4GM8A

Crystal structure of human wd repeat domain 5 with compound mm-102
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
304
structure length
302
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-affinity, small-molecule peptidomimetic inhibitors of MLL1/WDR5 protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
total genus 96
structure length 302
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm8A00
5C2WB 3FM0A 2P9NC 5KDOB 2UZXB 2H3XA 3NVNA 2H13A 2BCJB 5EAMA 4A11B 4BL0A 2H68A 3AH8B 3I7KA 1SQ9A 3RFGA 3IKOA 3DXMC 3JB9L 5IJ7E 3J80g 4FHLA 3CIKB 3RFHA 1OLZA 1GG2B 4A0BA 4JSNC 3AL8B 1RI6A 5EMLB 2XL3A 2H9PA 4CI3A 4OWRA 3SBPA 2IUPA 2HYEA 5JWZA 2P9KC 3N0DA 4ZOXA 4R7AB 1OMWB 4OZUA 3KRXB 3SWSD 2Z2OA 3PXWD 4O9DA 3I7PA 2PM6B 1JMXB 4A08A 4O1QD 4J87A 4NSXA 2I0RA 1L0QA 2G9AA 4J77A 4JT6C 3UKRC 5C2VB 3DXKC 1SQJA 2CN3A 3OW8A 4X60B 3I8CA 2AGLA 4GM9A 5FXYA 3RLMD 4U1EI 3C99A 2BBKH 3UVNA 1N6DA 3I7OA 2XYIA 4CY5A 3GREA 2H6KA 2HXCA 3J81g 3W15A 3JZGA 3EI4B 3UR4A 4PSWB 4G56B 3I8EA 2O9KA 4HDJA 4A09B 2CE9A 2IURA 4J86A 1K32A 2YNNA 4A11A 4UI9R 3MKSB 1QNIA 1JOFA 4CZXA 5AMSA 4CI8A 4XYHA 5CXBB 3V5WB 2PM9B 3JROA 3JAMg 4GMBA 2J55H 5B4WA 2AGZA 3IJ0A 4PXWA 5GSAA 4CI2A 3JZHA 4A7JA 4ZOVA 4J79A 4FA9D 4MK0B 4GZ8A 4J0XA 2I3TA 3OTTA 4J8BA 5FKSA 3UVOA 3L4OD 4AEZA 4GQBB 2GNQA 2CO0A 5GXIA 3V7DB 4A09A 2AQ5A 5EMMB 3DSMA 2G99A 3RMZD 4BH6A 2P9SC 1R5MA 5CXCA 1Q47A 2PM9A 5TDHB 5EALA 4QT8A 3SLED 3RN0D 5FQDA 2XU7A 4QL1A 3ULEC 2I0TA 4CY1A 3EMHA 3OKTA 4LG8A 4CY2A 2Z2NA 4Y5RD 4JSXC 1NEXB 2B4EA 2OVQB 5EM2B 1B9YA 2OK4A 4CI1A 5GMKn 2PBIB 3FGBA 3RSEC 3VGZA 3C75H 4QQEA 4FA4D 5FKTA 2P9IC 2MTAH 2AGYA 3SN6B 4EWRA 4FWWA 4U7AA 1N6FA 2I0SA 4CZYA 5A2Qg 1TBGA 3F3PA 3AL8A 2HKMA 2OVPB 3JPXA 3GFCA 4CY3A 5HE0B 4K3JB 3EG6A 3L4MD 3RN1D 5H14A 4GM8A 3MMYA 5EMKB 5K19A 2OJYA 3IIWA 2H47A 4ZN4A 4JSVC 2EBSA 3CFSB 3IJCA 1B9XA 4J0WA 1ERJA 2HJ4A 4ESGA 2IUQA 3FRXA 3UKUC 1K8KC 5GXHA 3SBQA 3I7LA 1PGUA 4XYIA 5IC7A 5FKRA 3MZKA 4JSPC 1P22A 3PXSD 3I89A 4FA1D 3I2NA 4O3TB 3P4FA 3ZWLB 3PSCB 2H9NA 3F3GA 5HE1B 5FLXg 5HYNB 5EM2A 5THAA 1PBYB 4GGAA 3ODTA 3B7FA 1GOTB 3SJLD 2P9PC 5EAPA 2H9MA 3A0FA 5I5JA 5I5MA 2J57G 3SHFA 5CXCB 2HJBA 5FKQA 4H5IA 4D6VA 3E0CA 2XL2A 4O45A 4D0KA 3EI2A 5H1MA 4J81A 3EI1A 4ERYA 2IAAA 3SXTD 1XKSA 2OK6A 2J56H 3IJ1A 2TRCB 3CFVA 3EU7A 1XHMA 3UVKA 5HE3B 2HKRA 3OL2A 4GGDA 2PM7B 3SFZA 1U4CA 5AJAA 3MXXA 4JXMA 3BG0A 1NR0A 2H14A 4K3ID 4YVDA 2AGXA 1PI6A 4TZ4A 2HESX 5SXMA 4L1QD 3BWSA 3N0EA 4E54A 2H9LA 4PBZA 4X3EA 4J73A 2H6NA 5HQGA 3PXTD 3BG1A 4PBYA 4QRJA 2Q7QA 1GXRA 3PVUB 4PC0A 3EI3B 5TEFA 3SBRA 3EI4A 2B5LA 4ERQA 2QC5A 3C5MA 4N14A 5H17A 3V9FA 4XEIC 5IGOA 4LGNA 3OKYA 5I5IA 3SVWD 4PSXB 5CYKA 3OKWA 4JT5C 3PE7A 3AL9A 1A0RB 3VA6A 3F3FA 4ZOZA 5AFU3 5C9ZB 1YFQA 2IWKA 4Y7RA 3ORVD 4A2LA 3MZLA 4J82A 3DM0A 3MKQA 4I79A 4GGCA 3JRPA 3C9CA 2IUVA 4A0AA 2CNXA 4L3HD 2P9LC 2OIZA 1SHYB 4A2MA 5EARA 2P9UC 5CYKB 2GC7A 4IMMA 4ES0A 2AH0A 4FA5D 1JJUB 4AOWA 2OVRB 4FB1D 5EMJB 1TYQC 3I7NA 4J78A 5IGQA 4A0AB 2AGWA 4CC9A 4J84A 3DWLC 4ZOYA 3JZNA 3UVLA 5IT9g 4A08B 2YNOA 1S4UX 2CE8A 4X61B 4CZVA 2UZYB 4ERZA 3K26A 3OKYB 5IJ8E 2CN2A 1XIPA 2I3SA 1MG3A 1GP2B 3U4YA 3NVQA 3AFCA 5K1CC 3EI3A 4A0BB 2GC4A 2AH1A 4Z8LA 4LG9A 4O3UB 5TEEA 4IA9A 2IWFA 2YMUA 3UVMA 2Z2PA 3HFQA 1N6EA 4L3GD 3EI1B 4L9OA 4E54B 3EI2B 3IIYA 4FAND 3RRMC 1U2VC 4JD2C 4GQ1A 2YNPA 4GM3A 4H5JA 2YBAA 2H6QA 3PVWB 3EWEA 3KRWB 5TF2A 3SMRA 3OL2B 2YB8B 4E5ZA 1VYHC 4KFMB 1PEVA 1MG2A 5CXBA 1JMZB 3PSLA 2W18A 2QXVA 3K27A 5HE2B 3NVXA 4BUJC 4PNKB 3I7HA 2CO0C 4FAVD 2B5MA 3SCYA 4E5ZB 4GQ2P 1FWXA 1MDAH 3VH0A 4X63B 5FA5B 2B5NA 4J8GA
