4L9OA

Crystal structure of the sec13-sec16 blade-inserted complex from pichia pastoris
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
347
structure length
330
Chain Sequence
SHMTAPVVRNPRTQFPIFHWCRGGKALSMLPKFDTYGQSKVEINIVGSGSVTIGNAHDDLIHDAVLDYYGRRLATCSSDKTIKIFEIQRLVETLIGHEGPVWQVAWAHPKFGVILASCSYDGKVLIWKEDNGVWNKVAEHSVHQASVNSVSWAPHEYGPVLLCASSDGKISIVEFKDGGALEPIVIQGHAIGVNAASWAPISNTRRFVSGGCDNLVKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPSRLSKSYIATASQDRTVLIWTKDGKSNKWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLWKENIQGKWESAGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Sec16,Protein transport protein SEC13
publication title Sec16 influences transitional ER sites by regulating rather than organizing COPII.
pubmed doi rcsb
source organism Komagataella pastoris
total genus 73
structure length 330
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l9oA00
4CI8A 4FAND 4K3JB 1K32A 3ODTA 5CXBB 4BH6A 4ZOYA 5H17A 3ULEC 1XIPA 5AFU3 2AGYA 2CN3A 3IIYA 4J0XA 5HE2B 5AMSA 5CYKA 4XYHA 3SLED 1JMXB 2H47A 3RLMD 5IC7A 5EMMB 5FKRA 2B4EA 4H5JA 2YNOA 2I0SA 4J8BA 5K1CC 5B4WA 4ERZA 5FKTA 3PSCB 4O45A 4CY5A 3CFVA 4OWRA 4J77A 2YB8B 4A0AB 1P22A 3DXKC 5EAMA 1A0RB 3DM0A 2P9NC 4A08B 2H6QA 4PSWB 1MG3A 2PM7B 2H3XA 2PM9A 4ZOXA 2AGWA 1MG2A 2YBAA 1S4UX 3V7DB 3OL2B 2UZXB 4CI2A 3DXMC 5FLXg 1TYQC 4L1QD 1N6DA 5IGQA 3RSEC 3BG1A 3SBQA 3L4OD 3MMYA 3MKQA 4GQBB 4MK0B 4O9DA 3RFHA 5AJAA 3DSMA 4U7AA 2OK4A 3SFZA 4E54B 1GOTB 4BL0A 3FGBA 5EMLB 5HYNB 4QQEA 2H13A 2I3TA 4PBYA 2OVRB 3JPXA 4KFMB 1RI6A 3HFQA 4GGCA 4FWWA 3I7NA 3VH0A 3OKYB 5H1MA 4GM9A 4CC9A 3VA6A 3OKTA 4X61B 4LG9A 3I7KA 3SXTD 5HE3B 4A09A 1PGUA 5IGOA 2O9KA 1K8KC 2IUPA 3UVLA 5TEFA 5EAPA 2UZYB 4GGDA 4J87A 4J82A 2I0RA 2XL2A 3EI2B 3IKOA 1PBYB 3C75H 5GXIA 1XHMA 3MKSB 4GGAA 5I5JA 4A0BA 5HE1B 4LGNA 1VYHC 2Z2PA 2GC7A 1JMZB 2H14A 2CE8A 5KDOB 3AFCA 4CZXA 3EU7A 3EG6A 3SVWD 2HYEA 4A09B 4A0AA 3JB9L 4FAVD 3PSLA 4A08A 5A2Qg 5JWZA 4J84A 3K27A 2H9PA 3MXXA 3IJ0A 4JT6C 4Z8LA 3I8CA 2W18A 3EI1A 3EI3A 5FKQA 4J73A 3IIWA 4FA1D 3GREA 3JRPA 3GFCA 2BBKH 4FA5D 3OL2A 4A0BB 2YNNA 3EMHA 1R5MA 5K19A 3NVNA 4GM8A 3SCYA 1NR0A 2BCJB 5C9ZB 4YVDA 3OKWA 3PXSD 5IJ7E 3OTTA 3UR4A 5TEEA 3UVMA 4X3EA 4E54A 2QXVA 3F3PA 3NVQA 4PSXB 5FXYA 3UKUC 3I2NA 3I8EA 2CO0A 2HXCA 3NVXA 4Y5RD 1PEVA 3JZGA 2B5LA 3BG0A 4JXMA 4CZVA 4QT8A 4FA4D 2P9PC 2GC4A 4QL1A 3I7HA 2QC5A 3OKYA 3EI1B 2B5NA 4A2LA 3EI3B 4A11A 3P4FA 4FHLA 4ERQA 2H68A 1U2VC 5TF2A 4O1QD 3KRXB 4O3TB 4A7JA 5I5MA 2YMUA 4GZ8A 3EI2A 3UVOA 1TBGA 2IWKA 3JROA 3KRWB 3RN1D 4J0WA 4EWRA 4JD2C 3RMZD 2CO0C 5HE0B 2J55H 3AL8B 2YNPA 1PI6A 3PVUB 2OK6A 2P9KC 4JT5C 4L9OA 1B9XA 4GQ2P 3F3FA 4U1EI 5FKSA 4J79A 3VGZA 4A11B 2H9NA 3JZHA 1GP2B 3ORVD 3PXTD 4D6VA 2H6NA 2HKRA 3C9CA 3FRXA 4E5ZA 2GNQA 4ZN4A 2OJYA 3PXWD 2CNXA 2Z2OA 3JZNA 3ZWLB 4PXWA 3JAMg 3EWEA 3N0EA 3OW8A 5IT9g 3B7FA 4L3GD 5H14A 5FA5B 4R7AB 2OVQB 2AGLA 3V5WB 3SHFA 5EALA 4TZ4A 3C5MA 4FB1D 5GXHA 3RN0D 5SXMA 3RRMC 5C2VB 4CY2A 4E5ZB 3I89A 1N6FA 2J57G 2AGZA 3UVKA 4J86A 2MTAH 1B9YA 4X60B 5EMJB 3SN6B 1ERJA 3U4YA 4J81A 4JSVC 2XU7A 4J78A 4NSXA 4D0KA 1GXRA 2G9AA 2P9LC 3FM0A 4PBZA 3C99A 4CZYA 4GQ1A 4CI3A 2AQ5A 4ZOVA 2EBSA 2P9UC 4AEZA 3L4MD 4XYIA 4BUJC 3PVWB 2B5MA 3UKRC 3AH8B 3MZKA 4CI1A 1Q47A 3RFGA 2IUVA 4O3UB 2H9MA 2P9IC 1SQ9A 2I3SA 1SQJA 5TDHB 3AL8A 2CN2A 3EI4B 3UVNA 3J81g 4A2MA 2Z2NA 5I5IA 5CXCA 1N6EA 3F3GA 1U4CA 4QRJA 4IMMA 3I7LA 2Q7QA 2OVPB 4ERYA 2AH1A 