4GM8A

Crystal structure of human wd repeat domain 5 with compound mm-102
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
304
structure length
302
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
publication title High-affinity, small-molecule peptidomimetic inhibitors of MLL1/WDR5 protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 302
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm8A00
1PI6A 1JMZB 3MKQA 3JB9L 4ES0A 5CXCA 3OTTA 4A0BB 4O9DA 3OL2B 5EMKB 2UZYB 2B5MA 3RN0D 2PM7B 4G56B 2CE9A 2H3XA 2TRCB 3SBRA 2J57G 1N6DA 3N0DA 5HQGA 5GXHA 4GGDA 3ULEC 4GMBA 2OVRB 3W15A 5GMKn 4O3TB 5EARA 3DSMA 5IC7A 2I0SA 4I79A 5CYKB 2XL3A 2H13A 3K26A 4J87A 4FAVD 4H5IA 2BCJB 4X63B 3AFCA 3NVNA 4CZVA 3EI1A 2AQ5A 4Y5RD 3DXKC 4JD2C 5FKSA 3EI3A 4PBZA 3CIKB 3RMZD 3RRMC 2H14A 3V9FA 4XYIA 1Q47A 2H6QA 3SBPA 2BBKH 2OK6A 3J81g 4CY3A 3CFSB 3UVKA 2GNQA 1U2VC 3IJ1A 3JZGA 4MK0B 2OVQB 3PE7A 2Z2NA 1JMXB 4QL1A 4ZOXA 4EWRA 4TZ4A 2YNOA 1PBYB 3JAMg 3UVLA 2XYIA 4KFMB 3EMHA 4A0AA 3EWEA 3I7HA 2HJ4A 2CO0C 4Y7RA 2UZXB 4J84A 2I0TA 3RFGA 2CN3A 4J0XA 4A2MA 3VA6A 3EI2A 5B4WA 5H17A 4CZXA 4FB1D 5AFU3 3PSCB 3EI1B 4ERYA 4JXMA 3F3GA 2IAAA 2B5LA 3AL8A 3EI3B 1P22A 3UKUC 4K3JB 5K1CC 4X3EA 5FKRA 2G9AA 4L1QD 4YVDA 2OK4A 1SQJA 2OJYA 2H9LA 5IGOA 3VGZA 3JPXA 2I3TA 2O9KA 2W18A 3GFCA 1GG2B 4ERZA 2YBAA 5A2Qg 3IIWA 3SVWD 5EAMA 2H68A 4X60B 2GC7A 4ZOVA 3PXTD 3EI4A 4A0AB 3NVXA 4JSPC 3OKYA 3PVUB 4CI2A 3L4MD 1TYQC 1N6EA 4Z8LA 1R5MA 4JT6C 3JZHA 3EI2B 4CC9A 2HXCA 3DXMC 5FKTA 5EMJB 5H14A 3IJ0A 3I7PA 1XHMA 4H5JA 4LG9A 2J55H 4J73A 5C9ZB 4L3HD 3AL8B 3SN6B 5TF2A 3EU7A 4J86A 3C75H 1B9YA 1GOTB 1GXRA 5IJ8E 4U7AA 2P9UC 4JSNC 4QT8A 4A7JA 4XYHA 4D0KA 3I7OA 4X61B 5AMSA 1JJUB 3F3FA 3MXXA 3L4OD 4GQBB 4PXWA 2PBIB 1JOFA 4GM3A 4PC0A 3BG1A 2OIZA 2AGXA 3PSLA 2Q7QA 3PXWD 3JZNA 3RLMD 3SMRA 3EI4B 4PNKB 4J0WA 3NVQA 3OKYB 5GSAA 4J8GA 1L0QA 2AGYA 4L3GD 2HYEA 2H6KA 5CXCB 4A11A 5FXYA 5I5JA 2H9MA 1K32A 3MZLA 2QC5A 2YNNA 1FWXA 2IUPA 3OKTA 3RSEC 3PVWB 4K3ID 1SQ9A 1XKSA 3AL9A 3UKRC 2AGZA 3FRXA 4O3UB 4L9OA 4GM9A 3K27A 4BUJC 4AEZA 3SLED 5GXIA 3ZWLB 3DWLC 4QRJA 1SHYB 3JRPA 4J79A 2OVPB 5C2VB 2YNPA 4ZOZA 3FM0A 3I8EA 5FKQA 1N6FA 2EBSA 4CZYA 3UVMA 4A2LA 3J80g 3KRWB 4J81A 3AH8B 3MKSB 4R7AB 2Z2PA 4CI1A 2P9NC 5EMMB 4QQEA 2HKMA 2H47A 4A11B 4CY1A 5TEEA 4JT5C 1U4CA 2P9PC 5JWZA 3C5MA 2HESX 3HFQA 4A08A 3V7DB 2CE8A 2IWFA 5TDHB 2B5NA 3ORVD 4FA9D 5AJAA 5CXBA 1MDAH 4PSWB 1XIPA 5KDOB 5HE0B 1S4UX 5EM2A 4A09A 3GREA 4J78A 2J56H 1QNIA 3IKOA 4NSXA 2CNXA 5EAPA 1MG2A 5TEFA 3I7KA 2XL2A 2P9LC 4D6VA 3ODTA 2I0RA 5EMLB 4FAND 1YFQA 2P9KC 1PGUA 5FLXg 4FWWA 5EALA 3I8CA 3UVNA 3I7LA 2P9SC 4FHLA 4ESGA 4ZOYA 3F3PA 3E0CA 3I7NA 4O45A 4J8BA 2GC4A 5IJ7E 1OMWB 3I2NA 1B9XA 4E5ZA 3OW8A 4ERQA 2AH0A 3OKWA 4E54A 3IJCA 3SFZA 3CFVA 5H1MA 4A08B 5FQDA 4GQ2P 5FA5B 5CXBB 2P9IC 4J82A 4IA9A 2H9NA 2AGWA 3DM0A 4IMMA 4A09B 5EM2B 5IGQA 4O1QD 4GGCA 3SBQA 2YB8B 4U1EI 4LG8A 2PM9A 2IWKA 4JSVC 4BL0A 4FA4D 5IT9g 3MMYA 1K8KC 2H9PA 2HKRA 4CY5A 3SJLD 1MG3A 2IUVA 4GZ8A 4OWRA 2QXVA 4PSXB 3EG6A 5HYNB 3I89A 1GP2B 3MZKA 2IURA 4AOWA 3A0FA 2H6NA 3RFHA 2AH1A 4GM8A 3PXSD 3BG0A 3P4FA 2CN2A 3BWSA 4UI9R 1ERJA 4GQ1A 5K19A 5THAA 4E5ZB 2I3SA 2XU7A 1OLZA 2MTAH 3B7FA 2HJBA 2YMUA 3V5WB 4FA5D 2B4EA 4E54B 1TBGA 3SHFA 4CI3A 4LGNA 1NR0A 5HE2B 5HE3B 3C9CA 3N0EA 4CY2A 2PM6B 3U4YA 1RI6A 3IIYA 3KRXB 4A0BA 5HE1B 4PBYA 4XEIC 3RN1D 3OL2A 3C99A 2IUQA 4FA1D 4GGAA 4CI8A 4HDJA 1VYHC 4OZUA 1A0RB 2PM9B 3SCYA 5I5IA 3SXTD 1PEVA 3SWSD 3UVOA 5C2WB 3JROA 4BH6A 3FGBA 5CYKA 2Z2OA 3UR4A 4N14A 1NEXB 4JSXC 4J77A 2G99A 5I5MA 2AGLA 4ZN4A 2CO0A 5SXMA 3VH0A