chains in the Genus database with same CATH superfamily
5C2WB 3FM0A 2P9NC 5KDOB 2UZXB 3GC3B 2H3XA 3NVNA 3VI4A 2H13A 2BCJB 2EICA 5M5TA 5EAMA 4A11B 4AMZA 4BL0A 2H68A 3AH8B 3I7KA 1SQ9A 3RFGA 3IKOA 3DXMC 3JB9L 5IJ7E 1E8NA 2HU5A 3J80g 4FHLA 3CIKB 3RFHA 1OLZA 1GG2B 4A0BA 4JSNC 1YR2A 2WQ8A 1RI6A 3AL8B 5EMLB 2XL3A 4MMZA 2H9PA 4CI3A 4OWRA 3SBPA 3ZE2A 2IUPA 2XZGA 2HYEA 5JWZA 1JTDB 2P9KC 3N0DA 3IUNA 4ZOXA 5C92A 4R7AB 1OMWB 4OZUA 3QHYB 1O6FA 3KRXB 3SWSD 3PXWD 1VE6A 2Z2OA 4O9DA 3I7PA 5FFOA 2PM6B 1JMXB 4A08A 4O1QD 4J87A 4NSXA 2I0RA 1L0QA 2G9AA 4J77A 1T2XA 4JT6C 3UKRC 5C2VB 3DXKC 1SQJA 2CN3A 3OW8A 3MUOA 4X60B 3I8CA 2AGLA 4GM9A 1H2ZA 5FXYA 3RLMD 4NAAA 4U1EI 3C99A 1O6GA 2BBKH 1N6DA 3UVNA 3I7OA 2XYIA 4CY5A 3GREA 2H6KA 1QFMA 2HXCA 4D9SA 3J81g 3W15A 2JKXA 2HU8A 3FCSA 3EI4B 3JZGA 3UR4A 4PSWB 4DNWA 4G56B 3K71A 3I8EA 2O9KA 4HDJA 3IVMA 3MUNA 4A09B 2CE9A 2IURA 4J86A 1K32A 2YNNA 4A11A 4AN1A 4UI9R 3MKSB 1QNIA 1JOFA 1M1XA 3IUMA 4CZXA 5AMSA 4CI8A 4XYHA 1JV2A 5CXBB 3V5WB 2PM9B 5FFGA 3JROA 3JAMg 4GMBA 3NIFA 3DDUA 2J55H 5B4WA 2AGZA 3IJ0A 4NC4A 4PXWA 5GSAA 4CI2A 3JZHA 3IJEA 4A7JA 4ZOVA 4J79A 4FA9D 4MK0B 4GZ8A 4J0XA 2I3TA 3OTTA 4J8BA 5FKSA 1H2XA 3UVOA 3L4OD 4AEZA 4GQBB 5C86A 2GNQA 2CO0A 5GXIA 3OF7A 3V7DB 4A09A 5M5VA 3EQ9A 2AQ5A 3V4VA 5EMMB 3DSMA 1GOHA 2G99A 3NIGA 3RMZD 4BH6A 2P9SC 1R5MA 5CXCA 2VDKA 4Z7NA 1Q47A 2PM9A 2XE4A 5TDHB 5EALA 4QT8A 4MMXA 3SLED 1U8CA 3RN0D 5FQDA 2XU7A 4QL1A 3ULEC 2I0TA 3T3PA 4CY1A 3EMHA 3OKTA 4LG8A 4CY2A 2Z2NA 4Y5RD 4G1EA 4JSXC 1NEXB 3ZE1A 2B4EA 4MMYA 2OVQB 5EM2B 1B9YA 2OK4A 4CI1A 5GMKn 2PBIB 3FGBA 3RSEC 3VGZA 3C75H 4QQEA 4DNUA 4FA4D 5FKTA 2P9IC 2EIBA 2MTAH 2AGYA 3SN6B 4EWRA 4FWWA 4U7AA 1N6FA 2I0SA 1C9LA 5E6RA 4CZYA 5A2Qg 1TBGA 3F3PA 3AL8A 2HKMA 2OVPB 5M5UA 3ZE0A 3JPXA 3GFCA 4BCCA 4RE5A 4CY3A 1A12A 2VDOA 5HE0B 4K3JB 3EG6A 4O02A 3L4MD 3RN1D 5H14A 4GM8A 3MMYA 4NENA 5EMKB 5K19A 2OJYA 3IIWA 2H47A 4ZN4A 4JSVC 2EBSA 3CFSB 3IJCA 1B9XA 4J0WA 1ERJA 2BKLA 2HJ4A 4ESGA 2IUQA 3FRXA 4QAMA 2QR5A 4Z7OA 3UKUC 1K8KC 2VC2A 5GXHA 3SBQA 3I7LA 3IURA 1PGUA 4XYIA 5IC7A 5FKRA 3MZKA 5M5SA 5E6SA 4JSPC 1P22A 3PXSD 3I89A 4FA1D 3I2NA 4O3TB 2VDNA 1VE7A 3P4FA 3ZWLB 3PSCB 2H9NA 3F3GA 5HE1B 2VZ3A 5FLXg 5HYNB 3MVDK 5EM2A 4WJKA 5THAA 1PBYB 3ODTA 3B7FA 4GGAA 1GOTB 3O4GA 3SJLD 2P9PC 5EAPA 2H9MA 3A0FA 1BPOA 5I5JA 2VDMA 5I5MA 2J57G 3SHFA 5CXCB 2HJBA 5FKQA 4H5IA 4D6VA 1UOQA 3E0CA 2XL2A 4O45A 1L5GA 3EQ7A 4NBMA 5H1MA 4D0KA 4J81A 3EI2A 4AX4A 3EI1A 3T3MA 4ERYA 2IAAA 3SXTD 3IUJA 1XKSA 3ZDZA 2OK6A 4BCBA 4UM9A 2J56H 3IJ1A 2TRCB 4DNVA 3CFVA 3EU7A 1XHMA 3UVKA 5HE3B 4WK4A 1UOPA 2HKRA 2VDLA 3OL2A 4GGDA 2PM7B 3SFZA 1U4CA 1E8MA 5AJAA 1VZ3A 3MXXA 4JXMA 3BG0A 3KCIA 4L1MA 4JHNA 1NR0A 2H14A 4K3ID 4YVDA 2AGXA 1PI6A 4TZ4A 3K6SA 2HESX 5SXMA 4L1QD 3BWSA 3N0EA 4E54A 2H9LA 2VDRA 4PBZA 4X3EA 4J73A 2H6NA 5HQGA 5M61A 3V4PA 3PXTD 3BG1A 4PBYA 2XDWA 4QRJA 2Q7QA 1GXRA 3PVUB 4PC0A 5HDBA 3EI3B 5TEFA 3SBRA 3EI4A 2B5LA 4IRZA 4ERQA 2QC5A 3C5MA 1UOOA 4N14A 5H17A 3FCUA 3V9FA 4XEIC 5IGOA 4LGNA 3OKYA 5I5IA 3IULA 3SVWD 4PSXB 5E6UA 5CYKA 3OKWA 4JT5C 3PE7A 3AL9A 1A0RB 3VA6A 3F3FA 4ZOZA 5AFU3 5C9ZB 1YFQA 2IWKA 4Y7RA 4BP8A 3ORVD 3O4HA 4A2LA 