4GM8A

Crystal structure of human wd repeat domain 5 with compound mm-102
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
304
structure length
302
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title High-affinity, small-molecule peptidomimetic inhibitors of MLL1/WDR5 protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 96
structure length 302
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm8A00
4JSNC 5CXCB 3SHFA 3CFSB 4CY2A 1XHMA 3SXTD 3U4YA 3EU7A 3SBQA 4A11B 1N6DA 4FHLA 3IIWA 3VH0A 4J0XA 1N6EA 4UI9R 3ULEC 4BUJC 4JSPC 2H68A 2BBKH 4ZOVA 4K3ID 4JT5C 3B7FA 4GM8A 2HXCA 2OVPB 5CXBB 3OKTA 4IA9A 5EALA 4YVDA 5I5MA 3PXSD 3C75H 3N0DA 5EMKB 5AMSA 4O9DA 4J82A 3SWSD 1JJUB 4CY3A 3EI3B 3OL2A 3DWLC 4A08B 1PBYB 4Y5RD 2YB8B 3L4OD 1VYHC 3SCYA 3A0FA 3GREA 4CI8A 4PC0A 2H6NA 3SBPA 3PXTD 3RLMD 3MXXA 4TZ4A 5EM2B 4KFMB 5GXIA 4CI2A 1MG2A 4D0KA 2OVQB 4QT8A 2CN2A 4A0AA 4GGCA 4O3TB 2AGXA 3I8EA 4A09B 4J81A 3EI2B 2OK6A 2AGYA 2J56H 2YBAA 4PBZA 1S4UX 3N0EA 4J86A 4GGDA 1NR0A 4ZOYA 2H9LA 4J77A 3PE7A 3RSEC 1GXRA 4GQ2P 5CXCA 2H47A 4X63B 2MTAH 5H17A 4GMBA 1GG2B 3NVNA 2YMUA 4X60B 4A11A 1NEXB 4X3EA 4ERZA 1XKSA 1FWXA 3C9CA 1GP2B 4FB1D 5C2WB 4ERQA 2AQ5A 4X61B 4J78A 4CI3A 3RN1D 5CXBA 4LG8A 2P9KC 2XYIA 3I2NA 3OTTA 4JXMA 5GXHA 4GGAA 5IGQA 3EI3A 1MG3A 2OIZA 2OVRB 4FA5D 4A08A 4O45A 2PM7B 4CI1A 4XYHA 4J73A 4K3JB 2P9PC 2HKRA 3DM0A 2OK4A 5I5IA 5EM2A 3SVWD 3RFGA 5A2Qg 4GM9A 4EWRA 1SQJA 5THAA 5EAPA 3ODTA 4JD2C 2B4EA 2P9IC 3RN0D 3UVNA 4BH6A 4A09A 4J0WA 5TEFA 3V5WB 3EI2A 4PNKB 3SJLD 3E0CA 4IMMA 2IWKA 2IAAA 5CYKB 3I7KA 4FWWA 4PSXB 4PBYA 4CZXA 4JSVC 4CY5A 3VA6A 2H14A 3SBRA 4O1QD 3OKYB 2CE9A 3C99A 4E5ZB 5FQDA 2AGZA 2H9PA 2CO0C 5FKTA 2HJ4A 3RMZD 2I3TA 3RRMC 1K8KC 1OMWB 3NVXA 4QQEA 4FAND 4J79A 2Q7QA 2XL2A 4ZOZA 2O9KA 2OJYA 5AFU3 5IJ7E 3UVLA 3VGZA 3I89A 4J84A 2GC4A 3L4MD 3JROA 3UR4A 2H6QA 3I7HA 2QC5A 3NVQA 5IT9g 3KRWB 4Y7RA 5H14A 4E54B 3SMRA 4CZYA 2J57G 5HE1B 2AH0A 5AJAA 3CIKB 3EWEA 3MKSB 2I0TA 3AH8B 5FA5B 2AH1A 4A2LA 3C5MA 3MMYA 3IKOA 3I8CA 4ES0A 5CYKA 1JOFA 4L9OA 3AL8B 1JMXB 1TBGA 5HE2B 2I3SA 4CY1A 4H5IA 3IJ0A 4J87A 4QL1A 4L1QD 4XEIC 4OWRA 2CNXA 4JSXC 3OKYA 3SFZA 5I5JA 3PVUB 4E5ZA 3DXMC 2HKMA 3F3PA 1GOTB 3F3FA 2UZYB 3IIYA 4JT6C 5FKQA 2IURA 3CFVA 5C2VB 3MZKA 4H5JA 1QNIA 3K27A 3ZWLB 4ZN4A 2W18A 4CZVA 5IC7A 3F3GA 4N14A 4A0BB 5K1CC 4FA4D 2TRCB 2XL3A 4GQ1A 4ERYA 3EI1B 2H9MA 4E54A 2P9NC 4L3GD 2H13A 5EAMA 2Z2OA 1TYQC 4ZOXA 4A7JA 4D6VA 2AGWA 3I7NA 3UVOA 3V9FA 4U1EI 5TEEA 1A0RB 3BG0A 1Q47A 3FGBA 3AL8A 4Z8LA 3J80g 3PSLA 1B9XA 3P4FA 4HDJA 4L3HD 4FAVD 3DXKC 2P9UC 4GZ8A 5FKSA 1PI6A 3JZGA 4I79A 2YNPA 5HE3B 2H9NA 1U4CA 3UKUC 2G99A 2QXVA 2I0RA 2PBIB 2IUPA 3OKWA 5IJ8E 1JMZB 5JWZA 2B5MA 1XIPA 3BWSA 5EARA 4LGNA 3JPXA 2EBSA 2HESX 4BL0A 2PM6B 3UKRC 3HFQA 5EMMB 2CE8A 2IUQA 5FKRA 3JB9L 3FRXA 2GNQA 2Z2PA 4A0BA 5FLXg 2UZXB 1L0QA 4U7AA 4A2MA 3AL9A 3EI1A 2PM9B 3IJCA 2B5NA 2AGLA 3V7DB 1N6FA 5K19A 3EMHA 4GM3A 1PGUA 3IJ1A 3EI4B 4G56B 4CC9A 2CN3A 3FM0A 4AEZA 4XYIA 4PXWA 1OLZA 2P9LC 1U2VC 2BCJB 5H1MA 3JZNA 1MDAH 3I7OA 5FXYA 4O3UB 3UVKA 5GMKn 5EMLB 3J81g 4GQBB 2GC7A 5EMJB 2HJBA 3EG6A 3SLED 5HYNB 3PSCB 5TF2A 1K32A 4J8BA 3GFCA 4ESGA 1B9YA 1ERJA 4AOWA 3MKQA 3PVWB 1RI6A 2IUVA 2XU7A 3I7LA 1SQ9A 5HQGA 2J55H 3AFCA 3JAMg 1SHYB 3BG1A 5GSAA 2H6KA 2I0SA 3OL2B 5HE0B 2YNNA 4QRJA 3SN6B 1PEVA 2CO0A 3ORVD 3MZLA 4LG9A 4PSWB 5IGOA 2Z2NA 4J8GA 3PXWD 2IWFA 5KDOB 2PM9A 2HYEA 3W15A 1YFQA 4OZUA 5SXMA 3DSMA 2G9AA 2B5LA 4A0AB 5B4WA 1R5MA 3JZHA 3KRXB 3JRPA 3OW8A 3RFHA 4NSXA 3EI4A 3I7PA 1P22A 2H3XA 5TDHB 4MK0B 4FA9D 3UVMA 2YNOA 3K26A 2P9SC 4R7AB 4FA1D 5C9ZB