chains in the Genus database with same CATH superfamily
1PI6A 3K71A 5HDBA 1VE7A 1JMZB 3MKQA 4O02A 3JB9L 4ES0A 5CXCA 3OTTA 4RE6A 4A0BB 4DNUA 4G55A 4O9DA 3NIGA 2BKLA 3OL2B 4MMZA 5EMKB 4NBMA 1E8MA 2UZYB 2B5MA 3RN0D 2PM7B 4D9SA 4G56B 2CE9A 3ZDXA 2H3XA 2TRCB 3SBRA 4WJKA 3NIDA 2J57G 1N6DA 3N0DA 5HQGA 5GXHA 4GGDA 3ULEC 4GMBA 2OVRB 3W15A 5GMKn 4O3TB 5EARA 2EIDA 3DSMA 5IC7A 2I0SA 4I79A 5CYKB 2XL3A 2H13A 3K26A 4AN0A 4J87A 2EIBA 4FAVD 4H5IA 1H2ZA 5M5UA 4JHNA 2BCJB 4X63B 3AFCA 3NVNA 4CZVA 3EI1A 2AQ5A 2HU5A 3IUNA 4Y5RD 3DXKC 4JD2C 2EIEA 5FKSA 3EI3A 4PBZA 3CIKB 3RMZD 3RRMC 2H14A 3V9FA 4XYIA 1Q47A 2H6QA 3SBPA 1GOHA 2BBKH 2OK6A 2HU8A 3EQ8A 3J81g 3K6SA 4AMYA 4CY3A 3CFSB 3UVKA 3T3MA 2GNQA 1U2VC 3IJ1A 3JZGA 4MK0B 2XDWA 2OVQB 1E8NA 3PE7A 2Z2NA 1JMXB 4QL1A 1GOGA 4ZOXA 3O4GA 4EWRA 4TZ4A 2YNOA 1PBYB 3JAMg 3UVLA 2XYIA 4G1MA 4KFMB 3EMHA 4WK4A 3MUOA 3EWEA 4A0AA 2VDOA 3I7HA 2HJ4A 4BCBA 2CO0C 4Y7RA 2UZXB 4J84A 2I0TA 3RFGA 1UTCA 1L5GA 3ZE0A 2CN3A 4J0XA 4A2MA 3VA6A 5M5VA 3EI2A 5B4WA 5H17A 4CZXA 4FB1D 5AFU3 3PSCB 3EI1B 4ERYA 4JXMA 3DDUA 1GOFA 3F3GA 2IAAA 2B5LA 3AL8A 3EI3B 3IULA 1P22A 3UKUC 4K3JB 3QHYB 5K1CC 1VZ2A 4X3EA 5FKRA 4WK0A 2G9AA 4L1QD 1JTDB 4YVDA 2OK4A 1SQJA 2OJYA 2H9LA 5FFGA 5IGOA 3VGZA 3JPXA 2I3TA 3FCSA 1YR2A 2O9KA 1O6GA 2W18A 3GFCA 1GG2B 2VDLA 4ERZA 2YBAA 1TYEA 5A2Qg 3IIWA 3SVWD 5EAMA 2H68A 2WQ8A 4X60B 2GC7A 4ZOVA 3PXTD 3EI4A 4A0AB 4BCDA 1H2XA 3NVXA 4JSPC 3OKYA 3PVUB 4CI2A 3L4MD 1TYQC 1N6EA 4Z8LA 4RE5A 3OF7A 1R5MA 4JT6C 3JZHA 3EI2B 1UOQA 3IUMA 4WK2A 2HXCA 3DXMC 5FKTA 4CC9A 5EMJB 5H14A 3IJ0A 3I7PA 1XHMA 4H5JA 4LG9A 2J55H 4J73A 4UM9A 5C9ZB 4L3HD 1M1XA 3AL8B 3SN6B 5TF2A 3EU7A 4J86A 3C75H 1B9YA 1GOTB 1GXRA 5IJ8E 4U7AA 2P9UC 4JSNC 4QT8A 4A7JA 4XYHA 4D0KA 4DNVA 4BP8A 3I7OA 4X61B 2VZ1A 5AMSA 1VZ3A 1JJUB 3F3FA 3MXXA 3L4OD 4GQBB 4PXWA 4UM8A 2PBIB 1JOFA 4GM3A 4PC0A 3BG1A 2OIZA 2AGXA 3PSLA 2Q7QA 3PXWD 2VZ3A 3VI3A 3JZNA 3RLMD 3SMRA 3EI4B 3ZDZA 1C9IA 4PNKB 4J0WA 3NVQA 3OKYB 5GSAA 4J8GA 1L0QA 2AGYA 4L3GD 4O2WA 2H6KA 5CXCB 4A11A 2HYEA 5FXYA 5I5JA 2H9MA 1K32A 3MZLA 2QC5A 4JHPC 2YNNA 1FWXA 2IUPA 2EICA 3OKTA 3RSEC 3PVWB 4K3ID 1SQ9A 1XKSA 2XZGA 5C86A 3AL9A 3UKRC 2AGZA 3FRXA 4O3UB 3ZE1A 4G1EA 4L9OA 2VDMA 4GM9A 4NC4A 3K27A 4BUJC 4AEZA 3SLED 5GXIA 3ZWLB 3DWLC 3K72A 4QRJA 1SHYB 3JRPA 4J79A 4Z7QA 2OVPB 5C2VB 3T3PA 2YNPA 4ZOZA 3FM0A 3I8EA 5FKQA 2VDQA 1N6FA 2EBSA 4CZYA 3UVMA 1VE6A 4A2LA 3J80g 3KRWB 3FCUA 4J81A 3AH8B 3ZE2A 3MKSB 4R7AB 3EQ9A 2VDPA 2Z2PA 4Z7OA 4IRZA 5E6UA 4CI1A 2P9NC 5EMMB 4QQEA 2HKMA 2H47A 4A11B 4CY1A 5TEEA 1A12A 5M5RA 4JT5C 1U4CA 2P9PC 5JWZA 3C5MA 2VC2A 2HESX 3V4VA 3HFQA 4A08A 3V7DB 2CE8A 2IWFA 5TDHB 2B5NA 3ORVD 4FA9D 3GD1I 5AJAA 5CXBA 1MDAH 4PSWB 1XIPA 5KDOB 5C92A 5HE0B 1S4UX 5EM2A 4A09A 3GREA 4MMXA 4J78A 2J56H 1QNIA 3IKOA 2JKXA 4NSXA 2VDNA 2CNXA 5EAPA 5FFOA 2QR5A 1MG2A 5TEFA 3O4IA 3I7KA 1C9LA 2XL2A 2P9LC 1JV2A 4D6VA 3ODTA 2I0RA 5EMLB 4FAND 1YFQA 2P9KC 3IVMA 1PGUA 5FLXg 4FWWA 5EALA 3I8CA 3UVNA 3I7LA 2P9SC 3NIFA 4FHLA 4ESGA 1UOOA 4ZOYA 3F3PA 3MUNA 1QFSA 3E0CA 3I7NA 4O45A 1O6FA 4J8BA 2GC4A 2VDKA 5IJ7E 3MVDK 1OMWB 4BCCA 3I2NA 5M5TA 1B9XA 4E5ZA 3OW8A 4ERQA 2AH0A 1T2XA 2XE4A 3OKWA 1K3IA 