3ZE1A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze1A00
2VDNA 3VI3A 3NIDA 4WK2A 3T3PA 4Z7OA 3V4PA 3T3MA 4MMXA 2VDPA 4IRZA 4Z7NA 3IJEA 4O02A 2VDMA 4MMYA 2VDRA 2VDLA 1JV2A 2VDQA 4WK0A 2VC2A 3ZE0A 3ZDYA 5E6RA 3FCUA 5FFGA 3ZE2A 5FFOA 3VI4A 3NIGA 1L5GA 3ZDZA 4UM8A 1M1XA 5E6UA 3K6SA 4UM9A 3K71A 3FCSA 3NIFA 5E6SA 3ZE1A 2VDOA 4NENA 3ZDXA 3K72A 1TYEA 5HDBA 4G1EA 4WJKA 4WK4A 2VDKA 4MMZA 4Z7QA 1U8CA 3V4VA 4G1MA
chains in the Genus database with same CATH superfamily
4ERZA 1QFSA 2IAAA 4H5IA 3NIDA 3OKTA 2Z2OA 4G55A 4JD2C 4PBYA 3DM0A 4J0XA 4QT8A 2W18A 5TDHB 1JV2A 3RLMD 4L3GD 2H6NA 4FWWA 4RE5A 3L4OD 4FA1D 3JAMg 4PBZA 3OKYA 3ZWLB 5C86A 3O4JA 5IC7A 4X61B 3SHFA 2I3TA 3BG1A 1O6GA 3P4FA 4EWRA 4NSXA 4Y7RA 4WJKA 2H6KA 4G1MA 3MZLA 4CI2A 5FKQA 1VZ2A 3RSEC 4A09A 4JT5C 3N0EA 4ZOVA 4DNVA 4PNKB 4E54A 3I8CA 3FGBA 5THAA 2H14A 4O02A 2OIZA 3DSMA 4MMYA 3C75H 2YMUA 4GM8A 3NVQA 1O6FA 1VE6A 2EIEA 2P9LC 3DWLC 4I79A 4O3TB 3IJCA 3PXWD 3FM0A 4OZUA 1PGUA 4H5JA 1NEXB 2XYIA 4O1QD 4X60B 3ZDXA 4ZN4A 4J73A 3EI2B 4A0AB 4CZXA 4ZOXA 4BL0A 3I8EA 1UOQA 4ZOZA 5AFU3 2Q7QA 4O2WA 5CYKB 4IRZA 3EI3A 2JKXA 3EWEA 2Z2PA 5IJ7E 1E5TA 2VDLA 3PXSD 1N6DA 3IIWA 1N6EA 5K19A 5C9ZB 1H2WA 2CNXA 4D9SA 1N6FA 3MMYA 2VDOA 4K3JB 3EQ8A 4YVDA 2AQ5A 2P9UC 2IWFA 5M5SA 1C9LA 3NVNA 3OW8A 4O45A 3SXTD 4ES0A 4PXWA 2PM6B 5GSAA 3EQ9A 3IJEA 2H47A 2VDMA 3JZNA 4AOWA 4BH6A 4A7JA 3EI2A 4A0AA 2H9MA 3IJ1A 5EAMA 2TRCB 3I7LA 4L9OA 2CO0A 2QXVA 1K8KC 3KRWB 3ULEC 2BBKH 4U1EI 1YR2A 1GG2B 2YNPA 2GC7A 1SQJA 2YNOA 3EQ7A 3OL2A 3O4GA 2HJ4A 5EMJB 5SXMA 4BP8A 3I2NA 5IT9g 3UR4A 1JTDB 4JHPC 4E5ZA 2UZXB 4GQBB 3C9CA 3AL9A 4GZ8A 2AGYA 3MKQA 4D0KA 4RE6A 2PM9A 1K3IA 3IIYA 3UKRC 1B9XA 5M5UA 2IWKA 4MK0B 1UOPA 4FB1D 5TEEA 3UVKA 1A12A 4DNUA 3UKUC 3QI0A 4J8GA 3CFVA 4TZ4A 2QZPA 2J56H 5FKSA 1OLZA 4U7AA 2AGWA 5M5TA 4A09B 2VZ3A 2AH0A 3K72A 1TYEA 4J86A 4ERYA 4E54B 3KCIA 3UVNA 1XHMA 1GOTB 2HJBA 2CE8A 4BCDA 3VI3A 4PSWB 3EI4A 2EBSA 2VDRA 5IJ8E 3O4HA 2OVRB 4CC9A 3PXTD 2VC2A 3VH0A 2VZ1A 3JZGA 4XYHA 3EU7A 3K26A 2XDWA 2HKMA 4A11B 1VYHC 2PBIB 2YNNA 5H14A 5I5IA 3E0CA 3EG6A 3V7DB 4JSVC 3I89A 1MG2A 