chains in the Genus database with same CATH superfamily
3EQ9A 4JSNC 5CXCB 3SHFA 3CFSB 4CY2A 1XHMA 3SXTD 3U4YA 3EU7A 3SBQA 4A11B 1N6DA 4FHLA 1JTDB 3IIWA 4JHPC 3VH0A 4J0XA 1QFMA 1N6EA 5E6SA 4UI9R 3ULEC 4BUJC 4JSPC 2H68A 2BBKH 4ZOVA 4K3ID 3NIDA 4JT5C 3B7FA 4GM8A 2HXCA 2OVPB 5CXBB 3OKTA 4IA9A 5EALA 3ZE2A 1YR2A 4YVDA 5I5MA 3PXSD 3C75H 3N0DA 5EMKB 5AMSA 4BCDA 2VDKA 4O9DA 4J82A 3SWSD 1JJUB 2HU7A 4CY3A 4IRZA 3EI3B 4AN1A 1VZ2A 3OL2A 3DWLC 4A08B 2EIBA 1PBYB 4Y5RD 2YB8B 3L4OD 1VYHC 3SCYA 2XZGA 3A0FA 3ZDZA 3GREA 4CI8A 4PC0A 2H6NA 3SBPA 3PXTD 3RLMD 3MXXA 4TZ4A 5EM2B 3NIFA 4KFMB 5GXIA 4CI2A 1MG2A 4D0KA 2OVQB 5M5SA 4QT8A 4Z7NA 2CN2A 4A0AA 4GGCA 4O3TB 2AGXA 3I8EA 4A09B 3V4VA 4J81A 3EI2B 2OK6A 2AGYA 1K3IA 2BKLA 2J56H 2YBAA 1U8CA 4PBZA 1S4UX 3N0EA 4GGDA 1NR0A 4J86A 4ZOYA 2H9LA 4J77A 3PE7A 3RSEC 3IUQA 1GXRA 1H2XA 4GQ2P 4UM9A 5CXCA 2H47A 4AMZA 1UOOA 4X63B 2MTAH 5H17A 4GMBA 1GG2B 3NVNA 2YMUA 4X60B 2EIDA 4WK4A 4A11A 1NEXB 4X3EA 4ERZA 3K6SA 4WK0A 1XKSA 1FWXA 3C9CA 2VC2A 1GP2B 1VE7A 2WQ8A 4FB1D 5C2WB 4ERQA 2AQ5A 4X61B 4J78A 4CI3A 3GD1I 3RN1D 5CXBA 4LG8A 3MVDK 2P9KC 3MUOA 2XYIA 3I2NA 3OTTA 4JXMA 5GXHA 4GGAA 5IGQA 3EI3A 3IUJA 1MG3A 2OIZA 2OVRB 2XE4A 4FA5D 4A08A 4O45A 2PM7B 1VZ3A 1T2XA 4RE6A 4XYHA 4CI1A 4J73A 3K71A 4K3JB 5M5VA 1L5GA 1C9LA 2P9PC 2HKRA 3DM0A 2OK4A 3O4GA 5I5IA 3VI3A 3IVMA 5EM2A 3SVWD 3RFGA 5A2Qg 4GM9A 3IUMA 2QR5A 4EWRA 1SQJA 5THAA 5EAPA 3ODTA 1UTCA 4JD2C 2B4EA 2P9IC 3RN0D 3UVNA 4BH6A 1M1XA 4A09A 4J0WA 5TEFA 1GOFA 3V5WB 3IULA 2QZPA 3EI2A 4PNKB 3SJLD 3E0CA 4IMMA 2IWKA 2IAAA 1UOPA 5CYKB 3I7KA 4FWWA 4PSXB 1E8NA 2VDLA 4BP8A 4PBYA 4CZXA 4JSVC 4CY5A 5FFOA 3VA6A 2H14A 3SBRA 4WK2A 4O1QD 3OKYB 2CE9A 3C99A 4E5ZB 5FQDA 1VE6A 2AGZA 2H9PA 1BPOA 2CO0C 5FKTA 4BCBA 2HJ4A 1QFSA 3RMZD 2I3TA 4L1MA 3RRMC 1K8KC 1OMWB 3NVXA 4NAAA 4QQEA 4FAND 4J79A 4UM8A 2HU5A 2Q7QA 2XL2A 4ZOZA 2O9KA 2VDOA 2OJYA 4MMYA 5AFU3 5IJ7E 3UVLA 3GC3B 3VGZA 3I89A 4J84A 2GC4A 3L4MD 3JROA 3UR4A 2H6QA 3I7HA 2EIEA 4AN0A 5M5UA 2QC5A 4BP9A 3NVQA 5IT9g 3KRWB 4Y7RA 5H14A 4E54B 3SMRA 4MMZA 4CZYA 2J57G 5HE1B 2AH0A 5AJAA 3CIKB 3EWEA 3MKSB 4WJKA 2I0TA 3NIGA 3AH8B 5FA5B 2AH1A 4A2LA 4D9SA 3C5MA 3MMYA 3IKOA 3K72A 3I8CA 4ES0A 5CYKA 4NENA 1JOFA 4L9OA 3AL8B 1JMXB 1TBGA 5HE2B 2I3SA 4CY1A 2XDWA 1I2MB 4H5IA 3IURA 3IJ0A 4DNWA 4J87A 4QL1A 1UOQA 3KCIA 4L1QD 4XEIC 4OWRA 2CNXA 4JSXC 3OKYA 3SFZA 1H2YA 5I5JA 3EQ7A 3PVUB 4E5ZA 2VDRA 3DXMC 2HKMA 3F3PA 1O6FA 2HU8A 1GOTB 5C92A 3VI4A 3F3FA 3QHYB 2UZYB 4G1EA 2VZ1A 3IIYA 5FFGA 1JV2A 4JT6C 5FKQA 2IURA 3CFVA 4AX4A 5C2VB 3MZKA 4H5JA 1QNIA 3K27A 3ZWLB 4ZN4A 2W18A 4CZVA 3OF7A 5IC7A 3F3GA 3ZDYA 4N14A 5M5RA 5E6RA 4A0BB 1C9IA 5K1CC 4FA4D 2TRCB 2XL3A 4GQ1A 1GOGA 4ERYA 3EI1B 2H9MA 5C86A 4E54A 2P9NC 2VDQA 2H13A 4L3GD 2VZ3A 5EAMA 2Z2OA 1TYQC 1E8MA 4ZOXA 4A7JA 4G1MA 4AMYA 1O6GA 4D6VA 2AGWA 3I7NA 3UVOA 3V9FA 4U1EI 3IUNA 5TEEA 1A0RB 3BG0A 1Q47A 3FGBA 5HDBA 3AL8A 4Z8LA 3J80g 3PSLA 1B9XA 3P4FA 4DNUA 4HDJA 4L3HD 4NC4A 3T3PA 4FAVD 3DXKC 2P9UC 2VDPA 4GZ8A 5FKSA 1PI6A 3JZGA 4I79A 4JHNA 2YNPA 5HE3B 2H9NA 1U4CA 3UKUC 3O4JA 3ZE0A 3MUNA 2G99A 2QXVA 2I0RA 3O4HA 2PBIB 2IUPA 3OKWA 5IJ8E 1JMZB 3ZE1A 4O02A 5JWZA 3QI0A 2B5MA 