with same CATH topology
 5TDH B;  5EMK B;  4BP9 A;  5TF2 A;  2H9L A;  3MUN A;  4G1M A;  4PNK B;  1U4C A;  2G9A A;  3IJE A;  5C2V B;  5M5V A;  4J8B A;  2QR5 A;  2AQ5 A;  2P9I C;  3PXS D;  3MUO A;  4JSN C;  2TRC B;  4CI2 A;  5AMS A;  3QI0 A;  4NSX A;  4GMB A;  2EIC A;  3EI1 A;  3O4I A;  3EQ7 A;  3EWE A;  3L4M D;  5IGO A;  5E6R A;  2PBI B;  3VH0 A;  1YFQ A;  4FHL A;  5TEF A;  5HE3 B;  1JMZ B;  5FXY A;  2IUQ A;  1K8K C;  5EML B;  1VZ2 A;  3V4P A;  3VI4 A;  1GOT B;  3I7H A;  4X61 B;  2HJ4 A;  4FAV D;  3MZK A;  4JSV C;  5IJ8 E;  1U8C A;  1XHM A;  3PXW D;  2CE8 A;  1A0R B;  1XIP A;  2BKL A;  4QT8 A;  4IRZ A;  4HDJ A;  3FCS A;  3A0F A;  3FRX A;  3ZE0 A;  3IUN A;  2YBA A;  3I7K A;  3IJC A;  3DM0 A;  3IUQ A;  2H14 A;  4DNU A;  2VDK A;  2CN2 A;  2HU8 A;  4R7A B;  4A0B A;  1OMW B;  4U7A A;  5CXC A;  1TBG A;  4Z8L A;  5FKR A;  3SBR A;  2B5N A;  4WJK A;  4A09 A;  3JZH A;  4ZOY A;  2AH0 A;  2PM6 B;  3JRO A;  4BP8 A;  3I89 A;  4Z7N A;  2H6N A;  5GXI A;  3FM0 A;  2H9N A;  1JTD B;  4IA9 A;  4E5Z A;  3EG6 A;  3NVX A;  2HKM A;  3IKO A;  4D9S A;  2OIZ A;  1E8M A;  4QL1 A;  2P9S C;  5CYK B;  4A2L A;  3ZDZ A;  4J79 A;  4A08 B;  3PVU B;  3ZE1 A;  4J8G A;  2H47 A;  3GRE A;  3UKU C;  3T3M A;  3NID A;  3OKT A;  3PVW B;  1JMX B;  4MMX A;  1UOO A;  2H6Q A;  3NVQ A;  4AN1 A;  4FA9 D;  1H2Z A;  4U1E I;  4WK2 A;  2CN3 A;  1E8N A;  4AOW A;  4AMY A;  2I3S A;  4DNV A;  4Z7Q A;  5M5T A;  2I3T A;  4FA4 D;  3ODT A;  3K72 A;  3PSC B;  3SN6 B;  3BG1 A;  3SLE D;  4BUJ C;  4FWW A;  1P22 A;  3KRW B;  1GXR A;  2H9M A;  2O9K A;  3F3G A;  4JSX C;  4NAA A;  3UVL A;  3NVN A;  2HYE A;  5H17 A;  5EMM B;  2H9P A;  3V7D B;  3FCU A;  3K6S A;  3BWS A;  1E5T A;  3EQ9 A;  4TZ4 A;  3ZDY A;  4GGA A;  4H5J A;  2I0R A;  4QQE A;  4A7J A;  2YMU A;  3RRM C;  3EI4 B;  4O02 A;  2EBS A;  1O6F A;  3E0C A;  1H2W A;  3I8C A;  4K3J B;  4Y5R D;  4E54 A;  5THA A;  2AGW A;  3C99 A;  3EMH A;  4BCC A;  4CZV A;  3OTT A;  2YNP A;  3OL2 B;  5H14 A;  5HYN B;  3MZL A;  4GM3 A;  3IUL A;  2QZP A;  4CY2 A;  2EIB A;  4L1M A;  1JV2 A;  4CI1 A;  3PXT D;  2OVR B;  4PSX B;  4CZY A;  3BG0 A;  4MK0 B;  5M61 A;  2PM9 A;  3UR4 A;  2I0S A;  3OKY A;  2VDR A;  4GZ8 A;  2YNN A;  2P9L C;  5I5M A;  1QNI A;  2PM7 B;  4PSW B;  4Y7R A;  5I5J A;  2MTA H;  5AFU 3;  1MG2 