2HJ4A

Crystal structure of alcaligenes faecalis aadh complex with p-nitrobenzylamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
357
structure length
357
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase; chain D, H
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 93
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hj4A01
4JSNC 4GQ2P 5IGOA 4EWRA 5EALA 2AGYA 4ERZA 3CFSB 2UZXB 4ZN4A 4J84A 4GQ1A 3EI1B 4PSXB 2CN3A 4X63B 2W18A 2YNNA 4KFMB 3EI3A 1B9XA 3JB9L 5CYKB 4ZOVA 5I5IA 4ESGA 2YNOA 2OK4A 4J82A 2H6QA 4LG9A 1XIPA 2P9LC 4GGDA 5TF2A 4PSWB 5I5MA 5HYNB 1NEXB 2BCJB 3EI4A 3P4FA 3IJ1A 2Z2OA 4FWWA 2PM9A 2XU7A 3AH8B 1MDAH 4A09B 4FHLA 2AGLA 2CO0C 2YMUA 1FWXA 2HJ4A 4A0AA 4PNKB 3NVXA 5EMMB 4L3GD 2AGXA 4CC9A 1NR0A 3DSMA 3IIYA 5CXCA 5IGQA 3ZWLB 3GREA 3I8EA 5C9ZB 2J55H 1TYQC 3CIKB 3DXKC 4U1EI 4K3ID 2IUVA 3IJ0A 3DM0A 2CN2A 1N6EA 2H3XA 3RN0D 4A11A 5FKRA 5H1MA 1B9YA 4CI3A 3EI2A 2EBSA 4AEZA 4R7AB 3EI3B 4J8GA 2OVQB 4CZXA 2YB8B 3MZKA 4Y5RD 3KRXB 4G56B 3C99A 1K32A 2H9MA 3UVOA 1N6FA 4JD2C 4J0WA 3F3FA 2HKMA 1JMXB 4QQEA 4HDJA 2GC4A 4E54A 3B7FA 3I7OA 4PBYA 3BG0A 2CO0A 2H6NA 3SJLD 5GMKn 3C9CA 3EI4B 3PSCB 3VGZA 2PM9B 2P9KC 1OLZA 3NVNA 4FAVD 3JRPA 1JJUB 1P22A 4L9OA 4Y7RA 3OTTA 3K27A 3V7DB 1GP2B 4LG8A 3EG6A 3FGBA 5SXMA 1MG2A 3SLED 1VYHC 4A0AB 1U4CA 2PBIB 2H47A 4XEIC 2B5LA 4D6VA 3I7NA 3SWSD 5CXCB 4X60B 2HJBA 2OVPB 2XL3A 3UVNA 3OW8A 3L4OD 2GNQA 4GM8A 2P9IC 3HFQA 2H68A 1JOFA 2AGWA 4UI9R 5I5JA 2J57G 3I7PA 1L0QA 3IKOA 4A11B 4GM3A 1SQJA 3I89A 2B4EA 3EI2B 5HE2B 4X61B 3UVMA 3SN6B 2PM6B 3AL9A 1PEVA 2H14A 1PGUA 3RRMC 2I0RA 4FA5D 5K1CC 5EM2A 4A08A 3SFZA 3JAMg 2GC7A 5GXIA 5EMJB 3VA6A 3W15A 3UKUC 4FA9D 3ULEC 4BL0A 4CY2A 3DWLC 4N14A 3OL2A 3J80g 1RI6A 4CI2A 2G9AA 2XL2A 1A0RB 5GSAA 4E54B 3C75H 4ZOYA 3V9FA 3MKQA 1U2VC 3RMZD 4IA9A 4CY1A 5JWZA 3PXSD 3AFCA 4ERYA 3BG1A 1GXRA 2AQ5A 3SBQA 3GFCA 5IJ7E 2HYEA 2QC5A 4PXWA 4CI1A 2IURA 3AL8A 4GGCA 4FA4D 5AMSA 5AJAA 4J79A 5CXBA 5EAMA 2CNXA 1OMWB 3OKTA 4GM9A 5FLXg 3RFHA 3UVLA 4J81A 4O1QD 4J8BA 3MMYA 5IC7A 2H6KA 2P9UC 3I2NA 3PXWD 4OWRA 4CY5A 3ORVD 2OIZA 4JSPC 4ZOZA 4CI8A 5TDHB 3JROA 3C5MA 4ES0A 2OJYA 1ERJA 1PBYB 5EM2B 4A08B 4K3JB 2CE8A 2Z2NA 4H5JA 3EWEA 4JSXC 2H9PA 3PE7A 1XHMA 3OL2B 4U7AA 1TBGA 5TEEA 3K26A 5HE1B 2H9LA 2PM7B 2CE9A 4GGAA 2IUPA 2IWFA 2AH0A 3F3GA 4J77A 3SBRA 3UKRC 3SBPA 3UVKA 2IUQA 3UR4A 4GZ8A 4MK0B 1MG3A 3I8CA 3FRXA 4J0XA 4BUJC 2I3SA 3AL8B 3MKSB 4A0BA 5HE0B 5THAA 5CXBB 2I0SA 4LGNA 5H14A 5H17A 2OVRB 4J86A 5C2VB 4O3UB 2HKRA 5EMKB 4A2LA 3OKYA 4PC0A 4L3HD 2O9KA 4D0KA 5AFU3 3EMHA 4J73A 2TRCB 4J78A 2BBKH 1S4UX 4JT5C 3I7KA 1GOTB 3PXTD 5EMLB 2XYIA 3U4YA 3VH0A 5TEFA 2HESX 4O3TB 4H5IA 2H13A 2Z2PA 3E0CA 3SMRA 4PBZA 3RLMD 4BH6A 4QT8A 4XYIA 1Q47A 3V5WB 3PSLA 4Z8LA 5EAPA 2P9PC 5FKTA 4O45A 4J87A 3JZHA 5IT9g 5FXYA 5A2Qg 3SVWD 3RSEC 3JZGA 4CZVA 4A7JA 3ODTA 4E5ZA 4IMMA 3NVQA 3PVWB 5K19A 2B5MA 3N0EA 3MZLA 5FKSA 4NSXA 2Q7QA 3MXXA 2YBAA 4O9DA 3BWSA 3SCYA 2J56H 4A0BB 3SHFA 1GG2B 4YVDA 5FA5B 2IAAA 4XYHA 3N0DA 5C2WB 4OZUA 2IWKA 2HXCA 3EI1A 3A0FA 5GXHA 1K8KC 3OKYB 2I3TA 3J81g 3CFVA 4QL1A 5HQGA 3IJCA 4GMBA 1R5MA 3I7HA 5CYKA 4A2MA 3F3PA 2B5NA 2P9NC 1N6DA 5KDOB 5B4WA 3DXMC 4JSVC 1XKSA 5FKQA 2AH1A 2YNPA 1SHYB 2UZYB 4CZYA 1SQ9A 2H9NA 2MTAH 5EARA 4QRJA 1JMZB 4TZ4A 2P9SC 3EU7A 3RFGA 4FAND 3L4MD 4I79A 2QXVA 5FQDA 1QNIA 2G99A 4FB1D 4JXMA 2AGZA 3FM0A 3JPXA 4A09A 4ZOXA 5IJ8E 4AOWA 2I0TA 3OKWA 4CY3A 4ERQA 2OK6A 3IIWA 4X3EA 4FA1D 4E5ZB 3JZNA 4GQBB 1YFQA 3KRWB 1PI6A 4JT6C 3I7LA 5HE3B 4L1QD 3SXTD 3RN1D 3PVUB