1XIPA 4G55A 1TYEA 3BWSA 5EARA 4LGNA 3JPXA 2EBSA 2HESX 4BL0A 2PM6B 3UKRC 3HFQA 5EMMB 2CE8A 2IUQA 4RE5A 5FKRA 4QAMA 3IJEA 3JB9L 3FRXA 2GNQA 2Z2PA 4A0BA 5FLXg 2UZXB 4DNVA 1L0QA 4U7AA 4A2MA 3AL9A 3EI1A 2PM9B 3IJCA 1A12A 2B5NA 2AGLA 3V7DB 1N6FA 5K19A 1E5TA 3EMHA 4GM3A 1PGUA 3IJ1A 3EI4B 4G56B 4CC9A 5E6UA 2CN3A 3FM0A 4AEZA 5M5TA 4XYIA 4PXWA 3FCUA 5M61A 1OLZA 3FCSA 1H2WA 1U2VC 2P9LC 2BCJB 5H1MA 3JZNA 4Z7QA 3ZDXA 4BCCA 4MMXA 1MDAH 3I7OA 5FXYA 4O3UB 3UVKA 5GMKn 5EMLB 3J81g 4GQBB 2GC7A 5EMJB 2HJBA 3EG6A 3EQ8A 3SLED 5HYNB 3PSCB 5TF2A 3O4IA 1K32A 4J8BA 3GFCA 4ESGA 1B9YA 1ERJA 4AOWA 3MKQA 4Z7OA 3PVWB 3V4PA 1RI6A 2IUVA 2XU7A 3I7LA 1SQ9A 5HQGA 2J55H 3AFCA 3JAMg 1SHYB 3BG1A 5GSAA 2H6KA 2I0SA 3OL2B 5HE0B 2VDMA 2YNNA 2VDNA 4QRJA 3SN6B 1PEVA 2CO0A 3ORVD 3MZLA 4LG9A 4PSWB 4O2WA 1GOHA 5IGOA 2Z2NA 4J8GA 4NBMA 1H2ZA 3PXWD 2IWFA 5KDOB 2PM9A 2HYEA 3W15A 1YFQA 4OZUA 5SXMA 3DSMA 2EICA 2G9AA 2B5LA 2JKXA 4A0AB 5B4WA 1R5MA 3JZHA 3KRXB 3DDUA 3JRPA 3OW8A 3RFHA 4NSXA 3EI4A 3I7PA 1P22A 2H3XA 5TDHB 4MK0B 4FA9D 3UVMA 2YNOA 3K26A 2P9SC 3T3MA 4R7AB 4FA1D 5C9ZB
chains in the Genus database with same CATH topology
4JSNC 5CXCB 3SHFA 3CFSB 4CY2A 1XHMA 3SXTD 3U4YA 3EU7A 3SBQA 4A11B 1N6DA 4FHLA 3IIWA 3VH0A 4J0XA 1N6EA 4UI9R 3ULEC 4BUJC 4JSPC 2H68A 2BBKH 4ZOVA 4K3ID 4JT5C 3B7FA 4GM8A 2HXCA 2OVPB 5CXBB 3OKTA 4IA9A 5EALA 4YVDA 5I5MA 3PXSD 3C75H 3N0DA 5EMKB 5AMSA 4O9DA 4J82A 3SWSD 1JJUB 4CY3A 3EI3B 3OL2A 3DWLC 4A08B 1PBYB 4Y5RD 2YB8B 3L4OD 1VYHC 3SCYA 3A0FA 3GREA 4CI8A 4PC0A 2H6NA 3SBPA 3PXTD 3RLMD 3MXXA 4TZ4A 5EM2B 4KFMB 5GXIA 4CI2A 1MG2A 4D0KA 2OVQB 4QT8A 2CN2A 4A0AA 4GGCA 4O3TB 2AGXA 3I8EA 4A09B 4J81A 3EI2B 2OK6A 2AGYA 2J56H 2YBAA 4PBZA 1S4UX 3N0EA 4J86A 4GGDA 1NR0A 4ZOYA 2H9LA 4J77A 3PE7A 3RSEC 1GXRA 4GQ2P 5CXCA 2H47A 4X63B 2MTAH 5H17A 4GMBA 1GG2B 3NVNA 2YMUA 4X60B 4A11A 1NEXB 4X3EA 4ERZA 1XKSA 1FWXA 3C9CA 1GP2B 4FB1D 5C2WB 4ERQA 2AQ5A 4X61B 4J78A 4CI3A 3RN1D 5CXBA 4LG8A 2P9KC 2XYIA 3I2NA 3OTTA 4JXMA 5GXHA 4GGAA 5IGQA 3EI3A 1MG3A 2OIZA 2OVRB 4FA5D 4A08A 4O45A 2PM7B 4CI1A 4XYHA 4J73A 4K3JB 2P9PC 2HKRA 3DM0A 2OK4A 5I5IA 5EM2A 3SVWD 3RFGA 5A2Qg 4GM9A 4EWRA 1SQJA 5THAA 5EAPA 3ODTA 4JD2C 2B4EA 2P9IC 3RN0D 3UVNA 4BH6A 4A09A 4J0WA 5TEFA 3V5WB 3EI2A 4PNKB 3SJLD 3E0CA 4IMMA 2IWKA 2IAAA 5CYKB 3I7KA 4FWWA 4PSXB 4PBYA 4CZXA 4JSVC 4CY5A 3VA6A 2H14A 3SBRA 4O1QD 3OKYB 2CE9A 3C99A 4E5ZB 5FQDA 2AGZA 2H9PA 2CO0C 5FKTA 2HJ4A 3RMZD 2I3TA 3RRMC 1K8KC 1OMWB 3NVXA 4QQEA 4FAND 4J79A 2Q7QA 2XL2A 4ZOZA 2O9KA 2OJYA 5AFU3 5IJ7E 3UVLA 3VGZA 3I89A 4J84A 2GC4A 3L4MD 3JROA 3UR4A 2H6QA 3I7HA 2QC5A 3NVQA 5IT9g 3KRWB 4Y7RA 5H14A 4E54B 3SMRA 4CZYA 2J57G 5HE1B 2AH0A 5AJAA 3CIKB 3EWEA 3MKSB 2I0TA 3AH8B 5FA5B 2AH1A 4A2LA 3C5MA 3MMYA 3IKOA 3I8CA 4ES0A 5CYKA 1JOFA 4L9OA 3AL8B 1JMXB 1TBGA 5HE2B 2I3SA 4CY1A 4H5IA 3IJ0A 4J87A 4QL1A 4L1QD 4XEIC 4OWRA 2CNXA 4JSXC 3OKYA 3SFZA 5I5JA 3PVUB 4E5ZA 3DXMC 2HKMA 3F3PA 1GOTB 3F3FA 2UZYB 3IIYA 4JT6C 5FKQA 2IURA 3CFVA 5C2VB 3MZKA 4H5JA 1QNIA 3K27A 3ZWLB 4ZN4A 2W18A 4CZVA 5IC7A 3F3GA 4N14A 4A0BB 5K1CC 4FA4D 2TRCB 2XL3A 4GQ1A 4ERYA 3EI1B 2H9MA 4E54A 2P9NC 4L3GD 2H13A 5EAMA 2Z2OA 1TYQC 4ZOXA 4A7JA 4D6VA 2AGWA 3I7NA 3UVOA 3V9FA 4U1EI 5TEEA 1A0RB 3BG0A 1Q47A 3FGBA 3AL8A 4Z8LA 3J80g 3PSLA 1B9XA 3P4FA 4HDJA 4L3HD 4FAVD 3DXKC 2P9UC 4GZ8A 5FKSA 1PI6A 3JZGA 4I79A 2YNPA 5HE3B 2H9NA 1U4CA 3UKUC 2G99A 2QXVA 2I0RA 2PBIB 2IUPA 