2HJ4A

Crystal structure of alcaligenes faecalis aadh complex with p-nitrobenzylamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
357
structure length
357
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase; chain D, H
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
total genus 93
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hj4A01
3SHFA 2P9UC 3JZGA 4CY2A 2HXCA 2H6KA 3ORVD 3ULEC 5SXMA 4E54A 2BBKH 3GREA 4JXMA 3I2NA 4MK0B 4ZOZA 5IT9g 5HYNB 2AH0A 2Q7QA 4O1QD 2I0SA 4CI2A 4LG9A 5I5IA 2MTAH 4A0BA 1PBYB 3EU7A 3MXXA 3OTTA 3V5WB 5C2WB 4XEIC 2OK4A 3RFGA 1MG3A 3SXTD 4U1EI 2HJBA 2H3XA 3W15A 2B5LA 5CXCA 4L3GD 4JD2C 2H6NA 1K32A 3JZNA 3SN6B 3MZLA 5EM2B 3IJCA 5GXHA 5TEFA 2P9NC 4A09A 4JT5C 4CY3A 2IAAA 4JT6C 1RI6A 3AFCA 5HE0B 5EMLB 3HFQA 2OJYA 2XL3A 4U7AA 3PXWD 1VYHC 3MMYA 4L3HD 2GC7A 1A0RB 5H14A 3RSEC 4O3TB 2AH1A 4QL1A 3EI4A 3SJLD 3VA6A 3CFSB 5EMMB 2I3SA 5EAMA 3PE7A 5FKRA 2CN3A 1PEVA 4J84A 4A2MA 1S4UX 2PBIB 3SBPA 5TF2A 3A0FA 4A08B 2AGZA 2OVQB 4A2LA 3N0EA 3OKWA 4J77A 3EI1B 4JSNC 4X3EA 3EI2A 5A2Qg 3EI3A 3OKYA 2J55H 4FWWA 5GMKn 3FM0A 3K27A 3SBRA 2OVRB 5HQGA 4CI1A 1SHYB 2G99A 3C9CA 3RN0D 2UZYB 5K19A 5EMJB 2CO0C 4CI8A 2J56H 5FQDA 2EBSA 2XYIA 4A11A 4CI3A 4UI9R 3PXTD 2OIZA 4CY5A 2I0TA 3B7FA 3I8EA 4J73A 5FXYA 1NEXB 3EI2B 4FAVD 4X61B 4Z8LA 3PVUB 3CFVA 3IJ0A 1B9XA 2O9KA 5CXBA 3CIKB 5EARA 4EWRA 3I7LA 1GXRA 1Q47A 4QQEA 3V7DB 4J87A 4PSXB 5HE2B 4ZOYA 4E5ZA 5TDHB 4A11B 3AL9A 3OL2A 4ERQA 4CZYA 4Y7RA 4H5IA 3AH8B 4J86A 3JPXA 3K26A 3N0DA 3I89A 3SMRA 3JB9L 1ERJA 4OZUA 3IIWA 3ZWLB 3NVNA 3OKTA 2YMUA 4E5ZB 2XL2A 3P4FA 2B4EA 3OL2B 2QXVA 4JSPC 2PM7B 4ZOVA 4Y5RD 3F3GA 2AGWA 3MZKA 4E54B 4NSXA 1MDAH 1SQ9A 4GQBB 3KRXB 2B5NA 2H6QA 3JRPA 4XYIA 4J79A 4LGNA 1OMWB 2HESX 4J81A 5H1MA 4A0BB 4H5JA 5IGOA 5IGQA 3NVQA 4GGAA 3U4YA 5C9ZB 1NR0A 2GC4A 5HE1B 3JZHA 4A7JA 4IMMA 5CXCB 4J78A 3JAMg 4AOWA 4AEZA 3UKUC 3PSCB 5GSAA 3DXMC 4CY1A 2AQ5A 4JSVC 2Z2PA 1B9YA 2BCJB 4A09B 2J57G 4J8GA 2AGYA 1U2VC 5I5JA 1XHMA 1N6DA 4GGDA 2IWKA 4BH6A 4R7AB 2GNQA 3BG1A 2CO0A 1N6FA 2YNOA 3RMZD 1FWXA 1GP2B 1P22A 3UVKA 4PSWB 5CYKA 5THAA 3EI4B 2OK6A 2P9LC 5EAPA 3SBQA 2PM9A 3BG0A 3MKSB 2H9PA 3I7NA 4L1QD 4ESGA 3L4OD 2UZXB 2YNPA 3IJ1A 4KFMB 3UVNA 1XIPA 2OVPB 1OLZA 2H9LA 4D6VA 4FAND 4O3UB 2P9PC 5IC7A 2IWFA 5EMKB 5KDOB 3PXSD 3EI3B 3OKYB 2IUQA 2W18A 3DM0A 3C5MA 3AL8A 5B4WA 4ZN4A 4GQ1A 5K1CC 3J80g 2H47A 4QRJA 5EALA 3DXKC 3JROA 5FKQA 3PVWB 4K3JB 1JMXB 1JMZB 4FA9D 4GGCA 4I79A 4BL0A 3SFZA 3EMHA 4PXWA 3KRWB 2HKMA 5H17A 3FGBA 2B5MA 2TRCB 2AGLA 2H9MA 3VGZA 4D0KA 4GM9A 5FLXg 2AGXA 4FA5D 4ERZA 1JOFA 1TBGA 5CXBB 3J81g 4O45A 3IIYA 3E0CA 5AMSA 2HKRA 1N6EA 3UVMA 3UVOA 4J0XA 2IUPA 2G9AA 2H14A 2PM6B 3I7PA 1PGUA 3DSMA 3I7HA 4PNKB 4X60B 4GQ2P 3SWSD 5IJ8E 2CNXA 5FKSA 5EM2A 3SCYA 1JJUB 2YB8B 3F3FA 3DWLC 4XYHA 4O9DA 1MG2A 3C75H 3V9FA 3I7OA 2I0RA 4GM8A 4ZOXA 2I3TA 1GG2B 4PC0A 1YFQA 4GMBA 2YNNA 3I8CA 4PBZA 5JWZA 4J82A 2H13A 1L0QA 1XKSA 3RRMC 4HDJA 4YVDA 3NVXA 5AFU3 4ES0A 2XU7A 5I5MA 3UKRC 2P9IC 2Z2NA 4FA1D 2CN2A 4A08A 3BWSA 4OWRA 3RFHA 4J8BA 3EI1A 1PI6A 4X63B 2YBAA 4A0AA 3PSLA 4IA9A 4LG8A 1U4CA 3OW8A 4J0WA 3SVWD 2H68A 4N14A 5FKTA 4FA4D 3UVLA 4CZVA 4G56B 2HJ4A 2IURA 3RN1D 3I7KA 1R5MA 5C2VB 2QC5A 5FA5B 3GFCA 2CE8A 2P9KC 5AJAA 4CZXA 3F3PA 2HYEA 3SLED 1GOTB 5CYKB 4A0AB 5GXIA 5IJ7E 4BUJC 3RLMD 2IUVA 2PM9B 3EG6A 3IKOA 4GZ8A 2CE9A 5HE3B 5TEEA 1K8KC 2H9NA 4QT8A 3C99A 4K3ID 3FRXA 4FHLA 3ODTA 4PBYA 3VH0A 1TYQC 4FB1D 4CC9A 1SQJA 3AL8B 4JSXC 4L9OA 3MKQA 1QNIA 3UR4A 2P9SC 3EWEA 4TZ4A 2Z2OA 3L4MD 4GM3A 4ERYA