chains in the Genus database with same CATH superfamily
2JKXA 4JSNC 4GQ2P 1UOQA 5IGOA 4EWRA 5EALA 2AGYA 2XZGA 4ERZA 3CFSB 3FCUA 2UZXB 4ZN4A 4J84A 4GQ1A 3EI1B 4PSXB 2CN3A 4X63B 2W18A 2YNNA 4KFMB 3EI3A 1B9XA 4MMZA 3JB9L 2HU5A 5CYKB 4ZOVA 5M5UA 5I5IA 1M1XA 4ESGA 2YNOA 2OK4A 1TYEA 1GOHA 4RE5A 4J82A 3MUOA 2H6QA 3IURA 4LG9A 1XIPA 2P9LC 4Z7OA 4GGDA 1C9LA 3NIDA 4AN0A 3IUMA 4PSWB 1E8MA 1H2ZA 5TF2A 5HYNB 5I5MA 1NEXB 3ZE0A 2BCJB 5M5TA 3EI4A 4AN1A 3P4FA 3IJ1A 2Z2OA 4FWWA 2PM9A 2XU7A 3AH8B 1MDAH 4A09B 4FHLA 2AGLA 2CO0C 2YMUA 2VDOA 1FWXA 2HJ4A 4A0AA 2EIEA 4PNKB 3NVXA 5EMMB 3IUJA 4L3GD 4NENA 2AGXA 4CC9A 1NR0A 3DSMA 3IIYA 5CXCA 5IGQA 3ZWLB 4BCCA 3GREA 1H2XA 3I8EA 5C9ZB 2J55H 1TYQC 3CIKB 4BCBA 3DXKC 4U1EI 1UOPA 4K3ID 2IUVA 4G55A 3IJ0A 3DM0A 2CN2A 1N6EA 2H3XA 3RN0D 4A11A 1L5GA 5FKRA 5H1MA 1B9YA 4CI3A 3EI2A 2EBSA 3EQ7A 4RE6A 4AEZA 4R7AB 3EI3B 3EQ8A 4J8GA 2OVQB 4CZXA 2YB8B 3MZKA 2XE4A 4Y5RD 3KRXB 4G56B 4DNVA 3C99A 1K32A 2H9MA 3UVOA 1N6FA 4JD2C 4J0WA 3VI4A 3F3FA 2HKMA 1JMXB 4QQEA 4HDJA 2GC4A 4E54A 3B7FA 3K71A 4DNUA 3I7OA 4PBYA 3BG0A 2CO0A 2H6NA 3SJLD 3ZDZA 4QAMA 5GMKn 3C9CA 3EI4B 3PSCB 3VGZA 4WK4A 2PM9B 2P9KC 1OLZA 3NVNA 4FAVD 3JRPA 1JJUB 1P22A 4L9OA 3OF7A 4Y7RA 2EICA 4Z7QA 3OTTA 3K27A 3V7DB 1GP2B 4LG8A 3EG6A 3FGBA 5SXMA 1MG2A 2VZ3A 3SLED 1VYHC 4A0AB 1U4CA 1VE7A 2PBIB 2H47A 4XEIC 2B5LA 4D6VA 3I7NA 1GOGA 3SWSD 4WJKA 5CXCB 2VDMA 4X60B 2HJBA 2OVPB 2XL3A 3UVNA 3OW8A 3L4OD 2GNQA 5M5VA 4GM8A 2P9IC 3HFQA 2H68A 1JOFA 2AGWA 4UI9R 3T3PA 5I5JA 4MMXA 2J57G 3I7PA 1L0QA 3IKOA 4A11B 4GM3A 1SQJA 3I89A 2B4EA 1K3IA 2VDNA 5E6RA 5HDBA 3MUNA 4BCDA 4DNWA 3EI2B 5HE2B 4X61B 3UVMA 3SN6B 2PM6B 3AL9A 3K72A 3GD1I 1PEVA 3NIFA 2H14A 1PGUA 3RRMC 4D9SA 2I0RA 4FA5D 5K1CC 5EM2A 4A08A 3SFZA 3JAMg 4MMYA 2GC7A 5GXIA 5EMJB 3VA6A 3W15A 3UKUC 4FA9D 1UTCA 3ULEC 4BL0A 4CY2A 3DWLC 4N14A 3OL2A 3J80g 1RI6A 4CI2A 2G9AA 3EQ9A 2XL2A 1A0RB 5GSAA 4E54B 3C75H 4ZOYA 3V9FA 3MKQA 1U2VC 3RMZD 4IA9A 1UOOA 3O4IA 4CY1A 5JWZA 3PXSD 3AFCA 4ERYA 3BG1A 1O6GA 4IRZA 1GXRA 4O2WA 2AQ5A 2HU7A 3GFCA 3SBQA 4L1MA 5IJ7E 2HYEA 2QC5A 4PXWA 2XDWA 4CI1A 2IURA 3AL8A 4GGCA 4FA4D 5AMSA 5AJAA 4J79A 3ZE1A 5CXBA 5EAMA 2CNXA 1OMWB 3OKTA 4GM9A 5FLXg 3ZE2A 3RFHA 3UVLA 5M5SA 4J81A 4O1QD 4J8BA 1A12A 3MMYA 5IC7A 2H6KA 2P9UC 3I2NA 3PXWD 3T3MA 4NAAA 4OWRA 4CY5A 3ORVD 2OIZA 4JSPC 4ZOZA 3O4GA 4CI8A 5TDHB 3JROA 3V4VA 3C5MA 4ES0A 2OJYA 1ERJA 1PBYB 2QR5A 5EM2B 4A08B 5C86A 4K3JB 1U8CA 2CE8A 2Z2NA 4H5JA 3EWEA 4JSXC 2H9PA 2VDLA 1XHMA 1VZ2A 3IULA 3OL2B 3PE7A 4U7AA 4O02A 4AX4A 1TBGA 4NC4A 2WQ8A 5TEEA 3K26A 5HE1B 3GC3B 2H9LA 2PM7B 2VDPA 2CE9A 3DDUA 4GGAA 3IUNA 1YR2A 2IUPA 3VI3A 2IWFA 2AH0A 3F3GA 4J77A 3SBRA 3UKRC 2VDRA 3SBPA 3UVKA 2IUQA 3UR4A 3K6SA 4GZ8A 1QFMA 4MK0B 1MG3A 3I8CA 3FRXA 4J0XA 1GOFA 4BUJC 2I3SA 3AL8B 3MKSB 4A0BA 5HE0B 5THAA 5CXBB 2I0SA 4LGNA 5H14A 5H17A 2OVRB 4WK0A 4BP9A 2EIBA 4J86A 2BKLA 4WK2A 5C2VB 4O3UB 2HKRA 5EMKB 4A2LA 3OKYA 4PC0A 5M5RA 4L3HD 2O9KA 4D0KA 5AFU3 3EMHA 4J73A 2TRCB 4J78A 2BBKH 1S4UX 4JT5C 3I7KA 1JV2A 1GOTB 3PXTD 5EMLB 2XYIA 3U4YA 3VH0A 5TEFA 2HESX 4O3TB 1H2WA 4H5IA 2H13A 2Z2PA 2VDKA 3E0CA 3SMRA 4PBZA 3RLMD 4BH6A 4QT8A 4XYIA 1Q47A 3V5WB 3PSLA 4Z8LA 4BP8A 3NIGA 4AMYA 4NBMA 5EAPA 2P9PC 5FKTA 4O45A 