3OKWA 5IJ8E 1JMZB 5JWZA 2B5MA 1XIPA 3BWSA 5EARA 4LGNA 3JPXA 2EBSA 2HESX 4BL0A 2PM6B 3UKRC 3HFQA 5EMMB 2CE8A 2IUQA 5FKRA 3JB9L 3FRXA 2GNQA 2Z2PA 4A0BA 5FLXg 2UZXB 1L0QA 4U7AA 4A2MA 3AL9A 3EI1A 2PM9B 3IJCA 2B5NA 2AGLA 3V7DB 1N6FA 5K19A 3EMHA 4GM3A 1PGUA 3IJ1A 3EI4B 4G56B 4CC9A 2CN3A 3FM0A 4AEZA 4XYIA 4PXWA 1OLZA 2P9LC 1U2VC 2BCJB 5H1MA 3JZNA 1MDAH 3I7OA 5FXYA 4O3UB 3UVKA 5GMKn 5EMLB 3J81g 4GQBB 2GC7A 5EMJB 2HJBA 3EG6A 3SLED 5HYNB 3PSCB 5TF2A 1K32A 4J8BA 3GFCA 4ESGA 1B9YA 1ERJA 4AOWA 3MKQA 3PVWB 1RI6A 2IUVA 2XU7A 3I7LA 1SQ9A 5HQGA 2J55H 3AFCA 3JAMg 1SHYB 3BG1A 5GSAA 2H6KA 2I0SA 3OL2B 5HE0B 2YNNA 4QRJA 3SN6B 1PEVA 2CO0A 3ORVD 3MZLA 4LG9A 4PSWB 5IGOA 2Z2NA 4J8GA 3PXWD 2IWFA 5KDOB 2PM9A 2HYEA 3W15A 1YFQA 4OZUA 5SXMA 3DSMA 2G9AA 2B5LA 4A0AB 5B4WA 1R5MA 3JZHA 3KRXB 3JRPA 3OW8A 3RFHA 4NSXA 3EI4A 3I7PA 1P22A 2H3XA 5TDHB 4MK0B 4FA9D 3UVMA 2YNOA 3K26A 2P9SC 4R7AB 4FA1D 5C9ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSN C;  5CXC B;  3SHF A;  3CFS B;  4CY2 A;  1XHM A;  3SXT D;  3U4Y A;  3EU7 A;  3SBQ A;  4A11 B;  1N6D A;  4FHL A;  3IIW A;  3VH0 A;  4J0X A;  1N6E A;  4UI9 R;  3ULE C;  4BUJ C;  4JSP C;  2H68 A;  2BBK H;  4ZOV A;  4K3I D;  4JT5 C;  3B7F A;  4GM8 A;  2HXC A;  2OVP B;  5CXB B;  3OKT A;  4IA9 A;  5EAL A;  4YVD A;  5I5M A;  3PXS D;  3C75 H;  3N0D A;  5EMK B;  5AMS A;  4O9D A;  4J82 A;  3SWS D;  1JJU B;  4CY3 A;  3EI3 B;  3OL2 A;  3DWL C;  4A08 B;  1PBY B;  4Y5R D;  2YB8 B;  3L4O D;  1VYH C;  3SCY A;  3A0F A;  3GRE A;  4CI8 A;  4PC0 A;  2H6N A;  3SBP A;  3PXT D;  3RLM D;  3MXX A;  4TZ4 A;  5EM2 B;  4KFM B;  5GXI A;  4CI2 A;  1MG2 A;  4D0K A;  2OVQ B;  4QT8 A;  2CN2 A;  4A0A A;  4GGC A;  4O3T B;  2AGX A;  3I8E A;  4A09 B;  4J81 A;  3EI2 B;  2OK6 A;  2AGY A;  2J56 H;  2YBA A;  4PBZ A;  1S4U X;  3N0E A;  4J86 A;  4GGD A;  1NR0 A;  4ZOY A;  2H9L A;  4J77 A;  3PE7 A;  3RSE C;  1GXR A;  4GQ2 P;  5CXC A;  2H47 A;  4X63 B;  2MTA H;  5H17 A;  4GMB A;  1GG2 B;  3NVN A;  2YMU A;  4X60 B;  4A11 A;  1NEX B;  4X3E A;  4ERZ A;  1XKS A;  1FWX A;  3C9C A;  1GP2 B;  4FB1 D;  5C2W B;  4ERQ A;  2AQ5 A;  4X61 B;  4J78 A;  4CI3 A;  3RN1 D;  5CXB A;  4LG8 A;  2P9K C;  2XYI A;  3I2N A;  3OTT A;  4JXM A;  5GXH A;  4GGA A;  5IGQ A;  3EI3 A;  1MG3 A;  2OIZ A;  2OVR B;  4FA5 D;  4A08 A;  4O45 A;  2PM7 B;  4CI1 A;  4XYH A;  4J73 A;  4K3J B;  2P9P C;  2HKR A;  3DM0 A;  2OK4 A;  5I5I A;  5EM2 A;  3SVW D;  3RFG A;  5A2Q g;  4GM9 A;  4EWR A;  1SQJ A;  5THA A;  5EAP A;  3ODT A;  4JD2 C;  2B4E A;  2P9I C;  3RN0 D;  3UVN A;  4BH6 A;  4A09 A;  4J0W A;  5TEF A;  3V5W B;  3EI2 A;  4PNK B;  3SJL D;  3E0C A;  4IMM A;  2IWK A;  2IAA A;  5CYK B;  3I7K A;  4FWW A;  4PSX B;  4PBY A;  4CZX A;  4JSV C;  4CY5 A;  3VA6 A;  2H14 A;  3SBR A;  4O1Q D;  3OKY B;  2CE9 A;  3C99 A;  4E5Z B;  5FQD A;  2AGZ A;  2H9P A;  2CO0 C;  5FKT A;  2HJ4 A;  3RMZ D;  2I3T A;  3RRM C;  1K8K C;  1OMW B;  3NVX A;  4QQE A;  4FAN D;  4J79 A;  2Q7Q A;  2XL2 A;  4ZOZ A;  2O9K A;  2OJY A;  5AFU 3;  5IJ7 E;  3UVL A;  3VGZ A;  3I89 A;  4J84 A;  2GC4 A;  3L4M D;  3JRO A;  3UR4 A;  2H6Q A;  3I7H A;  2QC5 A;  3NVQ A;  5IT9 g;  3KRW B;  4Y7R A;  5H14 A;  4E54 B;  3SMR A;  4CZY A;  2J57 G;  5HE1 B;  2AH0 A;  5AJA A;  3CIK B;  3EWE A;  3MKS B;  2I0T A;  3AH8 B;  5FA5 B;  2AH1 A;  4A2L A;  3C5M A;  3MMY A;  3IKO A;  3I8C A;  4ES0 A;  5CYK