3MZLA 4J82A 3DM0A 3MKQA 4I79A 4GGCA 3JRPA 3C9CA 2IUVA 4A0AA 2CNXA 4L3HD 2P9LC 2OIZA 4AMYA 1SHYB 4A2MA 3VI3A 5EARA 2P9UC 2GC7A 5CYKB 4IMMA 4ES0A 1GOFA 2AH0A 4FA5D 1JJUB 4AOWA 2OVRB 4FB1D 5EMJB 3O4JA 1TYQC 3I7NA 4J78A 5IGQA 1UTCA 3GD1I 4A0AB 4BP9A 2AGWA 4CC9A 4J84A 3DWLC 4ZOYA 3JZNA 3UVLA 1I2MB 4WK0A 5IT9g 4A08B 2YNOA 4BCDA 1S4UX 2CE8A 2VDQA 4X61B 3O4IA 4CZVA 2UZYB 3NIDA 4ERZA 4RE6A 3K26A 3OKYB 1H2YA 4JHPC 5IJ8E 2CN2A 1XIPA 2I3SA 1MG3A 1E5TA 1GP2B 3U4YA 3NVQA 1QFSA 3AFCA 5K1CC 3EI3A 2VDPA 4A0BB 2GC4A 1C9IA 2AH1A 4Z8LA 4LG9A 4O3UB 3ZDYA 5TEEA 4IA9A 2IWFA 2YMUA 3IUQA 4UM8A 3UVMA 2EIDA 3EQ8A 3K72A 2Z2PA 3HFQA 1N6EA 4L3GD 4AN0A 3EI1B 4L9OA 4Z7QA 4E54B 3EI2B 3IIYA 4FAND 3RRMC 4G1MA 1U2VC 4JD2C 4GQ1A 2YNPA 4GM3A 1GOGA 4H5JA 2YBAA 2H6QA 5M5RA 3PVWB 3EWEA 3KRWB 5TF2A 3SMRA 3OL2B 2YB8B 4E5ZA 1VYHC 3QI0A 4KFMB 4O2WA 1PEVA 1MG2A 5CXBA 1JMZB 3PSLA 2W18A 2QXVA 2EIEA 3K27A 4WK2A 1H2WA 1VZ2A 5HE2B 3NVXA 4BUJC 4PNKB 3I7HA 2CO0C 2HU7A 4FAVD 2QZPA 2B5MA 3SCYA 4E5ZB 4GQ2P 2VZ1A 1K3IA 1TYEA 1FWXA 1MDAH 4G55A 3VH0A 4X63B 5FA5B 2B5NA 4J8GA 3ZDXA
chains in the Genus database with same CATH topology
5C2WB 3FM0A 2P9NC 5KDOB 2UZXB 2H3XA 3NVNA 2H13A 2BCJB 5EAMA 4A11B 4BL0A 2H68A 3AH8B 3I7KA 1SQ9A 3RFGA 3IKOA 3DXMC 3JB9L 5IJ7E 3J80g 4FHLA 3CIKB 3RFHA 1OLZA 1GG2B 4A0BA 4JSNC 3AL8B 1RI6A 5EMLB 2XL3A 2H9PA 4CI3A 4OWRA 3SBPA 2IUPA 2HYEA 5JWZA 2P9KC 3N0DA 4ZOXA 4R7AB 1OMWB 4OZUA 3KRXB 3SWSD 2Z2OA 3PXWD 4O9DA 3I7PA 2PM6B 1JMXB 4A08A 4O1QD 4J87A 4NSXA 2I0RA 1L0QA 2G9AA 4J77A 4JT6C 3UKRC 5C2VB 3DXKC 1SQJA 2CN3A 3OW8A 4X60B 3I8CA 2AGLA 4GM9A 5FXYA 3RLMD 4U1EI 3C99A 2BBKH 3UVNA 1N6DA 3I7OA 2XYIA 4CY5A 3GREA 2H6KA 2HXCA 3J81g 3W15A 3JZGA 3EI4B 3UR4A 4PSWB 4G56B 3I8EA 2O9KA 4HDJA 4A09B 2CE9A 2IURA 4J86A 1K32A 2YNNA 4A11A 4UI9R 3MKSB 1QNIA 1JOFA 4CZXA 5AMSA 4CI8A 4XYHA 5CXBB 3V5WB 2PM9B 3JROA 3JAMg 4GMBA 2J55H 5B4WA 2AGZA 3IJ0A 4PXWA 5GSAA 4CI2A 3JZHA 4A7JA 4ZOVA 4J79A 4FA9D 4MK0B 4GZ8A 4J0XA 2I3TA 3OTTA 4J8BA 5FKSA 3UVOA 3L4OD 4AEZA 4GQBB 2GNQA 2CO0A 5GXIA 3V7DB 4A09A 2AQ5A 5EMMB 3DSMA 2G99A 3RMZD 4BH6A 2P9SC 1R5MA 5CXCA 1Q47A 2PM9A 5TDHB 5EALA 4QT8A 3SLED 3RN0D 5FQDA 2XU7A 4QL1A 3ULEC 2I0TA 4CY1A 3EMHA 3OKTA 4LG8A 4CY2A 2Z2NA 4Y5RD 4JSXC 1NEXB 2B4EA 2OVQB 5EM2B 1B9YA 2OK4A 4CI1A 5GMKn 2PBIB 3FGBA 3RSEC 3VGZA 3C75H 4QQEA 4FA4D 5FKTA 2P9IC 2MTAH 2AGYA 3SN6B 4EWRA 4FWWA 4U7AA 1N6FA 2I0SA 4CZYA 5A2Qg 1TBGA 3F3PA 3AL8A 2HKMA 2OVPB 3JPXA 3GFCA 4CY3A 5HE0B 4K3JB 3EG6A 3L4MD 3RN1D 5H14A 4GM8A 3MMYA 5EMKB 5K19A 2OJYA 3IIWA 2H47A 4ZN4A 4JSVC 2EBSA 3CFSB 3IJCA 1B9XA 4J0WA 1ERJA 2HJ4A 4ESGA 2IUQA 3FRXA 3UKUC 1K8KC 5GXHA 3SBQA 3I7LA 1PGUA 4XYIA 5IC7A 5FKRA 3MZKA 4JSPC 1P22A 3PXSD 3I89A 4FA1D 3I2NA 4O3TB 3P4FA 3ZWLB 3PSCB 2H9NA 3F3GA 5HE1B 5FLXg 5HYNB 5EM2A 5THAA 1PBYB 4GGAA 3ODTA 3B7FA 1GOTB 3SJLD 2P9PC 5EAPA 2H9MA 3A0FA 5I5JA 5I5MA 2J57G 3SHFA 5CXCB 2HJBA 5FKQA 4H5IA 4D6VA 3E0CA 2XL2A 4O45A 4D0KA 3EI2A 5H1MA 4J81A 3EI1A 4ERYA 2IAAA 3SXTD 1XKSA 2OK6A 2J56H 3IJ1A 2TRCB 3CFVA 3EU7A 1XHMA 3UVKA 5HE3B 2HKRA 3OL2A 4GGDA 2PM7B 3SFZA 1U4CA 5AJAA 3MXXA 4JXMA 3BG0A 1NR0A 2H14A 4K3ID 4YVDA 2AGXA 1PI6A 4TZ4A 2HESX 5SXMA 4L1QD 3BWSA 3N0EA 4E54A 2H9LA 4PBZA 4X3EA 4J73A 2H6NA 5HQGA 3PXTD 3BG1A 4PBYA 4QRJA 2Q7QA 1GXRA 3PVUB 4PC0A 3EI3B 5TEFA 3SBRA 3EI4A 2B5LA 4ERQA 2QC5A 3C5MA 4N14A 5H17A 3V9FA 4XEIC 5IGOA 4LGNA 3OKYA 5I5IA 