3ZE1A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
455
structure length
455
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system/peptide
source organism Homo sapiens
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
total genus 100
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze1A00
3T3MA 2VC2A 3ZDXA 1JV2A 3IJEA 5E6UA 4G1MA 4Z7OA 3T3PA 5E6SA 2VDKA 2VDMA 1TYEA 3NIDA 2VDLA 5FFGA 3K72A 2VDOA 4MMZA 3FCUA 4UM8A 3NIFA 4IRZA 5FFOA 5HDBA 4MMYA 3K6SA 3ZE2A 5E6RA 4WK0A 4Z7QA 3ZDYA 2VDQA 4WK2A 4WJKA 3V4VA 3ZDZA 4Z7NA 4O02A 4WK4A 3VI3A 1M1XA 3ZE1A 4NENA 1U8CA 2VDNA 3K71A 3V4PA 3VI4A 3NIGA 2VDRA 3FCSA 4UM9A 4G1EA 1L5GA 2VDPA 3ZE0A 4MMXA
chains in the Genus database with same CATH superfamily
1L0QA 5FQDA 4AMZA 2HKRA 1UOPA 3UVNA 1SQJA 5AJAA 3AL8B 3C9CA 5M5UA 3DDUA 2PM9B 2QR5A 5EMLB 3OKYA 3FCUA 5K19A 2J57G 2BCJB 5I5JA 1VE7A 3BG1A 2CE9A 4ZOXA 3OKYB 1NEXB 4X61B 2XE4A 2P9LC 3I8CA 4E54B 4D6VA 3ZE1A 3BG0A 3UKUC 4J78A 3L4MD 3O4GA 3MKSB 4GQ1A 4LGNA 1SQ9A 5M5TA 2HKMA 2PBIB 5CXCA 3B7FA 3EG6A 3CFVA 5EAPA 3IJEA 4X60B 4G1MA 5HYNB 3IJ0A 5GMKn 4MMZA 4QAMA 5E6RA 3I2NA 5HE0B 2OK4A 4BP8A 1Q47A 3EI3B 4ERZA 4N14A 3IUMA 4JD2C 3K26A 3PVUB 5H1MA 3F3FA 5FA5B 3IIYA 2QXVA 4J0WA 4JSPC 4ZN4A 1H2XA 5M5VA 1JMZB 2XU7A 5IC7A 1VYHC 5HE2B 3SBPA 4A09A 3ZE0A 4NSXA 4J8GA 4PC0A 3ZDXA 1XHMA 2AGWA 3UVKA 3RFGA 3VGZA 1PEVA 2I3SA 5IT9g 1PGUA 5FKRA 2IAAA 5IJ7E 4O3UB 4XEIC 5A2Qg 4NENA 2G9AA 2HJ4A 3JZHA 5C86A 3MUOA 3MMYA 2CE8A 2VDRA 2I0TA 5HQGA 3IVMA 4A11B 4ERYA 2VDPA 1O6FA 2OVQB 2P9PC 3IUNA 4X63B 3DM0A 3O4IA 2HU5A 3T3PA 3EI3A 3GC3B 5I5MA 4YVDA 4JSNC 3PE7A 4CZXA 4ZOYA 2AGLA 2CNXA 2H9NA 3NVQA 4QQEA 4D0KA 4J73A 3SVWD 4ES0A 3OF7A 4JT5C 5EM2B 4CY1A 3W15A 3KRWB 3PVWB 1K8KC 2AGXA 3SWSD 4A08A 1N6EA 4A0BB 3SN6B 4K3JB 5TEFA 5C2VB 4L1MA 2I3TA 5FXYA 2HESX 4L9OA 5E6UA 4CI2A 4J77A 4AOWA 4BP9A 1C9LA 2VDKA 2EIDA 4FHLA 4FWWA 2VDLA 3NIDA 5SXMA 3SBRA 3K72A 2VZ1A 1PI6A 4L3GD 3JB9L 1QFMA 4CY5A 4O1QD 4Z7QA 3SBQA 3PXSD 4FAND 3MKQA 1QFSA 3SHFA 3VI3A 4DNWA 3I7NA 4U7AA 2H3XA 5CXBB 2XZGA 1E8NA 3IJCA 4CZVA 4A09B 4OWRA 2I0SA 3AL9A 2P9SC 4OZUA 3NIFA 5HDBA 4E5ZB 4A11A 4BCDA 2QC5A 