4J87A 3JZHA 5IT9g 5FXYA 3QHYB 4G1MA 5A2Qg 1E5TA 3ZDXA 3SVWD 4AMZA 3RSEC 3JZGA 4CZVA 4A7JA 1VE6A 3ODTA 4E5ZA 1BPOA 3NVQA 4IMMA 3PVWB 1H2YA 5K19A 2B5MA 1QFSA 1JTDB 3N0EA 3MZLA 5E6SA 5FKSA 4NSXA 2Q7QA 3MXXA 5FFGA 2YBAA 3KCIA 4O9DA 3BWSA 3SCYA 2J56H 3O4HA 4A0BB 3SHFA 5E6UA 1GG2B 4UM9A 2HU8A 4YVDA 5FA5B 1E8NA 2IAAA 3N0DA 4JHPC 2VZ1A 4XYHA 5C2WB 4OZUA 2EIDA 2IWKA 2HXCA 3EI1A 2VC2A 3A0FA 5GXHA 1K8KC 3IUQA 3OKYB 2I3TA 3V4PA 3J81g 4JHNA 3CFVA 3O4JA 4QL1A 5HQGA 3IJCA 4GMBA 1R5MA 1T2XA 3IVMA 3I7HA 5CYKA 4A2MA 3F3PA 2B5NA 4Z7NA 2P9NC 5C92A 1N6DA 4G1EA 5KDOB 5B4WA 3DXMC 4JSVC 1XKSA 5FKQA 3QI0A 2AH1A 2YNPA 1SHYB 2UZYB 4CZYA 3ZDYA 1C9IA 1SQ9A 2H9NA 2MTAH 5EARA 3FCSA 4QRJA 1JMZB 4TZ4A 2VDQA 2P9SC 3EU7A 3RFGA 4FAND 3L4MD 4I79A 2QXVA 5FQDA 1QNIA 2G99A 4FB1D 4JXMA 2AGZA 3FM0A 3JPXA 3MVDK 4A09A 4ZOXA 5IJ8E 4AOWA 2I0TA 3OKWA 4CY3A 5M61A 4ERQA 2OK6A 5FFOA 1VZ3A 2QZPA 3IIWA 4X3EA 4FA1D 4E5ZB 3JZNA 4GQBB 1O6FA 1YFQA 3KRWB 1PI6A 4JT6C 1I2MB 3I7LA 5HE3B 4L1QD 3SXTD 4UM8A 3IJEA 3RN1D 3PVUB
chains in the Genus database with same CATH topology
4JSNC 4GQ2P 5IGOA 4EWRA 5EALA 2AGYA 4ERZA 3CFSB 2UZXB 4ZN4A 4J84A 4GQ1A 3EI1B 4PSXB 2CN3A 4X63B 2W18A 2YNNA 4KFMB 3EI3A 1B9XA 3JB9L 5CYKB 4ZOVA 5I5IA 4ESGA 2YNOA 2OK4A 4J82A 2H6QA 4LG9A 1XIPA 2P9LC 4GGDA 5TF2A 4PSWB 5I5MA 5HYNB 1NEXB 2BCJB 3EI4A 3P4FA 3IJ1A 2Z2OA 4FWWA 2PM9A 2XU7A 3AH8B 1MDAH 4A09B 4FHLA 2AGLA 2CO0C 2YMUA 1FWXA 2HJ4A 4A0AA 4PNKB 3NVXA 5EMMB 4L3GD 2AGXA 4CC9A 1NR0A 3DSMA 3IIYA 5CXCA 5IGQA 3ZWLB 3GREA 3I8EA 5C9ZB 2J55H 1TYQC 3CIKB 3DXKC 4U1EI 4K3ID 2IUVA 3IJ0A 3DM0A 2CN2A 1N6EA 2H3XA 3RN0D 4A11A 5FKRA 5H1MA 1B9YA 4CI3A 3EI2A 2EBSA 4AEZA 4R7AB 3EI3B 4J8GA 2OVQB 4CZXA 2YB8B 3MZKA 4Y5RD 3KRXB 4G56B 3C99A 1K32A 2H9MA 3UVOA 1N6FA 4JD2C 4J0WA 3F3FA 2HKMA 1JMXB 4QQEA 4HDJA 2GC4A 4E54A 3B7FA 3I7OA 4PBYA 3BG0A 2CO0A 2H6NA 3SJLD 5GMKn 3C9CA 3EI4B 3PSCB 3VGZA 2PM9B 2P9KC 1OLZA 3NVNA 4FAVD 3JRPA 1JJUB 1P22A 4L9OA 4Y7RA 3OTTA 3K27A 3V7DB 1GP2B 4LG8A 3EG6A 3FGBA 5SXMA 1MG2A 3SLED 1VYHC 4A0AB 1U4CA 2PBIB 2H47A 4XEIC 2B5LA 4D6VA 3I7NA 3SWSD 5CXCB 4X60B 2HJBA 2OVPB 2XL3A 3UVNA 3OW8A 3L4OD 2GNQA 4GM8A 2P9IC 3HFQA 2H68A 1JOFA 2AGWA 4UI9R 5I5JA 2J57G 3I7PA 1L0QA 3IKOA 4A11B 4GM3A 1SQJA 3I89A 2B4EA 3EI2B 5HE2B 4X61B 3UVMA 3SN6B 2PM6B 3AL9A 1PEVA 2H14A 1PGUA 3RRMC 2I0RA 4FA5D 5K1CC 5EM2A 4A08A 3SFZA 3JAMg 2GC7A 5GXIA 5EMJB 3VA6A 3W15A 3UKUC 4FA9D 3ULEC 4BL0A 4CY2A 3DWLC 4N14A 3OL2A 3J80g 1RI6A 4CI2A 2G9AA 2XL2A 1A0RB 5GSAA 4E54B 3C75H 4ZOYA 3V9FA 3MKQA 1U2VC 3RMZD 4IA9A 4CY1A 5JWZA 3PXSD 3AFCA 4ERYA 3BG1A 1GXRA 2AQ5A 3SBQA 3GFCA 5IJ7E 2HYEA 2QC5A 4PXWA 4CI1A 2IURA 3AL8A 4GGCA 4FA4D 5AMSA 5AJAA 4J79A 5CXBA 5EAMA 2CNXA 1OMWB 3OKTA 4GM9A 5FLXg 3RFHA 3UVLA 4J81A 4O1QD 4J8BA 3MMYA 5IC7A 2H6KA 2P9UC 3I2NA 3PXWD 4OWRA 4CY5A 3ORVD 2OIZA 4JSPC 4ZOZA 4CI8A 5TDHB 3JROA 3C5MA 4ES0A 2OJYA 1ERJA 1PBYB 5EM2B 4A08B 4K3JB 2CE8A 2Z2NA 4H5JA 3EWEA 4JSXC 2H9PA 3PE7A 1XHMA 3OL2B 4U7AA 1TBGA 5TEEA 3K26A 5HE1B 2H9LA 2PM7B 2CE9A 4GGAA 2IUPA 2IWFA 2AH0A 3F3GA 4J77A 3SBRA 3UKRC 3SBPA 3UVKA 2IUQA 3UR4A 4GZ8A 4MK0B 1MG3A 3I8CA 3FRXA 4J0XA 4BUJC 2I3SA 3AL8B 3MKSB 4A0BA 5HE0B 5THAA 5CXBB 2I0SA 4LGNA 5H14A 5H17A 2OVRB 4J86A 5C2VB 4O3UB 2HKRA 5EMKB 4A2LA 3OKYA 4PC0A 4L3HD 2O9KA 4D0KA 5AFU3 3EMHA 4J73A 2TRCB 4J78A 2BBKH 1S4UX 4JT5C 3I7KA 1GOTB 3PXTD 5EMLB 2XYIA 3U4YA 3VH0A 