A;  1K32 A;  3UKR C;  2VDN A;  4LG9 A;  4K3I D;  4D6V A;  1PEV A;  4RE5 A;  1S4U X;  2P9U C;  2BCJ B;  4ZOX A;  4JD2 C;  1TYQ C;  4X3E A;  4GM9 A;  4PXW A;  4GM8 A;  3HFQ A;  3NIG A;  4CY5 A;  5CXB B;  3J81 g;  3RN1 D;  1GOF A;  2EID A;  5E6S A;  1VE6 A;  2OJY A;  3RFG A;  1ERJ A;  3O4G A;  2CE9 A;  4ERZ A;  5H1M A;  1RI6 A;  2XYI A;  4CI3 A;  4MMY A;  5K19 A;  3V9F A;  1GOH A;  5FLX g;  3VGZ A;  5GXH A;  3I7P A;  3I7L A;  2HU5 A;  3DSM A;  3ZE2 A;  2AGX A;  3MKQ A;  2Z2O A;  1VE7 A;  4X60 B;  5HE1 B;  4O45 A;  3ULE C;  2IUP A;  2J55 H;  2P9K C;  4NC4 A;  1NR0 A;  4O1Q D;  3AL8 A;  4FA5 D;  2IWF A;  3MXX A;  5FA5 B;  2B4E A;  4Z7O A;  3P4F A;  3GD1 I;  4NBM A;  2Q7Q A;  4J86 A;  5M5S A;  3F3F A;  5GMK n;  2OK4 A;  4GQ2 P;  3N0E A;  5EAM A;  4J77 A;  1JOF A;  4JT6 C;  3MMY A;  4A11 A;  3JAM g;  5B4W A;  3RLM D;  4XYH A;  3NIF A;  5EM2 A;  5EAP A;  2IWK A;  3UVN A;  2YB8 B;  4H5I A;  4I79 A;  4FA1 D;  3EI1 B;  4BCB A;  2P9N C;  1UOP A;  3MKS B;  5I5I A;  2EIE A;  3N0D A;  4A0A B;  2IUV A;  4JT5 C;  4L3G D;  3KCI A;  1A12 A;  3IUR A;  4ZOV A;  1L5G A;  2OK6 A;  5M5U A;  2VDL A;  1QFM A;  1SHY B;  3OL2 A;  4O3U B;  1MG3 A;  4NEN A;  2GNQ A;  2XZG A;  3T3P A;  1UTC A;  5K1C C;  3DDU A;  2GC7 A;  1C9I A;  2XL3 A;  4N14 A;  1M1X A;  1H2X A;  2XE4 A;  5FFO A;  5HE2 B;  5HDB A;  5HE0 B;  3U4Y A;  2J57 G;  2WQ8 A;  3GC3 B;  2HXC A;  2H3X A;  4A0B B;  3SHF A;  1Q47 A;  2Z2P A;  5SXM A;  4L9O A;  3RFH A;  5AJA A;  1TYE A;  4CY1 A;  4ERY A;  3PE7 A;  4O2W A;  2QXV A;  4GGD A;  4EWR A;  1N6E A;  3IVM A;  3J80 g;  4IMM A;  3VI3 A;  4O3T B;  2H68 A;  4PC0 A;  4AEZ A;  5FKT A;  3VA6 A;  1PGU A;  3K27 A;  2IUR A;  3SBP A;  3IJ0 A;  4BL0 A;  3JRP A;  2H13 A;  2XDW A;  5IC7 A;  3SFZ A;  4BCD A;  2HES X;  3QHY B;  4UM8 A;  1I2M B;  4G56 B;  4GQ1 A;  4WK4 A;  2XU7 A;  2B5M A;  3I7N A;  2H6K A;  4ESG A;  4JHN A;  4J0W A;  2HU7 A;  4L1Q D;  3EI2 B;  2IAA A;  2HJB A;  1O6G A;  2VDQ A;  3C9C A;  2J56 H;  3K71 A;  1GG2 B;  3I2N A;  4PBZ A;  1PBY B;  2GC4 A;  4ZOZ A;  5EAL A;  2AGL A;  5EAR A;  4AX4 A;  3JZG A;  5IT9 g;  1GP2 B;  3EI3 B;  3K26 A;  3UVO A;  3UVM A;  4L3H D;  2G99 A;  3CIK B;  3I7O A;  3OW8 A;  4OZU A;  4J78 A;  4E54 B;  5IGQ A;  2UZY B;  3EU7 A;  4MMZ A;  4QAM A;  5CYK A;  4CI8 A;  