4AX4A 5M5SA 5M61A 4E54A 3IJCA 3SFZA 3CFVA 5H1MA 4A08B 5FQDA 4GQ2P 5FA5B 4DNWA 5CXBB 3IUQA 2P9IC 4J82A 4IA9A 2H9NA 3IJEA 2AGWA 3DM0A 4IMMA 4A09B 5EM2B 5IGQA 3QI0A 4GGCA 4O1QD 3SBQA 2YB8B 4U1EI 4LG8A 2PM9A 4QAMA 2IWKA 4JSVC 4BL0A 4FA4D 5IT9g 3MMYA 1K8KC 2H9PA 2HKRA 4CY5A 2QZPA 3SJLD 1MG3A 2IUVA 4GZ8A 4OWRA 2QXVA 4PSXB 3EG6A 3ZDYA 5HYNB 3I89A 1GP2B 3MZKA 2IURA 4AOWA 4L1MA 3A0FA 2H6NA 3RFHA 1BPOA 2AH1A 3VI4A 4GM8A 5E6RA 3PXSD 1E5TA 4BP9A 3KCIA 3BG0A 3IURA 3P4FA 2CN2A 3BWSA 4UI9R 5E6SA 1ERJA 4GQ1A 5K19A 5THAA 4E5ZB 1QFMA 2I3SA 2XU7A 3IUJA 4MMYA 1OLZA 2MTAH 3B7FA 2HJBA 2YMUA 3V5WB 4FA5D 2B4EA 4E54B 1TBGA 3SHFA 3GC3B 4CI3A 4LGNA 1NR0A 5HE2B 5HE3B 3C9CA 3N0EA 3O4HA 4CY2A 2PM6B 3U4YA 1RI6A 3IIYA 3KRXB 4A0BA 1H2WA 5HE1B 4PBYA 4XEIC 3RN1D 3OL2A 3C99A 2VDRA 2IUQA 4FA1D 4GGAA 4CI8A 4HDJA 1VYHC 4OZUA 1U8CA 1A0RB 2PM9B 3SCYA 5I5IA 3SXTD 1PEVA 3SWSD 3EQ7A 1H2YA 4NAAA 3UVOA 3V4PA 1I2MB 3O4JA 5C2WB 3JROA 4NENA 4BH6A 3FGBA 5CYKA 2Z2OA 3UR4A 4N14A 4AN1A 4Z7NA 1NEXB 1UOPA 4JSXC 2HU7A 4J77A 2G99A 5I5MA 2AGLA 4AMZA 4ZN4A 2CO0A 5SXMA 3VH0A
chains in the Genus database with same CATH topology
1PI6A 1JMZB 3MKQA 3JB9L 4ES0A 5CXCA 3OTTA 4A0BB 4O9DA 3OL2B 5EMKB 2UZYB 2B5MA 3RN0D 2PM7B 4G56B 2CE9A 2H3XA 2TRCB 3SBRA 2J57G 1N6DA 3N0DA 5HQGA 5GXHA 4GGDA 3ULEC 4GMBA 2OVRB 3W15A 5GMKn 4O3TB 5EARA 3DSMA 5IC7A 2I0SA 4I79A 5CYKB 2XL3A 2H13A 3K26A 4J87A 4FAVD 4H5IA 2BCJB 4X63B 3AFCA 3NVNA 4CZVA 3EI1A 2AQ5A 4Y5RD 3DXKC 4JD2C 5FKSA 3EI3A 4PBZA 3CIKB 3RMZD 3RRMC 2H14A 3V9FA 4XYIA 1Q47A 2H6QA 3SBPA 2BBKH 2OK6A 3J81g 4CY3A 3CFSB 3UVKA 2GNQA 1U2VC 3IJ1A 3JZGA 4MK0B 2OVQB 3PE7A 2Z2NA 1JMXB 4QL1A 4ZOXA 4EWRA 4TZ4A 2YNOA 1PBYB 3JAMg 3UVLA 2XYIA 4KFMB 3EMHA 4A0AA 3EWEA 3I7HA 2HJ4A 2CO0C 4Y7RA 2UZXB 4J84A 2I0TA 3RFGA 2CN3A 4J0XA 4A2MA 3VA6A 3EI2A 5B4WA 5H17A 4CZXA 4FB1D 5AFU3 3PSCB 3EI1B 4ERYA 4JXMA 3F3GA 2IAAA 2B5LA 3AL8A 3EI3B 1P22A 3UKUC 4K3JB 5K1CC 4X3EA 5FKRA 2G9AA 4L1QD 4YVDA 2OK4A 1SQJA 2OJYA 2H9LA 5IGOA 3VGZA 3JPXA 2I3TA 2O9KA 2W18A 3GFCA 1GG2B 4ERZA 2YBAA 5A2Qg 3IIWA 3SVWD 5EAMA 2H68A 4X60B 2GC7A 4ZOVA 3PXTD 3EI4A 4A0AB 3NVXA 4JSPC 3OKYA 3PVUB 4CI2A 3L4MD 1TYQC 1N6EA 4Z8LA 1R5MA 4JT6C 3JZHA 3EI2B 4CC9A 2HXCA 3DXMC 5FKTA 5EMJB 5H14A 3IJ0A 3I7PA 1XHMA 4H5JA 4LG9A 2J55H 4J73A 5C9ZB 4L3HD 3AL8B 3SN6B 5TF2A 3EU7A 4J86A 3C75H 1B9YA 1GOTB 1GXRA 5IJ8E 4U7AA 2P9UC 4JSNC 4QT8A 4A7JA 4XYHA 4D0KA 3I7OA 4X61B 5AMSA 1JJUB 3F3FA 3MXXA 3L4OD 4GQBB 4PXWA 2PBIB 1JOFA 4GM3A 4PC0A 3BG1A 2OIZA 2AGXA 3PSLA 2Q7QA 3PXWD 3JZNA 3RLMD 3SMRA 3EI4B 4PNKB 4J0WA 3NVQA 3OKYB 5GSAA 4J8GA 1L0QA 2AGYA 4L3GD 2HYEA 2H6KA 5CXCB 4A11A 5FXYA 5I5JA 2H9MA 1K32A 3MZLA 2QC5A 2YNNA 1FWXA 2IUPA 3OKTA 3RSEC 3PVWB 4K3ID 1SQ9A 1XKSA 3AL9A 3UKRC 2AGZA 3FRXA 4O3UB 4L9OA 4GM9A 3K27A 4BUJC 4AEZA 3SLED 5GXIA 3ZWLB 3DWLC 4QRJA 1SHYB 3JRPA 4J79A 2OVPB 5C2VB 2YNPA 4ZOZA 3FM0A 3I8EA 5FKQA 1N6FA 2EBSA 4CZYA 3UVMA 4A2LA 3J80g 3KRWB 4J81A 3AH8B 3MKSB 4R7AB 2Z2PA 4CI1A 2P9NC 5EMMB 4QQEA 2HKMA 2H47A 4A11B 4CY1A 5TEEA 4JT5C 1U4CA 2P9PC 5JWZA 3C5MA 2HESX 3HFQA 4A08A 3V7DB 2CE8A 2IWFA 5TDHB 2B5NA 3ORVD 4FA9D 5AJAA 5CXBA 1MDAH 4PSWB 1XIPA 5KDOB 5HE0B 1S4UX 5EM2A 4A09A 3GREA 4J78A 2J56H 1QNIA 3IKOA 4NSXA 2CNXA 5EAPA 1MG2A 5TEFA 3I7KA 2XL2A 2P9LC 4D6VA 3ODTA 2I0RA 5EMLB 4FAND 1YFQA 2P9KC 1PGUA 5FLXg 4FWWA 5EALA 3I8CA 3UVNA 3I7LA 2P9SC 4FHLA 4ESGA 4ZOYA 3F3PA 3E0CA 