3SVWD 4PSXB 5CYKA 3OKWA 4JT5C 3PE7A 3AL9A 1A0RB 3VA6A 3F3FA 4ZOZA 5AFU3 5C9ZB 1YFQA 2IWKA 4Y7RA 3ORVD 4A2LA 3MZLA 4J82A 3DM0A 3MKQA 4I79A 4GGCA 3JRPA 3C9CA 2IUVA 4A0AA 2CNXA 4L3HD 2P9LC 2OIZA 1SHYB 4A2MA 5EARA 2P9UC 5CYKB 2GC7A 4IMMA 4ES0A 2AH0A 4FA5D 1JJUB 4AOWA 2OVRB 4FB1D 5EMJB 1TYQC 3I7NA 4J78A 5IGQA 4A0AB 2AGWA 4CC9A 4J84A 3DWLC 4ZOYA 3JZNA 3UVLA 5IT9g 4A08B 2YNOA 1S4UX 2CE8A 4X61B 4CZVA 2UZYB 4ERZA 3K26A 3OKYB 5IJ8E 2CN2A 1XIPA 2I3SA 1MG3A 1GP2B 3U4YA 3NVQA 3AFCA 5K1CC 3EI3A 4A0BB 2GC4A 2AH1A 4Z8LA 4LG9A 4O3UB 5TEEA 4IA9A 2IWFA 2YMUA 3UVMA 2Z2PA 3HFQA 1N6EA 4L3GD 3EI1B 4L9OA 4E54B 3EI2B 3IIYA 4FAND 3RRMC 1U2VC 4JD2C 4GQ1A 2YNPA 4GM3A 4H5JA 2YBAA 2H6QA 3PVWB 3EWEA 3KRWB 5TF2A 3SMRA 3OL2B 2YB8B 4E5ZA 1VYHC 4KFMB 1PEVA 1MG2A 5CXBA 1JMZB 3PSLA 2W18A 2QXVA 3K27A 5HE2B 3NVXA 4BUJC 4PNKB 3I7HA 2CO0C 4FAVD 2B5MA 3SCYA 4E5ZB 4GQ2P 1FWXA 1MDAH 3VH0A 4X63B 5FA5B 2B5NA 4J8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2W B;  3FM0 A;  2P9N C;  5KDO B;  2UZX B;  2H3X A;  3NVN A;  2H13 A;  2BCJ B;  5EAM A;  4A11 B;  4BL0 A;  2H68 A;  3AH8 B;  3I7K A;  1SQ9 A;  3RFG A;  3IKO A;  3DXM C;  3JB9 L;  5IJ7 E;  3J80 g;  4FHL A;  3CIK B;  3RFH A;  1OLZ A;  1GG2 B;  4A0B A;  4JSN C;  3AL8 B;  1RI6 A;  5EML B;  2XL3 A;  2H9P A;  4CI3 A;  4OWR A;  3SBP A;  2IUP A;  2HYE A;  5JWZ A;  2P9K C;  3N0D A;  4ZOX A;  4R7A B;  1OMW B;  4OZU A;  3KRX B;  3SWS D;  2Z2O A;  3PXW D;  4O9D A;  3I7P A;  2PM6 B;  1JMX B;  4A08 A;  4O1Q D;  4J87 A;  4NSX A;  2I0R A;  1L0Q A;  2G9A A;  4J77 A;  4JT6 C;  3UKR C;  5C2V B;  3DXK C;  1SQJ A;  2CN3 A;  3OW8 A;  4X60 B;  3I8C A;  2AGL A;  4GM9 A;  5FXY A;  3RLM D;  4U1E I;  3C99 A;  2BBK H;  3UVN A;  1N6D A;  3I7O A;  2XYI A;  4CY5 A;  3GRE A;  2H6K A;  2HXC A;  3J81 g;  3W15 A;  3JZG A;  3EI4 B;  3UR4 A;  4PSW B;  4G56 B;  3I8E A;  2O9K A;  4HDJ A;  4A09 B;  2CE9 A;  2IUR A;  4J86 A;  1K32 A;  2YNN A;  4A11 A;  4UI9 R;  3MKS B;  1QNI A;  1JOF A;  4CZX A;  5AMS A;  4CI8 A;  4XYH A;  5CXB B;  3V5W B;  2PM9 B;  3JRO A;  3JAM g;  4GMB A;  2J55 H;  5B4W A;  2AGZ A;  3IJ0 A;  4PXW A;  5GSA A;  4CI2 A;  3JZH A;  4A7J A;  4ZOV A;  4J79 A;  4FA9 D;  4MK0 B;  4GZ8 A;  4J0X A;  2I3T A;  3OTT A;  4J8B A;  5FKS A;  3UVO A;  3L4O D;  4AEZ A;  4GQB B;  2GNQ A;  2CO0 A;  5GXI A;  3V7D B;  4A09 A;  2AQ5 A;  5EMM B;  3DSM A;  2G99 A;  3RMZ D;  4BH6 A;  2P9S C;  1R5M A;  5CXC A;  1Q47 A;  2PM9 A;  5TDH B;  5EAL A;  4QT8 A;  3SLE D;  3RN0 D;  5FQD A;  2XU7 A;  4QL1 A;  3ULE C;  2I0T A;  4CY1 A;  3EMH A;  3OKT A;  4LG8 A;  4CY2 A;  2Z2N A;  4Y5R D;  4JSX C;  1NEX B;  2B4E A;  2OVQ B;  5EM2 B;  1B9Y A;  2OK4 A;  4CI1 A;  5GMK n;  2PBI B;  3FGB A;  3RSE C;  3VGZ A;  3C75 H;  4QQE A;  4FA4 D;  5FKT A;  2P9I C;  2MTA H;  2AGY A;  3SN6 B;  4EWR A;  4FWW A;  4U7A A;  1N6F A;  2I0S A;  4CZY A;  5A2Q g;  1TBG A;  3F3P A;  3AL8 A;  2HKM A;  2OVP B;  3JPX A;  3GFC A;  4CY3 A;  5HE0 B;  4K3J B;  3EG6 A;  3L4M D;  3RN1 D;  5H14 A;  4GM8 A;  3MMY A;  5EMK B;  5K19 A;  2OJY A;  3IIW A;  2H47 A;  4ZN4 A;  4JSV C;  2EBS A;  3CFS B;  3IJC A;  1B9X A;  4J0W A;  1ERJ A;  2HJ4 A;  4ESG A;  2IUQ A;  3FRX A;  3UKU C;  1K8K C;  5GXH A;  3SBQ A;  3I7L A;  1PGU A;  4XYI A;  5IC7 A;  5FKR A;  3MZK A;  4JSP C;  1P22 A;  3PXS D;  3I89 A;  4FA1 D;  3I2N A;  4O3T B;  3P4F A;  3ZWL B;  3PSC B;  