chains in the Genus database with same CATH superfamily
3SHFA 2P9UC 2QR5A 3JZGA 4CY2A 2HXCA 2H6KA 4JHNA 5E6SA 3ORVD 3ULEC 5SXMA 4E54A 1JV2A 2BBKH 3GREA 4JXMA 3I2NA 4MK0B 4ZOZA 5IT9g 5HYNB 2AH0A 2Q7QA 1E5TA 4O1QD 2I0SA 4CI2A 1GOGA 4LG9A 4AMZA 5I5IA 2JKXA 3VI3A 4UM9A 2MTAH 4A0BA 1PBYB 3EU7A 3MXXA 3OTTA 3V5WB 5C2WB 3OF7A 4XEIC 2OK4A 3RFGA 1MG3A 3SXTD 3GC3B 4U1EI 2HJBA 2H3XA 3W15A 2B5LA 5CXCA 4L3GD 4Z7QA 2VC2A 5C86A 4JD2C 2H6NA 1K32A 1K3IA 2VDLA 3JZNA 3SN6B 3MZLA 5EM2B 2BKLA 3IJCA 2EICA 5GXHA 5TEFA 1UTCA 2P9NC 4A09A 1H2WA 3FCSA 4JT5C 4CY3A 2IAAA 4JT6C 1RI6A 3AFCA 3IURA 4WK0A 5HE0B 5EMLB 3HFQA 2OJYA 2XL3A 4IRZA 4U7AA 3PXWD 1VYHC 3MMYA 4L3HD 2GC7A 1A0RB 5H14A 3ZDXA 3RSEC 4O3TB 2AH1A 3IJEA 4QL1A 3EQ9A 3EI4A 4G1MA 3SJLD 1VZ2A 3EQ8A 2HU7A 3VA6A 3CFSB 5EMMB 2I3SA 5EAMA 3EQ7A 3PE7A 5FKRA 2CN3A 2EIBA 1A12A 1PEVA 4J84A 4A2MA 1S4UX 1T2XA 2PBIB 4BP8A 3SBPA 5TF2A 3A0FA 4A08B 2AGZA 1VE7A 2OVQB 4A2LA 3N0EA 3OKWA 4J77A 3EI1B 4L1MA 4O02A 4JSNC 1UOOA 4X3EA 3EI2A 5A2Qg 3EI3A 3OKYA 2J55H 4FWWA 5GMKn 3FM0A 3K27A 3SBRA 2OVRB 5HQGA 4CI1A 1SHYB 2G99A 4RE6A 3C9CA 4BCCA 3RN0D 2UZYB 5K19A 5EMJB 5M5UA 2CO0C 4CI8A 2J56H 5FQDA 2EBSA 2XYIA 4A11A 4CI3A 4UI9R 5C92A 3PXTD 2OIZA 4CY5A 3NIGA 4WK2A 2XE4A 2I0TA 3B7FA 3I8EA 4J73A 5FXYA 3IUNA 1NEXB 3EI2B 4FAVD 4O2WA 4X61B 4Z8LA 3PVUB 3CFVA 1O6GA 3IJ0A 1B9XA 2O9KA 5CXBA 3CIKB 5EARA 4EWRA 3I7LA 1GXRA 1E8NA 1VE6A 5FFGA 2VZ3A 4NBMA 3DDUA 1Q47A 4QQEA 3V7DB 4J87A 4PSXB 5HE2B 4ZOYA 4E5ZA 5TDHB 4WK4A 3AL9A 4A11B 3OL2A 4DNUA 4ERQA 4CZYA 4Y7RA 4H5IA 3AH8B 4J86A 3JPXA 1H2XA 3K26A 3N0DA 3I89A 4DNVA 3SMRA 2VDNA 3JB9L 1ERJA 4OZUA 3IIWA 3ZWLB 3NVNA 1C9LA 4Z7NA 2VDKA 3OKTA 2XDWA 2YMUA 1YR2A 4E5ZB 2XL2A 5E6UA 3P4FA 2B4EA 3OL2B 2QXVA 1BPOA 4JSPC 2PM7B 3FCUA 4ZOVA 4Y5RD 3F3GA 4AN0A 2AGWA 3K71A 3MZKA 4E54B 4NSXA 1MDAH 1SQ9A 4D9SA 4GQBB 3KRXB 2B5NA 2H6QA 3JRPA 4XYIA 4J79A 4LGNA 1OMWB 2HESX 4J81A 5H1MA 4A0BB 4H5JA 5IGOA 5IGQA 4AN1A 3NVQA 4GGAA 3U4YA 5C9ZB 2HU5A 1NR0A 2GC4A 5HE1B 4NC4A 3JZHA 5E6RA 1QFMA 4A7JA 3O4HA 4IMMA 5CXCB 4J78A 3JAMg 4AOWA 1M1XA 4AEZA 1JTDB 4JHPC 3UKUC 3PSCB 5GSAA 2VDRA 3DXMC 4CY1A 2AQ5A 4DNWA 4JSVC 2VZ1A 2VDMA 2Z2PA 1B9YA 2BCJB 4A09B 2J57G 4J8GA 1UOQA 2AGYA 1U2VC 5I5JA 1XHMA 3QI0A 1N6DA 4GGDA 2IWKA 4BH6A 4R7AB 2GNQA 3BG1A 2CO0A 2HU8A 1N6FA 2YNOA 3RMZD 1FWXA 1GP2B 1P22A 3UVKA 4PSWB 5CYKA 5THAA 3V4VA 3EI4B 2OK6A 2P9LC 5EAPA 3SBQA 2PM9A 4BCBA 3BG0A 3MKSB 2WQ8A 2H9PA 3I7NA 4L1QD 4QAMA 4ESGA 1UOPA 3L4OD 4NENA 2UZXB 2YNPA 4NAAA 3IJ1A 4KFMB 3UVNA 2VDPA 3T3MA 1XIPA 2OVPB 1OLZA 2H9LA 4D6VA 4FAND 4O3UB 2P9PC 5IC7A 2IWFA 3V4PA 5EMKB 5KDOB 3PXSD 3EI3B 2QZPA 3OKYB 2IUQA 2W18A 3IUJA 3KCIA 3DM0A 3C5MA 3AL8A 5B4WA 4ZN4A 5M5SA 4GQ1A 5K1CC 3K6SA 3J80g 2H47A 4QRJA 5EALA 3DXKC 3JROA 3QHYB 5FKQA 3PVWB 4K3JB 1JMXB 1JMZB 4FA9D 4GGCA 4I79A 4BL0A 3SFZA 3EMHA 4PXWA 3KRWB 2HKMA 5H17A 3FGBA 2B5MA 2TRCB 2AGLA 2H9MA 3VGZA 4D0KA 4GM9A 5FLXg 2AGXA 4FA5D 3MUOA 4ERZA 1JOFA 1TBGA 5CXBB 3J81g 4O45A 4AX4A 3IIYA 3E0CA 5AMSA 2HKRA 3O4IA 1N6EA 3UVMA 3UVOA 4J0XA 2IUPA 1L5GA 2G9AA 2H14A 2PM6B 3I7PA 1PGUA 3DSMA 3I7HA 4PNKB 5HDBA 4X60B 4GQ2P 4UM8A 1GOHA 3SWSD 5IJ8E 2CNXA 3IVMA 5FKSA 5EM2A 3SCYA 1JJUB 2YB8B 3F3FA 3DWLC 4XYHA 3ZE2A 