3I7NA 4O45A 4J8BA 2GC4A 5IJ7E 1OMWB 3I2NA 1B9XA 4E5ZA 3OW8A 4ERQA 2AH0A 3OKWA 4E54A 3IJCA 3SFZA 3CFVA 5H1MA 4A08B 5FQDA 4GQ2P 5FA5B 5CXBB 2P9IC 4J82A 4IA9A 2H9NA 2AGWA 3DM0A 4IMMA 4A09B 5EM2B 5IGQA 4O1QD 4GGCA 3SBQA 2YB8B 4U1EI 4LG8A 2PM9A 2IWKA 4JSVC 4BL0A 4FA4D 5IT9g 3MMYA 1K8KC 2H9PA 2HKRA 4CY5A 3SJLD 1MG3A 2IUVA 4GZ8A 4OWRA 2QXVA 4PSXB 3EG6A 5HYNB 3I89A 1GP2B 3MZKA 2IURA 4AOWA 3A0FA 2H6NA 3RFHA 2AH1A 4GM8A 3PXSD 3BG0A 3P4FA 2CN2A 3BWSA 4UI9R 1ERJA 4GQ1A 5K19A 5THAA 4E5ZB 2I3SA 2XU7A 1OLZA 2MTAH 3B7FA 2HJBA 2YMUA 3V5WB 4FA5D 2B4EA 4E54B 1TBGA 3SHFA 4CI3A 4LGNA 1NR0A 5HE2B 5HE3B 3C9CA 3N0EA 4CY2A 2PM6B 3U4YA 1RI6A 3IIYA 3KRXB 4A0BA 5HE1B 4PBYA 4XEIC 3RN1D 3OL2A 3C99A 2IUQA 4FA1D 4GGAA 4CI8A 4HDJA 1VYHC 4OZUA 1A0RB 2PM9B 3SCYA 5I5IA 3SXTD 1PEVA 3SWSD 3UVOA 5C2WB 3JROA 4BH6A 3FGBA 5CYKA 2Z2OA 3UR4A 4N14A 1NEXB 4JSXC 4J77A 2G99A 5I5MA 2AGLA 4ZN4A 2CO0A 5SXMA 3VH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI6 A;  1JMZ B;  3MKQ A;  3JB9 L;  4ES0 A;  5CXC A;  3OTT A;  4A0B B;  4O9D A;  3OL2 B;  5EMK B;  2UZY B;  2B5M A;  3RN0 D;  2PM7 B;  4G56 B;  2CE9 A;  2H3X A;  2TRC B;  3SBR A;  2J57 G;  1N6D A;  3N0D A;  5HQG A;  5GXH A;  4GGD A;  3ULE C;  4GMB A;  2OVR B;  3W15 A;  5GMK n;  4O3T B;  5EAR A;  3DSM A;  5IC7 A;  2I0S A;  4I79 A;  5CYK B;  2XL3 A;  2H13 A;  3K26 A;  4J87 A;  4FAV D;  4H5I A;  2BCJ B;  4X63 B;  3AFC A;  3NVN A;  4CZV A;  3EI1 A;  2AQ5 A;  4Y5R D;  3DXK C;  4JD2 C;  5FKS A;  3EI3 A;  4PBZ A;  3CIK B;  3RMZ D;  3RRM C;  2H14 A;  3V9F A;  4XYI A;  1Q47 A;  2H6Q A;  3SBP A;  2BBK H;  2OK6 A;  3J81 g;  4CY3 A;  3CFS B;  3UVK A;  2GNQ A;  1U2V C;  3IJ1 A;  3JZG A;  4MK0 B;  2OVQ B;  3PE7 A;  2Z2N A;  1JMX B;  4QL1 A;  4ZOX A;  4EWR A;  4TZ4 A;  2YNO A;  1PBY B;  3JAM g;  3UVL A;  2XYI A;  4KFM B;  3EMH A;  4A0A A;  3EWE A;  3I7H A;  2HJ4 A;  2CO0 C;  4Y7R A;  2UZX B;  4J84 A;  2I0T A;  3RFG A;  2CN3 A;  4J0X A;  4A2M A;  3VA6 A;  3EI2 A;  5B4W A;  5H17 A;  4CZX A;  4FB1 D;  5AFU 3;  3PSC B;  3EI1 B;  4ERY A;  4JXM A;  3F3G A;  2IAA A;  2B5L A;  3AL8 A;  3EI3 B;  1P22 A;  3UKU C;  4K3J B;  5K1C C;  4X3E A;  5FKR A;  2G9A A;  4L1Q D;  4YVD A;  2OK4 A;  1SQJ A;  2OJY A;  2H9L A;  5IGO A;  3VGZ A;  3JPX A;  2I3T A;  2O9K A;  2W18 A;  3GFC A;  1GG2 B;  4ERZ A;  2YBA A;  5A2Q g;  3IIW A;  3SVW D;  5EAM A;  2H68 A;  4X60 B;  2GC7 A;  4ZOV A;  3PXT D;  3EI4 A;  4A0A B;  3NVX A;  4JSP C;  3OKY A;  3PVU B;  4CI2 A;  3L4M D;  1TYQ C;  1N6E A;  4Z8L A;  1R5M A;  4JT6 C;  3JZH A;  3EI2 B;  4CC9 A;  2HXC A;  3DXM C;  5FKT A;  5EMJ B;  5H14 A;  3IJ0 A;  3I7P A;  1XHM A;  4H5J A;  4LG9 A;  2J55 H;  4J73 A;  5C9Z B;  4L3H D;  3AL8 B;  3SN6 B;  5TF2 A;  3EU7 A;  4J86 A;  3C75 H;  1B9Y A;  1GOT B;  1GXR A;  5IJ8 E;  4U7A A;  2P9U C;  4JSN C;  4QT8 A;  4A7J A;  4XYH A;  4D0K A;  3I7O A;  4X61 B;  5AMS A;  1JJU B;  3F3F A;  3MXX A;  3L4O D;  4GQB B;  4PXW A;  2PBI B;  1JOF A;  4GM3 A;  4PC0 A;  3BG1 A;  2OIZ A;  2AGX A;  3PSL A;  2Q7Q A;  3PXW D;  3JZN A;  3RLM D;  3SMR A;  3EI4 B;  4PNK B;  4J0W A;  3NVQ A;  3OKY B;  5GSA A;  4J8G A;  1L0Q A;  2AGY A;  4L3G D;  2HYE A;  2H6K A;  5CXC B;  4A11 A;  5FXY A;  5I5J A;  2H9M A;  1K32 A;  3MZL A;  2QC5 A;  2YNN A;  1FWX A;  2IUP A;  3OKT A;  3RSE C;  3PVW B;  4K3I D;  1SQ9 A;  1XKS A;  3AL9 A;  3UKR C;  2AGZ A;  3FRX