3O4JA 1QNIA 2H13A 2W18A 4ESGA 2VZ3A 4A2LA 4J82A 2MTAH 5THAA 2Q7QA 3ZDZA 5C2WB 5B4WA 5GXIA 5TDHB 2TRCB 3QI0A 1JJUB 5IJ8E 3F3PA 2GC7A 3NIGA 4AMYA 5M5SA 3NVNA 3C99A 2XL2A 2AQ5A 2XYIA 3OW8A 2PM7B 1JV2A 3JRPA 2H6QA 3J81g 4GQBB 3I89A 4CY3A 4DNVA 4MMYA 3KCIA 2PM6B 4J86A 3ZE2A 3VH0A 4IMMA 5H17A 4BL0A 3UVLA 2H9LA 4IA9A 3AH8B 1B9YA 1OLZA 2H68A 2YBAA 4PXWA 4WK4A 3CIKB 2YMUA 3V9FA 2HU8A 1U8CA 2OVRB 4PNKB 5M5RA 5H14A 2OJYA 1MDAH 2I0RA 2GC4A 3ODTA 4G1EA 2OVPB 4GZ8A 4A0BA 4CI3A 5IGOA 1YFQA 2EIEA 4O2WA 5FKQA 5EARA 4A08B 3MVDK 2EICA 5EM2A 3I7HA 2CN3A 3JROA 5CXCB 1MG2A 3K27A 4PSWB 4U1EI 4NAAA 3MUNA 2EBSA 2YNNA 2HYEA 3ULEC 2IURA 3OKWA 5C9ZB 3OKTA 1TYQC 4X3EA 2BKLA 3RN1D 2AGZA 4JSXC 1FWXA 4RE6A 1JTDB 5EAMA 4E5ZA 4J8BA 5K1CC 4JXMA 4CI8A 3NVXA 2Z2PA 3DSMA 4QL1A 1UOOA 2Z2NA 3RFHA 2UZXB 2P9IC 3GFCA 5M61A 3AL8A 4ZOZA 1GOGA 4Z8LA 3FGBA 1TYEA 2VDOA 3BWSA 2UZYB 2WQ8A 2H9MA 2HXCA 3EQ8A 1U4CA 4I79A 4H5JA 3JZGA 4J81A 3V5WB 4CY2A 3JAMg 3SFZA 3CFSB 4LG8A 3PSLA 3JZNA 5CYKA 4A2MA 2QZPA 2AH1A 4JT6C 1L5GA 4G55A 1O6GA 4BCBA 2B5NA 2VC2A 1BPOA 3UR4A 3EI1A 3SXTD 3JPXA 1N6DA 3I7KA 4BCCA 3IJ1A 5KDOB 1PBYB 4UM8A 3IUJA 4Y5RD 3MXXA 5AFU3 4JHNA 4BUJC 4L3HD 5EALA 3UVOA 4RE5A 3DXKC 3PXTD 3AFCA 1C9IA 3IKOA 3UVMA 3IUQA 4PSXB 3EU7A 5TF2A 3K71A 2CO0C 3J80g 4QRJA 2AH0A 2YNPA 4UI9R 2Z2OA 5GSAA 3OTTA 4D9SA 1YR2A 2H6NA 3EI4B 5FKTA 1UOQA 3E0CA 3I7LA 4E54A 4FA1D 1GOHA 2EIBA 2IWFA 1I2MB 4Y7RA 2HJBA 4JSVC 3K6SA 3C5MA 1R5MA 3GD1I 3EMHA 4G56B 2P9NC 2PM9A 3ZDYA 3SMRA 2VDQA 3EI4A 4O02A 3UKRC 2G99A 4ERQA 2XDWA 3N0DA 3RN0D 2H9PA 5C92A 4PBYA 4GGAA 5FKSA 4AEZA 4MMXA 4GMBA 3T3MA 3QHYB 3EI2B 4FA5D 4NBMA 2OIZA 4H5IA 3A0FA 4LG9A 2IWKA 2B5MA 2H6KA 1UTCA 4AX4A 4J87A 1VZ2A 3I8EA 4CZYA 4XYIA 1E8MA 1N6FA 2HU7A 1SHYB 1JMXB 4K3ID 4GM9A 3IURA 3OL2A 4FA4D 2GNQA 1RI6A 3DXMC 3V4PA 5FLXg 3IULA 5CYKB 4ZOVA 3SCYA 4O45A 5CXBA 2J55H 3FRXA 3HFQA 3FM0A 1OMWB 5E6SA 1E5TA 2VDMA 3IIWA 1MG3A 4EWRA 4QT8A 1P22A 5TEEA 4DNUA 3V4VA 4WJKA 3EQ9A 4KFMB 4CC9A 3RSEC 3I7OA 1XKSA 1H2ZA 3FCSA 4GQ2P 3SLED 4A0AA 4AN1A 4L1QD 3P4FA 4FB1D 4BH6A 1K32A 1GG2B 2YB8B 5AMSA 5FFGA 2B4EA 4GGDA 4R7AB 5FFOA 3EI2A 1S4UX 3L4OD 4WK0A 4O9DA 5EMMB 