3RRMC 3EI3B 5IGQA 3VA6A 1JJUB 4JSNC 3GREA 1VZ3A 4L1MA 3SJLD 5GXIA 5FKRA 3I7HA 3V5WB 1YFQA 4J82A 5JWZA 1S4UX 2I0SA 5AMSA 4A2MA 3BWSA 2XE4A 3DXMC 4Y5RD 4FAVD 3L4MD 3IUMA 3JPXA 4CY5A 3UVOA 5EMLB 1L5GA 1C9IA 1M1XA 4FA4D 4CY3A 5GXHA 3DXKC 4GM3A 2J55H 2B4EA 3FRXA 3MXXA 3SVWD 4JHNA 4CY1A 1GP2B 5FXYA 2HXCA 4A11A 1UTCA 4JSXC 3OL2B 4J77A 1JMZB 2H68A 4X3EA 3RN1D 4E5ZB 4AEZA 4UM8A 1K32A 3SCYA 4UM9A 4FA9D 1MG3A 2HYEA 2PM9B 3KRXB 1I2MB 3EI1B 2J57G 3GD1I 4BCCA 3UVLA 3ODTA 3NVXA 5H1MA 3N0DA 3I7NA 2I3SA 1B9YA 1U8CA 5TF2A 3V4VA 1MDAH 3AL8A 5K1CC 1H2ZA 2AGXA 1L0QA 1GOFA 2VDPA 3PE7A 1E8MA 2O9KA 4NAAA 4Z8LA 5M5RA 3BG0A 3SBPA 3PVUB 1R5MA 4K3ID 2G99A 1SQ9A 3ZE2A 4QQEA 2IUPA 4O9DA 4A2LA 4R7AB 3JRPA 2GNQA 3EI4B 3I7PA 3VGZA 4D6VA 2GC4A 2HU8A 3K27A 2VDKA 4MMZA 4UI9R 3W15A 3J81g 2Z2NA 2H3XA 4JXMA 4IMMA 3GC3B 5M61A 1XKSA 4J79A 3SBQA 5GMKn 3SWSD 4MMXA 3EI1A 4BCBA 1JMXB 3RFHA 1TBGA 3ZDYA 4XEIC 4LG8A 5EMMB 4GMBA 4NC4A 2H9LA 3RN0D 1H2YA 3SBRA 4QRJA 2P9PC 3IJ0A 4L1QD 3MKSB 4ZOYA 4GM9A 4GQ2P 5HYNB 2CN2A 2HESX 5CXBA 3IVMA 2XZGA 4PSXB 4GGDA 2QC5A 3GFCA 1A0RB 3O4IA 3MVDK 5HE2B 3CFSB 5H17A 5FLXg 2G9AA 2BCJB 4HDJA 1T2XA 3FCUA 3IURA 5E6RA 2UZYB 2XL2A 5HE3B 5C2VB 2QR5A 4CY2A 2CO0C 2P9KC 4G1EA 4X63B 1Q47A 2VDNA 4GGCA 2B5LA 3PSLA 3OF7A 3SLED 2OVPB 3JZHA 4QAMA 5HQGA 5EALA 4A0BA 1QFMA 5IGOA 3JROA 2MTAH 2HU5A 4IA9A 1NR0A 2OK6A 3ZDZA 3AL8B 4CZVA 3AFCA 3MUNA 3NIFA 5E6SA 3PVWB 1XIPA 2OK4A 2HU7A 2I0TA 2IURA 4GGAA 5M5VA 2XL3A 1H2XA 2B5MA 4DNWA 5HDBA 2B5NA 5FKTA 1VE7A 3MUOA 4FHLA 2EICA 1ERJA 2AH1A 2I0RA 2P9NC 4AN0A 3OTTA 2YB8B 5HE1B 1GOHA 1PEVA 3V9FA 2WQ8A 3F3PA 3J80g 1GXRA 4WK0A 4AMYA 3ZE0A 4J78A 4JSPC 5AJAA 2EIDA 5I5JA 1U2VC 3K6SA 4A08B 5E6UA 4BUJC 1OMWB 4CI1A 3K71A 3RMZD 3F3GA 2CE9A 4NENA 4JT6C 5EM2B 4Z7QA 2AGLA 4J8BA 5EMKB 3F3FA 4WK2A 1JOFA 3T3PA 1E8NA 3IUQA 4Z7OA 1RI6A 2YBAA 2CN3A 4J0WA 3T3MA 4J84A 4Z7NA 5A2Qg 2XU7A 2IUQA 3I7KA 3AH8B 5CXCB 3JB9L 2VDQA 2H9PA 5EAPA 1FWXA 4OWRA 1BPOA 3NIGA 3SN6B 3VI4A 2AGZA 1U4CA 5CXBB 4LGNA 1P22A 5I5MA 3IUJA 4FAND 4NBMA 2OVQB 5C2WB 3IKOA 2IUVA 4O3UB 4BP9A 3EMHA 3PSCB 4J81A 4CI8A 3RFGA 2EIBA 4A08A 