A;  4O3U B;  4L9O A;  4GM9 A;  3K27 A;  4BUJ C;  4AEZ A;  3SLE D;  5GXI A;  3ZWL B;  3DWL C;  4QRJ A;  1SHY B;  3JRP A;  4J79 A;  2OVP B;  5C2V B;  2YNP A;  4ZOZ A;  3FM0 A;  3I8E A;  5FKQ A;  1N6F A;  2EBS A;  4CZY A;  3UVM A;  4A2L A;  3J80 g;  3KRW B;  4J81 A;  3AH8 B;  3MKS B;  4R7A B;  2Z2P A;  4CI1 A;  2P9N C;  5EMM B;  4QQE A;  2HKM A;  2H47 A;  4A11 B;  4CY1 A;  5TEE A;  4JT5 C;  1U4C A;  2P9P C;  5JWZ A;  3C5M A;  2HES X;  3HFQ A;  4A08 A;  3V7D B;  2CE8 A;  2IWF A;  5TDH B;  2B5N A;  3ORV D;  4FA9 D;  5AJA A;  5CXB A;  1MDA H;  4PSW B;  1XIP A;  5KDO B;  5HE0 B;  1S4U X;  5EM2 A;  4A09 A;  3GRE A;  4J78 A;  2J56 H;  1QNI A;  3IKO A;  4NSX A;  2CNX A;  5EAP A;  1MG2 A;  5TEF A;  3I7K A;  2XL2 A;  2P9L C;  4D6V A;  3ODT A;  2I0R A;  5EML B;  4FAN D;  1YFQ A;  2P9K C;  1PGU A;  5FLX g;  4FWW A;  5EAL A;  3I8C A;  3UVN A;  3I7L A;  2P9S C;  4FHL A;  4ESG A;  4ZOY A;  3F3P A;  3E0C A;  3I7N A;  4O45 A;  4J8B A;  2GC4 A;  5IJ7 E;  1OMW B;  3I2N A;  1B9X A;  4E5Z A;  3OW8 A;  4ERQ A;  2AH0 A;  3OKW A;  4E54 A;  3IJC A;  3SFZ A;  3CFV A;  5H1M A;  4A08 B;  5FQD A;  4GQ2 P;  5FA5 B;  5CXB B;  2P9I C;  4J82 A;  4IA9 A;  2H9N A;  2AGW A;  3DM0 A;  4IMM A;  4A09 B;  5EM2 B;  5IGQ A;  4O1Q D;  4GGC A;  3SBQ A;  2YB8 B;  4U1E I;  4LG8 A;  2PM9 A;  2IWK A;  4JSV C;  4BL0 A;  4FA4 D;  5IT9 g;  3MMY A;  1K8K C;  2H9P A;  2HKR A;  4CY5 A;  3SJL D;  1MG3 A;  2IUV A;  4GZ8 A;  4OWR A;  2QXV A;  4PSX B;  3EG6 A;  5HYN B;  3I89 A;  1GP2 B;  3MZK A;  2IUR A;  4AOW A;  3A0F A;  2H6N A;  3RFH A;  2AH1 A;  4GM8 A;  3PXS D;  3BG0 A;  3P4F A;  2CN2 A;  3BWS A;  4UI9 R;  1ERJ A;  4GQ1 A;  5K19 A;  5THA A;  4E5Z B;  2I3S A;  2XU7 A;  1OLZ A;  2MTA H;  3B7F A;  2HJB A;  2YMU A;  3V5W B;  4FA5 D;  2B4E A;  4E54 B;  1TBG A;  3SHF A;  4CI3 A;  4LGN A;  1NR0 A;  5HE2 B;  5HE3 B;  3C9C A;  3N0E A;  4CY2 A;  2PM6 B;  3U4Y A;  1RI6 A;  3IIY A;  3KRX B;  4A0B A;  5HE1 B;  4PBY A;  4XEI C;  3RN1 D;  3OL2 A;  3C99 A;  2IUQ A;  4FA1 D;  4GGA A;  4CI8 A;  4HDJ A;  1VYH C;  4OZU A;  1A0R B;  2PM9 B;  3SCY A;  5I5I A;  3SXT D;  1PEV A;  3SWS D;  3UVO A;  5C2W B;  3JRO A;  4BH6 A;  3FGB A;  5CYK A;  2Z2O A;  3UR4 A;  4N14 A;  1NEX B;  4JSX C;  4J77 A;  2G99 A;  5I5M A;  2AGL A;  4ZN4 A;  2CO0 A;  5SXM A;  3VH0 A; 
#chains in the Genus database with same CATH topology
 1PI6 A;  3K71 A;  5HDB A;  1VE7 A;  1JMZ B;  3MKQ A;  4O02 A;  3JB9 L;  4ES0 A;  5CXC A;  3OTT A;  4RE6 A;  4A0B B;  4DNU A;  4G55 A;  4O9D A;  3NIG A;  2BKL A;  3OL2 B;  4MMZ A;  5EMK B;  4NBM A;  1E8M A;  2UZY B;  2B5M A;  3RN0 D;  2PM7 B;  4D9S A;  4G56 B;  2CE9 A;  3ZDX A;  2H3X A;  2TRC B;  3SBR A;  4WJK A;  3NID A;  2J57 G;  1N6D A;  3N0D A;  5HQG A;  5GXH A;  4GGD A;  3ULE C;  4GMB A;  2OVR B;  3W15 A;  5GMK n;  4O3T B;  5EAR A;  2EID A;  3DSM A;  5IC7 A;  2I0S A;  4I79 A;  5CYK B;  2XL3 A;  2H13 A;  3K26 A;  4AN0 A;  4J87 A;  2EIB A;  4FAV D;  4H5I A;  1H2Z A;  5M5U A;  4JHN A;  2BCJ B;  4X63 B;  3AFC A;  3NVN A;  4CZV A;  3EI1 A;  2AQ5 A;  2HU5 A;  3IUN A;  4Y5R D;  3DXK C;  4JD2 C;  2EIE A;  5FKS A;  3EI3 A;  4PBZ A;  3CIK B;  3RMZ D;  3RRM C;  2H14 A;  3V9F A;  4XYI A;  1Q47 A;  2H6Q A;  3SBP A;  1GOH A;  2BBK H;  2OK6 A;  2HU8 A;  3EQ8 A;  3J81 g;  3K6S A;  4AMY A;  4CY3 A;  3CFS B;  3UVK A;  3T3M A;  2GNQ A;  1U2V C;  