2CN2A 1XIPA 3V7DB 5GXHA 4AN0A 3PXWD 4JHPC 2VDNA 4A0AB 1NR0A 1U2VC 1H2YA 4UM9A 5EMKB 2O9KA 5JWZA 2H47A 3MZKA 5IGQA 2OK6A 1TBGA 5I5IA 4TZ4A 4Z7OA 3ZWLB 1ERJA 4CI1A 1GOFA 3F3GA 2XL3A 4J84A 2J56H 3SJLD 3RMZD 2CO0A 1A12A 4GM8A 4FAVD 1H2WA 3O4HA 2IUVA 4NC4A 1A0RB 2P9UC 1JOFA 5HE3B 3VI4A 1VZ3A 2B5LA 3EQ7A 3GREA 1GXRA 4GM3A 2P9KC 2YNOA 3OL2B 1B9XA 2IUQA 3C75H 2IUPA 5HE1B 3N0EA 3RLMD 4J79A 3EI1B 4XYHA 1GP2B 4GGCA 4IRZA 1K3IA 3I7PA 3EWEA 4HDJA 4J0XA 3RRMC 1T2XA 2JKXA 1VE6A 3VA6A 3PSCB 2H14A 3DWLC 4WK2A 1GOTB 4FA9D 4O3TB 4Z7NA 5EMJB 4A7JA 1M1XA 2AGYA 3MZLA 2BBKH 4PBZA 3U4YA 3ORVD 4MK0B 3KRXB
chains in the Genus database with same CATH topology
3T3MA 2VC2A 3ZDXA 1JV2A 3IJEA 5E6UA 4G1MA 4Z7OA 3T3PA 5E6SA 2VDKA 2VDMA 1TYEA 3NIDA 2VDLA 5FFGA 3K72A 2VDOA 4MMZA 3FCUA 4UM8A 3NIFA 4IRZA 5FFOA 5HDBA 4MMYA 3K6SA 3ZE2A 5E6RA 4WK0A 4Z7QA 3ZDYA 2VDQA 4WK2A 4WJKA 3V4VA 3ZDZA 4Z7NA 4O02A 4WK4A 3VI3A 1M1XA 3ZE1A 4NENA 1U8CA 2VDNA 3K71A 3V4PA 3VI4A 3NIGA 2VDRA 3FCSA 4UM9A 4G1EA 1L5GA 2VDPA 3ZE0A 4MMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T3M A;  2VC2 A;  3ZDX A;  1JV2 A;  3IJE A;  5E6U A;  4G1M A;  4Z7O A;  3T3P A;  5E6S A;  2VDK A;  2VDM A;  1TYE A;  3NID A;  2VDL A;  5FFG A;  3K72 A;  2VDO A;  4MMZ A;  3FCU A;  4UM8 A;  3NIF A;  4IRZ A;  5FFO A;  5HDB A;  4MMY A;  3K6S A;  3ZE2 A;  5E6R A;  4WK0 A;  4Z7Q A;  3ZDY A;  2VDQ A;  4WK2 A;  4WJK A;  3V4V A;  3ZDZ A;  4Z7N A;  4O02 A;  4WK4 A;  3VI3 A;  1M1X A;  3ZE1 A;  4NEN A;  1U8C A;  2VDN A;  3K71 A;  3V4P A;  3VI4 A;  3NIG A;  2VDR A;  3FCS A;  4UM9 A;  4G1E A;  1L5G A;  2VDP A;  3ZE0 A;  4MMX A; 
#chains in the Genus database with same CATH topology
 1L0Q A;  5FQD A;  4AMZ A;  2HKR A;  1UOP A;  3UVN A;  1SQJ A;  5AJA A;  3AL8 B;  3C9C A;  5M5U A;  3DDU A;  2PM9 B;  2QR5 A;  5EML B;  3OKY A;  3FCU A;  5K19 A;  2J57 G;  2BCJ B;  5I5J A;  1VE7 A;  3BG1 A;  2CE9 A;  4ZOX A;  3OKY B;  1NEX B;  4X61 B;  2XE4 A;  2P9L C;  3I8C A;  4E54 B;  4D6V A;  3ZE1 A;  3BG0 A;  3UKU C;  4J78 A;  3L4M D;  3O4G A;  3MKS B;  4GQ1 A;  4LGN A;  1SQ9 A;  5M5T A;  2HKM A;  2PBI B;  5CXC A;  3B7F A;  3EG6 