A;  1JOF A;  4L9O A;  3AL8 B;  1JMX B;  1TBG A;  5HE2 B;  2I3S A;  4CY1 A;  4H5I A;  3IJ0 A;  4J87 A;  4QL1 A;  4L1Q D;  4XEI C;  4OWR A;  2CNX A;  4JSX C;  3OKY A;  3SFZ A;  5I5J A;  3PVU B;  4E5Z A;  3DXM C;  2HKM A;  3F3P A;  1GOT B;  3F3F A;  2UZY B;  3IIY A;  4JT6 C;  5FKQ A;  2IUR A;  3CFV A;  5C2V B;  3MZK A;  4H5J A;  1QNI A;  3K27 A;  3ZWL B;  4ZN4 A;  2W18 A;  4CZV A;  5IC7 A;  3F3G A;  4N14 A;  4A0B B;  5K1C C;  4FA4 D;  2TRC B;  2XL3 A;  4GQ1 A;  4ERY A;  3EI1 B;  2H9M A;  4E54 A;  2P9N C;  4L3G D;  2H13 A;  5EAM A;  2Z2O A;  1TYQ C;  4ZOX A;  4A7J A;  4D6V A;  2AGW A;  3I7N A;  3UVO A;  3V9F A;  4U1E I;  5TEE A;  1A0R B;  3BG0 A;  1Q47 A;  3FGB A;  3AL8 A;  4Z8L A;  3J80 g;  3PSL A;  1B9X A;  3P4F A;  4HDJ A;  4L3H D;  4FAV D;  3DXK C;  2P9U C;  4GZ8 A;  5FKS A;  1PI6 A;  3JZG A;  4I79 A;  2YNP A;  5HE3 B;  2H9N A;  1U4C A;  3UKU C;  2G99 A;  2QXV A;  2I0R A;  2PBI B;  2IUP A;  3OKW A;  5IJ8 E;  1JMZ B;  5JWZ A;  2B5M A;  1XIP A;  3BWS A;  5EAR A;  4LGN A;  3JPX A;  2EBS A;  2HES X;  4BL0 A;  2PM6 B;  3UKR C;  3HFQ A;  5EMM B;  2CE8 A;  2IUQ A;  5FKR A;  3JB9 L;  3FRX A;  2GNQ A;  2Z2P A;  4A0B A;  5FLX g;  2UZX B;  1L0Q A;  4U7A A;  4A2M A;  3AL9 A;  3EI1 A;  2PM9 B;  3IJC A;  2B5N A;  2AGL A;  3V7D B;  1N6F A;  5K19 A;  3EMH A;  4GM3 A;  1PGU A;  3IJ1 A;  3EI4 B;  4G56 B;  4CC9 A;  2CN3 A;  3FM0 A;  4AEZ A;  4XYI A;  4PXW A;  1OLZ A;  2P9L C;  1U2V C;  2BCJ B;  5H1M A;  3JZN A;  1MDA H;  3I7O A;  5FXY A;  4O3U B;  3UVK A;  5GMK n;  5EML B;  3J81 g;  4GQB B;  2GC7 A;  5EMJ B;  2HJB A;  3EG6 A;  3SLE D;  5HYN B;  3PSC B;  5TF2 A;  1K32 A;  4J8B A;  3GFC A;  4ESG A;  1B9Y A;  1ERJ A;  4AOW A;  3MKQ A;  3PVW B;  1RI6 A;  2IUV A;  2XU7 A;  3I7L A;  1SQ9 A;  5HQG A;  2J55 H;  3AFC A;  3JAM g;  1SHY B;  3BG1 A;  5GSA A;  2H6K A;  2I0S A;  3OL2 B;  5HE0 B;  2YNN A;  4QRJ A;  3SN6 B;  1PEV A;  2CO0 A;  3ORV D;  3MZL A;  4LG9 A;  4PSW B;  5IGO A;  2Z2N A;  4J8G A;  3PXW D;  2IWF A;  5KDO B;  2PM9 A;  2HYE A;  3W15 A;  1YFQ A;  4OZU A;  5SXM A;  3DSM A;  2G9A A;  2B5L A;  4A0A B;  5B4W A;  1R5M A;  3JZH A;  3KRX B;  3JRP A;  3OW8 A;  3RFH A;  4NSX A;  3EI4 A;  3I7P A;  1P22 A;  2H3X A;  5TDH B;  4MK0 B;  4FA9 D;  3UVM A;  2YNO A;  3K26 A;  2P9S C;  4R7A B;  4FA1 D;  5C9Z B; 
#chains in the Genus database with same CATH topology
 3EQ9 A;  4JSN C;  5CXC B;  3SHF A;  3CFS B;  4CY2 A;  1XHM A;  3SXT D;  3U4Y A;  3EU7 A;  3SBQ A;  4A11 B;  1N6D A;  4FHL A;  1JTD B;  3IIW A;  4JHP C;  3VH0 A;  4J0X A;  1QFM A;  1N6E A;  5E6S A;  4UI9 R;  3ULE C;  4BUJ C;  4JSP C;  2H68 A;  2BBK H;  4ZOV A;  4K3I D;  3NID A;  4JT5 C;  3B7F A;  4GM8 A;  2HXC A;  2OVP B;  5CXB B;  3OKT A;  4IA9 A;  5EAL A;  3ZE2 A;  1YR2 A;  4YVD A;  5I5M A;  3PXS D;  3C75 H;  3N0D A;  5EMK B;  5AMS A;  4BCD A;  2VDK A;  4O9D A;  4J82 A;  3SWS D;  1JJU B;  2HU7 A;  4CY3 A;  4IRZ A;  3EI3 B;  4AN1 A;  1VZ2 A;  3OL2 A;  3DWL C;  4A08 B;  2EIB A;  1PBY B;  4Y5R D;  2YB8 B;  3L4O D;  1VYH C;  3SCY A;  2XZG A;  3A0F A;  3ZDZ A;  3GRE A;  4CI8 A;  4PC0 A;  2H6N A;  3SBP A;  3PXT D;  3RLM D;  3MXX A;  4TZ4 A;  5EM2 B;  3NIF A;  4KFM B;  5GXI A;  4CI2 A;  1MG2 A;  4D0K A;  2OVQ B;  5M5S A;  4QT8 A;  4Z7N A;  2CN2 A;  4A0A A;  4GGC A;  4O3T B;  2AGX A;  3I8E A;  4A09 B;  3V4V A;  4J81 A;  3EI2 B;  2OK6 