2H9N A;  3F3G A;  5HE1 B;  5FLX g;  5HYN B;  5EM2 A;  5THA A;  1PBY B;  4GGA A;  3ODT A;  3B7F A;  1GOT B;  3SJL D;  2P9P C;  5EAP A;  2H9M A;  3A0F A;  5I5J A;  5I5M A;  2J57 G;  3SHF A;  5CXC B;  2HJB A;  5FKQ A;  4H5I A;  4D6V A;  3E0C A;  2XL2 A;  4O45 A;  4D0K A;  3EI2 A;  5H1M A;  4J81 A;  3EI1 A;  4ERY A;  2IAA A;  3SXT D;  1XKS A;  2OK6 A;  2J56 H;  3IJ1 A;  2TRC B;  3CFV A;  3EU7 A;  1XHM A;  3UVK A;  5HE3 B;  2HKR A;  3OL2 A;  4GGD A;  2PM7 B;  3SFZ A;  1U4C A;  5AJA A;  3MXX A;  4JXM A;  3BG0 A;  1NR0 A;  2H14 A;  4K3I D;  4YVD A;  2AGX A;  1PI6 A;  4TZ4 A;  2HES X;  5SXM A;  4L1Q D;  3BWS A;  3N0E A;  4E54 A;  2H9L A;  4PBZ A;  4X3E A;  4J73 A;  2H6N A;  5HQG A;  3PXT D;  3BG1 A;  4PBY A;  4QRJ A;  2Q7Q A;  1GXR A;  3PVU B;  4PC0 A;  3EI3 B;  5TEF A;  3SBR A;  3EI4 A;  2B5L A;  4ERQ A;  2QC5 A;  3C5M A;  4N14 A;  5H17 A;  3V9F A;  4XEI C;  5IGO A;  4LGN A;  3OKY A;  5I5I A;  3SVW D;  4PSX B;  5CYK A;  3OKW A;  4JT5 C;  3PE7 A;  3AL9 A;  1A0R B;  3VA6 A;  3F3F A;  4ZOZ A;  5AFU 3;  5C9Z B;  1YFQ A;  2IWK A;  4Y7R A;  3ORV D;  4A2L A;  3MZL A;  4J82 A;  3DM0 A;  3MKQ A;  4I79 A;  4GGC A;  3JRP A;  3C9C A;  2IUV A;  4A0A A;  2CNX A;  4L3H D;  2P9L C;  2OIZ A;  1SHY B;  4A2M A;  5EAR A;  2P9U C;  5CYK B;  2GC7 A;  4IMM A;  4ES0 A;  2AH0 A;  4FA5 D;  1JJU B;  4AOW A;  2OVR B;  4FB1 D;  5EMJ B;  1TYQ C;  3I7N A;  4J78 A;  5IGQ A;  4A0A B;  2AGW A;  4CC9 A;  4J84 A;  3DWL C;  4ZOY A;  3JZN A;  3UVL A;  5IT9 g;  4A08 B;  2YNO A;  1S4U X;  2CE8 A;  4X61 B;  4CZV A;  2UZY B;  4ERZ A;  3K26 A;  3OKY B;  5IJ8 E;  2CN2 A;  1XIP A;  2I3S A;  1MG3 A;  1GP2 B;  3U4Y A;  3NVQ A;  3AFC A;  5K1C C;  3EI3 A;  4A0B B;  2GC4 A;  2AH1 A;  4Z8L A;  4LG9 A;  4O3U B;  5TEE A;  4IA9 A;  2IWF A;  2YMU A;  3UVM A;  2Z2P A;  3HFQ A;  1N6E A;  4L3G D;  3EI1 B;  4L9O A;  4E54 B;  3EI2 B;  3IIY A;  4FAN D;  3RRM C;  1U2V C;  4JD2 C;  4GQ1 A;  2YNP A;  4GM3 A;  4H5J A;  2YBA A;  2H6Q A;  3PVW B;  3EWE A;  3KRW B;  5TF2 A;  3SMR A;  3OL2 B;  2YB8 B;  4E5Z A;  1VYH C;  4KFM B;  1PEV A;  1MG2 A;  5CXB A;  1JMZ B;  3PSL A;  2W18 A;  2QXV A;  3K27 A;  5HE2 B;  3NVX A;  4BUJ C;  4PNK B;  3I7H A;  2CO0 C;  4FAV D;  2B5M A;  3SCY A;  4E5Z B;  4GQ2 P;  1FWX A;  1MDA H;  3VH0 A;  4X63 B;  5FA5 B;  2B5N A;  4J8G A; 
#chains in the Genus database with same CATH topology
 5C2W B;  3FM0 A;  2P9N C;  5KDO B;  2UZX B;  3GC3 B;  2H3X A;  3NVN A;  3VI4 A;  2H13 A;  2BCJ B;  2EIC A;  5M5T A;  5EAM A;  4A11 B;  4AMZ A;  4BL0 A;  2H68 A;  3AH8 B;  3I7K A;  1SQ9 A;  3RFG A;  3IKO A;  3DXM C;  3JB9 L;  5IJ7 E;  1E8N A;  2HU5 A;  3J80 g;  4FHL A;  3CIK B;  3RFH A;  1OLZ A;  1GG2 B;  4A0B A;  4JSN C;  1YR2 A;  2WQ8 A;  1RI6 A;  3AL8 B;  5EML B;  2XL3 A;  4MMZ A;  2H9P A;  4CI3 A;  4OWR A;  3SBP A;  3ZE2 A;  2IUP A;  2XZG A;  2HYE A;  5JWZ A;  1JTD B;  2P9K C;  3N0D A;  3IUN A;  4ZOX A;  5C92 A;  4R7A B;  1OMW B;  4OZU A;  3QHY B;  1O6F A;  3KRX B;  3SWS D;  3PXW D;  1VE6 A;  2Z2O A;  4O9D A;  3I7P A;  5FFO A;  2PM6 B;  1JMX B;  4A08 A;  4O1Q D;  4J87 A;  4NSX A;  2I0R A;  1L0Q A;  2G9A A;  4J77 A;  1T2X A;  4JT6 C;  3UKR C;  5C2V B;  3DXK C;  1SQJ A;  2CN3 A;  3OW8 A;  3MUO A;  4X60 B;  3I8C A;  2AGL A;  4GM9 A;  1H2Z A;  5FXY A;  3RLM D;  4NAA A;  4U1E I;  3C99 A;  1O6G A;  2BBK H;  1N6D A;  3UVN A;  3I7O