A;  3CFV A;  5EAP A;  3IJE A;  4X60 B;  4G1M A;  5HYN B;  3IJ0 A;  5GMK n;  4MMZ A;  4QAM A;  5E6R A;  3I2N A;  5HE0 B;  2OK4 A;  4BP8 A;  1Q47 A;  3EI3 B;  4ERZ A;  4N14 A;  3IUM A;  4JD2 C;  3K26 A;  3PVU B;  5H1M A;  3F3F A;  5FA5 B;  3IIY A;  2QXV A;  4J0W A;  4JSP C;  4ZN4 A;  1H2X A;  5M5V A;  1JMZ B;  2XU7 A;  5IC7 A;  1VYH C;  5HE2 B;  3SBP A;  4A09 A;  3ZE0 A;  4NSX A;  4J8G A;  4PC0 A;  3ZDX A;  1XHM A;  2AGW A;  3UVK A;  3RFG A;  3VGZ A;  1PEV A;  2I3S A;  5IT9 g;  1PGU A;  5FKR A;  2IAA A;  5IJ7 E;  4O3U B;  4XEI C;  5A2Q g;  4NEN A;  2G9A A;  2HJ4 A;  3JZH A;  5C86 A;  3MUO A;  3MMY A;  2CE8 A;  2VDR A;  2I0T A;  5HQG A;  3IVM A;  4A11 B;  4ERY A;  2VDP A;  1O6F A;  2OVQ B;  2P9P C;  3IUN A;  4X63 B;  3DM0 A;  3O4I A;  2HU5 A;  3T3P A;  3EI3 A;  3GC3 B;  5I5M A;  4YVD A;  4JSN C;  3PE7 A;  4CZX A;  4ZOY A;  2AGL A;  2CNX A;  2H9N A;  3NVQ A;  4QQE A;  4D0K A;  4J73 A;  3SVW D;  4ES0 A;  3OF7 A;  4JT5 C;  5EM2 B;  4CY1 A;  3W15 A;  3KRW B;  3PVW B;  1K8K C;  2AGX A;  3SWS D;  4A08 A;  1N6E A;  4A0B B;  3SN6 B;  4K3J B;  5TEF A;  5C2V B;  4L1M A;  2I3T A;  5FXY A;  2HES X;  4L9O A;  5E6U A;  4CI2 A;  4J77 A;  4AOW A;  4BP9 A;  1C9L A;  2VDK A;  2EID A;  4FHL A;  4FWW A;  2VDL A;  3NID A;  5SXM A;  3SBR A;  3K72 A;  2VZ1 A;  1PI6 A;  4L3G D;  3JB9 L;  1QFM A;  4CY5 A;  4O1Q D;  4Z7Q A;  3SBQ A;  3PXS D;  4FAN D;  3MKQ A;  1QFS A;  3SHF A;  3VI3 A;  4DNW A;  3I7N A;  4U7A A;  2H3X A;  5CXB B;  2XZG A;  1E8N A;  3IJC A;  4CZV A;  4A09 B;  4OWR A;  2I0S A;  3AL9 A;  2P9S C;  4OZU A;  3NIF A;  5HDB A;  4E5Z B;  4A11 A;  4BCD A;  2QC5 A;  3O4J A;  1QNI A;  2H13 A;  2W18 A;  4ESG A;  2VZ3 A;  4A2L A;  4J82 A;  2MTA H;  5THA A;  2Q7Q A;  3ZDZ A;  5C2W B;  5B4W A;  5GXI A;  5TDH B;  2TRC B;  3QI0 A;  1JJU B;  5IJ8 E;  3F3P A;  2GC7 A;  3NIG A;  4AMY A;  5M5S A;  3NVN A;  3C99 A;  2XL2 A;  2AQ5 A;  2XYI A;  3OW8 A;  2PM7 B;  1JV2 A;  3JRP A;  2H6Q A;  3J81 g;  4GQB B;  3I89 A;  4CY3 A;  4DNV A;  4MMY A;  3KCI A;  2PM6 B;  4J86 A;  3ZE2 A;  3VH0 A;  4IMM A;  5H17 A;  4BL0 A;  3UVL A;  2H9L A;  4IA9 A;  3AH8 B;  1B9Y A;  