4L9OA

Crystal structure of the sec13-sec16 blade-inserted complex from pichia pastoris
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
347
structure length
330
Chain Sequence
SHMTAPVVRNPRTQFPIFHWCRGGKALSMLPKFDTYGQSKVEINIVGSGSVTIGNAHDDLIHDAVLDYYGRRLATCSSDKTIKIFEIQRLVETLIGHEGPVWQVAWAHPKFGVILASCSYDGKVLIWKEDNGVWNKVAEHSVHQASVNSVSWAPHEYGPVLLCASSDGKISIVEFKDGGALEPIVIQGHAIGVNAASWAPISNTRRFVSGGCDNLVKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPSRLSKSYIATASQDRTVLIWTKDGKSNKWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLWKENIQGKWESAGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sec16,Protein transport protein SEC13
publication title Sec16 influences transitional ER sites by regulating rather than organizing COPII.
pubmed doi rcsb
source organism Komagataella pastoris
molecule tags Protein transport
total genus 73
structure length 330
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l9oA00
2HXCA 3EWEA 3BWSA 1R5MA 4FA9D 5SXMA 1MDAH 3DXKC 5AMSA 4A0AB 2CO0C 3NVNA 5IJ8E 4GGCA 1JMZB 4D6VA 1GG2B 3UVNA 2AH1A 4GM9A 2OVQB 5I5MA 4QQEA 1TBGA 3SXTD 4O3UB 3JZHA 5K19A 3U4YA 1MG2A 4U7AA 4CI8A 4J77A 3SCYA 4L1QD 4XEIC 4JXMA 3PSCB 1U4CA 4OWRA 4A0BB 5IC7A 4I79A 4FAND 4A0BA 2YBAA 5H17A 2J57G 2OK6A 3JRPA 1N6DA 4CY2A 3F3GA 2UZYB 3RMZD 3FM0A 3FRXA 5C2WB 3ORVD 4CC9A 4PBZA 2H9NA 5EAMA 2P9IC 2OVPB 4R7AB 4O9DA 4IMMA 2Z2NA 4FWWA 3C5MA 3OL2B 4LGNA 4X61B 4J73A 3OL2A 2H47A 1K8KC 1K32A 3AFCA 2HJ4A 5FKQA 3MMYA 4ES0A 2YMUA 4CI2A 2AQ5A 4L3GD 3SN6B 4AOWA 2MTAH 3AH8B 4XYHA 4E54B 3JAMg 5GXIA 4X60B 2CNXA 3SHFA 2IUVA 3L4MD 5FKRA 1N6EA 2PM9A 4ZOVA 2I3SA 4ESGA 4NSXA 4BH6A 3CIKB 4EWRA 5TDHB 2HESX 2CE8A 5EMMB 4H5IA 4ZN4A 1SQ9A 3NVXA 5I5JA 4G56B 2I3TA 2H13A 1ERJA 4X63B 3UVKA 5EMKB 4J84A 2H68A 2HKRA 3IJCA 2TRCB 4KFMB 3SFZA 4PC0A 3PE7A 2HJBA 2IWKA 2OK4A 1JJUB 3B7FA 4UI9R 4QT8A 4D0KA 2I0TA 3EI1B 3J81g 3JZNA 5CYKB 5HE3B 3I7OA 3AL8B 3I7NA 4GQ2P 2EBSA 1N6FA 2IUQA 4GM3A 4A0AA 3RRMC 3UKUC 2XL3A 1YFQA 1VYHC 4CY1A 3PSLA 3JZGA 3I89A 