5TEFA 2HESX 4O3TB 4H5IA 2H13A 2Z2PA 3E0CA 3SMRA 4PBZA 3RLMD 4BH6A 4QT8A 4XYIA 1Q47A 3V5WB 3PSLA 4Z8LA 5EAPA 2P9PC 5FKTA 4O45A 4J87A 3JZHA 5IT9g 5FXYA 5A2Qg 3SVWD 3RSEC 3JZGA 4CZVA 4A7JA 3ODTA 4E5ZA 4IMMA 3NVQA 3PVWB 5K19A 2B5MA 3N0EA 3MZLA 5FKSA 4NSXA 2Q7QA 3MXXA 2YBAA 4O9DA 3BWSA 3SCYA 2J56H 4A0BB 3SHFA 1GG2B 4YVDA 5FA5B 2IAAA 4XYHA 3N0DA 5C2WB 4OZUA 2IWKA 2HXCA 3EI1A 3A0FA 5GXHA 1K8KC 3OKYB 2I3TA 3J81g 3CFVA 4QL1A 5HQGA 3IJCA 4GMBA 1R5MA 3I7HA 5CYKA 4A2MA 3F3PA 2B5NA 2P9NC 1N6DA 5KDOB 5B4WA 3DXMC 4JSVC 1XKSA 5FKQA 2AH1A 2YNPA 1SHYB 2UZYB 4CZYA 1SQ9A 2H9NA 2MTAH 5EARA 4QRJA 1JMZB 4TZ4A 2P9SC 3EU7A 3RFGA 4FAND 3L4MD 4I79A 2QXVA 5FQDA 1QNIA 2G99A 4FB1D 4JXMA 2AGZA 3FM0A 3JPXA 4A09A 4ZOXA 5IJ8E 4AOWA 2I0TA 3OKWA 4CY3A 4ERQA 2OK6A 3IIWA 4X3EA 4FA1D 4E5ZB 3JZNA 4GQBB 1YFQA 3KRWB 1PI6A 4JT6C 3I7LA 5HE3B 4L1QD 3SXTD 3RN1D 3PVUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSN C;  4GQ2 P;  5IGO A;  4EWR A;  5EAL A;  2AGY A;  4ERZ A;  3CFS B;  2UZX B;  4ZN4 A;  4J84 A;  4GQ1 A;  3EI1 B;  4PSX B;  2CN3 A;  4X63 B;  2W18 A;  2YNN A;  4KFM B;  3EI3 A;  1B9X A;  3JB9 L;  5CYK B;  4ZOV A;  5I5I A;  4ESG A;  2YNO A;  2OK4 A;  4J82 A;  2H6Q A;  4LG9 A;  1XIP A;  2P9L C;  4GGD A;  5TF2 A;  4PSW B;  5I5M A;  5HYN B;  1NEX B;  2BCJ B;  3EI4 A;  3P4F A;  3IJ1 A;  2Z2O A;  4FWW A;  2PM9 A;  2XU7 A;  3AH8 B;  1MDA H;  4A09 B;  4FHL A;  2AGL A;  2CO0 C;  2YMU A;  1FWX A;  2HJ4 A;  4A0A A;  4PNK B;  3NVX A;  5EMM B;  4L3G D;  2AGX A;  4CC9 A;  1NR0 A;  3DSM A;  3IIY A;  5CXC A;  5IGQ A;  3ZWL B;  3GRE A;  3I8E A;  5C9Z B;  2J55 H;  1TYQ C;  3CIK B;  3DXK C;  4U1E I;  4K3I D;  2IUV A;  3IJ0 A;  3DM0 A;  2CN2 A;  1N6E A;  2H3X A;  3RN0 D;  4A11 A;  5FKR A;  5H1M A;  1B9Y A;  4CI3 A;  3EI2 A;  2EBS A;  4AEZ A;  4R7A B;  3EI3 B;  4J8G A;  2OVQ B;  4CZX A;  2YB8 B;  3MZK A;  4Y5R D;  3KRX B;  4G56 B;  3C99 A;  1K32 A;  2H9M A;  3UVO A;  1N6F A;  4JD2 C;  4J0W A;  3F3F A;  2HKM A;  1JMX B;  4QQE A;  4HDJ A;  2GC4 A;  4E54 A;  3B7F A;  3I7O A;  4PBY A;  3BG0 A;  2CO0 A;  2H6N A;  3SJL D;  5GMK n;  3C9C A;  3EI4 B;  3PSC B;  3VGZ A;  2PM9 B;  2P9K C;  1OLZ A;  3NVN A;  4FAV D;  3JRP A;  1JJU B;  1P22 A;  4L9O A;  4Y7R A;  3OTT A;  3K27 A;  3V7D B;  1GP2 B;  4LG8 A;  3EG6 A;  3FGB A;  5SXM A;  1MG2 A;  3SLE D;  1VYH C;  4A0A B;  1U4C A;  2PBI B;  2H47 A;  4XEI C;  2B5L A;  4D6V A;  3I7N A;  3SWS D;  5CXC B;  4X60 B;  2HJB A;  2OVP B;  2XL3 A;  3UVN A;  3OW8 A;  3L4O D;  2GNQ A;  4GM8 A;  2P9I C;  3HFQ A;  2H68 A;  1JOF A;  2AGW A;  4UI9 R;  5I5J A;  2J57 G;  3I7P A;  1L0Q A;  3IKO A;  4A11 B;  4GM3 A;  1SQJ A;  3I89 A;  2B4E A;  3EI2 B;  5HE2 B;  4X61 B;  3UVM A;  3SN6 B;  2PM6 B;  3AL9 A;  1PEV A;  2H14 A;  1PGU A;  3RRM C;  2I0R A;  4FA5 D;  5K1C C;  5EM2 A;  4A08 A;  3SFZ A;  3JAM g;  2GC7 A;  5GXI A;  5EMJ B;  3VA6 A;  3W15 A;  3UKU C;  4FA9 D;  3ULE C;  4BL0 A;  4CY2 A;  3DWL C;  4N14 A;  3OL2 A;  3J80 g;  1RI6 A;  4CI2 A;  2G9A A;  2XL2 A;  1A0R B;  5GSA A;  4E54 B;  3C75 H;  4ZOY A;  3V9F A;  3MKQ A;  1U2V C;  3RMZ D;  4IA9 A;  4CY1 A;  5JWZ A;  3PXS D;  3AFC A;  4ERY A;  3BG1 A;  1GXR A;  2AQ5 A;  3SBQ A;  3GFC A;  5IJ7 E;  2HYE A;  2QC5 A;  4PXW A;  4CI1 A;  2IUR A;  3AL8 A;  4GGC A;  4FA4 D;  5AMS A;  5AJA A;  4J79 A;  5CXB A;  5EAM A;  2CNX A;  1OMW B;  3OKT A;  4GM9 