3I8E A;  4A08 A;  2AH1 A;  2BBK H;  3AH8 B;  3IJ1 A;  4UM9 A;  1B9Y A;  4ERQ A;  3C5M A;  4DNW A;  3DWL C;  2CO0 A;  2Z2N A;  4J73 A;  1VZ3 A;  3MVD K;  4A0A A;  3C75 H;  3F3P A;  5GSA A;  2PM9 B;  1GOG A;  4G1E A;  3SMR A;  3OKY B;  2VDP A;  3JZN A;  3OKW A;  4RE6 A;  3SXT D;  3W15 A;  2W18 A;  1OLZ A;  2I0T A;  4OWR A;  1U2V C;  5FKS A;  4LG8 A;  3AFC A;  3L4O D;  3UVK A;  1VYH C;  4GGC A;  1C9L A;  2B5L A;  3IUM A;  3O4J A;  4CZX A;  4CY3 A;  5FQD A;  1T2X A;  3ZWL B;  1MDA H;  4LGN A;  4JSP C;  4J87 A;  4FAN D;  4J84 A;  5FKQ A;  5C86 A;  1SQJ A;  4J82 A;  3SCY A;  3EI4 A;  1K3I A;  3IIY A;  4J81 A;  5M5R A;  4ZN4 A;  5C2W B;  1H2Y A;  5EMJ B;  2VZ1 A;  2VC2 A;  3EQ8 A;  3DXM C;  4YVD A;  2OVP B;  2CO0 C;  4ES0 A;  1N6F A;  4AN0 A;  4BH6 A;  4CC9 A;  3FGB A;  3OF7 A;  3CFS B;  2VZ3 A;  2XL2 A;  5TEE A;  4KFM B;  5JWZ A;  2YNO A;  5IJ7 E;  3RMZ D;  1FWX A;  2HKR A;  4QRJ A;  4JXM A;  5FFG A;  2VDO A;  1YR2 A;  1B9X A;  5C92 A;  1UOQ A;  4G55 A;  3AL8 B;  4UI9 R;  2AGZ A;  3DXK C;  5CXC B;  5HQG A;  3SJL D;  4PBY A;  2P9P C;  4A09 B;  3IUJ A;  1PI6 A;  4O9D A;  3EI2 A;  4JHP C;  4WK0 A;  5E6U A;  3ZDX A;  4J0X A;  2OVQ B;  3SWS D;  4X63 B;  3ORV D;  4A11 B;  3RSE C;  3B7F A;  4E5Z B;  3KRX B;  5CXB A;  3V4V A;  2VDM A;  3GFC A;  5EM2 B;  3IIW A;  4D0K A;  2CNX A;  3CFV A;  3O4H A;  3RN0 D;  3EI3 A;  4AMZ A;  2AGY A;  3JPX A;  4XEI C;  5KDO B;  1L0Q A;  2JKX A;  1N6D A;  1QFS A;  2QC5 A;  4XYI A;  3V5W B;  3AL9 A;  4A2M A;  4GQB B;  3JB9 L;  1XKS A;  3SBQ A;  5C9Z B;  3SVW D;  4FB1 D;  1R5M A;  1SQ9 A;  1BPO A;  1NEX B;  2UZX B;  3PSL A;  1JJU B;  5A2Q g; 
#chains in the Genus database with same CATH homology
 3NID A;  3ZDY A;  3K6S A;  4MMX A;  4WJK A;  4Z7O A;  2VDR A;  4G1E A;  4G1M A;  4O02 A;  3IJE A;  1TYE A;  4UM8 A;  4WK2 A;  2VDP A;  3V4P A;  3VI4 A;  1L5G A;  2VC2 A;  4WK4 A;  4MMY A;  2VDL A;  2VDN A;  3T3M A;  1U8C A;  4Z7Q A;  4Z7N A;  3VI3 A;  5E6U A;  4WK0 A;  4NEN A;  4MMZ A;  3T3P A;  3ZDX A;  3ZE2 A;  4IRZ A;  3FCS A;  3K72 A;  3ZE0 A;  2VDQ A;  3NIF A;  3ZDZ A;  1JV2 A;  3V4V A;  2VDM A;  3K71 A;  1M1X A;  4UM9 A;  5FFO A;  3NIG A;  3ZE1 A;  5HDB A;  2VDK A;  5FFG A;  2VDO A;  5E6S A;  3FCU A;  5E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...