4AMZA 4ESGA 3B7FA 2BKLA 3V4PA 5KDOB 4CI3A 4AX4A 2PM7B 2H9NA 2OJYA 5EM2A 3SFZA 3I7OA 4ERQA 5FA5B 3IUNA 4N14A 3OKWA 3A0FA 3C99A 2H6QA 3QHYB 3U4YA 1QNIA 2H13A 2HKRA 5CYKA 4G56B 3ZE1A 5C92A 4A0BB 4FA5D 1PI6A 5CXCA 4LG9A 4WK4A 3SMRA 3MZKA 3CIKB 4CZYA 1PBYB 4J87A 3OKYB 4KFMB 3UVMA 4XYIA 2P9SC 1SHYB 3C5MA 5EARA 5FFGA 5FFOA 1UOOA 3IULA 3HFQA 4L3HD 3DDUA 5HE0B 5TEFA 3FCSA 4AN1A 3ORVD 5FQDA 4QL1A 2P9IC 4GQ1A 5B4WA 1GOGA 1TYQC 4PC0A
chains in the Genus database with same CATH topology
2VDNA 3VI3A 3NIDA 4WK2A 3T3PA 4Z7OA 3V4PA 3T3MA 4MMXA 2VDPA 4IRZA 4Z7NA 3IJEA 4O02A 2VDMA 4MMYA 2VDRA 2VDLA 1JV2A 2VDQA 4WK0A 2VC2A 3ZE0A 3ZDYA 5E6RA 3FCUA 5FFGA 3ZE2A 5FFOA 3VI4A 3NIGA 1L5GA 3ZDZA 4UM8A 1M1XA 5E6UA 3K6SA 4UM9A 3K71A 3FCSA 3NIFA 5E6SA 3ZE1A 2VDOA 4NENA 3ZDXA 3K72A 1TYEA 5HDBA 4G1EA 4WJKA 4WK4A 2VDKA 4MMZA 4Z7QA 1U8CA 3V4VA 4G1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDN A;  3VI3 A;  3NID A;  4WK2 A;  3T3P A;  4Z7O A;  3V4P A;  3T3M A;  4MMX A;  2VDP A;  4IRZ A;  4Z7N A;  3IJE A;  4O02 A;  2VDM A;  4MMY A;  2VDR A;  2VDL A;  1JV2 A;  2VDQ A;  4WK0 A;  2VC2 A;  3ZE0 A;  3ZDY A;  5E6R A;  3FCU A;  5FFG A;  3ZE2 A;  5FFO A;  3VI4 A;  3NIG A;  1L5G A;  3ZDZ A;  4UM8 A;  1M1X A;  5E6U A;  3K6S A;  4UM9 A;  3K71 A;  3FCS A;  3NIF A;  5E6S A;  3ZE1 A;  2VDO A;  4NEN A;  3ZDX A;  3K72 A;  1TYE A;  5HDB A;  4G1E A;  4WJK A;  4WK4 A;  2VDK A;  4MMZ A;  4Z7Q A;  1U8C A;  3V4V A;  4G1M A; 
#chains in the Genus database with same CATH topology
 4ERZ A;  1QFS A;  2IAA A;  4H5I A;  3NID A;  3OKT A;  2Z2O A;  4G55 A;  4JD2 C;  4PBY A;  3DM0 A;  4J0X A;  4QT8 A;  2W18 A;  5TDH B;  1JV2 A;  3RLM D;  4L3G D;  2H6N A;  4FWW A;  4RE5 A;  3L4O D;  4FA1 D;  3JAM g;  4PBZ A;  3OKY A;  3ZWL B;  5C86 A;  3O4J A;  5IC7 A;  4X61 B;  3SHF A;  2I3T A;  3BG1 A;  1O6G A;  3P4F A;  4EWR A;  4NSX A;  4Y7R A;  4WJK A;  2H6K A;  4G1M A;  3MZL A;  4CI2 A;  5FKQ A;  1VZ2 A;  3RSE C;  4A09 A;  4JT5 C;  3N0E A;  4ZOV A;  4DNV A;  4PNK B;  4E54 A;  3I8C A;  3FGB A;  5THA A;  2H14 A;  4O02 A;  2OIZ A;  3DSM A;  4MMY A;  3C75 