A;  5FLX g;  3RFH A;  3UVL A;  4J81 A;  4O1Q D;  4J8B A;  3MMY A;  5IC7 A;  2H6K A;  2P9U C;  3I2N A;  3PXW D;  4OWR A;  4CY5 A;  3ORV D;  2OIZ A;  4JSP C;  4ZOZ A;  4CI8 A;  5TDH B;  3JRO A;  3C5M A;  4ES0 A;  2OJY A;  1ERJ A;  1PBY B;  5EM2 B;  4A08 B;  4K3J B;  2CE8 A;  2Z2N A;  4H5J A;  3EWE A;  4JSX C;  2H9P A;  3PE7 A;  1XHM A;  3OL2 B;  4U7A A;  1TBG A;  5TEE A;  3K26 A;  5HE1 B;  2H9L A;  2PM7 B;  2CE9 A;  4GGA A;  2IUP A;  2IWF A;  2AH0 A;  3F3G A;  4J77 A;  3SBR A;  3UKR C;  3SBP A;  3UVK A;  2IUQ A;  3UR4 A;  4GZ8 A;  4MK0 B;  1MG3 A;  3I8C A;  3FRX A;  4J0X A;  4BUJ C;  2I3S A;  3AL8 B;  3MKS B;  4A0B A;  5HE0 B;  5THA A;  5CXB B;  2I0S A;  4LGN A;  5H14 A;  5H17 A;  2OVR B;  4J86 A;  5C2V B;  4O3U B;  2HKR A;  5EMK B;  4A2L A;  3OKY A;  4PC0 A;  4L3H D;  2O9K A;  4D0K A;  5AFU 3;  3EMH A;  4J73 A;  2TRC B;  4J78 A;  2BBK H;  1S4U X;  4JT5 C;  3I7K A;  1GOT B;  3PXT D;  5EML B;  2XYI A;  3U4Y A;  3VH0 A;  5TEF A;  2HES X;  4O3T B;  4H5I A;  2H13 A;  2Z2P A;  3E0C A;  3SMR A;  4PBZ A;  3RLM D;  4BH6 A;  4QT8 A;  4XYI A;  1Q47 A;  3V5W B;  3PSL A;  4Z8L A;  5EAP A;  2P9P C;  5FKT A;  4O45 A;  4J87 A;  3JZH A;  5IT9 g;  5FXY A;  5A2Q g;  3SVW D;  3RSE C;  3JZG A;  4CZV A;  4A7J A;  3ODT A;  4E5Z A;  4IMM A;  3NVQ A;  3PVW B;  5K19 A;  2B5M A;  3N0E A;  3MZL A;  5FKS A;  4NSX A;  2Q7Q A;  3MXX A;  2YBA A;  4O9D A;  3BWS A;  3SCY A;  2J56 H;  4A0B B;  3SHF A;  1GG2 B;  4YVD A;  5FA5 B;  2IAA A;  4XYH A;  3N0D A;  5C2W B;  4OZU A;  2IWK A;  2HXC A;  3EI1 A;  3A0F A;  5GXH A;  1K8K C;  3OKY B;  2I3T A;  3J81 g;  3CFV A;  4QL1 A;  5HQG A;  3IJC A;  4GMB A;  1R5M A;  3I7H A;  5CYK A;  4A2M A;  3F3P A;  2B5N A;  2P9N C;  1N6D A;  5KDO B;  5B4W A;  3DXM C;  4JSV C;  1XKS A;  5FKQ A;  2AH1 A;  2YNP A;  1SHY B;  2UZY B;  4CZY A;  1SQ9 A;  2H9N A;  2MTA H;  5EAR A;  4QRJ A;  1JMZ B;  4TZ4 A;  2P9S C;  3EU7 A;  3RFG A;  4FAN D;  3L4M D;  4I79 A;  2QXV A;  5FQD A;  1QNI A;  2G99 A;  4FB1 D;  4JXM A;  2AGZ A;  3FM0 A;  3JPX A;  4A09 A;  4ZOX A;  5IJ8 E;  4AOW A;  2I0T A;  3OKW A;  4CY3 A;  4ERQ A;  2OK6 A;  3IIW A;  4X3E A;  4FA1 D;  4E5Z B;  3JZN A;  4GQB B;  1YFQ A;  3KRW B;  1PI6 A;  4JT6 C;  3I7L A;  5HE3 B;  4L1Q D;  3SXT D;  3RN1 D;  3PVU B; 
#chains in the Genus database with same CATH topology
 2JKX A;  4JSN C;  4GQ2 P;  1UOQ A;  5IGO A;  4EWR A;  5EAL A;  2AGY A;  2XZG A;  4ERZ A;  3CFS B;  3FCU A;  2UZX B;  4ZN4 A;  4J84 A;  4GQ1 A;  3EI1 B;  4PSX B;  2CN3 A;  4X63 B;  2W18 A;  2YNN A;  4KFM B;  3EI3 A;  1B9X A;  4MMZ A;  3JB9 L;  2HU5 A;  5CYK B;  4ZOV A;  5M5U A;  5I5I A;  1M1X A;  4ESG A;  2YNO A;  2OK4 A;  1TYE A;  1GOH A;  4RE5 A;  4J82 A;  3MUO A;  2H6Q A;  3IUR A;  4LG9 A;  1XIP A;  2P9L C;  4Z7O A;  4GGD A;  1C9L A;  3NID A;  4AN0 A;  3IUM A;  4PSW B;  1E8M A;  1H2Z A;  5TF2 A;  5HYN B;  5I5M A;  1NEX B;  3ZE0 A;  2BCJ B;  5M5T A;  3EI4 A;  4AN1 A;  3P4F A;  3IJ1 A;  2Z2O A;  4FWW A;  2PM9 A;  2XU7 A;  3AH8 B;  1MDA H;  4A09 B;  4FHL A;  2AGL A;  2CO0 C;  2YMU A;  2VDO A;  1FWX A;  2HJ4 A;  4A0A A;  2EIE A;  4PNK B;  3NVX A;  5EMM B;  3IUJ A;  4L3G D;  4NEN A;  2AGX A;  4CC9 A;  1NR0 A;  3DSM A;  3IIY A;  5CXC A;  5IGQ A;  3ZWL B;  4BCC A;  3GRE A;  1H2X A;  3I8E A;  5C9Z B;  2J55 H;  1TYQ C;  3CIK B;  4BCB A;  3DXK C;  4U1E I;  1UOP