3W15A 3IJCA 1JOFA 1JJUB 1NEXB 4J8GA 1QNIA 2IAAA 3DWLC 2IURA 5IJ8E 1SHYB 5HQGA 5CYKB 3K26A 2CE9A 1L0QA 4L3HD 5GSAA 2J56H 4IA9A 3I7PA 5EM2A 2XL3A 5FQDA 4JSNC 5CXCB 3AL9A 3V9FA 4I79A 3SJLD 4JSXC 3SBPA 4X63B 4ESGA 4LG8A 4UI9R 4FA9D 3J80g 4PC0A 1GG2B 2PM6B 4XEIC 4Y7RA 4AOWA 5C2WB 3PE7A 1XKSA 5EMKB 3E0CA 1FWXA 3IJ1A 2AGXA 2PM9B 2TRCB 5EARA 4ES0A 4ZOZA 2IUQA 4GM3A 1OMWB 3MZLA 4K3ID 4CY1A 5THAA 2OIZA 3CIKB 5CXBA 3SWSD 3I7OA 2H6KA 2XYIA 5EM2B 2P9SC 1OLZA 2G99A 2HKMA 2AH0A 4N14A 2HJBA 2H9LA 4CY3A 1MDAH 3SBRA 3BWSA 4GMBA 4JSPC 4G56B 2HJ4A 2HESX 2I0TA 3CFSB 3A0FA 5GMKn 4HDJA 1YFQA 3EI4A 2PBIB 4PNKB 3SMRA 3N0DA 4H5IA 4OZUA 2IWFA
chains in the Genus database with same CATH superfamily
4CI8A 4FAND 4K3JB 1K32A 3ODTA 5CXBB 4BH6A 4ZOYA 1H2XA 3K72A 4IRZA 5H17A 5HDBA 1XIPA 3FCUA 3ULEC 5AFU3 2VDMA 2AGYA 5C86A 2CN3A 2VZ3A 3IIYA 4J0XA 5HE2B 5AMSA 5CYKA 4DNUA 4XYHA 3SLED 1JMXB 2H47A 2VDOA 3RLMD 4NBMA 4RE6A 5IC7A 5EMMB 1U8CA 5FKRA 4AMZA 2B4EA 4H5JA 3MVDK 2YNOA 5M5TA 2I0SA 4J8BA 5K1CC 5B4WA 4ERZA 5FKTA 4UM8A 3PSCB 4O45A 4CY5A 3CFVA 4O02A 4OWRA 2VDLA 4J77A 3IULA 2YB8B 4A0AB 1P22A 3DXKC 5EAMA 1A0RB 3DM0A 3T3MA 3FCSA 2P9NC 4A08B 2H6QA 1VZ3A 4PSWB 4MMYA 1MG3A 2PM7B 2H3XA 2PM9A 4ZOXA 2HU8A 2AGWA 1MG2A 3O4HA 2YBAA 1VE7A 1S4UX 3V7DB 3OL2B 2UZXB 4CI2A 3DXMC 5FLXg 1TYQC 1L5GA 4L1QD 1N6DA 5IGQA 3RSEC 3BG1A 3SBQA 3L4OD 3MMYA 3MKQA 5C92A 4GQBB 4MK0B 4O9DA 1E8NA 1TYEA 3RFHA 5AJAA 3DSMA 4U7AA 2OK4A 3SFZA 4E54B 1GOTB 4BL0A 3FGBA 5EMLB 5HYNB 4QQEA 2H13A 2I3TA 4PBYA 2OVRB 3IUQA 3JPXA 1RI6A 3HFQA 4GGCA 2HU5A 4KFMB 4FWWA 2VDPA 3I7NA 3VH0A 3OKYB 5H1MA 1JV2A 4GM9A 4CC9A 3VA6A 3OKTA 3NIDA 4X61B 1UOQA 3I7KA 4LG9A 3SXTD 5HE3B 5M5UA 4A09A 1PGUA 5IGOA 2O9KA 1K8KC 2IUPA 3UVLA 5TEFA 5EAPA 2UZYB 4GGDA 2XZGA 4J87A 4J82A 2I0RA 2XL2A 3EI2B 2VC2A 3IKOA 1PBYB 3C75H 1YR2A 4AX4A 1XHMA 5GXIA 3MKSB 4GGAA 4NAAA 3NIGA 3OF7A 5I5JA 3EQ9A 3ZDXA 4A0BA 5HE1B 4LGNA 1VYHC 2BKLA 2EICA 2Z2PA 2GC7A 1JMZB 2VDQA 2H14A 3NIFA 4MMXA 2CE8A 4WJKA 5KDOB 3AFCA 4CZXA 3EU7A 3EG6A 3SVWD 2HYEA 4A09B 4A0AA 3JB9L 4NC4A 4BP9A 1M1XA 4FAVD 3PSLA 4A08A 5A2Qg 5JWZA 4J84A 3KCIA 3K27A 2H9PA 3MXXA 3IJ0A 4JT6C 4Z8LA 3I8CA 2W18A 3EI1A 3EI3A 3MUOA 5FKQA 4RE5A 4J73A 3IIWA 4FA1D 3GREA 4AN1A 3JRPA 3GFCA 2BBKH 3ZE1A 4FA5D 3OL2A 4A0BB 5FFOA 2YNNA 3EMHA 1R5MA 4DNVA 5K19A 3NVNA 4GM8A 3SCYA 3VI3A 1NR0A 2BCJB 1VE6A 5C9ZB 5E6SA 4YVDA 3OKWA 3PXSD 5IJ7E 3OTTA 3UR4A 4BCCA 3IURA 5TEEA 3UVMA 4X3EA 4E54A 2QXVA 3F3PA 3NVQA 4PSXB 5FXYA 4G1MA 3UKUC 3I2NA 3I8EA 2CO0A 2HXCA 4WK2A 3NVXA 4Y5RD 1PEVA 3JZGA 5FFGA 2B5LA 3BG0A 4JXMA 4CZVA 4QT8A 4FA4D 2P9PC 2GC4A 4QL1A 3I7HA 2QC5A 3OKYA 3EI1B 2B5NA 4A2LA 3EI3B 2VDRA 4A11A 3P4FA 4FHLA 2EIBA 4ERQA 2H68A 1U2VC 5TF2A 4O1QD 4DNWA 3KRXB 4O3TB 3VI4A 4A7JA 5I5MA 2YMUA 4GZ8A 3EI2A 3UVOA 1TBGA 2IWKA 3JROA 3KRWB 3RN1D 4J0WA 4EWRA 4JD2C 3RMZD 4AN0A 2CO0C 4JHNA 5HE0B 2J55H 3AL8B 2YNPA 4Z7NA 1PI6A 3PVUB 2OK6A 1E5TA 2P9KC 4JT5C 4L9OA 1B9XA 4GQ2P 3T3PA 3F3FA 2VDNA 4U1EI 3MUNA 3O4GA 5FKSA 4J79A 3VGZA 4A11B 2H9NA 3JZHA 5M5VA 1GP2B 3IVMA 3ORVD 3PXTD 2H6NA 4D6VA 1H2ZA 2HKRA 3C9CA 3FRXA 4E5ZA 2GNQA 4ZN4A 2OJYA 1UOOA 3PXWD 2CNXA 2Z2OA 2EIDA 3JZNA 3ZWLB 4PXWA 4G1EA 3JAMg 3EWEA 3N0EA 3OW8A 5IT9g 3B7FA 4L3GD 5H14A 5FA5B 4R7AB 2OVQB 2AGLA 3O4IA 2VZ1A 3V5WB 3SHFA 5EALA 4TZ4A 3C5MA 1QFMA 1C9LA 4FB1D 5GXHA 3QHYB 3RN0D 5SXMA 3RRMC 5C2VB 4Z7OA 1T2XA 4CY2A 1JTDB 3V4PA 4E5ZB 4WK0A 3I89A 1N6FA 2J57G 2VDKA 2AGZA 3UVKA 2XDWA 4J86A 