A;  2XYI A;  4CY5 A;  3GRE A;  2H6K A;  1QFM A;  2HXC A;  4D9S A;  3J81 g;  3W15 A;  2JKX A;  2HU8 A;  3FCS A;  3EI4 B;  3JZG A;  3UR4 A;  4PSW B;  4DNW A;  4G56 B;  3K71 A;  3I8E A;  2O9K A;  4HDJ A;  3IVM A;  3MUN A;  4A09 B;  2CE9 A;  2IUR A;  4J86 A;  1K32 A;  2YNN A;  4A11 A;  4AN1 A;  4UI9 R;  3MKS B;  1QNI A;  1JOF A;  1M1X A;  3IUM A;  4CZX A;  5AMS A;  4CI8 A;  4XYH A;  1JV2 A;  5CXB B;  3V5W B;  2PM9 B;  5FFG A;  3JRO A;  3JAM g;  4GMB A;  3NIF A;  3DDU A;  2J55 H;  5B4W A;  2AGZ A;  3IJ0 A;  4NC4 A;  4PXW A;  5GSA A;  4CI2 A;  3JZH A;  3IJE A;  4A7J A;  4ZOV A;  4J79 A;  4FA9 D;  4MK0 B;  4GZ8 A;  4J0X A;  2I3T A;  3OTT A;  4J8B A;  5FKS A;  1H2X A;  3UVO A;  3L4O D;  4AEZ A;  4GQB B;  5C86 A;  2GNQ A;  2CO0 A;  5GXI A;  3OF7 A;  3V7D B;  4A09 A;  5M5V A;  3EQ9 A;  2AQ5 A;  3V4V A;  5EMM B;  3DSM A;  1GOH A;  2G99 A;  3NIG A;  3RMZ D;  4BH6 A;  2P9S C;  1R5M A;  5CXC A;  2VDK A;  4Z7N A;  1Q47 A;  2PM9 A;  2XE4 A;  5TDH B;  5EAL A;  4QT8 A;  4MMX A;  3SLE D;  1U8C A;  3RN0 D;  5FQD A;  2XU7 A;  4QL1 A;  3ULE C;  2I0T A;  3T3P A;  4CY1 A;  3EMH A;  3OKT A;  4LG8 A;  4CY2 A;  2Z2N A;  4Y5R D;  4G1E A;  4JSX C;  1NEX B;  3ZE1 A;  2B4E A;  4MMY A;  2OVQ B;  5EM2 B;  1B9Y A;  2OK4 A;  4CI1 A;  5GMK n;  2PBI B;  3FGB A;  3RSE C;  3VGZ A;  3C75 H;  4QQE A;  4DNU A;  4FA4 D;  5FKT A;  2P9I C;  2EIB A;  2MTA H;  2AGY A;  3SN6 B;  4EWR A;  4FWW A;  4U7A A;  1N6F A;  2I0S A;  1C9L A;  5E6R A;  4CZY A;  5A2Q g;  1TBG A;  3F3P A;  3AL8 A;  2HKM A;  2OVP B;  5M5U A;  3ZE0 A;  3JPX A;  3GFC A;  4BCC A;  4RE5 A;  4CY3 A;  1A12 A;  2VDO A;  5HE0 B;  4K3J B;  3EG6 A;  4O02 A;  3L4M D;  3RN1 D;  5H14 A;  4GM8 A;  3MMY A;  4NEN A;  5EMK B;  5K19 A;  2OJY A;  3IIW A;  2H47 A;  4ZN4 A;  4JSV C;  2EBS A;  3CFS B;  3IJC A;  1B9X A;  4J0W A;  1ERJ A;  2BKL A;  2HJ4 A;  4ESG A;  2IUQ A;  3FRX A;  4QAM A;  2QR5 A;  4Z7O A;  3UKU C;  1K8K C;  2VC2 A;  5GXH A;  3SBQ A;  3I7L A;  3IUR A;  1PGU A;  4XYI A;  5IC7 A;  5FKR A;  3MZK A;  5M5S A;  5E6S A;  4JSP C;  1P22 A;  3PXS D;  3I89 A;  4FA1 D;  3I2N A;  4O3T B;  2VDN A;  1VE7 A;  3P4F A;  3ZWL B;  3PSC B;  2H9N A;  3F3G A;  5HE1 B;  2VZ3 A;  5FLX g;  5HYN B;  3MVD K;  5EM2 A;  4WJK A;  5THA A;  1PBY B;  3ODT A;  3B7F A;  4GGA A;  1GOT B;  3O4G A;  3SJL D;  2P9P C;  5EAP A;  2H9M A;  3A0F A;  1BPO A;  5I5J A;  2VDM A;  5I5M A;  2J57 G;  3SHF A;  5CXC B;  2HJB A;  5FKQ A;  4H5I A;  4D6V A;  1UOQ A;  3E0C A;  2XL2 A;  4O45 A;  1L5G A;  3EQ7 A;  4NBM A;  5H1M A;  4D0K A;  4J81 A;  3EI2 A;  4AX4 A;  3EI1 A;  3T3M A;  4ERY A;  2IAA A;  3SXT D;  3IUJ A;  1XKS A;  3ZDZ A;  2OK6 A;  4BCB A;  4UM9 A;  2J56 H;  3IJ1 A;  2TRC B;  4DNV A;  3CFV A;  3EU7 A;  1XHM A;  3UVK A;  5HE3 B;  4WK4 A;  1UOP A;  2HKR A;  2VDL A;  3OL2 A;  4GGD A;  2PM7 B;  3SFZ A;  1U4C A;  1E8M A;  5AJA A;  1VZ3 A;  3MXX A;  4JXM A;  3BG0 A;  3KCI A;  4L1M A;  4JHN A;  1NR0 A;  2H14 A;  4K3I D;  4YVD A;  2AGX A;  1PI6 A;  4TZ4 A;  3K6S A;  2HES X;  5SXM A;  4L1Q D;  3BWS A;  3N0E A;  4E54 A;  2H9L A;  2VDR A;  4PBZ A;  4X3E A;  4J73 A;  2H6N A;  5HQG A;  5M61 A;  3V4P A;  3PXT D;  3BG1 A;  4PBY A;  2XDW A;  4QRJ A;  2Q7Q A;  1GXR A;  3PVU B;  4PC0 A;  5HDB A;  3EI3 B;  5TEF A;  3SBR A;  3EI4 A;  2B5L A;  4IRZ A;  4ERQ A;  2QC5 A;  3C5M A;  1UOO A;  4N14 A;  5H17 A;  