3IJ1 A;  3JZG A;  4MK0 B;  2XDW A;  2OVQ B;  1E8N A;  3PE7 A;  2Z2N A;  1JMX B;  4QL1 A;  1GOG A;  4ZOX A;  3O4G A;  4EWR A;  4TZ4 A;  2YNO A;  1PBY B;  3JAM g;  3UVL A;  2XYI A;  4G1M A;  4KFM B;  3EMH A;  4WK4 A;  3MUO A;  3EWE A;  4A0A A;  2VDO A;  3I7H A;  2HJ4 A;  4BCB A;  2CO0 C;  4Y7R A;  2UZX B;  4J84 A;  2I0T A;  3RFG A;  1UTC A;  1L5G A;  3ZE0 A;  2CN3 A;  4J0X A;  4A2M A;  3VA6 A;  5M5V A;  3EI2 A;  5B4W A;  5H17 A;  4CZX A;  4FB1 D;  5AFU 3;  3PSC B;  3EI1 B;  4ERY A;  4JXM A;  3DDU A;  1GOF A;  3F3G A;  2IAA A;  2B5L A;  3AL8 A;  3EI3 B;  3IUL A;  1P22 A;  3UKU C;  4K3J B;  3QHY B;  5K1C C;  1VZ2 A;  4X3E A;  5FKR A;  4WK0 A;  2G9A A;  4L1Q D;  1JTD B;  4YVD A;  2OK4 A;  1SQJ A;  2OJY A;  2H9L A;  5FFG A;  5IGO A;  3VGZ A;  3JPX A;  2I3T A;  3FCS A;  1YR2 A;  2O9K A;  1O6G A;  2W18 A;  3GFC A;  1GG2 B;  2VDL A;  4ERZ A;  2YBA A;  1TYE A;  5A2Q g;  3IIW A;  3SVW D;  5EAM A;  2H68 A;  2WQ8 A;  4X60 B;  2GC7 A;  4ZOV A;  3PXT D;  3EI4 A;  4A0A B;  4BCD A;  1H2X A;  3NVX A;  4JSP C;  3OKY A;  3PVU B;  4CI2 A;  3L4M D;  1TYQ C;  1N6E A;  4Z8L A;  4RE5 A;  3OF7 A;  1R5M A;  4JT6 C;  3JZH A;  3EI2 B;  1UOQ A;  3IUM A;  4WK2 A;  2HXC A;  3DXM C;  5FKT A;  4CC9 A;  5EMJ B;  5H14 A;  3IJ0 A;  3I7P A;  1XHM A;  4H5J A;  4LG9 A;  2J55 H;  4J73 A;  4UM9 A;  5C9Z B;  4L3H D;  1M1X A;  3AL8 B;  3SN6 B;  5TF2 A;  3EU7 A;  4J86 A;  3C75 H;  1B9Y A;  1GOT B;  1GXR A;  5IJ8 E;  4U7A A;  2P9U C;  4JSN C;  4QT8 A;  4A7J A;  4XYH A;  4D0K A;  4DNV A;  4BP8 A;  3I7O A;  4X61 B;  2VZ1 A;  5AMS A;  1VZ3 A;  1JJU B;  3F3F A;  3MXX A;  3L4O D;  4GQB B;  4PXW A;  4UM8 A;  2PBI B;  1JOF A;  4GM3 A;  4PC0 A;  3BG1 A;  2OIZ A;  2AGX A;  3PSL A;  2Q7Q A;  3PXW D;  2VZ3 A;  3VI3 A;  3JZN A;  3RLM D;  3SMR A;  3EI4 B;  3ZDZ A;  1C9I A;  4PNK B;  4J0W A;  3NVQ A;  3OKY B;  5GSA A;  4J8G A;  1L0Q A;  2AGY A;  4L3G D;  4O2W A;  2H6K A;  5CXC B;  4A11 A;  2HYE A;  5FXY A;  5I5J A;  2H9M A;  1K32 A;  3MZL A;  2QC5 A;  4JHP C;  2YNN A;  1FWX A;  2IUP A;  2EIC A;  3OKT A;  3RSE C;  3PVW B;  4K3I D;  1SQ9 A;  1XKS A;  2XZG A;  5C86 A;  3AL9 A;  3UKR C;  2AGZ A;  3FRX A;  4O3U B;  3ZE1 A;  4G1E A;  4L9O A;  2VDM A;  4GM9 A;  4NC4 A;  3K27 A;  4BUJ C;  4AEZ A;  3SLE D;  5GXI A;  3ZWL B;  3DWL C;  3K72 A;  4QRJ A;  1SHY B;  3JRP A;  4J79 A;  4Z7Q A;  2OVP B;  5C2V B;  3T3P A;  2YNP A;  4ZOZ A;  3FM0 A;  3I8E A;  5FKQ A;  2VDQ A;  1N6F A;  2EBS A;  4CZY A;  3UVM A;  1VE6 A;  4A2L A;  3J80 g;  3KRW B;  3FCU A;  4J81 A;  3AH8 B;  3ZE2 A;  3MKS B;  4R7A B;  3EQ9 A;  2VDP A;  2Z2P A;  4Z7O A;  4IRZ A;  5E6U A;  4CI1 A;  2P9N C;  5EMM B;  4QQE A;  2HKM A;  2H47 A;  4A11 B;  4CY1 A;  5TEE A;  1A12 A;  5M5R A;  4JT5 C;  1U4C A;  2P9P C;  5JWZ A;  3C5M A;  2VC2 A;  2HES X;  3V4V A;  3HFQ A;  4A08 A;  3V7D B;  2CE8 A;  2IWF A;  5TDH B;  2B5N A;  3ORV D;  4FA9 D;  3GD1 I;  5AJA A;  5CXB A;  1MDA H;  4PSW B;  1XIP A;  5KDO B;  5C92 A;  5HE0 B;  1S4U X;  5EM2 A;  4A09 A;  3GRE A;  4MMX A;  4J78 A;  2J56 H;  1QNI A;  3IKO A;  2JKX A;  4NSX A;  2VDN A;  2CNX A;  5EAP A;  5FFO A;  2QR5 A;  1MG2 A;  5TEF A;  3O4I A;  3I7K A;  1C9L A;  2XL2 A;  2P9L C;  1JV2 A;  4D6V A;  3ODT A;  2I0R A;  5EML B;  4FAN D;  1YFQ A;  2P9K C;  3IVM A;  1PGU A;  5FLX g;  4FWW A;  5EAL A;  3I8C A;  3UVN A;  3I7L A;  2P9S C;  