A;  2AGY A;  1K3I A;  2BKL A;  2J56 H;  2YBA A;  1U8C A;  4PBZ A;  1S4U X;  3N0E A;  4GGD A;  1NR0 A;  4J86 A;  4ZOY A;  2H9L A;  4J77 A;  3PE7 A;  3RSE C;  3IUQ A;  1GXR A;  1H2X A;  4GQ2 P;  4UM9 A;  5CXC A;  2H47 A;  4AMZ A;  1UOO A;  4X63 B;  2MTA H;  5H17 A;  4GMB A;  1GG2 B;  3NVN A;  2YMU A;  4X60 B;  2EID A;  4WK4 A;  4A11 A;  1NEX B;  4X3E A;  4ERZ A;  3K6S A;  4WK0 A;  1XKS A;  1FWX A;  3C9C A;  2VC2 A;  1GP2 B;  1VE7 A;  2WQ8 A;  4FB1 D;  5C2W B;  4ERQ A;  2AQ5 A;  4X61 B;  4J78 A;  4CI3 A;  3GD1 I;  3RN1 D;  5CXB A;  4LG8 A;  3MVD K;  2P9K C;  3MUO A;  2XYI A;  3I2N A;  3OTT A;  4JXM A;  5GXH A;  4GGA A;  5IGQ A;  3EI3 A;  3IUJ A;  1MG3 A;  2OIZ A;  2OVR B;  2XE4 A;  4FA5 D;  4A08 A;  4O45 A;  2PM7 B;  1VZ3 A;  1T2X A;  4RE6 A;  4XYH A;  4CI1 A;  4J73 A;  3K71 A;  4K3J B;  5M5V A;  1L5G A;  1C9L A;  2P9P C;  2HKR A;  3DM0 A;  2OK4 A;  3O4G A;  5I5I A;  3VI3 A;  3IVM A;  5EM2 A;  3SVW D;  3RFG A;  5A2Q g;  4GM9 A;  3IUM A;  2QR5 A;  4EWR A;  1SQJ A;  5THA A;  5EAP A;  3ODT A;  1UTC A;  4JD2 C;  2B4E A;  2P9I C;  3RN0 D;  3UVN A;  4BH6 A;  1M1X A;  4A09 A;  4J0W A;  5TEF A;  1GOF A;  3V5W B;  3IUL A;  2QZP A;  3EI2 A;  4PNK B;  3SJL D;  3E0C A;  4IMM A;  2IWK A;  2IAA A;  1UOP A;  5CYK B;  3I7K A;  4FWW A;  4PSX B;  1E8N A;  2VDL A;  4BP8 A;  4PBY A;  4CZX A;  4JSV C;  4CY5 A;  5FFO A;  3VA6 A;  2H14 A;  3SBR A;  4WK2 A;  4O1Q D;  3OKY B;  2CE9 A;  3C99 A;  4E5Z B;  5FQD A;  1VE6 A;  2AGZ A;  2H9P A;  1BPO A;  2CO0 C;  5FKT A;  4BCB A;  2HJ4 A;  1QFS A;  3RMZ D;  2I3T A;  4L1M A;  3RRM C;  1K8K C;  1OMW B;  3NVX A;  4NAA A;  4QQE A;  4FAN D;  4J79 A;  4UM8 A;  2HU5 A;  2Q7Q A;  2XL2 A;  4ZOZ A;  2O9K A;  2VDO A;  2OJY A;  4MMY A;  5AFU 3;  5IJ7 E;  3UVL A;  3GC3 B;  3VGZ A;  3I89 A;  4J84 A;  2GC4 A;  3L4M D;  3JRO A;  3UR4 A;  2H6Q A;  3I7H A;  2EIE A;  4AN0 A;  5M5U A;  2QC5 A;  4BP9 A;  3NVQ A;  5IT9 g;  3KRW B;  4Y7R A;  5H14 A;  4E54 B;  3SMR A;  4MMZ A;  4CZY A;  2J57 G;  5HE1 B;  2AH0 A;  5AJA A;  3CIK B;  3EWE A;  3MKS B;  4WJK A;  2I0T A;  3NIG A;  3AH8 B;  5FA5 B;  2AH1 A;  4A2L A;  4D9S A;  3C5M A;  3MMY A;  3IKO A;  3K72 A;  3I8C A;  4ES0 A;  5CYK A;  4NEN A;  1JOF A;  4L9O A;  3AL8 B;  1JMX B;  1TBG A;  5HE2 B;  2I3S A;  4CY1 A;  2XDW A;  1I2M B;  4H5I A;  3IUR A;  3IJ0 A;  4DNW A;  4J87 A;  4QL1 A;  1UOQ A;  3KCI A;  4L1Q D;  4XEI C;  4OWR A;  2CNX A;  4JSX C;  3OKY A;  3SFZ A;  1H2Y A;  5I5J A;  3EQ7 A;  3PVU B;  4E5Z A;  2VDR A;  3DXM C;  2HKM A;  3F3P A;  1O6F A;  2HU8 A;  1GOT B;  5C92 A;  3VI4 A;  3F3F A;  3QHY B;  2UZY B;  4G1E A;  2VZ1 A;  3IIY A;  5FFG A;  1JV2 A;  4JT6 C;  5FKQ A;  2IUR A;  3CFV A;  4AX4 A;  5C2V B;  3MZK A;  4H5J A;  1QNI A;  3K27 A;  3ZWL B;  4ZN4 A;  2W18 A;  4CZV A;  3OF7 A;  5IC7 A;  3F3G A;  3ZDY A;  4N14 A;  5M5R A;  5E6R A;  4A0B B;  1C9I A;  5K1C C;  4FA4 D;  2TRC B;  2XL3 A;  4GQ1 A;  1GOG A;  4ERY A;  3EI1 B;  2H9M A;  5C86 A;  4E54 A;  2P9N C;  2VDQ A;  2H13 A;  4L3G D;  2VZ3 A;  5EAM A;  2Z2O A;  1TYQ C;  1E8M A;  4ZOX A;  4A7J A;  4G1M A;  4AMY A;  1O6G A;  4D6V A;  2AGW A;  3I7N A;  3UVO A;  3V9F A;  4U1E I;  3IUN A;  5TEE A;  1A0R B;  3BG0 A;  1Q47 A;  3FGB A;  5HDB A;  3AL8 A;  4Z8L A;  3J80 g;  3PSL A;  1B9X A;  3P4F A;  4DNU A;  4HDJ A;  4L3H D;  4NC4 A;  3T3P A;  4FAV D;  3DXK C;  2P9U C;  