3FCU A;  3V9F A;  4XEI C;  5IGO A;  4LGN A;  3OKY A;  5I5I A;  3IUL A;  3SVW D;  4PSX B;  5E6U A;  5CYK A;  3OKW A;  4JT5 C;  3PE7 A;  3AL9 A;  1A0R B;  3VA6 A;  3F3F A;  4ZOZ A;  5AFU 3;  5C9Z B;  1YFQ A;  2IWK A;  4Y7R A;  4BP8 A;  3ORV D;  3O4H A;  4A2L A;  3MZL A;  4J82 A;  3DM0 A;  3MKQ A;  4I79 A;  4GGC A;  3JRP A;  3C9C A;  2IUV A;  4A0A A;  2CNX A;  4L3H D;  2P9L C;  2OIZ A;  4AMY A;  1SHY B;  4A2M A;  3VI3 A;  5EAR A;  2P9U C;  2GC7 A;  5CYK B;  4IMM A;  4ES0 A;  1GOF A;  2AH0 A;  4FA5 D;  1JJU B;  4AOW A;  2OVR B;  4FB1 D;  5EMJ B;  3O4J A;  1TYQ C;  3I7N A;  4J78 A;  5IGQ A;  1UTC A;  3GD1 I;  4A0A B;  4BP9 A;  2AGW A;  4CC9 A;  4J84 A;  3DWL C;  4ZOY A;  3JZN A;  3UVL A;  1I2M B;  4WK0 A;  5IT9 g;  4A08 B;  2YNO A;  4BCD A;  1S4U X;  2CE8 A;  2VDQ A;  4X61 B;  3O4I A;  4CZV A;  2UZY B;  3NID A;  4ERZ A;  4RE6 A;  3K26 A;  3OKY B;  1H2Y A;  4JHP C;  5IJ8 E;  2CN2 A;  1XIP A;  2I3S A;  1MG3 A;  1E5T A;  1GP2 B;  3U4Y A;  3NVQ A;  1QFS A;  3AFC A;  5K1C C;  3EI3 A;  2VDP A;  4A0B B;  2GC4 A;  1C9I A;  2AH1 A;  4Z8L A;  4LG9 A;  4O3U B;  3ZDY A;  5TEE A;  4IA9 A;  2IWF A;  2YMU A;  3IUQ A;  4UM8 A;  3UVM A;  2EID A;  3EQ8 A;  3K72 A;  2Z2P A;  3HFQ A;  1N6E A;  4L3G D;  4AN0 A;  3EI1 B;  4L9O A;  4Z7Q A;  4E54 B;  3EI2 B;  3IIY A;  4FAN D;  3RRM C;  4G1M A;  1U2V C;  4JD2 C;  4GQ1 A;  2YNP A;  4GM3 A;  1GOG A;  4H5J A;  2YBA A;  2H6Q A;  5M5R A;  3PVW B;  3EWE A;  3KRW B;  5TF2 A;  3SMR A;  3OL2 B;  2YB8 B;  4E5Z A;  1VYH C;  3QI0 A;  4KFM B;  4O2W A;  1PEV A;  1MG2 A;  5CXB A;  1JMZ B;  3PSL A;  2W18 A;  2QXV A;  2EIE A;  3K27 A;  4WK2 A;  1H2W A;  1VZ2 A;  5HE2 B;  3NVX A;  4BUJ C;  4PNK B;  3I7H A;  2CO0 C;  2HU7 A;  4FAV D;  2QZP A;  2B5M A;  3SCY A;  4E5Z B;  4GQ2 P;  2VZ1 A;  1K3I A;  1TYE A;  1FWX A;  1MDA H;  4G55 A;  3VH0 A;  4X63 B;  5FA5 B;  2B5N A;  4J8G A;  3ZDX A; 
#chains in the Genus database with same CATH homology
 5C2W B;  3FM0 A;  2P9N C;  5KDO B;  2UZX B;  2H3X A;  3NVN A;  2H13 A;  2BCJ B;  5EAM A;  4A11 B;  4BL0 A;  2H68 A;  3AH8 B;  3I7K A;  1SQ9 A;  3RFG A;  3IKO A;  3DXM C;  3JB9 L;  5IJ7 E;  3J80 g;  4FHL A;  3CIK B;  3RFH A;  1OLZ A;  1GG2 B;  4A0B A;  4JSN C;  3AL8 B;  1RI6 A;  5EML B;  2XL3 A;  2H9P A;  4CI3 A;  4OWR A;  3SBP A;  2IUP A;  2HYE A;  5JWZ A;  2P9K C;  3N0D A;  4ZOX A;  4R7A B;  1OMW B;  4OZU A;  3KRX B;  3SWS D;  2Z2O A;  3PXW D;  4O9D A;  3I7P A;  2PM6 B;  1JMX B;  4A08 A;  4O1Q D;  4J87 A;  4NSX A;  2I0R A;  1L0Q A;  2G9A A;  4J77 A;  4JT6 C;  3UKR C;  5C2V B;  3DXK C;  1SQJ A;  2CN3 A;  3OW8 A;  4X60 B;  3I8C A;  2AGL A;  4GM9 A;  5FXY A;  3RLM D;  4U1E I;  3C99 A;  2BBK H;  3UVN A;  1N6D A;  3I7O A;  2XYI A;  4CY5 A;  3GRE A;  2H6K A;  2HXC A;  3J81 g;  3W15 A;  3JZG A;  3EI4 B;  3UR4 A;  4PSW B;  4G56 B;  3I8E A;  2O9K A;  4HDJ A;  4A09 B;  2CE9 A;  2IUR A;  4J86 A;  1K32 A;  2YNN A;  4A11 A;  4UI9 R;  3MKS B;  1QNI A;  1JOF A;  4CZX A;  5AMS A;  4CI8 A;  4XYH A;  5CXB B;  3V5W B;  2PM9 B;  3JRO A;  3JAM g;  4GMB A;  2J55 H;  5B4W A;  2AGZ A;  3IJ0 A;  4PXW A;  5GSA A;  4CI2 A;  3JZH A;  4A7J A;  4ZOV A;  4J79 A;  4FA9 D;  4MK0 B;  4GZ8 A;  4J0X A;  2I3T A;  3OTT A;  4J8B A;  5FKS A;  3UVO A;  3L4O D;  4AEZ A;  4GQB B;  2GNQ A;  2CO0 A;  5GXI A;  3V7D B;  4A09 A;  2AQ5 A;  5EMM B;  3DSM A;  2G99 A;  