4O9DA 1VZ3A 2VDQA 1MG2A 5FFOA 3C75H 3V9FA 3I7OA 2I0RA 4GM8A 4ZOXA 2I3TA 1GG2B 4PC0A 1YFQA 4BCDA 4GMBA 4MMXA 3IUMA 2YNNA 3I8CA 4PBZA 5JWZA 1H2YA 3T3PA 4J82A 2H13A 4BP9A 1L0QA 4MMYA 4MMZA 1XKSA 3NIDA 3RRMC 1I2MB 1TYEA 5M5TA 4HDJA 3GD1I 4YVDA 3NVXA 5AFU3 4ES0A 2XU7A 5I5MA 3NIFA 3UKRC 1E8MA 2P9IC 2Z2NA 4FA1D 2CN2A 3K72A 4A08A 3BWSA 4OWRA 3RFHA 4J8BA 3EI1A 4G1EA 1PI6A 4X63B 2YBAA 5M5RA 3PSLA 4A0AA 2XZGA 4IA9A 4LG8A 3IUQA 1U4CA 3OW8A 4J0WA 1C9IA 3SVWD 2H68A 1O6FA 4N14A 5FKTA 4FA4D 3O4JA 3UVLA 4CZVA 4G56B 2HJ4A 2IURA 3RN1D 3I7KA 1R5MA 5C2VB 2QC5A 5FA5B 1GOFA 3GFCA 4Z7OA 2CE8A 2P9KC 5AJAA 4CZXA 3F3PA 4RE5A 2HYEA 4AMYA 3SLED 1GOTB 3O4GA 5CYKB 3ZDZA 4A0AB 2EIDA 5GXIA 5IJ7E 4BUJC 3RLMD 1H2ZA 2IUVA 2PM9B 3IULA 1U8CA 3ZE0A 3EG6A 3IKOA 4GZ8A 4G55A 2VDOA 2CE9A 5HE3B 3MUNA 5TEEA 1K8KC 2H9NA 4QT8A 5M61A 3C99A 5M5VA 4K3ID 3FRXA 2EIEA 4FHLA 3ODTA 4PBYA 3VH0A 3VI4A 1TYQC 3MVDK 4FB1D 4CC9A 1SQJA 3AL8B 4JSXC 4L9OA 3MKQA 1QNIA 3UR4A 2P9SC 3ZDYA 3EWEA 4TZ4A 2Z2OA 1QFSA 4WJKA 3L4MD 4GM3A 3ZE1A 4ERYA
chains in the Genus database with same CATH topology
3SHFA 2P9UC 3JZGA 4CY2A 2HXCA 2H6KA 3ORVD 3ULEC 5SXMA 4E54A 2BBKH 3GREA 4JXMA 3I2NA 4MK0B 4ZOZA 5IT9g 5HYNB 2AH0A 2Q7QA 4O1QD 2I0SA 4CI2A 4LG9A 5I5IA 2MTAH 4A0BA 1PBYB 3EU7A 3MXXA 3OTTA 3V5WB 5C2WB 4XEIC 2OK4A 3RFGA 1MG3A 3SXTD 4U1EI 2HJBA 2H3XA 3W15A 2B5LA 5CXCA 4L3GD 4JD2C 2H6NA 1K32A 3JZNA 3SN6B 3MZLA 5EM2B 3IJCA 5GXHA 5TEFA 2P9NC 4A09A 4JT5C 4CY3A 2IAAA 4JT6C 1RI6A 3AFCA 5HE0B 5EMLB 3HFQA 2OJYA 2XL3A 4U7AA 3PXWD 1VYHC 3MMYA 4L3HD 2GC7A 1A0RB 5H14A 3RSEC 4O3TB 2AH1A 4QL1A 3EI4A 3SJLD 3VA6A 3CFSB 5EMMB 2I3SA 5EAMA 3PE7A 5FKRA 2CN3A 1PEVA 4J84A 4A2MA 1S4UX 2PBIB 3SBPA 5TF2A 3A0FA 4A08B 2AGZA 2OVQB 4A2LA 3N0EA 3OKWA 4J77A 3EI1B 4JSNC 4X3EA 3EI2A 5A2Qg 3EI3A 3OKYA 2J55H 4FWWA 5GMKn 3FM0A 3K27A 3SBRA 2OVRB 5HQGA 4CI1A 1SHYB 2G99A 3C9CA 3RN0D 2UZYB 5K19A 5EMJB 2CO0C 4CI8A 2J56H 5FQDA 2EBSA 2XYIA 4A11A 4CI3A 4UI9R 3PXTD 2OIZA 4CY5A 2I0TA 3B7FA 3I8EA 4J73A 5FXYA 1NEXB 3EI2B 4FAVD 4X61B 4Z8LA 3PVUB 3CFVA 3IJ0A 1B9XA 2O9KA 5CXBA 3CIKB 5EARA 4EWRA 3I7LA 1GXRA 1Q47A 4QQEA 3V7DB 4J87A 4PSXB 5HE2B 4ZOYA 4E5ZA 5TDHB 4A11B 3AL9A 3OL2A 4ERQA 4CZYA 4Y7RA 4H5IA 3AH8B 4J86A 3JPXA 3K26A 3N0DA 3I89A 3SMRA 3JB9L 1ERJA 4OZUA 3IIWA 3ZWLB 3NVNA 3OKTA 2YMUA 4E5ZB 2XL2A 3P4FA 2B4EA 3OL2B 2QXVA 4JSPC 2PM7B 4ZOVA 4Y5RD 3F3GA 2AGWA 3MZKA 4E54B 4NSXA 1MDAH 1SQ9A 4GQBB 3KRXB 2B5NA 2H6QA 3JRPA 4XYIA 4J79A 4LGNA 1OMWB 2HESX 4J81A 5H1MA 4A0BB 4H5JA 5IGOA 5IGQA 3NVQA 4GGAA 3U4YA 5C9ZB 1NR0A 2GC4A 5HE1B 3JZHA 4A7JA 4IMMA 5CXCB 4J78A 3JAMg 4AOWA 4AEZA 3UKUC 3PSCB 5GSAA 3DXMC 4CY1A 2AQ5A 4JSVC 2Z2PA 1B9YA 2BCJB 4A09B 2J57G 4J8GA 2AGYA 1U2VC 5I5JA 1XHMA 1N6DA 4GGDA 2IWKA 4BH6A 4R7AB 2GNQA 3BG1A 2CO0A 1N6FA 2YNOA 3RMZD 1FWXA 1GP2B 1P22A 3UVKA 4PSWB 5CYKA 5THAA 3EI4B 2OK6A 2P9LC 5EAPA 3SBQA 2PM9A 3BG0A 3MKSB 2H9PA 3I7NA 4L1QD 4ESGA 3L4OD 2UZXB 2YNPA 3IJ1A 4KFMB 3UVNA 1XIPA 2OVPB 1OLZA 2H9LA 4D6VA 4FAND 4O3UB 2P9PC 5IC7A 2IWFA 5EMKB 5KDOB 3PXSD 3EI3B 3OKYB 2IUQA 2W18A 3DM0A 3C5MA 3AL8A 5B4WA 4ZN4A 4GQ1A 5K1CC 3J80g 2H47A 4QRJA 5EALA 3DXKC 3JROA 5FKQA 3PVWB 4K3JB 1JMXB 1JMZB 4FA9D 4GGCA 4I79A 4BL0A 3SFZA 3EMHA 4PXWA 3KRWB 2HKMA 5H17A 3FGBA 2B5MA 2TRCB 2AGLA 2H9MA 3VGZA 4D0KA 4GM9A 5FLXg 2AGXA 4FA5D 4ERZA 1JOFA 1TBGA 5CXBB 3J81g 4O45A 3IIYA 3E0CA 5AMSA 2HKRA 1N6EA 3UVMA 