A;  4K3I D;  2IUV A;  4G55 A;  3IJ0 A;  3DM0 A;  2CN2 A;  1N6E A;  2H3X A;  3RN0 D;  4A11 A;  1L5G A;  5FKR A;  5H1M A;  1B9Y A;  4CI3 A;  3EI2 A;  2EBS A;  3EQ7 A;  4RE6 A;  4AEZ A;  4R7A B;  3EI3 B;  3EQ8 A;  4J8G A;  2OVQ B;  4CZX A;  2YB8 B;  3MZK A;  2XE4 A;  4Y5R D;  3KRX B;  4G56 B;  4DNV A;  3C99 A;  1K32 A;  2H9M A;  3UVO A;  1N6F A;  4JD2 C;  4J0W A;  3VI4 A;  3F3F A;  2HKM A;  1JMX B;  4QQE A;  4HDJ A;  2GC4 A;  4E54 A;  3B7F A;  3K71 A;  4DNU A;  3I7O A;  4PBY A;  3BG0 A;  2CO0 A;  2H6N A;  3SJL D;  3ZDZ A;  4QAM A;  5GMK n;  3C9C A;  3EI4 B;  3PSC B;  3VGZ A;  4WK4 A;  2PM9 B;  2P9K C;  1OLZ A;  3NVN A;  4FAV D;  3JRP A;  1JJU B;  1P22 A;  4L9O A;  3OF7 A;  4Y7R A;  2EIC A;  4Z7Q A;  3OTT A;  3K27 A;  3V7D B;  1GP2 B;  4LG8 A;  3EG6 A;  3FGB A;  5SXM A;  1MG2 A;  2VZ3 A;  3SLE D;  1VYH C;  4A0A B;  1U4C A;  1VE7 A;  2PBI B;  2H47 A;  4XEI C;  2B5L A;  4D6V A;  3I7N A;  1GOG A;  3SWS D;  4WJK A;  5CXC B;  2VDM A;  4X60 B;  2HJB A;  2OVP B;  2XL3 A;  3UVN A;  3OW8 A;  3L4O D;  2GNQ A;  5M5V A;  4GM8 A;  2P9I C;  3HFQ A;  2H68 A;  1JOF A;  2AGW A;  4UI9 R;  3T3P A;  5I5J A;  4MMX A;  2J57 G;  3I7P A;  1L0Q A;  3IKO A;  4A11 B;  4GM3 A;  1SQJ A;  3I89 A;  2B4E A;  1K3I A;  2VDN A;  5E6R A;  5HDB A;  3MUN A;  4BCD A;  4DNW A;  3EI2 B;  5HE2 B;  4X61 B;  3UVM A;  3SN6 B;  2PM6 B;  3AL9 A;  3K72 A;  3GD1 I;  1PEV A;  3NIF A;  2H14 A;  1PGU A;  3RRM C;  4D9S A;  2I0R A;  4FA5 D;  5K1C C;  5EM2 A;  4A08 A;  3SFZ A;  3JAM g;  4MMY A;  2GC7 A;  5GXI A;  5EMJ B;  3VA6 A;  3W15 A;  3UKU C;  4FA9 D;  1UTC A;  3ULE C;  4BL0 A;  4CY2 A;  3DWL C;  4N14 A;  3OL2 A;  3J80 g;  1RI6 A;  4CI2 A;  2G9A A;  3EQ9 A;  2XL2 A;  1A0R B;  5GSA A;  4E54 B;  3C75 H;  4ZOY A;  3V9F A;  3MKQ A;  1U2V C;  3RMZ D;  4IA9 A;  1UOO A;  3O4I A;  4CY1 A;  5JWZ A;  3PXS D;  3AFC A;  4ERY A;  3BG1 A;  1O6G A;  4IRZ A;  1GXR A;  4O2W A;  2AQ5 A;  2HU7 A;  3GFC A;  3SBQ A;  4L1M A;  5IJ7 E;  2HYE A;  2QC5 A;  4PXW A;  2XDW A;  4CI1 A;  2IUR A;  3AL8 A;  4GGC A;  4FA4 D;  5AMS A;  5AJA A;  4J79 A;  3ZE1 A;  5CXB A;  5EAM A;  2CNX A;  1OMW B;  3OKT A;  4GM9 A;  5FLX g;  3ZE2 A;  3RFH A;  3UVL A;  5M5S A;  4J81 A;  4O1Q D;  4J8B A;  1A12 A;  3MMY A;  5IC7 A;  2H6K A;  2P9U C;  3I2N A;  3PXW D;  3T3M A;  4NAA A;  4OWR A;  4CY5 A;  3ORV D;  2OIZ A;  4JSP C;  4ZOZ A;  3O4G A;  4CI8 A;  5TDH B;  3JRO A;  3V4V A;  3C5M A;  4ES0 A;  2OJY A;  1ERJ A;  1PBY B;  2QR5 A;  5EM2 B;  4A08 B;  5C86 A;  4K3J B;  1U8C A;  2CE8 A;  2Z2N A;  4H5J A;  3EWE A;  4JSX C;  2H9P A;  2VDL A;  1XHM A;  1VZ2 A;  3IUL A;  3OL2 B;  3PE7 A;  4U7A A;  4O02 A;  4AX4 A;  1TBG A;  4NC4 A;  2WQ8 A;  5TEE A;  3K26 A;  5HE1 B;  3GC3 B;  2H9L A;  2PM7 B;  2VDP A;  2CE9 A;  3DDU A;  4GGA A;  3IUN A;  1YR2 A;  2IUP A;  3VI3 A;  2IWF A;  2AH0 A;  3F3G A;  4J77 A;  3SBR A;  3UKR C;  2VDR A;  3SBP A;  3UVK A;  2IUQ A;  3UR4 A;  3K6S A;  4GZ8 A;  1QFM A;  4MK0 B;  1MG3 A;  3I8C A;  3FRX A;  4J0X A;  1GOF A;  4BUJ C;  2I3S A;  3AL8 B;  3MKS B;  4A0B A;  5HE0 B;  5THA A;  5CXB B;  2I0S A;  4LGN A;  5H14 A;  5H17 A;  2OVR B;  4WK0 A;  4BP9 A;  2EIB A;  4J86 A;  2BKL A;  4WK2 A;  5C2V B;  4O3U B;  2HKR A;  5EMK B;  4A2L A;  3OKY A;  4PC0 A;  5M5R A;  4L3H D;  2O9K A;  4D0K A;  5AFU 3;  3EMH A;  4J73 A;  2TRC B;  4J78 A;  2BBK H;  