2MTAH 1B9YA 4X60B 5EMJB 2JKXA 3SN6B 1ERJA 1UOPA 3U4YA 4J81A 4JSVC 2XU7A 4J78A 4NSXA 3IUJA 4D0KA 1GXRA 2G9AA 2P9LC 3FM0A 4PBZA 3C99A 4CZYA 4GQ1A 4NENA 5E6UA 2AQ5A 4G55A 4ZOVA 3ZDYA 4CI3A 2EBSA 2P9UC 4AEZA 3L4MD 4XYIA 4BUJC 3PVWB 2B5MA 2HU7A 3GC3B 3UKRC 3AH8B 3MZKA 3ZE2A 4CI1A 1Q47A 3RFGA 2IUVA 4O3UB 3K71A 2H9MA 2P9IC 1SQ9A 2I3SA 1SQJA 5TDHB 3AL8A 2CN2A 3EI4B 3UVNA 3J81g 1A12A 4A2MA 2Z2NA 5I5IA 5CXCA 1VZ2A 4UM9A 1N6EA 3F3GA 1U4CA 4QRJA 4D9SA 4IMMA 1K3IA 3I7LA 4BCDA 2Q7QA 2OVPB 4ERYA 2AH1A 3W15A 3IJCA 3GD1I 1JOFA 1I2MB 1JJUB 4Z7QA 3ZE0A 1NEXB 1BPOA 4J8GA 1QNIA 2IAAA 3DWLC 4AMYA 2IURA 5IJ8E 1SHYB 5HQGA 5CYKB 3K26A 2CE9A 1L0QA 4L3HD 5GSAA 1GOFA 2J56H 4IA9A 3I7PA 5EM2A 2XL3A 5FQDA 4JSNC 3DDUA 5CXCB 3AL9A 4WK4A 1H2YA 3V9FA 4I79A 3SJLD 4JSXC 3SBPA 4X63B 1UTCA 4ESGA 1E8MA 4BP8A 4LG8A 4UI9R 4FA9D 1GOHA 3J80g 4PC0A 5M5RA 1GG2B 2PM6B 4XEIC 4Y7RA 4AOWA 5C2WB 3EQ7A 3PE7A 3IUNA 1XKSA 2QZPA 5EMKB 3IJEA 2WQ8A 1C9IA 3E0CA 1FWXA 3QI0A 3IJ1A 2AGXA 2PM9B 2TRCB 5M5SA 5EARA 4ES0A 2QR5A 4ZOZA 2IUQA 4GM3A 1OMWB 3EQ8A 3MZLA 4K3ID 4CY1A 5THAA 2OIZA 3CIKB 5CXBA 3SWSD 3I7OA 2H6KA 2XYIA 5EM2B 2P9SC 1OLZA 1H2WA 2G99A 2HKMA 3K6SA 2AH0A 1O6GA 3IUMA 3O4JA 1GOGA 1QFSA 4N14A 2HJBA 1O6FA 4O2WA 2H9LA 2EIEA 4CY3A 1MDAH 3SBRA 5M61A 3BWSA 4GMBA 4JSPC 4G56B 2HJ4A 2HESX 2I0TA 3CFSB 3A0FA 4MMZA 4QAMA 5GMKn 4HDJA 1YFQA 3EI4A 2PBIB 5E6RA 4L1MA 4PNKB 2XE4A 3SMRA 3N0DA 4H5IA 2IWFA 4JHPC 4OZUA 4BCBA 3ZDZA 3V4VA
chains in the Genus database with same CATH topology
4CI8A 4FAND 4K3JB 1K32A 3ODTA 5CXBB 4BH6A 4ZOYA 5H17A 3ULEC 1XIPA 5AFU3 2AGYA 2CN3A 3IIYA 4J0XA 5HE2B 5AMSA 5CYKA 4XYHA 3SLED 1JMXB 2H47A 3RLMD 5IC7A 5EMMB 5FKRA 2B4EA 4H5JA 2YNOA 2I0SA 4J8BA 5K1CC 5B4WA 4ERZA 5FKTA 3PSCB 4O45A 4CY5A 3CFVA 4OWRA 4J77A 2YB8B 4A0AB 1P22A 3DXKC 5EAMA 1A0RB 3DM0A 2P9NC 4A08B 2H6QA 4PSWB 1MG3A 2PM7B 2H3XA 2PM9A 4ZOXA 2AGWA 1MG2A 2YBAA 1S4UX 3V7DB 3OL2B 2UZXB 4CI2A 3DXMC 5FLXg 1TYQC 4L1QD 1N6DA 5IGQA 3RSEC 3BG1A 3SBQA 3L4OD 3MMYA 3MKQA 4GQBB 4MK0B 4O9DA 3RFHA 5AJAA 3DSMA 4U7AA 2OK4A 3SFZA 4E54B 1GOTB 4BL0A 3FGBA 5EMLB 5HYNB 4QQEA 2H13A 2I3TA 4PBYA 2OVRB 3JPXA 4KFMB 1RI6A 3HFQA 4GGCA 4FWWA 3I7NA 3VH0A 3OKYB 5H1MA 4GM9A 4CC9A 3VA6A 3OKTA 4X61B 4LG9A 3I7KA 3SXTD 5HE3B 4A09A 1PGUA 5IGOA 2O9KA 1K8KC 2IUPA 3UVLA 5TEFA 5EAPA 2UZYB 4GGDA 4J87A 4J82A 2I0RA 2XL2A 3EI2B 3IKOA 1PBYB 3C75H 5GXIA 1XHMA 3MKSB 4GGAA 5I5JA 4A0BA 5HE1B 4LGNA 1VYHC 2Z2PA 2GC7A 1JMZB 2H14A 2CE8A 5KDOB 3AFCA 4CZXA 3EU7A 3EG6A 3SVWD 2HYEA 4A09B 4A0AA 3JB9L 4FAVD 3PSLA 4A08A 5A2Qg 5JWZA 4J84A 3K27A 2H9PA 3MXXA 3IJ0A 4JT6C 4Z8LA 3I8CA 2W18A 3EI1A 3EI3A 5FKQA 4J73A 3IIWA 4FA1D 3GREA 3JRPA 3GFCA 2BBKH 4FA5D 3OL2A 4A0BB 2YNNA 3EMHA 1R5MA 5K19A 3NVNA 4GM8A 3SCYA 1NR0A 2BCJB 5C9ZB 4YVDA 3OKWA 3PXSD 5IJ7E 3OTTA 3UR4A 5TEEA 3UVMA 4X3EA 4E54A 2QXVA 3F3PA 3NVQA 4PSXB 5FXYA 3UKUC 3I2NA 3I8EA 2CO0A 2HXCA 3NVXA 4Y5RD 1PEVA 3JZGA 2B5LA 3BG0A 4JXMA 4CZVA 4QT8A 4FA4D 2P9PC 2GC4A 4QL1A 3I7HA 2QC5A 3OKYA 3EI1B 2B5NA 4A2LA 3EI3B 4A11A 3P4FA 4FHLA 4ERQA 2H68A 1U2VC 5TF2A 4O1QD 3KRXB 4O3TB 4A7JA 5I5MA 2YMUA 4GZ8A 3EI2A 3UVOA 1TBGA 2IWKA 3JROA 3KRWB 3RN1D 4J0WA 4EWRA 4JD2C 3RMZD 2CO0C 5HE0B 2J55H 3AL8B 2YNPA 1PI6A 3PVUB 2OK6A 2P9KC 4JT5C 4L9OA 1B9XA 4GQ2P 3F3FA 4U1EI 5FKSA 4J79A 3VGZA 4A11B 2H9NA 3JZHA 1GP2B 3ORVD 3PXTD 4D6VA 2H6NA 2HKRA 3C9CA 3FRXA 4E5ZA 2GNQA 4ZN4A 2OJYA 3PXWD 2CNXA 2Z2OA 3JZNA 3ZWLB 4PXWA 3JAMg 3EWEA 3N0EA 3OW8A 5IT9g 