3UVOA 4J0XA 2IUPA 2G9AA 2H14A 2PM6B 3I7PA 1PGUA 3DSMA 3I7HA 4PNKB 4X60B 4GQ2P 3SWSD 5IJ8E 2CNXA 5FKSA 5EM2A 3SCYA 1JJUB 2YB8B 3F3FA 3DWLC 4XYHA 4O9DA 1MG2A 3C75H 3V9FA 3I7OA 2I0RA 4GM8A 4ZOXA 2I3TA 1GG2B 4PC0A 1YFQA 4GMBA 2YNNA 3I8CA 4PBZA 5JWZA 4J82A 2H13A 1L0QA 1XKSA 3RRMC 4HDJA 4YVDA 3NVXA 5AFU3 4ES0A 2XU7A 5I5MA 3UKRC 2P9IC 2Z2NA 4FA1D 2CN2A 4A08A 3BWSA 4OWRA 3RFHA 4J8BA 3EI1A 1PI6A 4X63B 2YBAA 4A0AA 3PSLA 4IA9A 4LG8A 1U4CA 3OW8A 4J0WA 3SVWD 2H68A 4N14A 5FKTA 4FA4D 3UVLA 4CZVA 4G56B 2HJ4A 2IURA 3RN1D 3I7KA 1R5MA 5C2VB 2QC5A 5FA5B 3GFCA 2CE8A 2P9KC 5AJAA 4CZXA 3F3PA 2HYEA 3SLED 1GOTB 5CYKB 4A0AB 5GXIA 5IJ7E 4BUJC 3RLMD 2IUVA 2PM9B 3EG6A 3IKOA 4GZ8A 2CE9A 5HE3B 5TEEA 1K8KC 2H9NA 4QT8A 3C99A 4K3ID 3FRXA 4FHLA 3ODTA 4PBYA 3VH0A 1TYQC 4FB1D 4CC9A 1SQJA 3AL8B 4JSXC 4L9OA 3MKQA 1QNIA 3UR4A 2P9SC 3EWEA 4TZ4A 2Z2OA 3L4MD 4GM3A 4ERYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHF A;  2P9U C;  3JZG A;  4CY2 A;  2HXC A;  2H6K A;  3ORV D;  3ULE C;  5SXM A;  4E54 A;  2BBK H;  3GRE A;  4JXM A;  3I2N A;  4MK0 B;  4ZOZ A;  5IT9 g;  5HYN B;  2AH0 A;  2Q7Q A;  4O1Q D;  2I0S A;  4CI2 A;  4LG9 A;  5I5I A;  2MTA H;  4A0B A;  1PBY B;  3EU7 A;  3MXX A;  3OTT A;  3V5W B;  5C2W B;  4XEI C;  2OK4 A;  3RFG A;  1MG3 A;  3SXT D;  4U1E I;  2HJB A;  2H3X A;  3W15 A;  2B5L A;  5CXC A;  4L3G D;  4JD2 C;  2H6N A;  1K32 A;  3JZN A;  3SN6 B;  3MZL A;  5EM2 B;  3IJC A;  5GXH A;  5TEF A;  2P9N C;  4A09 A;  4JT5 C;  4CY3 A;  2IAA A;  4JT6 C;  1RI6 A;  3AFC A;  5HE0 B;  5EML B;  3HFQ A;  2OJY A;  2XL3 A;  4U7A A;  3PXW D;  1VYH C;  3MMY A;  4L3H D;  2GC7 A;  1A0R B;  5H14 A;  3RSE C;  4O3T B;  2AH1 A;  4QL1 A;  3EI4 A;  3SJL D;  3VA6 A;  3CFS B;  5EMM B;  2I3S A;  5EAM A;  3PE7 A;  5FKR A;  2CN3 A;  1PEV A;  4J84 A;  4A2M A;  1S4U X;  2PBI B;  3SBP A;  5TF2 A;  3A0F A;  4A08 B;  2AGZ A;  2OVQ B;  4A2L A;  3N0E A;  3OKW A;  4J77 A;  3EI1 B;  4JSN C;  4X3E A;  3EI2 A;  5A2Q g;  3EI3 A;  3OKY A;  2J55 H;  4FWW A;  5GMK n;  3FM0 A;  3K27 A;  3SBR A;  2OVR B;  5HQG A;  4CI1 A;  1SHY B;  2G99 A;  3C9C A;  3RN0 D;  2UZY B;  5K19 A;  5EMJ B;  2CO0 C;  4CI8 A;  2J56 H;  5FQD A;  2EBS A;  2XYI A;  4A11 A;  4CI3 A;  4UI9 R;  3PXT D;  2OIZ A;  4CY5 A;  2I0T A;  3B7F A;  3I8E A;  4J73 A;  5FXY A;  1NEX B;  3EI2 B;  4FAV D;  4X61 B;  4Z8L A;  3PVU B;  3CFV A;  3IJ0 A;  1B9X A;  2O9K A;  5CXB A;  3CIK B;  5EAR A;  4EWR A;  3I7L A;  1GXR A;  1Q47 A;  4QQE A;  3V7D B;  4J87 A;  4PSX B;  5HE2 B;  4ZOY A;  4E5Z A;  5TDH B;  4A11 B;  3AL9 A;  3OL2 A;  4ERQ A;  4CZY A;  4Y7R A;  4H5I A;  3AH8 B;  4J86 A;  3JPX A;  3K26 A;  3N0D A;  3I89 A;  3SMR A;  3JB9 L;  1ERJ A;  4OZU A;  3IIW A;  3ZWL B;  3NVN A;  3OKT A;  2YMU A;  4E5Z B;  2XL2 A;  3P4F A;  2B4E A;  3OL2 B;  2QXV A;  4JSP C;  2PM7 B;  4ZOV A;  4Y5R D;  3F3G A;  2AGW A;  3MZK A;  4E54 B;  4NSX A;  1MDA H;  1SQ9 A;  4GQB B;  3KRX B;  2B5N A;  2H6Q A;  3JRP A;  4XYI A;  4J79 A;  4LGN A;  1OMW B;  2HES X;  4J81 A;  5H1M A;  4A0B B;  4H5J A;  5IGO A;  5IGQ A;  3NVQ A;  4GGA A;  3U4Y A;  5C9Z B;  1NR0 A;  2GC4 A;  5HE1 B;  3JZH A;  4A7J A;  4IMM A;  5CXC B;  4J78 A;  3JAM g;  4AOW A;  4AEZ A;  3UKU C;  3PSC B;  5GSA A;  3DXM C;  4CY1 A;  2AQ5 A;  4JSV C;  2Z2P A;  1B9Y A;  2BCJ B;  4A09 B;  2J57 G;  4J8G A;  2AGY A;  1U2V C;  5I5J A;  1XHM A;  1N6D A;  