1S4U X;  4JT5 C;  3I7K A;  1JV2 A;  1GOT B;  3PXT D;  5EML B;  2XYI A;  3U4Y A;  3VH0 A;  5TEF A;  2HES X;  4O3T B;  1H2W A;  4H5I A;  2H13 A;  2Z2P A;  2VDK A;  3E0C A;  3SMR A;  4PBZ A;  3RLM D;  4BH6 A;  4QT8 A;  4XYI A;  1Q47 A;  3V5W B;  3PSL A;  4Z8L A;  4BP8 A;  3NIG A;  4AMY A;  4NBM A;  5EAP A;  2P9P C;  5FKT A;  4O45 A;  4J87 A;  3JZH A;  5IT9 g;  5FXY A;  3QHY B;  4G1M A;  5A2Q g;  1E5T A;  3ZDX A;  3SVW D;  4AMZ A;  3RSE C;  3JZG A;  4CZV A;  4A7J A;  1VE6 A;  3ODT A;  4E5Z A;  1BPO A;  3NVQ A;  4IMM A;  3PVW B;  1H2Y A;  5K19 A;  2B5M A;  1QFS A;  1JTD B;  3N0E A;  3MZL A;  5E6S A;  5FKS A;  4NSX A;  2Q7Q A;  3MXX A;  5FFG A;  2YBA A;  3KCI A;  4O9D A;  3BWS A;  3SCY A;  2J56 H;  3O4H A;  4A0B B;  3SHF A;  5E6U A;  1GG2 B;  4UM9 A;  2HU8 A;  4YVD A;  5FA5 B;  1E8N A;  2IAA A;  3N0D A;  4JHP C;  2VZ1 A;  4XYH A;  5C2W B;  4OZU A;  2EID A;  2IWK A;  2HXC A;  3EI1 A;  2VC2 A;  3A0F A;  5GXH A;  1K8K C;  3IUQ A;  3OKY B;  2I3T A;  3V4P A;  3J81 g;  4JHN A;  3CFV A;  3O4J A;  4QL1 A;  5HQG A;  3IJC A;  4GMB A;  1R5M A;  1T2X A;  3IVM A;  3I7H A;  5CYK A;  4A2M A;  3F3P A;  2B5N A;  4Z7N A;  2P9N C;  5C92 A;  1N6D A;  4G1E A;  5KDO B;  5B4W A;  3DXM C;  4JSV C;  1XKS A;  5FKQ A;  3QI0 A;  2AH1 A;  2YNP A;  1SHY B;  2UZY B;  4CZY A;  3ZDY A;  1C9I A;  1SQ9 A;  2H9N A;  2MTA H;  5EAR A;  3FCS A;  4QRJ A;  1JMZ B;  4TZ4 A;  2VDQ A;  2P9S C;  3EU7 A;  3RFG A;  4FAN D;  3L4M D;  4I79 A;  2QXV A;  5FQD A;  1QNI A;  2G99 A;  4FB1 D;  4JXM A;  2AGZ A;  3FM0 A;  3JPX A;  3MVD K;  4A09 A;  4ZOX A;  5IJ8 E;  4AOW A;  2I0T A;  3OKW A;  4CY3 A;  5M61 A;  4ERQ A;  2OK6 A;  5FFO A;  1VZ3 A;  2QZP A;  3IIW A;  4X3E A;  4FA1 D;  4E5Z B;  3JZN A;  4GQB B;  1O6F A;  1YFQ A;  3KRW B;  1PI6 A;  4JT6 C;  1I2M B;  3I7L A;  5HE3 B;  4L1Q D;  3SXT D;  4UM8 A;  3IJE A;  3RN1 D;  3PVU B; 
#chains in the Genus database with same CATH homology
 4JSN C;  4GQ2 P;  5IGO A;  4EWR A;  5EAL A;  2AGY A;  4ERZ A;  3CFS B;  2UZX B;  4ZN4 A;  4J84 A;  4GQ1 A;  3EI1 B;  4PSX B;  2CN3 A;  4X63 B;  2W18 A;  2YNN A;  4KFM B;  3EI3 A;  1B9X A;  3JB9 L;  5CYK B;  4ZOV A;  5I5I A;  4ESG A;  2YNO A;  2OK4 A;  4J82 A;  2H6Q A;  4LG9 A;  1XIP A;  2P9L C;  4GGD A;  5TF2 A;  4PSW B;  5I5M A;  5HYN B;  1NEX B;  2BCJ B;  3EI4 A;  3P4F A;  3IJ1 A;  2Z2O A;  4FWW A;  2PM9 A;  2XU7 A;  3AH8 B;  1MDA H;  4A09 B;  4FHL A;  2AGL A;  2CO0 C;  2YMU A;  1FWX A;  2HJ4 A;  4A0A A;  4PNK B;  3NVX A;  5EMM B;  4L3G D;  2AGX A;  4CC9 A;  1NR0 A;  3DSM A;  3IIY A;  5CXC A;  5IGQ A;  3ZWL B;  3GRE A;  3I8E A;  5C9Z B;  2J55 H;  1TYQ C;  3CIK B;  3DXK C;  4U1E I;  4K3I D;  2IUV A;  3IJ0 A;  3DM0 A;  2CN2 A;  1N6E A;  2H3X A;  3RN0 D;  4A11 A;  5FKR A;  5H1M A;  1B9Y A;  4CI3 A;  3EI2 A;  2EBS A;  4AEZ A;  4R7A B;  3EI3 B;  4J8G A;  2OVQ B;  4CZX A;  2YB8 B;  3MZK A;  4Y5R D;  3KRX B;  4G56 B;  3C99 A;  1K32 A;  2H9M A;  3UVO A;  1N6F A;  4JD2 C;  4J0W A;  3F3F A;  2HKM A;  1JMX B;  4QQE A;  4HDJ A;  2GC4 A;  4E54 A;  3B7F A;  3I7O A;  4PBY A;  3BG0 A;  2CO0 A;  2H6N A;  3SJL D;  5GMK n;  3C9C A;  3EI4 B;  3PSC B;  3VGZ A;  2PM9 B;  2P9K C;  1OLZ A;  3NVN A;  4FAV D;  3JRP A;  1JJU B;  1P22 A;  4L9O A;  4Y7R A;  3OTT A;  3K27 A;  3V7D B;  1GP2 B;  4LG8 A;  3EG6 A;  3FGB A;  5SXM A;  1MG2 A;  3SLE D;  1VYH C;  4A0A