3NIF A;  4FHL A;  4ESG A;  1UOO A;  4ZOY A;  3F3P A;  3MUN A;  1QFS A;  3E0C A;  3I7N A;  4O45 A;  1O6F A;  4J8B A;  2GC4 A;  2VDK A;  5IJ7 E;  3MVD K;  1OMW B;  4BCC A;  3I2N A;  5M5T A;  1B9X A;  4E5Z A;  3OW8 A;  4ERQ A;  2AH0 A;  1T2X A;  2XE4 A;  3OKW A;  1K3I A;  4AX4 A;  5M5S A;  5M61 A;  4E54 A;  3IJC A;  3SFZ A;  3CFV A;  5H1M A;  4A08 B;  5FQD A;  4GQ2 P;  5FA5 B;  4DNW A;  5CXB B;  3IUQ A;  2P9I C;  4J82 A;  4IA9 A;  2H9N A;  3IJE A;  2AGW A;  3DM0 A;  4IMM A;  4A09 B;  5EM2 B;  5IGQ A;  3QI0 A;  4GGC A;  4O1Q D;  3SBQ A;  2YB8 B;  4U1E I;  4LG8 A;  2PM9 A;  4QAM A;  2IWK A;  4JSV C;  4BL0 A;  4FA4 D;  5IT9 g;  3MMY A;  1K8K C;  2H9P A;  2HKR A;  4CY5 A;  2QZP A;  3SJL D;  1MG3 A;  2IUV A;  4GZ8 A;  4OWR A;  2QXV A;  4PSX B;  3EG6 A;  3ZDY A;  5HYN B;  3I89 A;  1GP2 B;  3MZK A;  2IUR A;  4AOW A;  4L1M A;  3A0F A;  2H6N A;  3RFH A;  1BPO A;  2AH1 A;  3VI4 A;  4GM8 A;  5E6R A;  3PXS D;  1E5T A;  4BP9 A;  3KCI A;  3BG0 A;  3IUR A;  3P4F A;  2CN2 A;  3BWS A;  4UI9 R;  5E6S A;  1ERJ A;  4GQ1 A;  5K19 A;  5THA A;  4E5Z B;  1QFM A;  2I3S A;  2XU7 A;  3IUJ A;  4MMY A;  1OLZ A;  2MTA H;  3B7F A;  2HJB A;  2YMU A;  3V5W B;  4FA5 D;  2B4E A;  4E54 B;  1TBG A;  3SHF A;  3GC3 B;  4CI3 A;  4LGN A;  1NR0 A;  5HE2 B;  5HE3 B;  3C9C A;  3N0E A;  3O4H A;  4CY2 A;  2PM6 B;  3U4Y A;  1RI6 A;  3IIY A;  3KRX B;  4A0B A;  1H2W A;  5HE1 B;  4PBY A;  4XEI C;  3RN1 D;  3OL2 A;  3C99 A;  2VDR A;  2IUQ A;  4FA1 D;  4GGA A;  4CI8 A;  4HDJ A;  1VYH C;  4OZU A;  1U8C A;  1A0R B;  2PM9 B;  3SCY A;  5I5I A;  3SXT D;  1PEV A;  3SWS D;  3EQ7 A;  1H2Y A;  4NAA A;  3UVO A;  3V4P A;  1I2M B;  3O4J A;  5C2W B;  3JRO A;  4NEN A;  4BH6 A;  3FGB A;  5CYK A;  2Z2O A;  3UR4 A;  4N14 A;  4AN1 A;  4Z7N A;  1NEX B;  1UOP A;  4JSX C;  2HU7 A;  4J77 A;  2G99 A;  5I5M A;  2AGL A;  4AMZ A;  4ZN4 A;  2CO0 A;  5SXM A;  3VH0 A; 
#chains in the Genus database with same CATH homology
 1PI6 A;  1JMZ B;  3MKQ A;  3JB9 L;  4ES0 A;  5CXC A;  3OTT A;  4A0B B;  4O9D A;  3OL2 B;  5EMK B;  2UZY B;  2B5M A;  3RN0 D;  2PM7 B;  4G56 B;  2CE9 A;  2H3X A;  2TRC B;  3SBR A;  2J57 G;  1N6D A;  3N0D A;  5HQG A;  5GXH A;  4GGD A;  3ULE C;  4GMB A;  2OVR B;  3W15 A;  5GMK n;  4O3T B;  5EAR A;  3DSM A;  5IC7 A;  2I0S A;  4I79 A;  5CYK B;  2XL3 A;  2H13 A;  3K26 A;  4J87 A;  4FAV D;  4H5I A;  2BCJ B;  4X63 B;  3AFC A;  3NVN A;  4CZV A;  3EI1 A;  2AQ5 A;  4Y5R D;  3DXK C;  4JD2 C;  5FKS A;  3EI3 A;  4PBZ A;  3CIK B;  3RMZ D;  3RRM C;  2H14 A;  3V9F A;  4XYI A;  1Q47 A;  2H6Q A;  3SBP A;  2BBK H;  2OK6 A;  3J81 g;  4CY3 A;  3CFS B;  3UVK A;  2GNQ A;  1U2V C;  3IJ1 A;  3JZG A;  4MK0 B;  2OVQ B;  3PE7 A;  2Z2N A;  1JMX B;  4QL1 A;  4ZOX A;  4EWR A;  4TZ4 A;  2YNO A;  1PBY B;  3JAM g;  3UVL A;  2XYI A;  4KFM B;  3EMH A;  4A0A A;  3EWE A;  3I7H A;  2HJ4 A;  2CO0 C;  4Y7R A;  2UZX B;  4J84 A;  2I0T A;  3RFG A;  2CN3 A;  4J0X A;  4A2M A;  3VA6 A;  3EI2 A;  5B4W A;  5H17 A;  4CZX A;  4FB1 D;  5AFU 3;  3PSC B;  3EI1 B;  4ERY A;  4JXM A;  3F3G A;  2IAA A;  2B5L A;  3AL8 A;  3EI3 B;  1P22 A;  3UKU C;  4K3J B;  5K1C C;  4X3E A;  5FKR A;  2G9A A;  4L1Q D;  4YVD A;  2OK4 A;  1SQJ A;  2OJY A;  2H9L A;  5IGO A;  3VGZ A;  3JPX A;  2I3T A;  2O9K A;  2W18 A;  3GFC A;  1GG2 B;  4ERZ A;  2YBA A;  5A2Q g;  3IIW A;  3SVW D;  5EAM A;  2H68 A;  4X60 