4GGD A;  2IWK A;  4BH6 A;  4R7A B;  2GNQ A;  3BG1 A;  2CO0 A;  1N6F A;  2YNO A;  3RMZ D;  1FWX A;  1GP2 B;  1P22 A;  3UVK A;  4PSW B;  5CYK A;  5THA A;  3EI4 B;  2OK6 A;  2P9L C;  5EAP A;  3SBQ A;  2PM9 A;  3BG0 A;  3MKS B;  2H9P A;  3I7N A;  4L1Q D;  4ESG A;  3L4O D;  2UZX B;  2YNP A;  3IJ1 A;  4KFM B;  3UVN A;  1XIP A;  2OVP B;  1OLZ A;  2H9L A;  4D6V A;  4FAN D;  4O3U B;  2P9P C;  5IC7 A;  2IWF A;  5EMK B;  5KDO B;  3PXS D;  3EI3 B;  3OKY B;  2IUQ A;  2W18 A;  3DM0 A;  3C5M A;  3AL8 A;  5B4W A;  4ZN4 A;  4GQ1 A;  5K1C C;  3J80 g;  2H47 A;  4QRJ A;  5EAL A;  3DXK C;  3JRO A;  5FKQ A;  3PVW B;  4K3J B;  1JMX B;  1JMZ B;  4FA9 D;  4GGC A;  4I79 A;  4BL0 A;  3SFZ A;  3EMH A;  4PXW A;  3KRW B;  2HKM A;  5H17 A;  3FGB A;  2B5M A;  2TRC B;  2AGL A;  2H9M A;  3VGZ A;  4D0K A;  4GM9 A;  5FLX g;  2AGX A;  4FA5 D;  4ERZ A;  1JOF A;  1TBG A;  5CXB B;  3J81 g;  4O45 A;  3IIY A;  3E0C A;  5AMS A;  2HKR A;  1N6E A;  3UVM A;  3UVO A;  4J0X A;  2IUP A;  2G9A A;  2H14 A;  2PM6 B;  3I7P A;  1PGU A;  3DSM A;  3I7H A;  4PNK B;  4X60 B;  4GQ2 P;  3SWS D;  5IJ8 E;  2CNX A;  5FKS A;  5EM2 A;  3SCY A;  1JJU B;  2YB8 B;  3F3F A;  3DWL C;  4XYH A;  4O9D A;  1MG2 A;  3C75 H;  3V9F A;  3I7O A;  2I0R A;  4GM8 A;  4ZOX A;  2I3T A;  1GG2 B;  4PC0 A;  1YFQ A;  4GMB A;  2YNN A;  3I8C A;  4PBZ A;  5JWZ A;  4J82 A;  2H13 A;  1L0Q A;  1XKS A;  3RRM C;  4HDJ A;  4YVD A;  3NVX A;  5AFU 3;  4ES0 A;  2XU7 A;  5I5M A;  3UKR C;  2P9I C;  2Z2N A;  4FA1 D;  2CN2 A;  4A08 A;  3BWS A;  4OWR A;  3RFH A;  4J8B A;  3EI1 A;  1PI6 A;  4X63 B;  2YBA A;  4A0A A;  3PSL A;  4IA9 A;  4LG8 A;  1U4C A;  3OW8 A;  4J0W A;  3SVW D;  2H68 A;  4N14 A;  5FKT A;  4FA4 D;  3UVL A;  4CZV A;  4G56 B;  2HJ4 A;  2IUR A;  3RN1 D;  3I7K A;  1R5M A;  5C2V B;  2QC5 A;  5FA5 B;  3GFC A;  2CE8 A;  2P9K C;  5AJA A;  4CZX A;  3F3P A;  2HYE A;  3SLE D;  1GOT B;  5CYK B;  4A0A B;  5GXI A;  5IJ7 E;  4BUJ C;  3RLM D;  2IUV A;  2PM9 B;  3EG6 A;  3IKO A;  4GZ8 A;  2CE9 A;  5HE3 B;  5TEE A;  1K8K C;  2H9N A;  4QT8 A;  3C99 A;  4K3I D;  3FRX A;  4FHL A;  3ODT A;  4PBY A;  3VH0 A;  1TYQ C;  4FB1 D;  4CC9 A;  1SQJ A;  3AL8 B;  4JSX C;  4L9O A;  3MKQ A;  1QNI A;  3UR4 A;  2P9S C;  3EWE A;  4TZ4 A;  2Z2O A;  3L4M D;  4GM3 A;  4ERY A; 
#chains in the Genus database with same CATH topology
 3SHF A;  2P9U C;  2QR5 A;  3JZG A;  4CY2 A;  2HXC A;  2H6K A;  4JHN A;  5E6S A;  3ORV D;  3ULE C;  5SXM A;  4E54 A;  1JV2 A;  2BBK H;  3GRE A;  4JXM A;  3I2N A;  4MK0 B;  4ZOZ A;  5IT9 g;  5HYN B;  2AH0 A;  2Q7Q A;  1E5T A;  4O1Q D;  2I0S A;  4CI2 A;  1GOG A;  4LG9 A;  4AMZ A;  5I5I A;  2JKX A;  3VI3 A;  4UM9 A;  2MTA H;  4A0B A;  1PBY B;  3EU7 A;  3MXX A;  3OTT A;  3V5W B;  5C2W B;  3OF7 A;  4XEI C;  2OK4 A;  3RFG A;  1MG3 A;  3SXT D;  3GC3 B;  4U1E I;  2HJB A;  2H3X A;  3W15 A;  2B5L A;  5CXC A;  4L3G D;  4Z7Q A;  2VC2 A;  5C86 A;  4JD2 C;  2H6N A;  1K32 A;  1K3I A;  2VDL A;  3JZN A;  3SN6 B;  3MZL A;  5EM2 B;  2BKL A;  3IJC A;  2EIC A;  5GXH A;  5TEF A;  1UTC A;  2P9N C;  4A09 A;  1H2W A;  3FCS A;  4JT5 C;  4CY3 A;  2IAA A;  4JT6 C;  1RI6 A;  3AFC A;  3IUR A;  4WK0 A;  5HE0 B;  5EML B;  3HFQ A;  2OJY A;  2XL3 A;  4IRZ A;  4U7A A;  3PXW D;  1VYH C;  3MMY A;  4L3H D;  2GC7 A;  1A0R B;  5H14 A;  3ZDX A;  3RSE C;  4O3T B;  2AH1 A;  3IJE A;  4QL1 A;  