1OLZ A;  2H68 A;  2YBA A;  4PXW A;  4WK4 A;  3CIK B;  2YMU A;  3V9F A;  2HU8 A;  1U8C A;  2OVR B;  4PNK B;  5M5R A;  5H14 A;  2OJY A;  1MDA H;  2I0R A;  2GC4 A;  3ODT A;  4G1E A;  2OVP B;  4GZ8 A;  4A0B A;  4CI3 A;  5IGO A;  1YFQ A;  2EIE A;  4O2W A;  5FKQ A;  5EAR A;  4A08 B;  3MVD K;  2EIC A;  5EM2 A;  3I7H A;  2CN3 A;  3JRO A;  5CXC B;  1MG2 A;  3K27 A;  4PSW B;  4U1E I;  4NAA A;  3MUN A;  2EBS A;  2YNN A;  2HYE A;  3ULE C;  2IUR A;  3OKW A;  5C9Z B;  3OKT A;  1TYQ C;  4X3E A;  2BKL A;  3RN1 D;  2AGZ A;  4JSX C;  1FWX A;  4RE6 A;  1JTD B;  5EAM A;  4E5Z A;  4J8B A;  5K1C C;  4JXM A;  4CI8 A;  3NVX A;  2Z2P A;  3DSM A;  4QL1 A;  1UOO A;  2Z2N A;  3RFH A;  2UZX B;  2P9I C;  3GFC A;  5M61 A;  3AL8 A;  4ZOZ A;  1GOG A;  4Z8L A;  3FGB A;  1TYE A;  2VDO A;  3BWS A;  2UZY B;  2WQ8 A;  2H9M A;  2HXC A;  3EQ8 A;  1U4C A;  4I79 A;  4H5J A;  3JZG A;  4J81 A;  3V5W B;  4CY2 A;  3JAM g;  3SFZ A;  3CFS B;  4LG8 A;  3PSL A;  3JZN A;  5CYK A;  4A2M A;  2QZP A;  2AH1 A;  4JT6 C;  1L5G A;  4G55 A;  1O6G A;  4BCB A;  2B5N A;  2VC2 A;  1BPO A;  3UR4 A;  3EI1 A;  3SXT D;  3JPX A;  1N6D A;  3I7K A;  4BCC A;  3IJ1 A;  5KDO B;  1PBY B;  4UM8 A;  3IUJ A;  4Y5R D;  3MXX A;  5AFU 3;  4JHN A;  4BUJ C;  4L3H D;  5EAL A;  3UVO A;  4RE5 A;  3DXK C;  3PXT D;  3AFC A;  1C9I A;  3IKO A;  3UVM A;  3IUQ A;  4PSX B;  3EU7 A;  5TF2 A;  3K71 A;  2CO0 C;  3J80 g;  4QRJ A;  2AH0 A;  2YNP A;  4UI9 R;  2Z2O A;  5GSA A;  3OTT A;  4D9S A;  1YR2 A;  2H6N A;  3EI4 B;  5FKT A;  1UOQ A;  3E0C A;  3I7L A;  4E54 A;  4FA1 D;  1GOH A;  2EIB A;  2IWF A;  1I2M B;  4Y7R A;  2HJB A;  4JSV C;  3K6S A;  3C5M A;  1R5M A;  3GD1 I;  3EMH A;  4G56 B;  2P9N C;  2PM9 A;  3ZDY A;  3SMR A;  2VDQ A;  3EI4 A;  4O02 A;  3UKR C;  2G99 A;  4ERQ A;  2XDW A;  3N0D A;  3RN0 D;  2H9P A;  5C92 A;  4PBY A;  4GGA A;  5FKS A;  4AEZ A;  4MMX A;  4GMB A;  3T3M A;  3QHY B;  3EI2 B;  4FA5 D;  4NBM A;  2OIZ A;  4H5I A;  3A0F A;  4LG9 A;  2IWK A;  2B5M A;  2H6K A;  1UTC A;  4AX4 A;  4J87 A;  1VZ2 A;  3I8E A;  4CZY A;  4XYI A;  1E8M A;  1N6F A;  2HU7 A;  1SHY B;  1JMX B;  4K3I D;  4GM9 A;  3IUR A;  3OL2 