2VDP A;  4GZ8 A;  5FKS A;  1PI6 A;  3JZG A;  4I79 A;  4JHN A;  2YNP A;  5HE3 B;  2H9N A;  1U4C A;  3UKU C;  3O4J A;  3ZE0 A;  3MUN A;  2G99 A;  2QXV A;  2I0R A;  3O4H A;  2PBI B;  2IUP A;  3OKW A;  5IJ8 E;  1JMZ B;  3ZE1 A;  4O02 A;  5JWZ A;  3QI0 A;  2B5M A;  1XIP A;  4G55 A;  1TYE A;  3BWS A;  5EAR A;  4LGN A;  3JPX A;  2EBS A;  2HES X;  4BL0 A;  2PM6 B;  3UKR C;  3HFQ A;  5EMM B;  2CE8 A;  2IUQ A;  4RE5 A;  5FKR A;  4QAM A;  3IJE A;  3JB9 L;  3FRX A;  2GNQ A;  2Z2P A;  4A0B A;  5FLX g;  2UZX B;  4DNV A;  1L0Q A;  4U7A A;  4A2M A;  3AL9 A;  3EI1 A;  2PM9 B;  3IJC A;  1A12 A;  2B5N A;  2AGL A;  3V7D B;  1N6F A;  5K19 A;  1E5T A;  3EMH A;  4GM3 A;  1PGU A;  3IJ1 A;  3EI4 B;  4G56 B;  4CC9 A;  5E6U A;  2CN3 A;  3FM0 A;  4AEZ A;  5M5T A;  4XYI A;  4PXW A;  3FCU A;  5M61 A;  1OLZ A;  3FCS A;  1H2W A;  1U2V C;  2P9L C;  2BCJ B;  5H1M A;  3JZN A;  4Z7Q A;  3ZDX A;  4BCC A;  4MMX A;  1MDA H;  3I7O A;  5FXY A;  4O3U B;  3UVK A;  5GMK n;  5EML B;  3J81 g;  4GQB B;  2GC7 A;  5EMJ B;  2HJB A;  3EG6 A;  3EQ8 A;  3SLE D;  5HYN B;  3PSC B;  5TF2 A;  3O4I A;  1K32 A;  4J8B A;  3GFC A;  4ESG A;  1B9Y A;  1ERJ A;  4AOW A;  3MKQ A;  4Z7O A;  3PVW B;  3V4P A;  1RI6 A;  2IUV A;  2XU7 A;  3I7L A;  1SQ9 A;  5HQG A;  2J55 H;  3AFC A;  3JAM g;  1SHY B;  3BG1 A;  5GSA A;  2H6K A;  2I0S A;  3OL2 B;  5HE0 B;  2VDM A;  2YNN A;  2VDN A;  4QRJ A;  3SN6 B;  1PEV A;  2CO0 A;  3ORV D;  3MZL A;  4LG9 A;  4PSW B;  4O2W A;  1GOH A;  5IGO A;  2Z2N A;  4J8G A;  4NBM A;  1H2Z A;  3PXW D;  2IWF A;  5KDO B;  2PM9 A;  2HYE A;  3W15 A;  1YFQ A;  4OZU A;  5SXM A;  3DSM A;  2EIC A;  2G9A A;  2B5L A;  2JKX A;  4A0A B;  5B4W A;  1R5M A;  3JZH A;  3KRX B;  3DDU A;  3JRP A;  3OW8 A;  3RFH A;  4NSX A;  3EI4 A;  3I7P A;  1P22 A;  2H3X A;  5TDH B;  4MK0 B;  4FA9 D;  3UVM A;  2YNO A;  3K26 A;  2P9S C;  3T3M A;  4R7A B;  4FA1 D;  5C9Z B; 
#chains in the Genus database with same CATH homology
 4JSN C;  5CXC B;  3SHF A;  3CFS B;  4CY2 A;  1XHM A;  3SXT D;  3U4Y A;  3EU7 A;  3SBQ A;  4A11 B;  1N6D A;  4FHL A;  3IIW A;  3VH0 A;  4J0X A;  1N6E A;  4UI9 R;  3ULE C;  4BUJ C;  4JSP C;  2H68 A;  2BBK H;  4ZOV A;  4K3I D;  4JT5 C;  3B7F A;  4GM8 A;  2HXC A;  2OVP B;  5CXB B;  3OKT A;  4IA9 A;  5EAL A;  4YVD A;  5I5M A;  3PXS D;  3C75 H;  3N0D A;  5EMK B;  5AMS A;  4O9D A;  4J82 A;  3SWS D;  1JJU B;  4CY3 A;  3EI3 B;  3OL2 A;  3DWL C;  4A08 B;  1PBY B;  4Y5R D;  2YB8 B;  3L4O D;  1VYH C;  3SCY A;  3A0F A;  3GRE A;  4CI8 A;  4PC0 A;  2H6N A;  3SBP A;  3PXT D;  3RLM D;  3MXX A;  4TZ4 A;  5EM2 B;  4KFM B;  5GXI A;  4CI2 A;  1MG2 A;  4D0K A;  2OVQ B;  4QT8 A;  2CN2 A;  4A0A A;  4GGC A;  4O3T B;  2AGX A;  3I8E A;  4A09 B;  4J81 A;  3EI2 B;  2OK6 A;  2AGY A;  2J56 H;  2YBA A;  4PBZ A;  1S4U X;  3N0E A;  4J86 A;  4GGD A;  1NR0 A;  4ZOY A;  2H9L A;  4J77 A;  3PE7 A;  3RSE C;  1GXR A;  4GQ2 P;  5CXC A;  2H47 A;  4X63 B;  2MTA H;  5H17 A;  4GMB A;  1GG2 B;  3NVN A;  2YMU A;  4X60 B;  4A11 A;  1NEX B;  4X3E A;  4ERZ A;  1XKS A;  1FWX A;  3C9C A;  1GP2 B;  4FB1 D;  5C2W B;  4ERQ A;  2AQ5 A;  4X61 B;  4J78 A;  4CI3 A;  3RN1 D;  5CXB A;  4LG8 A;  2P9K C;  2XYI A;  3I2N A;  3OTT A;  4JXM A;  5GXH A;  4GGA A;  5IGQ A;  3EI3 A;  1MG3 A;  2OIZ A;  2OVR B;  4FA5 D;  4A08 A;  4O45 A;  2PM7 B;  4CI1 A;  4XYH A;  4J73 A;  4K3J B;  2P9P C;  