3B7FA 4L3GD 5H14A 5FA5B 4R7AB 2OVQB 2AGLA 3V5WB 3SHFA 5EALA 4TZ4A 3C5MA 4FB1D 5GXHA 3RN0D 5SXMA 3RRMC 5C2VB 4CY2A 4E5ZB 3I89A 1N6FA 2J57G 2AGZA 3UVKA 4J86A 2MTAH 1B9YA 4X60B 5EMJB 3SN6B 1ERJA 3U4YA 4J81A 4JSVC 2XU7A 4J78A 4NSXA 4D0KA 1GXRA 2G9AA 2P9LC 3FM0A 4PBZA 3C99A 4CZYA 4GQ1A 4CI3A 2AQ5A 4ZOVA 2EBSA 2P9UC 4AEZA 3L4MD 4XYIA 4BUJC 3PVWB 2B5MA 3UKRC 3AH8B 3MZKA 4CI1A 1Q47A 3RFGA 2IUVA 4O3UB 2H9MA 2P9IC 1SQ9A 2I3SA 1SQJA 5TDHB 3AL8A 2CN2A 3EI4B 3UVNA 3J81g 4A2MA 2Z2NA 5I5IA 5CXCA 1N6EA 3F3GA 1U4CA 4QRJA 4IMMA 3I7LA 2Q7QA 2OVPB 4ERYA 2AH1A 3W15A 3IJCA 1JOFA 1JJUB 1NEXB 4J8GA 1QNIA 2IAAA 3DWLC 2IURA 5IJ8E 1SHYB 5HQGA 5CYKB 3K26A 2CE9A 1L0QA 4L3HD 5GSAA 2J56H 4IA9A 3I7PA 5EM2A 2XL3A 5FQDA 4JSNC 5CXCB 3AL9A 3V9FA 4I79A 3SJLD 4JSXC 3SBPA 4X63B 4ESGA 4LG8A 4UI9R 4FA9D 3J80g 4PC0A 1GG2B 2PM6B 4XEIC 4Y7RA 4AOWA 5C2WB 3PE7A 1XKSA 5EMKB 3E0CA 1FWXA 3IJ1A 2AGXA 2PM9B 2TRCB 5EARA 4ES0A 4ZOZA 2IUQA 4GM3A 1OMWB 3MZLA 4K3ID 4CY1A 5THAA 2OIZA 3CIKB 5CXBA 3SWSD 3I7OA 2H6KA 2XYIA 5EM2B 2P9SC 1OLZA 2G99A 2HKMA 2AH0A 4N14A 2HJBA 2H9LA 4CY3A 1MDAH 3SBRA 3BWSA 4GMBA 4JSPC 4G56B 2HJ4A 2HESX 2I0TA 3CFSB 3A0FA 5GMKn 4HDJA 1YFQA 3EI4A 2PBIB 4PNKB 3SMRA 3N0DA 4H5IA 4OZUA 2IWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI8 A;  4FAN D;  4K3J B;  1K32 A;  3ODT A;  5CXB B;  4BH6 A;  4ZOY A;  5H17 A;  3ULE C;  1XIP A;  5AFU 3;  2AGY A;  2CN3 A;  3IIY A;  4J0X A;  5HE2 B;  5AMS A;  5CYK A;  4XYH A;  3SLE D;  1JMX B;  2H47 A;  3RLM D;  5IC7 A;  5EMM B;  5FKR A;  2B4E A;  4H5J A;  2YNO A;  2I0S A;  4J8B A;  5K1C C;  5B4W A;  4ERZ A;  5FKT A;  3PSC B;  4O45 A;  4CY5 A;  3CFV A;  4OWR A;  4J77 A;  2YB8 B;  4A0A B;  1P22 A;  3DXK C;  5EAM A;  1A0R B;  3DM0 A;  2P9N C;  4A08 B;  2H6Q A;  4PSW B;  1MG3 A;  2PM7 B;  2H3X A;  2PM9 A;  4ZOX A;  2AGW A;  1MG2 A;  2YBA A;  1S4U X;  3V7D B;  3OL2 B;  2UZX B;  4CI2 A;  3DXM C;  5FLX g;  1TYQ C;  4L1Q D;  1N6D A;  5IGQ A;  3RSE C;  3BG1 A;  3SBQ A;  3L4O D;  3MMY A;  3MKQ A;  4GQB B;  4MK0 B;  4O9D A;  3RFH A;  5AJA A;  3DSM A;  4U7A A;  2OK4 A;  3SFZ A;  4E54 B;  1GOT B;  4BL0 A;  3FGB A;  5EML B;  5HYN B;  4QQE A;  2H13 A;  2I3T A;  4PBY A;  2OVR B;  3JPX A;  4KFM B;  1RI6 A;  3HFQ A;  4GGC A;  4FWW A;  3I7N A;  3VH0 A;  3OKY B;  5H1M A;  4GM9 A;  4CC9 A;  3VA6 A;  3OKT A;  4X61 B;  4LG9 A;  3I7K A;  3SXT D;  5HE3 B;  4A09 A;  1PGU A;  5IGO A;  2O9K A;  1K8K C;  2IUP A;  3UVL A;  5TEF A;  5EAP A;  2UZY B;  4GGD A;  4J87 A;  4J82 A;  2I0R A;  2XL2 A;  3EI2 B;  3IKO A;  1PBY B;  3C75 H;  5GXI A;  1XHM A;  3MKS B;  4GGA A;  5I5J A;  4A0B A;  5HE1 B;  4LGN A;  1VYH C;  2Z2P A;  2GC7 A;  1JMZ B;  2H14 A;  2CE8 A;  5KDO B;  3AFC A;  4CZX A;  3EU7 A;  3EG6 A;  3SVW D;  2HYE A;  4A09 B;  4A0A A;  3JB9 L;  4FAV D;  3PSL A;  4A08 A;  5A2Q g;  5JWZ A;  4J84 A;  3K27 A;  2H9P A;  3MXX A;  3IJ0 A;  4JT6 C;  4Z8L A;  3I8C A;  2W18 A;  3EI1 A;  3EI3 A;  5FKQ A;  4J73 A;  3IIW A;  4FA1 D;  3GRE A;  3JRP A;  3GFC A;  2BBK H;  4FA5 D;  3OL2 A;  4A0B B;  2YNN A;  3EMH A;  1R5M A;  5K19 A;  3NVN A;  4GM8 A;  3SCY A;  1NR0 A;  2BCJ B;  5C9Z B;  4YVD A;  3OKW A;  3PXS D;  5IJ7 E;  3OTT A;  3UR4 A;  5TEE A;  3UVM A;  4X3E A;  4E54 A;  2QXV A;  3F3P A;  3NVQ A;  4PSX B;  5FXY A;  3UKU C;  3I2N A;  3I8E A;  2CO0 A;  2HXC A;  3NVX A;  4Y5R D;  1PEV A;  3JZG A;  2B5L A;  3BG0 A;  4JXM A;  4CZV A;  4QT8 A;  4FA4 D;  2P9P C;  2GC4 