3RMZ D;  4BH6 A;  2P9S C;  1R5M A;  5CXC A;  1Q47 A;  2PM9 A;  5TDH B;  5EAL A;  4QT8 A;  3SLE D;  3RN0 D;  5FQD A;  2XU7 A;  4QL1 A;  3ULE C;  2I0T A;  4CY1 A;  3EMH A;  3OKT A;  4LG8 A;  4CY2 A;  2Z2N A;  4Y5R D;  4JSX C;  1NEX B;  2B4E A;  2OVQ B;  5EM2 B;  1B9Y A;  2OK4 A;  4CI1 A;  5GMK n;  2PBI B;  3FGB A;  3RSE C;  3VGZ A;  3C75 H;  4QQE A;  4FA4 D;  5FKT A;  2P9I C;  2MTA H;  2AGY A;  3SN6 B;  4EWR A;  4FWW A;  4U7A A;  1N6F A;  2I0S A;  4CZY A;  5A2Q g;  1TBG A;  3F3P A;  3AL8 A;  2HKM A;  2OVP B;  3JPX A;  3GFC A;  4CY3 A;  5HE0 B;  4K3J B;  3EG6 A;  3L4M D;  3RN1 D;  5H14 A;  4GM8 A;  3MMY A;  5EMK B;  5K19 A;  2OJY A;  3IIW A;  2H47 A;  4ZN4 A;  4JSV C;  2EBS A;  3CFS B;  3IJC A;  1B9X A;  4J0W A;  1ERJ A;  2HJ4 A;  4ESG A;  2IUQ A;  3FRX A;  3UKU C;  1K8K C;  5GXH A;  3SBQ A;  3I7L A;  1PGU A;  4XYI A;  5IC7 A;  5FKR A;  3MZK A;  4JSP C;  1P22 A;  3PXS D;  3I89 A;  4FA1 D;  3I2N A;  4O3T B;  3P4F A;  3ZWL B;  3PSC B;  2H9N A;  3F3G A;  5HE1 B;  5FLX g;  5HYN B;  5EM2 A;  5THA A;  1PBY B;  4GGA A;  3ODT A;  3B7F A;  1GOT B;  3SJL D;  2P9P C;  5EAP A;  2H9M A;  3A0F A;  5I5J A;  5I5M A;  2J57 G;  3SHF A;  5CXC B;  2HJB A;  5FKQ A;  4H5I A;  4D6V A;  3E0C A;  2XL2 A;  4O45 A;  4D0K A;  3EI2 A;  5H1M A;  4J81 A;  3EI1 A;  4ERY A;  2IAA A;  3SXT D;  1XKS A;  2OK6 A;  2J56 H;  3IJ1 A;  2TRC B;  3CFV A;  3EU7 A;  1XHM A;  3UVK A;  5HE3 B;  2HKR A;  3OL2 A;  4GGD A;  2PM7 B;  3SFZ A;  1U4C A;  5AJA A;  3MXX A;  4JXM A;  3BG0 A;  1NR0 A;  2H14 A;  4K3I D;  4YVD A;  2AGX A;  1PI6 A;  4TZ4 A;  2HES X;  5SXM A;  4L1Q D;  3BWS A;  3N0E A;  4E54 A;  2H9L A;  4PBZ A;  4X3E A;  4J73 A;  2H6N A;  5HQG A;  3PXT D;  3BG1 A;  4PBY A;  4QRJ A;  2Q7Q A;  1GXR A;  3PVU B;  4PC0 A;  3EI3 B;  5TEF A;  3SBR A;  3EI4 A;  2B5L A;  4ERQ A;  2QC5 A;  3C5M A;  4N14 A;  5H17 A;  3V9F A;  4XEI C;  5IGO A;  4LGN A;  3OKY A;  5I5I A;  3SVW D;  4PSX B;  5CYK A;  3OKW A;  4JT5 C;  3PE7 A;  3AL9 A;  1A0R B;  3VA6 A;  3F3F A;  4ZOZ A;  5AFU 3;  5C9Z B;  1YFQ A;  2IWK A;  4Y7R A;  3ORV D;  4A2L A;  3MZL A;  4J82 A;  3DM0 A;  3MKQ A;  4I79 A;  4GGC A;  3JRP A;  3C9C A;  2IUV A;  4A0A A;  2CNX A;  4L3H D;  2P9L C;  2OIZ A;  1SHY B;  4A2M A;  5EAR A;  2P9U C;  5CYK B;  2GC7 A;  4IMM A;  4ES0 A;  2AH0 A;  4FA5 D;  1JJU B;  4AOW A;  2OVR B;  4FB1 D;  5EMJ B;  1TYQ C;  3I7N A;  4J78 A;  5IGQ A;  4A0A B;  2AGW A;  4CC9 A;  4J84 A;  3DWL C;  4ZOY A;  3JZN A;  3UVL A;  5IT9 g;  4A08 B;  2YNO A;  1S4U X;  2CE8 A;  4X61 B;  4CZV A;  2UZY B;  4ERZ A;  3K26 A;  3OKY B;  5IJ8 E;  2CN2 A;  1XIP A;  2I3S A;  1MG3 A;  1GP2 B;  3U4Y A;  3NVQ A;  3AFC A;  5K1C C;  3EI3 A;  4A0B B;  2GC4 A;  2AH1 A;  4Z8L A;  4LG9 A;  4O3U B;  5TEE A;  4IA9 A;  2IWF A;  2YMU A;  3UVM A;  2Z2P A;  3HFQ A;  1N6E A;  4L3G D;  3EI1 B;  4L9O A;  4E54 B;  3EI2 B;  3IIY A;  4FAN D;  3RRM C;  1U2V C;  4JD2 C;  4GQ1 A;  2YNP A;  4GM3 A;  4H5J A;  2YBA A;  2H6Q A;  3PVW B;  3EWE A;  3KRW B;  5TF2 A;  3SMR A;  3OL2 B;  2YB8 B;  4E5Z A;  1VYH C;  4KFM B;  1PEV A;  1MG2 A;  5CXB A;  1JMZ B;  3PSL A;  2W18 A;  2QXV A;  3K27 A;  5HE2 B;  3NVX A;  4BUJ C;  4PNK B;  3I7H A;  2CO0 C;  4FAV D;  2B5M A;  3SCY A;  4E5Z B;  4GQ2 P;  1FWX A;  1MDA H;  3VH0 A;  4X63 B;  5FA5 B;  2B5N A;  4J8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...