3EQ9 A;  3EI4 A;  4G1M A;  3SJL D;  1VZ2 A;  3EQ8 A;  2HU7 A;  3VA6 A;  3CFS B;  5EMM B;  2I3S A;  5EAM A;  3EQ7 A;  3PE7 A;  5FKR A;  2CN3 A;  2EIB A;  1A12 A;  1PEV A;  4J84 A;  4A2M A;  1S4U X;  1T2X A;  2PBI B;  4BP8 A;  3SBP A;  5TF2 A;  3A0F A;  4A08 B;  2AGZ A;  1VE7 A;  2OVQ B;  4A2L A;  3N0E A;  3OKW A;  4J77 A;  3EI1 B;  4L1M A;  4O02 A;  4JSN C;  1UOO A;  4X3E A;  3EI2 A;  5A2Q g;  3EI3 A;  3OKY A;  2J55 H;  4FWW A;  5GMK n;  3FM0 A;  3K27 A;  3SBR A;  2OVR B;  5HQG A;  4CI1 A;  1SHY B;  2G99 A;  4RE6 A;  3C9C A;  4BCC A;  3RN0 D;  2UZY B;  5K19 A;  5EMJ B;  5M5U A;  2CO0 C;  4CI8 A;  2J56 H;  5FQD A;  2EBS A;  2XYI A;  4A11 A;  4CI3 A;  4UI9 R;  5C92 A;  3PXT D;  2OIZ A;  4CY5 A;  3NIG A;  4WK2 A;  2XE4 A;  2I0T A;  3B7F A;  3I8E A;  4J73 A;  5FXY A;  3IUN A;  1NEX B;  3EI2 B;  4FAV D;  4O2W A;  4X61 B;  4Z8L A;  3PVU B;  3CFV A;  1O6G A;  3IJ0 A;  1B9X A;  2O9K A;  5CXB A;  3CIK B;  5EAR A;  4EWR A;  3I7L A;  1GXR A;  1E8N A;  1VE6 A;  5FFG A;  2VZ3 A;  4NBM A;  3DDU A;  1Q47 A;  4QQE A;  3V7D B;  4J87 A;  4PSX B;  5HE2 B;  4ZOY A;  4E5Z A;  5TDH B;  4WK4 A;  3AL9 A;  4A11 B;  3OL2 A;  4DNU A;  4ERQ A;  4CZY A;  4Y7R A;  4H5I A;  3AH8 B;  4J86 A;  3JPX A;  1H2X A;  3K26 A;  3N0D A;  3I89 A;  4DNV A;  3SMR A;  2VDN A;  3JB9 L;  1ERJ A;  4OZU A;  3IIW A;  3ZWL B;  3NVN A;  1C9L A;  4Z7N A;  2VDK A;  3OKT A;  2XDW A;  2YMU A;  1YR2 A;  4E5Z B;  2XL2 A;  5E6U A;  3P4F A;  2B4E A;  3OL2 B;  2QXV A;  1BPO A;  4JSP C;  2PM7 B;  3FCU A;  4ZOV A;  4Y5R D;  3F3G A;  4AN0 A;  2AGW A;  3K71 A;  3MZK A;  4E54 B;  4NSX A;  1MDA H;  1SQ9 A;  4D9S A;  4GQB B;  3KRX B;  2B5N A;  2H6Q A;  3JRP A;  4XYI A;  4J79 A;  4LGN A;  1OMW B;  2HES X;  4J81 A;  5H1M A;  4A0B B;  4H5J A;  5IGO A;  5IGQ A;  4AN1 A;  3NVQ A;  4GGA A;  3U4Y A;  5C9Z B;  2HU5 A;  1NR0 A;  2GC4 A;  5HE1 B;  4NC4 A;  3JZH A;  5E6R A;  1QFM A;  4A7J A;  3O4H A;  4IMM A;  5CXC B;  4J78 A;  3JAM g;  4AOW A;  1M1X A;  4AEZ A;  1JTD B;  4JHP C;  3UKU C;  3PSC B;  5GSA A;  2VDR A;  3DXM C;  4CY1 A;  2AQ5 A;  4DNW A;  4JSV C;  2VZ1 A;  2VDM A;  2Z2P A;  1B9Y A;  2BCJ B;  4A09 B;  2J57 G;  4J8G A;  1UOQ A;  2AGY A;  1U2V C;  5I5J A;  1XHM A;  3QI0 A;  1N6D A;  4GGD A;  2IWK A;  4BH6 A;  4R7A B;  2GNQ A;  3BG1 A;  2CO0 A;  2HU8 A;  1N6F A;  2YNO A;  3RMZ D;  1FWX A;  1GP2 B;  1P22 A;  3UVK A;  4PSW B;  5CYK A;  5THA A;  3V4V A;  3EI4 B;  2OK6 A;  2P9L C;  5EAP A;  3SBQ A;  2PM9 A;  4BCB A;  3BG0 A;  3MKS B;  2WQ8 A;  2H9P A;  3I7N A;  4L1Q D;  4QAM A;  4ESG A;  1UOP A;  3L4O D;  4NEN A;  2UZX B;  2YNP A;  4NAA A;  3IJ1 A;  4KFM B;  3UVN A;  2VDP A;  3T3M A;  1XIP A;  2OVP B;  1OLZ A;  2H9L A;  4D6V A;  4FAN D;  4O3U B;  2P9P C;  5IC7 A;  2IWF A;  3V4P A;  5EMK B;  5KDO B;  3PXS D;  3EI3 B;  2QZP A;  3OKY B;  2IUQ A;  2W18 A;  3IUJ A;  3KCI A;  3DM0 A;  3C5M A;  3AL8 A;  5B4W A;  4ZN4 A;  5M5S A;  4GQ1 A;  5K1C C;  3K6S A;  3J80 g;  2H47 A;  4QRJ A;  5EAL A;  3DXK C;  3JRO A;  3QHY B;  5FKQ A;  3PVW B;  4K3J B;  1JMX B;  1JMZ B;  4FA9 D;  4GGC A;  4I79 A;  4BL0 A;  3SFZ A;  3EMH A;  4PXW A;  3KRW B;  2HKM A;  5H17 A;  3FGB A;  2B5M A;  2TRC B;  2AGL A;  2H9M A;  3VGZ A;  4D0K A;  4GM9 A;  5FLX g;  2AGX A;  4FA5 D;  3MUO A;  4ERZ A;  1JOF A;  1TBG A;  5CXB B;  3J81 g;  4O45 A;  4AX4 A;  3IIY A;  3E0C