A;  4QL1 A;  3I7H A;  2QC5 A;  3OKY A;  3EI1 B;  2B5N A;  4A2L A;  3EI3 B;  4A11 A;  3P4F A;  4FHL A;  4ERQ A;  2H68 A;  1U2V C;  5TF2 A;  4O1Q D;  3KRX B;  4O3T B;  4A7J A;  5I5M A;  2YMU A;  4GZ8 A;  3EI2 A;  3UVO A;  1TBG A;  2IWK A;  3JRO A;  3KRW B;  3RN1 D;  4J0W A;  4EWR A;  4JD2 C;  3RMZ D;  2CO0 C;  5HE0 B;  2J55 H;  3AL8 B;  2YNP A;  1PI6 A;  3PVU B;  2OK6 A;  2P9K C;  4JT5 C;  4L9O A;  1B9X A;  4GQ2 P;  3F3F A;  4U1E I;  5FKS A;  4J79 A;  3VGZ A;  4A11 B;  2H9N A;  3JZH A;  1GP2 B;  3ORV D;  3PXT D;  4D6V A;  2H6N A;  2HKR A;  3C9C A;  3FRX A;  4E5Z A;  2GNQ A;  4ZN4 A;  2OJY A;  3PXW D;  2CNX A;  2Z2O A;  3JZN A;  3ZWL B;  4PXW A;  3JAM g;  3EWE A;  3N0E A;  3OW8 A;  5IT9 g;  3B7F A;  4L3G D;  5H14 A;  5FA5 B;  4R7A B;  2OVQ B;  2AGL A;  3V5W B;  3SHF A;  5EAL A;  4TZ4 A;  3C5M A;  4FB1 D;  5GXH A;  3RN0 D;  5SXM A;  3RRM C;  5C2V B;  4CY2 A;  4E5Z B;  3I89 A;  1N6F A;  2J57 G;  2AGZ A;  3UVK A;  4J86 A;  2MTA H;  1B9Y A;  4X60 B;  5EMJ B;  3SN6 B;  1ERJ A;  3U4Y A;  4J81 A;  4JSV C;  2XU7 A;  4J78 A;  4NSX A;  4D0K A;  1GXR A;  2G9A A;  2P9L C;  3FM0 A;  4PBZ A;  3C99 A;  4CZY A;  4GQ1 A;  4CI3 A;  2AQ5 A;  4ZOV A;  2EBS A;  2P9U C;  4AEZ A;  3L4M D;  4XYI A;  4BUJ C;  3PVW B;  2B5M A;  3UKR C;  3AH8 B;  3MZK A;  4CI1 A;  1Q47 A;  3RFG A;  2IUV A;  4O3U B;  2H9M A;  2P9I C;  1SQ9 A;  2I3S A;  1SQJ A;  5TDH B;  3AL8 A;  2CN2 A;  3EI4 B;  3UVN A;  3J81 g;  4A2M A;  2Z2N A;  5I5I A;  5CXC A;  1N6E A;  3F3G A;  1U4C A;  4QRJ A;  4IMM A;  3I7L A;  2Q7Q A;  2OVP B;  4ERY A;  2AH1 A;  3W15 A;  3IJC A;  1JOF A;  1JJU B;  1NEX B;  4J8G A;  1QNI A;  2IAA A;  3DWL C;  2IUR A;  5IJ8 E;  1SHY B;  5HQG A;  5CYK B;  3K26 A;  2CE9 A;  1L0Q A;  4L3H D;  5GSA A;  2J56 H;  4IA9 A;  3I7P A;  5EM2 A;  2XL3 A;  5FQD A;  4JSN C;  5CXC B;  3AL9 A;  3V9F A;  4I79 A;  3SJL D;  4JSX C;  3SBP A;  4X63 B;  4ESG A;  4LG8 A;  4UI9 R;  4FA9 D;  3J80 g;  4PC0 A;  1GG2 B;  2PM6 B;  4XEI C;  4Y7R A;  4AOW A;  5C2W B;  3PE7 A;  1XKS A;  5EMK B;  3E0C A;  1FWX A;  3IJ1 A;  2AGX A;  2PM9 B;  2TRC B;  5EAR A;  4ES0 A;  4ZOZ A;  2IUQ A;  4GM3 A;  1OMW B;  3MZL A;  4K3I D;  4CY1 A;  5THA A;  2OIZ A;  3CIK B;  5CXB A;  3SWS D;  3I7O A;  2H6K A;  2XYI A;  5EM2 B;  2P9S C;  1OLZ A;  2G99 A;  2HKM A;  2AH0 A;  4N14 A;  2HJB A;  2H9L A;  4CY3 A;  1MDA H;  3SBR A;  3BWS A;  4GMB A;  4JSP C;  4G56 B;  2HJ4 A;  2HES X;  2I0T A;  3CFS B;  3A0F A;  5GMK n;  4HDJ A;  1YFQ A;  3EI4 A;  2PBI B;  4PNK B;  3SMR A;  3N0D A;  4H5I A;  4OZU A;  2IWF A; 
#chains in the Genus database with same CATH topology
 4CI8 A;  4FAN D;  4K3J B;  1K32 A;  3ODT A;  5CXB B;  4BH6 A;  4ZOY A;  1H2X A;  3K72 A;  4IRZ A;  5H17 A;  5HDB A;  1XIP A;  3FCU A;  3ULE C;  5AFU 3;  2VDM A;  2AGY A;  5C86 A;  2CN3 A;  2VZ3 A;  3IIY A;  4J0X A;  5HE2 B;  5AMS A;  5CYK A;  4DNU A;  4XYH A;  3SLE D;  1JMX B;  2H47 A;  2VDO A;  3RLM D;  4NBM A;  4RE6 A;  5IC7 A;  5EMM B;  1U8C A;  5FKR A;  4AMZ A;  2B4E A;  4H5J A;  3MVD K;  2YNO A;  5M5T A;  2I0S A;  4J8B A;  5K1C C;  5B4W A;  4ERZ A;  5FKT A;  4UM8 A;  3PSC B;  4O45 A;  4CY5 A;  3CFV A;  4O02 A;  4OWR A;  2VDL A;  4J77 A;  3IUL A;  2YB8 B;  4A0A B;  1P22 A;  3DXK C;  5EAM A;  1A0R B;  3DM0 A;  3T3M A;  3FCS A;  2P9N C;  4A08 B;  2H6Q A;  1VZ3 A;  4PSW B;  4MMY A;  1MG3 A;  2PM7 B;  2H3X A;  2PM9 A;  4ZOX A;  2HU8 A;  2AGW A;  1MG2 A;  