H;  2YMU A;  4GM8 A;  3NVQ A;  1O6F A;  1VE6 A;  2EIE A;  2P9L C;  3DWL C;  4I79 A;  4O3T B;  3IJC A;  3PXW D;  3FM0 A;  4OZU A;  1PGU A;  4H5J A;  1NEX B;  2XYI A;  4O1Q D;  4X60 B;  3ZDX A;  4ZN4 A;  4J73 A;  3EI2 B;  4A0A B;  4CZX A;  4ZOX A;  4BL0 A;  3I8E A;  1UOQ A;  4ZOZ A;  5AFU 3;  2Q7Q A;  4O2W A;  5CYK B;  4IRZ A;  3EI3 A;  2JKX A;  3EWE A;  2Z2P A;  5IJ7 E;  1E5T A;  2VDL A;  3PXS D;  1N6D A;  3IIW A;  1N6E A;  5K19 A;  5C9Z B;  1H2W A;  2CNX A;  4D9S A;  1N6F A;  3MMY A;  2VDO A;  4K3J B;  3EQ8 A;  4YVD A;  2AQ5 A;  2P9U C;  2IWF A;  5M5S A;  1C9L A;  3NVN A;  3OW8 A;  4O45 A;  3SXT D;  4ES0 A;  4PXW A;  2PM6 B;  5GSA A;  3EQ9 A;  3IJE A;  2H47 A;  2VDM A;  3JZN A;  4AOW A;  4BH6 A;  4A7J A;  3EI2 A;  4A0A A;  2H9M A;  3IJ1 A;  5EAM A;  2TRC B;  3I7L A;  4L9O A;  2CO0 A;  2QXV A;  1K8K C;  3KRW B;  3ULE C;  2BBK H;  4U1E I;  1YR2 A;  1GG2 B;  2YNP A;  2GC7 A;  1SQJ A;  2YNO A;  3EQ7 A;  3OL2 A;  3O4G A;  2HJ4 A;  5EMJ B;  5SXM A;  4BP8 A;  3I2N A;  5IT9 g;  3UR4 A;  1JTD B;  4JHP C;  4E5Z A;  2UZX B;  4GQB B;  3C9C A;  3AL9 A;  4GZ8 A;  2AGY A;  3MKQ A;  4D0K A;  4RE6 A;  2PM9 A;  1K3I A;  3IIY A;  3UKR C;  1B9X A;  5M5U A;  2IWK A;  4MK0 B;  1UOP A;  4FB1 D;  5TEE A;  3UVK A;  1A12 A;  4DNU A;  3UKU C;  3QI0 A;  4J8G A;  3CFV A;  4TZ4 A;  2QZP A;  2J56 H;  5FKS A;  1OLZ A;  4U7A A;  2AGW A;  5M5T A;  4A09 B;  2VZ3 A;  2AH0 A;  3K72 A;  1TYE A;  4J86 A;  4ERY A;  4E54 B;  3KCI A;  3UVN A;  1XHM A;  1GOT B;  2HJB A;  2CE8 A;  4BCD A;  3VI3 A;  4PSW B;  3EI4 A;  2EBS A;  2VDR A;  5IJ8 E;  3O4H A;  2OVR B;  4CC9 A;  3PXT D;  2VC2 A;  3VH0 A;  2VZ1 A;  3JZG A;  4XYH A;  3EU7 A;  3K26 A;  2XDW A;  2HKM A;  4A11 B;  1VYH C;  2PBI B;  2YNN A;  5H14 A;  5I5I A;  3E0C A;  3EG6 A;  3V7D B;  4JSV C;  3I89 A;  1MG2 A;  3RRM C;  3EI3 B;  5IGQ A;  3VA6 A;  1JJU B;  4JSN C;  3GRE A;  1VZ3 A;  4L1M A;  3SJL D;  5GXI A;  5FKR A;  3I7H A;  3V5W B;  1YFQ A;  4J82 A;  5JWZ A;  1S4U X;  2I0S A;  5AMS A;  4A2M A;  3BWS A;  2XE4 A;  3DXM C;  4Y5R D;  4FAV D;  3L4M D;  3IUM A;  3JPX A;  