A;  5AMS A;  2HKR A;  3O4I A;  1N6E A;  3UVM A;  3UVO A;  4J0X A;  2IUP A;  1L5G A;  2G9A A;  2H14 A;  2PM6 B;  3I7P A;  1PGU A;  3DSM A;  3I7H A;  4PNK B;  5HDB A;  4X60 B;  4GQ2 P;  4UM8 A;  1GOH A;  3SWS D;  5IJ8 E;  2CNX A;  3IVM A;  5FKS A;  5EM2 A;  3SCY A;  1JJU B;  2YB8 B;  3F3F A;  3DWL C;  4XYH A;  3ZE2 A;  4O9D A;  1VZ3 A;  2VDQ A;  1MG2 A;  5FFO A;  3C75 H;  3V9F A;  3I7O A;  2I0R A;  4GM8 A;  4ZOX A;  2I3T A;  1GG2 B;  4PC0 A;  1YFQ A;  4BCD A;  4GMB A;  4MMX A;  3IUM A;  2YNN A;  3I8C A;  4PBZ A;  5JWZ A;  1H2Y A;  3T3P A;  4J82 A;  2H13 A;  4BP9 A;  1L0Q A;  4MMY A;  4MMZ A;  1XKS A;  3NID A;  3RRM C;  1I2M B;  1TYE A;  5M5T A;  4HDJ A;  3GD1 I;  4YVD A;  3NVX A;  5AFU 3;  4ES0 A;  2XU7 A;  5I5M A;  3NIF A;  3UKR C;  1E8M A;  2P9I C;  2Z2N A;  4FA1 D;  2CN2 A;  3K72 A;  4A08 A;  3BWS A;  4OWR A;  3RFH A;  4J8B A;  3EI1 A;  4G1E A;  1PI6 A;  4X63 B;  2YBA A;  5M5R A;  3PSL A;  4A0A A;  2XZG A;  4IA9 A;  4LG8 A;  3IUQ A;  1U4C A;  3OW8 A;  4J0W A;  1C9I A;  3SVW D;  2H68 A;  1O6F A;  4N14 A;  5FKT A;  4FA4 D;  3O4J A;  3UVL A;  4CZV A;  4G56 B;  2HJ4 A;  2IUR A;  3RN1 D;  3I7K A;  1R5M A;  5C2V B;  2QC5 A;  5FA5 B;  1GOF A;  3GFC A;  4Z7O A;  2CE8 A;  2P9K C;  5AJA A;  4CZX A;  3F3P A;  4RE5 A;  2HYE A;  4AMY A;  3SLE D;  1GOT B;  3O4G A;  5CYK B;  3ZDZ A;  4A0A B;  2EID A;  5GXI A;  5IJ7 E;  4BUJ C;  3RLM D;  1H2Z A;  2IUV A;  2PM9 B;  3IUL A;  1U8C A;  3ZE0 A;  3EG6 A;  3IKO A;  4GZ8 A;  4G55 A;  2VDO A;  2CE9 A;  5HE3 B;  3MUN A;  5TEE A;  1K8K C;  2H9N A;  4QT8 A;  5M61 A;  3C99 A;  5M5V A;  4K3I D;  3FRX A;  2EIE A;  4FHL A;  3ODT A;  4PBY A;  3VH0 A;  3VI4 A;  1TYQ C;  3MVD K;  4FB1 D;  4CC9 A;  1SQJ A;  3AL8 B;  4JSX C;  4L9O A;  3MKQ A;  1QNI A;  3UR4 A;  2P9S C;  3ZDY A;  3EWE A;  4TZ4 A;  2Z2O A;  1QFS A;  4WJK A;  3L4M D;  4GM3 A;  3ZE1 A;  4ERY A; 
#chains in the Genus database with same CATH homology
 3SHF A;  2P9U C;  3JZG A;  4CY2 A;  2HXC A;  2H6K A;  3ORV D;  3ULE C;  5SXM A;  4E54 A;  2BBK H;  3GRE A;  4JXM A;  3I2N A;  4MK0 B;  4ZOZ A;  5IT9 g;  5HYN B;  2AH0 A;  2Q7Q A;  4O1Q D;  2I0S A;  4CI2 A;  4LG9 A;  5I5I A;  2MTA H;  4A0B A;  1PBY B;  3EU7 A;  3MXX A;  3OTT A;  3V5W B;  5C2W B;  4XEI C;  2OK4 A;  3RFG A;  1MG3 A;  3SXT D;  4U1E I;  2HJB A;  2H3X A;  3W15 A;  2B5L A;  5CXC A;  4L3G D;  4JD2 C;  2H6N A;  1K32 A;  3JZN A;  3SN6 B;  3MZL A;  5EM2 B;  3IJC A;  5GXH A;  5TEF A;  2P9N C;  4A09 A;  4JT5 C;  4CY3 A;  2IAA A;  4JT6 C;  1RI6 A;  3AFC A;  5HE0 B;  5EML B;  3HFQ A;  2OJY A;  2XL3 A;  4U7A A;  3PXW D;  1VYH C;  3MMY A;  4L3H D;  2GC7 A;  1A0R B;  5H14 A;  3RSE C;  4O3T B;  2AH1 A;  4QL1 A;  3EI4 A;  3SJL D;  3VA6 A;  3CFS B;  5EMM B;  2I3S A;  5EAM A;  3PE7 A;  5FKR A;  2CN3 A;  1PEV A;  4J84 A;  4A2M A;  1S4U X;  2PBI B;  3SBP A;  5TF2 A;  3A0F A;  4A08 B;  2AGZ A;  2OVQ B;  4A2L A;  3N0E A;  3OKW A;  4J77 A;  3EI1 B;  4JSN C;  4X3E A;  3EI2 A;  5A2Q g;  3EI3 A;  3OKY A;  2J55 H;  4FWW A;  5GMK n;  3FM0 A;  3K27 A;  3SBR A;  2OVR B;  5HQG A;  4CI1 A;  1SHY B;  2G99 A;  3C9C A;  3RN0 D;  2UZY B;  5K19 A;  5EMJ B;  2CO0 C;  4CI8 A;  2J56 H;  5FQD A;  2EBS A;  2XYI A;  4A11 A;  4CI3 A;  4UI9 R;  3PXT D;  2OIZ A;  4CY5 A;  2I0T A;  3B7F A;  3I8E A;  4J73 A;  5FXY A;  1NEX B;  3EI2 B;  4FAV D;  4X61 B;  4Z8L A;  