A;  4FA4 D;  2GNQ A;  1RI6 A;  3DXM C;  3V4P A;  5FLX g;  3IUL A;  5CYK B;  4ZOV A;  3SCY A;  4O45 A;  5CXB A;  2J55 H;  3FRX A;  3HFQ A;  3FM0 A;  1OMW B;  5E6S A;  1E5T A;  2VDM A;  3IIW A;  1MG3 A;  4EWR A;  4QT8 A;  1P22 A;  5TEE A;  4DNU A;  3V4V A;  4WJK A;  3EQ9 A;  4KFM B;  4CC9 A;  3RSE C;  3I7O A;  1XKS A;  1H2Z A;  3FCS A;  4GQ2 P;  3SLE D;  4A0A A;  4AN1 A;  4L1Q D;  3P4F A;  4FB1 D;  4BH6 A;  1K32 A;  1GG2 B;  2YB8 B;  5AMS A;  5FFG A;  2B4E A;  4GGD A;  4R7A B;  5FFO A;  3EI2 A;  1S4U X;  3L4O D;  4WK0 A;  4O9D A;  5EMM B;  2CN2 A;  1XIP A;  3V7D B;  5GXH A;  4AN0 A;  3PXW D;  4JHP C;  2VDN A;  4A0A B;  1NR0 A;  1U2V C;  1H2Y A;  4UM9 A;  5EMK B;  2O9K A;  5JWZ A;  2H47 A;  3MZK A;  5IGQ A;  2OK6 A;  1TBG A;  5I5I A;  4TZ4 A;  4Z7O A;  3ZWL B;  1ERJ A;  4CI1 A;  1GOF A;  3F3G A;  2XL3 A;  4J84 A;  2J56 H;  3SJL D;  3RMZ D;  2CO0 A;  1A12 A;  4GM8 A;  4FAV D;  1H2W A;  3O4H A;  2IUV A;  4NC4 A;  1A0R B;  2P9U C;  1JOF A;  5HE3 B;  3VI4 A;  1VZ3 A;  2B5L A;  3EQ7 A;  3GRE A;  1GXR A;  4GM3 A;  2P9K C;  2YNO A;  3OL2 B;  1B9X A;  2IUQ A;  3C75 H;  2IUP A;  5HE1 B;  3N0E A;  3RLM D;  4J79 A;  3EI1 B;  4XYH A;  1GP2 B;  4GGC A;  4IRZ A;  1K3I A;  3I7P A;  3EWE A;  4HDJ A;  4J0X A;  3RRM C;  1T2X A;  2JKX A;  1VE6 A;  3VA6 A;  3PSC B;  2H14 A;  3DWL C;  4WK2 A;  1GOT B;  4FA9 D;  4O3T B;  4Z7N A;  5EMJ B;  4A7J A;  1M1X A;  2AGY A;  3MZL A;  2BBK H;  4PBZ A;  3U4Y A;  3ORV D;  4MK0 B;  3KRX B; 
#chains in the Genus database with same CATH homology
 3T3M A;  2VC2 A;  3ZDX A;  1JV2 A;  3IJE A;  5E6U A;  4G1M A;  4Z7O A;  3T3P A;  5E6S A;  2VDK A;  2VDM A;  1TYE A;  3NID A;  2VDL A;  5FFG A;  3K72 A;  2VDO A;  4MMZ A;  3FCU A;  4UM8 A;  3NIF A;  4IRZ A;  5FFO A;  5HDB A;  4MMY A;  3K6S A;  3ZE2 A;  5E6R A;  4WK0 A;  4Z7Q A;  3ZDY A;  2VDQ A;  4WK2 A;  4WJK A;  3V4V A;  3ZDZ A;  4Z7N A;  4O02 A;  4WK4 A;  3VI3 A;  1M1X A;  3ZE1 A;  4NEN A;  1U8C A;  2VDN A;  3K71 A;  3V4P A;  3VI4 A;  3NIG A;  2VDR A;  3FCS A;  4UM9 A;  4G1E A;  1L5G A;  2VDP A;  3ZE0 A;  4MMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...