4CY5 A;  3UVO A;  5EML B;  1L5G A;  1C9I A;  1M1X A;  4FA4 D;  4CY3 A;  5GXH A;  3DXK C;  4GM3 A;  2J55 H;  2B4E A;  3FRX A;  3MXX A;  3SVW D;  4JHN A;  4CY1 A;  1GP2 B;  5FXY A;  2HXC A;  4A11 A;  1UTC A;  4JSX C;  3OL2 B;  4J77 A;  1JMZ B;  2H68 A;  4X3E A;  3RN1 D;  4E5Z B;  4AEZ A;  4UM8 A;  1K32 A;  3SCY A;  4UM9 A;  4FA9 D;  1MG3 A;  2HYE A;  2PM9 B;  3KRX B;  1I2M B;  3EI1 B;  2J57 G;  3GD1 I;  4BCC A;  3UVL A;  3ODT A;  3NVX A;  5H1M A;  3N0D A;  3I7N A;  2I3S A;  1B9Y A;  1U8C A;  5TF2 A;  3V4V A;  1MDA H;  3AL8 A;  5K1C C;  1H2Z A;  2AGX A;  1L0Q A;  1GOF A;  2VDP A;  3PE7 A;  1E8M A;  2O9K A;  4NAA A;  4Z8L A;  5M5R A;  3BG0 A;  3SBP A;  3PVU B;  1R5M A;  4K3I D;  2G99 A;  1SQ9 A;  3ZE2 A;  4QQE A;  2IUP A;  4O9D A;  4A2L A;  4R7A B;  3JRP A;  2GNQ A;  3EI4 B;  3I7P A;  3VGZ A;  4D6V A;  2GC4 A;  2HU8 A;  3K27 A;  2VDK A;  4MMZ A;  4UI9 R;  3W15 A;  3J81 g;  2Z2N A;  2H3X A;  4JXM A;  4IMM A;  3GC3 B;  5M61 A;  1XKS A;  4J79 A;  3SBQ A;  5GMK n;  3SWS D;  4MMX A;  3EI1 A;  4BCB A;  1JMX B;  3RFH A;  1TBG A;  3ZDY A;  4XEI C;  4LG8 A;  5EMM B;  4GMB A;  4NC4 A;  2H9L A;  3RN0 D;  1H2Y A;  3SBR A;  4QRJ A;  2P9P C;  3IJ0 A;  4L1Q D;  3MKS B;  4ZOY A;  4GM9 A;  4GQ2 P;  5HYN B;  2CN2 A;  2HES X;  5CXB A;  3IVM A;  2XZG A;  4PSX B;  4GGD A;  2QC5 A;  3GFC A;  1A0R B;  3O4I A;  3MVD K;  5HE2 B;  3CFS B;  5H17 A;  5FLX g;  2G9A A;  2BCJ B;  4HDJ A;  1T2X A;  3FCU A;  3IUR A;  5E6R A;  2UZY B;  2XL2 A;  5HE3 B;  5C2V B;  2QR5 A;  4CY2 A;  2CO0 C;  2P9K C;  4G1E A;  4X63 B;  1Q47 A;  2VDN A;  4GGC A;  2B5L A;  3PSL A;  3OF7 A;  3SLE D;  2OVP B;  3JZH A;  4QAM A;  5HQG A;  5EAL A;  4A0B A;  1QFM A;  5IGO A;  3JRO A;  2MTA H;  2HU5 A;  4IA9 A;  1NR0 A;  2OK6 A;  3ZDZ A;  3AL8 B;  4CZV A;  3AFC A;  3MUN A;  3NIF A;  5E6S A;  3PVW B;  1XIP A;  2OK4 A;  2HU7 A;  2I0T A;  2IUR A;  4GGA A;  5M5V A;  2XL3 A;  1H2X A;  2B5M A;  4DNW A;  5HDB A;  2B5N A;  5FKT A;  1VE7 A;  3MUO A;  4FHL A;  2EIC A;  1ERJ A;  2AH1 A;  2I0R A;  2P9N C;  4AN0 A;  3OTT A;  2YB8 B;  5HE1 B;  1GOH A;  1PEV A;  