2HKR A;  3DM0 A;  2OK4 A;  5I5I A;  5EM2 A;  3SVW D;  3RFG A;  5A2Q g;  4GM9 A;  4EWR A;  1SQJ A;  5THA A;  5EAP A;  3ODT A;  4JD2 C;  2B4E A;  2P9I C;  3RN0 D;  3UVN A;  4BH6 A;  4A09 A;  4J0W A;  5TEF A;  3V5W B;  3EI2 A;  4PNK B;  3SJL D;  3E0C A;  4IMM A;  2IWK A;  2IAA A;  5CYK B;  3I7K A;  4FWW A;  4PSX B;  4PBY A;  4CZX A;  4JSV C;  4CY5 A;  3VA6 A;  2H14 A;  3SBR A;  4O1Q D;  3OKY B;  2CE9 A;  3C99 A;  4E5Z B;  5FQD A;  2AGZ A;  2H9P A;  2CO0 C;  5FKT A;  2HJ4 A;  3RMZ D;  2I3T A;  3RRM C;  1K8K C;  1OMW B;  3NVX A;  4QQE A;  4FAN D;  4J79 A;  2Q7Q A;  2XL2 A;  4ZOZ A;  2O9K A;  2OJY A;  5AFU 3;  5IJ7 E;  3UVL A;  3VGZ A;  3I89 A;  4J84 A;  2GC4 A;  3L4M D;  3JRO A;  3UR4 A;  2H6Q A;  3I7H A;  2QC5 A;  3NVQ A;  5IT9 g;  3KRW B;  4Y7R A;  5H14 A;  4E54 B;  3SMR A;  4CZY A;  2J57 G;  5HE1 B;  2AH0 A;  5AJA A;  3CIK B;  3EWE A;  3MKS B;  2I0T A;  3AH8 B;  5FA5 B;  2AH1 A;  4A2L A;  3C5M A;  3MMY A;  3IKO A;  3I8C A;  4ES0 A;  5CYK A;  1JOF A;  4L9O A;  3AL8 B;  1JMX B;  1TBG A;  5HE2 B;  2I3S A;  4CY1 A;  4H5I A;  3IJ0 A;  4J87 A;  4QL1 A;  4L1Q D;  4XEI C;  4OWR A;  2CNX A;  4JSX C;  3OKY A;  3SFZ A;  5I5J A;  3PVU B;  4E5Z A;  3DXM C;  2HKM A;  3F3P A;  1GOT B;  3F3F A;  2UZY B;  3IIY A;  4JT6 C;  5FKQ A;  2IUR A;  3CFV A;  5C2V B;  3MZK A;  4H5J A;  1QNI A;  3K27 A;  3ZWL B;  4ZN4 A;  2W18 A;  4CZV A;  5IC7 A;  3F3G A;  4N14 A;  4A0B B;  5K1C C;  4FA4 D;  2TRC B;  2XL3 A;  4GQ1 A;  4ERY A;  3EI1 B;  2H9M A;  4E54 A;  2P9N C;  4L3G D;  2H13 A;  5EAM A;  2Z2O A;  1TYQ C;  4ZOX A;  4A7J A;  4D6V A;  2AGW A;  3I7N A;  3UVO A;  3V9F A;  4U1E I;  5TEE A;  1A0R B;  3BG0 A;  1Q47 A;  3FGB A;  3AL8 A;  4Z8L A;  3J80 g;  3PSL A;  1B9X A;  3P4F A;  4HDJ A;  4L3H D;  4FAV D;  3DXK C;  2P9U C;  4GZ8 A;  5FKS A;  1PI6 A;  3JZG A;  4I79 A;  2YNP A;  5HE3 B;  2H9N A;  1U4C A;  3UKU C;  2G99 A;  2QXV A;  2I0R A;  2PBI B;  2IUP A;  3OKW A;  5IJ8 E;  1JMZ B;  5JWZ A;  2B5M A;  1XIP A;  3BWS A;  5EAR A;  4LGN A;  3JPX A;  2EBS A;  2HES X;  4BL0 A;  2PM6 B;  3UKR C;  3HFQ A;  5EMM B;  2CE8 A;  2IUQ A;  5FKR A;  3JB9 L;  3FRX A;  2GNQ A;  2Z2P A;  4A0B A;  5FLX g;  2UZX B;  1L0Q A;  4U7A A;  4A2M A;  3AL9 A;  3EI1 A;  2PM9 B;  3IJC A;  2B5N A;  2AGL A;  3V7D B;  1N6F A;  5K19 A;  3EMH A;  4GM3 A;  1PGU A;  3IJ1 A;  3EI4 B;  4G56 B;  4CC9 A;  2CN3 A;  3FM0 A;  4AEZ A;  4XYI A;  4PXW A;  1OLZ A;  2P9L C;  1U2V C;  2BCJ B;  5H1M A;  3JZN A;  1MDA H;  3I7O A;  5FXY A;  4O3U B;  3UVK A;  5GMK n;  5EML B;  3J81 g;  4GQB B;  2GC7 A;  5EMJ B;  2HJB A;  3EG6 A;  3SLE D;  5HYN B;  3PSC B;  5TF2 A;  1K32 A;  4J8B A;  3GFC A;  4ESG A;  1B9Y A;  1ERJ A;  4AOW A;  3MKQ A;  3PVW B;  1RI6 A;  2IUV A;  2XU7 A;  3I7L A;  1SQ9 A;  5HQG A;  2J55 H;  3AFC A;  3JAM g;  1SHY B;  3BG1 A;  5GSA A;  2H6K A;  2I0S A;  3OL2 B;  5HE0 B;  2YNN A;  4QRJ A;  3SN6 B;  1PEV A;  2CO0 A;  3ORV D;  3MZL A;  4LG9 A;  4PSW B;  5IGO A;  2Z2N A;  4J8G A;  3PXW D;  2IWF A;  5KDO B;  2PM9 A;  2HYE A;  3W15 A;  1YFQ A;  4OZU A;  5SXM A;  3DSM A;  2G9A A;  2B5L A;  4A0A B;  5B4W A;  1R5M A;  3JZH A;  3KRX B;  3JRP A;  3OW8 A;  3RFH A;  4NSX A;  3EI4 A;  3I7P A;  1P22 A;  2H3X A;  5TDH B;  4MK0 B;  4FA9 D;  3UVM A;  2YNO A;  3K26 A;  2P9S C;  4R7A B;  4FA1 D;  5C9Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...