B;  1U4C A;  2PBI B;  2H47 A;  4XEI C;  2B5L A;  4D6V A;  3I7N A;  3SWS D;  5CXC B;  4X60 B;  2HJB A;  2OVP B;  2XL3 A;  3UVN A;  3OW8 A;  3L4O D;  2GNQ A;  4GM8 A;  2P9I C;  3HFQ A;  2H68 A;  1JOF A;  2AGW A;  4UI9 R;  5I5J A;  2J57 G;  3I7P A;  1L0Q A;  3IKO A;  4A11 B;  4GM3 A;  1SQJ A;  3I89 A;  2B4E A;  3EI2 B;  5HE2 B;  4X61 B;  3UVM A;  3SN6 B;  2PM6 B;  3AL9 A;  1PEV A;  2H14 A;  1PGU A;  3RRM C;  2I0R A;  4FA5 D;  5K1C C;  5EM2 A;  4A08 A;  3SFZ A;  3JAM g;  2GC7 A;  5GXI A;  5EMJ B;  3VA6 A;  3W15 A;  3UKU C;  4FA9 D;  3ULE C;  4BL0 A;  4CY2 A;  3DWL C;  4N14 A;  3OL2 A;  3J80 g;  1RI6 A;  4CI2 A;  2G9A A;  2XL2 A;  1A0R B;  5GSA A;  4E54 B;  3C75 H;  4ZOY A;  3V9F A;  3MKQ A;  1U2V C;  3RMZ D;  4IA9 A;  4CY1 A;  5JWZ A;  3PXS D;  3AFC A;  4ERY A;  3BG1 A;  1GXR A;  2AQ5 A;  3SBQ A;  3GFC A;  5IJ7 E;  2HYE A;  2QC5 A;  4PXW A;  4CI1 A;  2IUR A;  3AL8 A;  4GGC A;  4FA4 D;  5AMS A;  5AJA A;  4J79 A;  5CXB A;  5EAM A;  2CNX A;  1OMW B;  3OKT A;  4GM9 A;  5FLX g;  3RFH A;  3UVL A;  4J81 A;  4O1Q D;  4J8B A;  3MMY A;  5IC7 A;  2H6K A;  2P9U C;  3I2N A;  3PXW D;  4OWR A;  4CY5 A;  3ORV D;  2OIZ A;  4JSP C;  4ZOZ A;  4CI8 A;  5TDH B;  3JRO A;  3C5M A;  4ES0 A;  2OJY A;  1ERJ A;  1PBY B;  5EM2 B;  4A08 B;  4K3J B;  2CE8 A;  2Z2N A;  4H5J A;  3EWE A;  4JSX C;  2H9P A;  3PE7 A;  1XHM A;  3OL2 B;  4U7A A;  1TBG A;  5TEE A;  3K26 A;  5HE1 B;  2H9L A;  2PM7 B;  2CE9 A;  4GGA A;  2IUP A;  2IWF A;  2AH0 A;  3F3G A;  4J77 A;  3SBR A;  3UKR C;  3SBP A;  3UVK A;  2IUQ A;  3UR4 A;  4GZ8 A;  4MK0 B;  1MG3 A;  3I8C A;  3FRX A;  4J0X A;  4BUJ C;  2I3S A;  3AL8 B;  3MKS B;  4A0B A;  5HE0 B;  5THA A;  5CXB B;  2I0S A;  4LGN A;  5H14 A;  5H17 A;  2OVR B;  4J86 A;  5C2V B;  4O3U B;  2HKR A;  5EMK B;  4A2L A;  3OKY A;  4PC0 A;  4L3H D;  2O9K A;  4D0K A;  5AFU 3;  3EMH A;  4J73 A;  2TRC B;  4J78 A;  2BBK H;  1S4U X;  4JT5 C;  3I7K A;  1GOT B;  3PXT D;  5EML B;  2XYI A;  3U4Y A;  3VH0 A;  5TEF A;  2HES X;  4O3T B;  4H5I A;  2H13 A;  2Z2P A;  3E0C A;  3SMR A;  4PBZ A;  3RLM D;  4BH6 A;  4QT8 A;  4XYI A;  1Q47 A;  3V5W B;  3PSL A;  4Z8L A;  5EAP A;  2P9P C;  5FKT A;  4O45 A;  4J87 A;  3JZH A;  5IT9 g;  5FXY A;  5A2Q g;  3SVW D;  3RSE C;  3JZG A;  4CZV A;  4A7J A;  3ODT A;  4E5Z A;  4IMM A;  3NVQ A;  3PVW B;  5K19 A;  2B5M A;  3N0E A;  3MZL A;  5FKS A;  4NSX A;  2Q7Q A;  3MXX A;  2YBA A;  4O9D A;  3BWS A;  3SCY A;  2J56 H;  4A0B B;  3SHF A;  1GG2 B;  4YVD A;  5FA5 B;  2IAA A;  4XYH A;  3N0D A;  5C2W B;  4OZU A;  2IWK A;  2HXC A;  3EI1 A;  3A0F A;  5GXH A;  1K8K C;  3OKY B;  2I3T A;  3J81 g;  3CFV A;  4QL1 A;  5HQG A;  3IJC A;  4GMB A;  1R5M A;  3I7H A;  5CYK A;  4A2M A;  3F3P A;  2B5N A;  2P9N C;  1N6D A;  5KDO B;  5B4W A;  3DXM C;  4JSV C;  1XKS A;  5FKQ A;  2AH1 A;  2YNP A;  1SHY B;  2UZY B;  4CZY A;  1SQ9 A;  2H9N A;  2MTA H;  5EAR A;  4QRJ A;  1JMZ B;  4TZ4 A;  2P9S C;  3EU7 A;  3RFG A;  4FAN D;  3L4M D;  4I79 A;  2QXV A;  5FQD A;  1QNI A;  2G99 A;  4FB1 D;  4JXM A;  2AGZ A;  3FM0 A;  3JPX A;  4A09 A;  4ZOX A;  5IJ8 E;  4AOW A;  2I0T A;  3OKW A;  4CY3 A;  4ERQ A;  2OK6 A;  3IIW A;  4X3E A;  4FA1 D;  4E5Z B;  3JZN A;  4GQB B;  1YFQ A;  3KRW B;  1PI6 A;  4JT6 C;  3I7L A;  5HE3 B;  4L1Q D;  3SXT D;  3RN1 D;  3PVU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...