B;  2GC7 A;  4ZOV A;  3PXT D;  3EI4 A;  4A0A B;  3NVX A;  4JSP C;  3OKY A;  3PVU B;  4CI2 A;  3L4M D;  1TYQ C;  1N6E A;  4Z8L A;  1R5M A;  4JT6 C;  3JZH A;  3EI2 B;  4CC9 A;  2HXC A;  3DXM C;  5FKT A;  5EMJ B;  5H14 A;  3IJ0 A;  3I7P A;  1XHM A;  4H5J A;  4LG9 A;  2J55 H;  4J73 A;  5C9Z B;  4L3H D;  3AL8 B;  3SN6 B;  5TF2 A;  3EU7 A;  4J86 A;  3C75 H;  1B9Y A;  1GOT B;  1GXR A;  5IJ8 E;  4U7A A;  2P9U C;  4JSN C;  4QT8 A;  4A7J A;  4XYH A;  4D0K A;  3I7O A;  4X61 B;  5AMS A;  1JJU B;  3F3F A;  3MXX A;  3L4O D;  4GQB B;  4PXW A;  2PBI B;  1JOF A;  4GM3 A;  4PC0 A;  3BG1 A;  2OIZ A;  2AGX A;  3PSL A;  2Q7Q A;  3PXW D;  3JZN A;  3RLM D;  3SMR A;  3EI4 B;  4PNK B;  4J0W A;  3NVQ A;  3OKY B;  5GSA A;  4J8G A;  1L0Q A;  2AGY A;  4L3G D;  2HYE A;  2H6K A;  5CXC B;  4A11 A;  5FXY A;  5I5J A;  2H9M A;  1K32 A;  3MZL A;  2QC5 A;  2YNN A;  1FWX A;  2IUP A;  3OKT A;  3RSE C;  3PVW B;  4K3I D;  1SQ9 A;  1XKS A;  3AL9 A;  3UKR C;  2AGZ A;  3FRX A;  4O3U B;  4L9O A;  4GM9 A;  3K27 A;  4BUJ C;  4AEZ A;  3SLE D;  5GXI A;  3ZWL B;  3DWL C;  4QRJ A;  1SHY B;  3JRP A;  4J79 A;  2OVP B;  5C2V B;  2YNP A;  4ZOZ A;  3FM0 A;  3I8E A;  5FKQ A;  1N6F A;  2EBS A;  4CZY A;  3UVM A;  4A2L A;  3J80 g;  3KRW B;  4J81 A;  3AH8 B;  3MKS B;  4R7A B;  2Z2P A;  4CI1 A;  2P9N C;  5EMM B;  4QQE A;  2HKM A;  2H47 A;  4A11 B;  4CY1 A;  5TEE A;  4JT5 C;  1U4C A;  2P9P C;  5JWZ A;  3C5M A;  2HES X;  3HFQ A;  4A08 A;  3V7D B;  2CE8 A;  2IWF A;  5TDH B;  2B5N A;  3ORV D;  4FA9 D;  5AJA A;  5CXB A;  1MDA H;  4PSW B;  1XIP A;  5KDO B;  5HE0 B;  1S4U X;  5EM2 A;  4A09 A;  3GRE A;  4J78 A;  2J56 H;  1QNI A;  3IKO A;  4NSX A;  2CNX A;  5EAP A;  1MG2 A;  5TEF A;  3I7K A;  2XL2 A;  2P9L C;  4D6V A;  3ODT A;  2I0R A;  5EML B;  4FAN D;  1YFQ A;  2P9K C;  1PGU A;  5FLX g;  4FWW A;  5EAL A;  3I8C A;  3UVN A;  3I7L A;  2P9S C;  4FHL A;  4ESG A;  4ZOY A;  3F3P A;  3E0C A;  3I7N A;  4O45 A;  4J8B A;  2GC4 A;  5IJ7 E;  1OMW B;  3I2N A;  1B9X A;  4E5Z A;  3OW8 A;  4ERQ A;  2AH0 A;  3OKW A;  4E54 A;  3IJC A;  3SFZ A;  3CFV A;  5H1M A;  4A08 B;  5FQD A;  4GQ2 P;  5FA5 B;  5CXB B;  2P9I C;  4J82 A;  4IA9 A;  2H9N A;  2AGW A;  3DM0 A;  4IMM A;  4A09 B;  5EM2 B;  5IGQ A;  4O1Q D;  4GGC A;  3SBQ A;  2YB8 B;  4U1E I;  4LG8 A;  2PM9 A;  2IWK A;  4JSV C;  4BL0 A;  4FA4 D;  5IT9 g;  3MMY A;  1K8K C;  2H9P A;  2HKR A;  4CY5 A;  3SJL D;  1MG3 A;  2IUV A;  4GZ8 A;  4OWR A;  2QXV A;  4PSX B;  3EG6 A;  5HYN B;  3I89 A;  1GP2 B;  3MZK A;  2IUR A;  4AOW A;  3A0F A;  2H6N A;  3RFH A;  2AH1 A;  4GM8 A;  3PXS D;  3BG0 A;  3P4F A;  2CN2 A;  3BWS A;  4UI9 R;  1ERJ A;  4GQ1 A;  5K19 A;  5THA A;  4E5Z B;  2I3S A;  2XU7 A;  1OLZ A;  2MTA H;  3B7F A;  2HJB A;  2YMU A;  3V5W B;  4FA5 D;  2B4E A;  4E54 B;  1TBG A;  3SHF A;  4CI3 A;  4LGN A;  1NR0 A;  5HE2 B;  5HE3 B;  3C9C A;  3N0E A;  4CY2 A;  2PM6 B;  3U4Y A;  1RI6 A;  3IIY A;  3KRX B;  4A0B A;  5HE1 B;  4PBY A;  4XEI C;  3RN1 D;  3OL2 A;  3C99 A;  2IUQ A;  4FA1 D;  4GGA A;  4CI8 A;  4HDJ A;  1VYH C;  4OZU A;  1A0R B;  2PM9 B;  3SCY A;  5I5I A;  3SXT D;  1PEV A;  3SWS D;  3UVO A;  5C2W B;  3JRO A;  4BH6 A;  3FGB A;  5CYK A;  2Z2O A;  3UR4 A;  4N14 A;  1NEX B;  4JSX C;  4J77 A;  2G99 A;  5I5M A;  2AGL A;  4ZN4 A;  2CO0 A;  5SXM A;  3VH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...