3O4H A;  2YBA A;  1VE7 A;  1S4U X;  3V7D B;  3OL2 B;  2UZX B;  4CI2 A;  3DXM C;  5FLX g;  1TYQ C;  1L5G A;  4L1Q D;  1N6D A;  5IGQ A;  3RSE C;  3BG1 A;  3SBQ A;  3L4O D;  3MMY A;  3MKQ A;  5C92 A;  4GQB B;  4MK0 B;  4O9D A;  1E8N A;  1TYE A;  3RFH A;  5AJA A;  3DSM A;  4U7A A;  2OK4 A;  3SFZ A;  4E54 B;  1GOT B;  4BL0 A;  3FGB A;  5EML B;  5HYN B;  4QQE A;  2H13 A;  2I3T A;  4PBY A;  2OVR B;  3IUQ A;  3JPX A;  1RI6 A;  3HFQ A;  4GGC A;  2HU5 A;  4KFM B;  4FWW A;  2VDP A;  3I7N A;  3VH0 A;  3OKY B;  5H1M A;  1JV2 A;  4GM9 A;  4CC9 A;  3VA6 A;  3OKT A;  3NID A;  4X61 B;  1UOQ A;  3I7K A;  4LG9 A;  3SXT D;  5HE3 B;  5M5U A;  4A09 A;  1PGU A;  5IGO A;  2O9K A;  1K8K C;  2IUP A;  3UVL A;  5TEF A;  5EAP A;  2UZY B;  4GGD A;  2XZG A;  4J87 A;  4J82 A;  2I0R A;  2XL2 A;  3EI2 B;  2VC2 A;  3IKO A;  1PBY B;  3C75 H;  1YR2 A;  4AX4 A;  1XHM A;  5GXI A;  3MKS B;  4GGA A;  4NAA A;  3NIG A;  3OF7 A;  5I5J A;  3EQ9 A;  3ZDX A;  4A0B A;  5HE1 B;  4LGN A;  1VYH C;  2BKL A;  2EIC A;  2Z2P A;  2GC7 A;  1JMZ B;  2VDQ A;  2H14 A;  3NIF A;  4MMX A;  2CE8 A;  4WJK A;  5KDO B;  3AFC A;  4CZX A;  3EU7 A;  3EG6 A;  3SVW D;  2HYE A;  4A09 B;  4A0A A;  3JB9 L;  4NC4 A;  4BP9 A;  1M1X A;  4FAV D;  3PSL A;  4A08 A;  5A2Q g;  5JWZ A;  4J84 A;  3KCI A;  3K27 A;  2H9P A;  3MXX A;  3IJ0 A;  4JT6 C;  4Z8L A;  3I8C A;  2W18 A;  3EI1 A;  3EI3 A;  3MUO A;  5FKQ A;  4RE5 A;  4J73 A;  3IIW A;  4FA1 D;  3GRE A;  4AN1 A;  3JRP A;  3GFC A;  2BBK H;  3ZE1 A;  4FA5 D;  3OL2 A;  4A0B B;  5FFO A;  2YNN A;  3EMH A;  1R5M A;  4DNV A;  5K19 A;  3NVN A;  4GM8 A;  3SCY A;  3VI3 A;  1NR0 A;  2BCJ B;  1VE6 A;  5C9Z B;  5E6S A;  4YVD A;  3OKW A;  3PXS D;  5IJ7 E;  3OTT A;  3UR4 A;  4BCC A;  3IUR A;  5TEE A;  3UVM A;  4X3E A;  4E54 A;  2QXV A;  3F3P A;  3NVQ A;  4PSX B;  5FXY A;  4G1M A;  3UKU C;  3I2N A;  3I8E A;  2CO0 A;  2HXC A;  4WK2 A;  3NVX A;  4Y5R D;  1PEV A;  3JZG A;  5FFG A;  2B5L A;  3BG0 A;  4JXM A;  4CZV A;  4QT8 A;  4FA4 D;  2P9P C;  2GC4 A;  4QL1 A;  3I7H A;  2QC5 A;  3OKY A;  3EI1 B;  2B5N A;  4A2L A;  3EI3 B;  2VDR A;  4A11 A;  3P4F A;  4FHL A;  2EIB A;  4ERQ A;  2H68 A;  1U2V C;  5TF2 A;  4O1Q D;  4DNW A;  3KRX B;  4O3T B;  3VI4 A;  4A7J A;  5I5M A;  2YMU A;  4GZ8 A;  3EI2 A;  3UVO A;  1TBG A;  2IWK A;  3JRO A;  3KRW B;  3RN1 D;  4J0W A;  4EWR A;  4JD2 C;  3RMZ D;  4AN0 A;  2CO0 C;  4JHN A;  5HE0 B;  2J55 H;  3AL8 B;  2YNP A;  4Z7N A;  1PI6 A;  3PVU B;  2OK6 A;  1E5T A;  2P9K C;  4JT5 C;  4L9O A;  1B9X A;  4GQ2 P;  3T3P A;  3F3F A;  2VDN A;  4U1E I;  3MUN A;  3O4G A;  5FKS A;  4J79 A;  3VGZ A;  4A11 B;  2H9N A;  3JZH A;  5M5V A;  1GP2 B;  3IVM A;  3ORV D;  3PXT D;  2H6N A;  4D6V A;  1H2Z A;  2HKR A;  3C9C A;  3FRX A;  4E5Z A;  2GNQ A;  4ZN4 A;  2OJY A;  1UOO A;  3PXW D;  2CNX A;  2Z2O A;  2EID A;  3JZN A;  3ZWL B;  4PXW A;  4G1E A;  3JAM g;  3EWE A;  3N0E A;  3OW8 A;  5IT9 g;  3B7F A;  4L3G D;  5H14 A;  5FA5 B;  4R7A B;  2OVQ B;  2AGL A;  3O4I A;  2VZ1 A;  3V5W B;  3SHF A;  5EAL A;  4TZ4 A;  3C5M A;  1QFM A;  1C9L A;  4FB1 D;  5GXH A;  3QHY B;  3RN0 D;  5SXM A;  3RRM C;  5C2V B;  4Z7O A;  1T2X A;  4CY2 A;  1JTD B;  3V4P A;  4E5Z B;  4WK0 A;  3I89 A;  1N6F A;  2J57 G;  2VDK A;  2AGZ A;  3UVK A;  2XDW A;  4J86 A;  2MTA H;  1B9Y A;  4X60 B;  5EMJ B;  2JKX A;  3SN6 B;  1ERJ A;  1UOP A;  3U4Y A;  4J81 A;  4JSV C;  2XU7 A;  4J78 A;  4NSX A;  3IUJ A;  4D0K A;  