3V9F A;  2WQ8 A;  3F3P A;  3J80 g;  1GXR A;  4WK0 A;  4AMY A;  3ZE0 A;  4J78 A;  4JSP C;  5AJA A;  2EID A;  5I5J A;  1U2V C;  3K6S A;  4A08 B;  5E6U A;  4BUJ C;  1OMW B;  4CI1 A;  3K71 A;  3RMZ D;  3F3G A;  2CE9 A;  4NEN A;  4JT6 C;  5EM2 B;  4Z7Q A;  2AGL A;  4J8B A;  5EMK B;  3F3F A;  4WK2 A;  1JOF A;  3T3P A;  1E8N A;  3IUQ A;  4Z7O A;  1RI6 A;  2YBA A;  2CN3 A;  4J0W A;  3T3M A;  4J84 A;  4Z7N A;  5A2Q g;  2XU7 A;  2IUQ A;  3I7K A;  3AH8 B;  5CXC B;  3JB9 L;  2VDQ A;  2H9P A;  5EAP A;  1FWX A;  4OWR A;  1BPO A;  3NIG A;  3SN6 B;  3VI4 A;  2AGZ A;  1U4C A;  5CXB B;  4LGN A;  1P22 A;  5I5M A;  3IUJ A;  4FAN D;  4NBM A;  2OVQ B;  5C2W B;  3IKO A;  2IUV A;  4O3U B;  4BP9 A;  3EMH A;  3PSC B;  4J81 A;  4CI8 A;  3RFG A;  2EIB A;  4A08 A;  4AMZ A;  4ESG A;  3B7F A;  2BKL A;  3V4P A;  5KDO B;  4CI3 A;  4AX4 A;  2PM7 B;  2H9N A;  2OJY A;  5EM2 A;  3SFZ A;  3I7O A;  4ERQ A;  5FA5 B;  3IUN A;  4N14 A;  3OKW A;  3A0F A;  3C99 A;  2H6Q A;  3QHY B;  3U4Y A;  1QNI A;  2H13 A;  2HKR A;  5CYK A;  4G56 B;  3ZE1 A;  5C92 A;  4A0B B;  4FA5 D;  1PI6 A;  5CXC A;  4LG9 A;  4WK4 A;  3SMR A;  3MZK A;  3CIK B;  4CZY A;  1PBY B;  4J87 A;  3OKY B;  4KFM B;  3UVM A;  4XYI A;  2P9S C;  1SHY B;  3C5M A;  5EAR A;  5FFG A;  5FFO A;  1UOO A;  3IUL A;  3HFQ A;  4L3H D;  3DDU A;  5HE0 B;  5TEF A;  3FCS A;  4AN1 A;  3ORV D;  5FQD A;  4QL1 A;  2P9I C;  4GQ1 A;  5B4W A;  1GOG A;  1TYQ C;  4PC0 A; 
#chains in the Genus database with same CATH homology
 2VDN A;  3VI3 A;  3NID A;  4WK2 A;  3T3P A;  4Z7O A;  3V4P A;  3T3M A;  4MMX A;  2VDP A;  4IRZ A;  4Z7N A;  3IJE A;  4O02 A;  2VDM A;  4MMY A;  2VDR A;  2VDL A;  1JV2 A;  2VDQ A;  4WK0 A;  2VC2 A;  3ZE0 A;  3ZDY A;  5E6R A;  3FCU A;  5FFG A;  3ZE2 A;  5FFO A;  3VI4 A;  3NIG A;  1L5G A;  3ZDZ A;  4UM8 A;  1M1X A;  5E6U A;  3K6S A;  4UM9 A;  3K71 A;  3FCS A;  3NIF A;  5E6S A;  3ZE1 A;  2VDO A;  4NEN A;  3ZDX A;  3K72 A;  1TYE A;  5HDB A;  4G1E A;  4WJK A;  4WK4 A;  2VDK A;  4MMZ A;  4Z7Q A;  1U8C A;  3V4V A;  4G1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...