3PVU B;  3CFV A;  3IJ0 A;  1B9X A;  2O9K A;  5CXB A;  3CIK B;  5EAR A;  4EWR A;  3I7L A;  1GXR A;  1Q47 A;  4QQE A;  3V7D B;  4J87 A;  4PSX B;  5HE2 B;  4ZOY A;  4E5Z A;  5TDH B;  4A11 B;  3AL9 A;  3OL2 A;  4ERQ A;  4CZY A;  4Y7R A;  4H5I A;  3AH8 B;  4J86 A;  3JPX A;  3K26 A;  3N0D A;  3I89 A;  3SMR A;  3JB9 L;  1ERJ A;  4OZU A;  3IIW A;  3ZWL B;  3NVN A;  3OKT A;  2YMU A;  4E5Z B;  2XL2 A;  3P4F A;  2B4E A;  3OL2 B;  2QXV A;  4JSP C;  2PM7 B;  4ZOV A;  4Y5R D;  3F3G A;  2AGW A;  3MZK A;  4E54 B;  4NSX A;  1MDA H;  1SQ9 A;  4GQB B;  3KRX B;  2B5N A;  2H6Q A;  3JRP A;  4XYI A;  4J79 A;  4LGN A;  1OMW B;  2HES X;  4J81 A;  5H1M A;  4A0B B;  4H5J A;  5IGO A;  5IGQ A;  3NVQ A;  4GGA A;  3U4Y A;  5C9Z B;  1NR0 A;  2GC4 A;  5HE1 B;  3JZH A;  4A7J A;  4IMM A;  5CXC B;  4J78 A;  3JAM g;  4AOW A;  4AEZ A;  3UKU C;  3PSC B;  5GSA A;  3DXM C;  4CY1 A;  2AQ5 A;  4JSV C;  2Z2P A;  1B9Y A;  2BCJ B;  4A09 B;  2J57 G;  4J8G A;  2AGY A;  1U2V C;  5I5J A;  1XHM A;  1N6D A;  4GGD A;  2IWK A;  4BH6 A;  4R7A B;  2GNQ A;  3BG1 A;  2CO0 A;  1N6F A;  2YNO A;  3RMZ D;  1FWX A;  1GP2 B;  1P22 A;  3UVK A;  4PSW B;  5CYK A;  5THA A;  3EI4 B;  2OK6 A;  2P9L C;  5EAP A;  3SBQ A;  2PM9 A;  3BG0 A;  3MKS B;  2H9P A;  3I7N A;  4L1Q D;  4ESG A;  3L4O D;  2UZX B;  2YNP A;  3IJ1 A;  4KFM B;  3UVN A;  1XIP A;  2OVP B;  1OLZ A;  2H9L A;  4D6V A;  4FAN D;  4O3U B;  2P9P C;  5IC7 A;  2IWF A;  5EMK B;  5KDO B;  3PXS D;  3EI3 B;  3OKY B;  2IUQ A;  2W18 A;  3DM0 A;  3C5M A;  3AL8 A;  5B4W A;  4ZN4 A;  4GQ1 A;  5K1C C;  3J80 g;  2H47 A;  4QRJ A;  5EAL A;  3DXK C;  3JRO A;  5FKQ A;  3PVW B;  4K3J B;  1JMX B;  1JMZ B;  4FA9 D;  4GGC A;  4I79 A;  4BL0 A;  3SFZ A;  3EMH A;  4PXW A;  3KRW B;  2HKM A;  5H17 A;  3FGB A;  2B5M A;  2TRC B;  2AGL A;  2H9M A;  3VGZ A;  4D0K A;  4GM9 A;  5FLX g;  2AGX A;  4FA5 D;  4ERZ A;  1JOF A;  1TBG A;  5CXB B;  3J81 g;  4O45 A;  3IIY A;  3E0C A;  5AMS A;  2HKR A;  1N6E A;  3UVM A;  3UVO A;  4J0X A;  2IUP A;  2G9A A;  2H14 A;  2PM6 B;  3I7P A;  1PGU A;  3DSM A;  3I7H A;  4PNK B;  4X60 B;  4GQ2 P;  3SWS D;  5IJ8 E;  2CNX A;  5FKS A;  5EM2 A;  3SCY A;  1JJU B;  2YB8 B;  3F3F A;  3DWL C;  4XYH A;  4O9D A;  1MG2 A;  3C75 H;  3V9F A;  3I7O A;  2I0R A;  4GM8 A;  4ZOX A;  2I3T A;  1GG2 B;  4PC0 A;  1YFQ A;  4GMB A;  2YNN A;  3I8C A;  4PBZ A;  5JWZ A;  4J82 A;  2H13 A;  1L0Q A;  1XKS A;  3RRM C;  4HDJ A;  4YVD A;  3NVX A;  5AFU 3;  4ES0 A;  2XU7 A;  5I5M A;  3UKR C;  2P9I C;  2Z2N A;  4FA1 D;  2CN2 A;  4A08 A;  3BWS A;  4OWR A;  3RFH A;  4J8B A;  3EI1 A;  1PI6 A;  4X63 B;  2YBA A;  4A0A A;  3PSL A;  4IA9 A;  4LG8 A;  1U4C A;  3OW8 A;  4J0W A;  3SVW D;  2H68 A;  4N14 A;  5FKT A;  4FA4 D;  3UVL A;  4CZV A;  4G56 B;  2HJ4 A;  2IUR A;  3RN1 D;  3I7K A;  1R5M A;  5C2V B;  2QC5 A;  5FA5 B;  3GFC A;  2CE8 A;  2P9K C;  5AJA A;  4CZX A;  3F3P A;  2HYE A;  3SLE D;  1GOT B;  5CYK B;  4A0A B;  5GXI A;  5IJ7 E;  4BUJ C;  3RLM D;  2IUV A;  2PM9 B;  3EG6 A;  3IKO A;  4GZ8 A;  2CE9 A;  5HE3 B;  5TEE A;  1K8K C;  2H9N A;  4QT8 A;  3C99 A;  4K3I D;  3FRX A;  4FHL A;  3ODT A;  4PBY A;  3VH0 A;  1TYQ C;  4FB1 D;  4CC9 A;  1SQJ A;  3AL8 B;  4JSX C;  4L9O A;  3MKQ A;  1QNI A;  3UR4 A;  2P9S C;  3EWE A;  4TZ4 A;  2Z2O A;  3L4M D;  4GM3 A;  4ERY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...