1GXR A;  2G9A A;  2P9L C;  3FM0 A;  4PBZ A;  3C99 A;  4CZY A;  4GQ1 A;  4NEN A;  5E6U A;  2AQ5 A;  4G55 A;  4ZOV A;  3ZDY A;  4CI3 A;  2EBS A;  2P9U C;  4AEZ A;  3L4M D;  4XYI A;  4BUJ C;  3PVW B;  2B5M A;  2HU7 A;  3GC3 B;  3UKR C;  3AH8 B;  3MZK A;  3ZE2 A;  4CI1 A;  1Q47 A;  3RFG A;  2IUV A;  4O3U B;  3K71 A;  2H9M A;  2P9I C;  1SQ9 A;  2I3S A;  1SQJ A;  5TDH B;  3AL8 A;  2CN2 A;  3EI4 B;  3UVN A;  3J81 g;  1A12 A;  4A2M A;  2Z2N A;  5I5I A;  5CXC A;  1VZ2 A;  4UM9 A;  1N6E A;  3F3G A;  1U4C A;  4QRJ A;  4D9S A;  4IMM A;  1K3I A;  3I7L A;  4BCD A;  2Q7Q A;  2OVP B;  4ERY A;  2AH1 A;  3W15 A;  3IJC A;  3GD1 I;  1JOF A;  1I2M B;  1JJU B;  4Z7Q A;  3ZE0 A;  1NEX B;  1BPO A;  4J8G A;  1QNI A;  2IAA A;  3DWL C;  4AMY A;  2IUR A;  5IJ8 E;  1SHY B;  5HQG A;  5CYK B;  3K26 A;  2CE9 A;  1L0Q A;  4L3H D;  5GSA A;  1GOF A;  2J56 H;  4IA9 A;  3I7P A;  5EM2 A;  2XL3 A;  5FQD A;  4JSN C;  3DDU A;  5CXC B;  3AL9 A;  4WK4 A;  1H2Y A;  3V9F A;  4I79 A;  3SJL D;  4JSX C;  3SBP A;  4X63 B;  1UTC A;  4ESG A;  1E8M A;  4BP8 A;  4LG8 A;  4UI9 R;  4FA9 D;  1GOH A;  3J80 g;  4PC0 A;  5M5R A;  1GG2 B;  2PM6 B;  4XEI C;  4Y7R A;  4AOW A;  5C2W B;  3EQ7 A;  3PE7 A;  3IUN A;  1XKS A;  2QZP A;  5EMK B;  3IJE A;  2WQ8 A;  1C9I A;  3E0C A;  1FWX A;  3QI0 A;  3IJ1 A;  2AGX A;  2PM9 B;  2TRC B;  5M5S A;  5EAR A;  4ES0 A;  2QR5 A;  4ZOZ A;  2IUQ A;  4GM3 A;  1OMW B;  3EQ8 A;  3MZL A;  4K3I D;  4CY1 A;  5THA A;  2OIZ A;  3CIK B;  5CXB A;  3SWS D;  3I7O A;  2H6K A;  2XYI A;  5EM2 B;  2P9S C;  1OLZ A;  1H2W A;  2G99 A;  2HKM A;  3K6S A;  2AH0 A;  1O6G A;  3IUM A;  3O4J A;  1GOG A;  1QFS A;  4N14 A;  2HJB A;  1O6F A;  4O2W A;  2H9L A;  2EIE A;  4CY3 A;  1MDA H;  3SBR A;  5M61 A;  3BWS A;  4GMB A;  4JSP C;  4G56 B;  2HJ4 A;  2HES X;  2I0T A;  3CFS B;  3A0F A;  4MMZ A;  4QAM A;  5GMK n;  4HDJ A;  1YFQ A;  3EI4 A;  2PBI B;  5E6R A;  4L1M A;  4PNK B;  2XE4 A;  3SMR A;  3N0D A;  4H5I A;  2IWF A;  4JHP C;  4OZU A;  4BCB A;  3ZDZ A;  3V4V A; 
#chains in the Genus database with same CATH homology
 4CI8 A;  4FAN D;  4K3J B;  1K32 A;  3ODT A;  5CXB B;  4BH6 A;  4ZOY A;  5H17 A;  3ULE C;  1XIP A;  5AFU 3;  2AGY A;  2CN3 A;  3IIY A;  4J0X A;  5HE2 B;  5AMS A;  5CYK A;  4XYH A;  3SLE D;  1JMX B;  2H47 A;  3RLM D;  5IC7 A;  5EMM B;  5FKR A;  2B4E A;  4H5J A;  2YNO A;  2I0S A;  4J8B A;  5K1C C;  5B4W A;  4ERZ A;  5FKT A;  3PSC B;  4O45 A;  4CY5 A;  3CFV A;  4OWR A;  4J77 A;  2YB8 B;  4A0A B;  1P22 A;  3DXK C;  5EAM A;  1A0R B;  3DM0 A;  2P9N C;  4A08 B;  2H6Q A;  4PSW B;  1MG3 A;  2PM7 B;  2H3X A;  2PM9 A;  4ZOX A;  2AGW A;  1MG2 A;  2YBA A;  1S4U X;  3V7D B;  3OL2 B;  2UZX B;  4CI2 A;  3DXM C;  5FLX g;  1TYQ C;  4L1Q D;  1N6D A;  5IGQ A;  3RSE C;  3BG1 A;  3SBQ A;  3L4O D;  3MMY A;  3MKQ A;  4GQB B;  4MK0 B;  4O9D A;  3RFH A;  5AJA A;  3DSM A;  4U7A A;  2OK4 A;  3SFZ A;  4E54 B;  1GOT B;  4BL0 A;  3FGB A;  5EML B;  5HYN B;  4QQE A;  2H13 A;  2I3T A;  4PBY A;  2OVR B;  3JPX A;  4KFM B;  1RI6 A;  3HFQ A;  4GGC A;  4FWW A;  3I7N A;  3VH0 A;  3OKY B;  5H1M A;  4GM9 A;  4CC9 A;  3VA6 A;  3OKT A;  4X61 B;  4LG9 A;  3I7K A;  3SXT D;  5HE3 B;  4A09 A;  1PGU A;  5IGO A;  2O9K A;  1K8K C;  2IUP A;  3UVL A;  5TEF A;  5EAP A;  2UZY B;  4GGD A;  4J87 A;  4J82 A;  2I0R A;  2XL2 A;  3EI2 B;  3IKO A;  1PBY B;  3C75 H;  5GXI A;  1XHM A;  3MKS B;  4GGA A;  5I5J A;  4A0B A;  5HE1 B;  4LGN A;  1VYH C;  2Z2P A;  2GC7 A;  1JMZ B;  2H14 A;  2CE8 A;  5KDO B;  3AFC A;  4CZX A;  3EU7 A;  3EG6 A;  3SVW D;  2HYE A;  4A09 B;  4A0A A;  3JB9 L;  4FAV D;  3PSL A;  4A08 A;  5A2Q g;  5JWZ A;  4J84 A;  3K27 A;  2H9P A;  3MXX A;  3IJ0 A;  4JT6 C;  4Z8L A;  3I8C A;  2W18 A;  3EI1 A;  3EI3 A;  5FKQ A;  4J73 A;  3IIW A;  4FA1 D;  3GRE A;  3JRP A;  3GFC A;  2BBK H;  4FA5 D;  3OL2 A;  4A0B B;  2YNN A;  3EMH A;  1R5M A;  5K19 A;  3NVN A;  4GM8 A;  3SCY A;  1NR0 A;  2BCJ B;  5C9Z B;  4YVD A;  3OKW A;  3PXS D;  5IJ7 E;  3OTT A;  3UR4 A;  5TEE A;  3UVM A;  4X3E A;  4E54 A;  2QXV A;  3F3P A;  3NVQ A;  4PSX B;  5FXY A;  3UKU C;  3I2N A;  3I8E A;  2CO0 A;  2HXC A;  3NVX A;  4Y5R D;  1PEV A;  3JZG A;  2B5L A;  3BG0 A;  4JXM A;  4CZV A;  4QT8 A;  4FA4 D;  2P9P C;  2GC4 A;  4QL1 A;  3I7H A;  2QC5 A;  3OKY A;  3EI1 B;  2B5N A;  4A2L A;  3EI3 B;  4A11 A;  3P4F A;  4FHL A;  4ERQ A;  2H68 A;  1U2V C;  5TF2 A;  4O1Q D;  3KRX B;  4O3T B;  4A7J A;  5I5M A;  2YMU A;  4GZ8 A;  3EI2 A;  3UVO A;  1TBG A;  2IWK A;  3JRO A;  3KRW B;  3RN1 D;  4J0W A;  4EWR A;  4JD2 C;  3RMZ D;  2CO0 C;  5HE0 B;  2J55 H;  3AL8 B;  2YNP A;  1PI6 A;  3PVU B;  2OK6 A;  2P9K C;  4JT5 C;  4L9O A;  1B9X A;  4GQ2 P;  3F3F A;  4U1E I;  5FKS A;  4J79 A;  3VGZ A;  4A11 B;  2H9N A;  3JZH A;  1GP2 B;  3ORV D;  3PXT D;  4D6V A;  2H6N A;  2HKR A;  3C9C A;  3FRX A;  4E5Z A;  2GNQ A;  4ZN4 A;  2OJY A;  3PXW D;  2CNX A;  2Z2O A;  3JZN A;  3ZWL B;  4PXW A;  3JAM g;  3EWE A;  3N0E A;  3OW8 A;  5IT9 g;  3B7F A;  4L3G D;  5H14 A;  5FA5 B;  4R7A B;  2OVQ B;  2AGL A;  3V5W B;  3SHF A;  5EAL A;  4TZ4 A;  3C5M A;  4FB1 D;  5GXH A;  3RN0 D;  5SXM A;  3RRM C;  5C2V B;  4CY2 A;  4E5Z B;  3I89 A;  1N6F A;  2J57 G;  2AGZ A;  3UVK A;  4J86 A;  2MTA H;  1B9Y A;  4X60 B;  5EMJ B;  3SN6 B;  1ERJ A;  3U4Y A;  4J81 A;  4JSV C;  2XU7 A;  4J78 A;  4NSX A;  4D0K A;  1GXR A;  2G9A A;  2P9L C;  3FM0 A;  4PBZ A;  3C99 A;  4CZY A;  4GQ1 A;  4CI3 A;  2AQ5 A;  4ZOV A;  2EBS A;  2P9U C;  4AEZ A;  3L4M D;  4XYI A;  4BUJ C;  3PVW B;  2B5M A;  3UKR C;  3AH8 B;  3MZK A;  4CI1 A;  1Q47 A;  3RFG A;  2IUV A;  4O3U B;  2H9M A;  2P9I C;  1SQ9 A;  2I3S A;  1SQJ A;  5TDH B;  3AL8 A;  2CN2 A;  3EI4 B;  3UVN A;  3J81 g;  4A2M A;  2Z2N A;  5I5I A;  5CXC A;  1N6E A;  3F3G A;  1U4C A;  4QRJ A;  4IMM A;  3I7L A;  2Q7Q A;  2OVP B;  4ERY A;  2AH1 A;  3W15 A;  3IJC A;  1JOF A;  1JJU B;  1NEX B;  4J8G A;  1QNI A;  2IAA A;  3DWL C;  2IUR A;  5IJ8 E;  1SHY B;  5HQG A;  5CYK B;  3K26 A;  2CE9 A;  1L0Q A;  4L3H D;  5GSA A;  2J56 H;  4IA9 A;  3I7P A;  5EM2 A;  2XL3 A;  5FQD A;  4JSN C;  5CXC B;  3AL9 A;  3V9F A;  4I79 A;  3SJL D;  4JSX C;  3SBP A;  4X63 B;  4ESG A;  4LG8 A;  4UI9 R;  4FA9 D;  3J80 g;  4PC0 A;  1GG2 B;  2PM6 B;  4XEI C;  4Y7R A;  4AOW A;  5C2W B;  3PE7 A;  1XKS A;  5EMK B;  3E0C A;  1FWX A;  3IJ1 A;  2AGX A;  2PM9 B;  2TRC B;  5EAR A;  4ES0 A;  4ZOZ A;  2IUQ A;  4GM3 A;  1OMW B;  3MZL A;  4K3I D;  4CY1 A;  5THA A;  2OIZ A;  3CIK B;  5CXB A;  3SWS D;  3I7O A;  2H6K A;  2XYI A;  5EM2 B;  2P9S C;  1OLZ A;  2G99 A;  2HKM A;  2AH0 A;  4N14 A;  2HJB A;  2H9L A;  4CY3 A;  1MDA H;  3SBR A;  3BWS A;  4GMB A;  4JSP C;  4G56 B;  2HJ4 A;  2HES X;  2I0T A;  3CFS B;  3A0F A;  5GMK n;  4HDJ A;  1YFQ A;  3EI4 A;  2PBI B;  4PNK B;  3SMR A;  3N0D A;  4H5I A;  4OZU A;  2IWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...