1NR0A 3IJ1A 5TF2A 1PBYB 1GP2B 3E0CA 2YNPA 2H6QA 4LG8A 4GQ1A 1OMWB 4PBYA 2H9PA 3UKRC 1B9XA 1RI6A 4JSVC 1TYQC 5HE2B 4O45A 3PVUB 4L3HD 5H1MA 3MKSB 2P9SC 3JPXA 3DSMA 3I7HA 5IT9g 4QRJA 3GREA 1XIPA 2GNQA 3IJ0A 3SMRA 3W15A 4CI1A 1XHMA 2P9UC 5EM2B 3C9CA 3SVWD 2AGXA 4JSPC 3I2NA 4PSXB 3SBPA 5AFU3 4J78A 3C99A 3JROA 4PNKB 4Z8LA 3EI4B 1B9YA 4Y5RD 3EI4A 1FWXA 3EI2B 2Z2OA 2IAAA 2OVRB 4BUJC 3FGBA 2YNNA 4J8GA 3IKOA 3P4FA 3RN1D 2AGWA 5GSAA 3RLMD 3BG1A 3UVMA 2G99A 5CXBB 4Y7RA 4BL0A 1JMXB 3RFHA 5TEFA 1A0RB 4E54A 5CXBA 2I0RA 5FKTA 4FHLA 4FB1D 5HQGA 4K3ID 2CO0A 4CZYA 3KRXB 3SBRA 4J87A 1NEXB 2B5MA 4GM8A 5FXYA 5C9ZB 3EU7A 4A08B 2QXVA 5EMLB 2H9MA 4JT5C 5EMJB 5HE1B 4FAVD 3F3PA 4A08A 4O1QD 2J56H 2P9KC 2H9LA 4J81A 5FA5B 4FA4D 5TEEA 3VGZA 1U2VC 2UZXB 5HYNB 4A09B 5JWZA 4A7JA 4CZVA 3MXXA 2Z2PA 3SLED 5IGQA 3KRWB 2AGLA 3A0FA 4CZXA 5EARA 3I8EA 2H6KA 4A2LA 2PBIB 2W18A 1P22A 3EI1A 3I7KA 4ERQA 2AGYA 5CXCB 3AL9A 3L4OD 5CYKA 3MZLA 3AL8A 4ZOZA 4YVDA 3VA6A 4J8BA 4A2MA 5H14A 3SBQA 1XKSA 2HKMA 2B4EA 3PXTD 4AEZA 4HDJA 2GC7A 2CN3A 2QC5A 4GGAA 1PI6A 3EG6A 4H5JA 5EAPA 3UR4A 1SHYB 3OKTA 1GXRA 3MKQA 4X3EA 3OKWA 3V9FA 3N0EA 2PM6B 4QL1A 3C75H 4CI3A 4J79A 4TZ4A 2BBKH 3ULEC 5A2Qg 2B5LA 3UVLA 4JT6C 4CY3A 4E5ZB 2YNOA 1MG3A 3F3FA 4E5ZA 3BG0A 4JSNC 3V5WB 3MZKA 2IUPA 5THAA 4FA1D 3OKYB 3ODTA 3OKYA 3K26A 3EI3B 2HYEA 3OW8A 4PXWA 4OZUA 3EI3A 2IURA 5IJ7E 5EM2A 4U1EI 3NVQA 1QNIA 5C2VB 2B5NA 3PXWD 3VH0A 2H3XA 2IWFA 2CN2A 2OJYA 3RFGA 4K3JB 3PXSD 4ZOXA 3RN0D 5FQDA 2Q7QA 5GMKn 3EI2A 3N0DA 3EMHA 4PSWB 2P9NC 4GQBB 2CE9A 2AH0A 2YB8B 3SJLD 3SWSD 5HE0B 3I8CA 3DWLC 3CFSB 5EALA 5KDOB 4XYIA 1PGUA 2AGZA 5FLXg 2H14A 4IA9A 1GOTB 3J80g 2O9KA 5FKSA 5B4WA 1OLZA 3IIWA 3IIYA 3UVOA 4FA5D 4CY5A 4ERYA 5IGOA 4J0WA 3DM0A 3RSEC 4ZOYA 5I5IA 2BCJB 2XU7A 4N14A 5GXHA 2PM9B 4A11B 3I7LA 4A11A 4MK0B 2J55H 4GGDA 4GZ8A 3I7PA 3OTTA 4J0XA 4L9OA 3JB9L 2PM7B 4ERZA 4A09A 2XYIA 2G9AA 4J86A 3K27A 3V7DB 4O3TB 1Q47A 4J82A 3ZWLB 3DXMC 4GMBA 4JSXC 2P9PC 3GFCA 5K1CC 2OIZA 5CXCA 2GC4A 1L0QA 1PEVA 4LG9A 1SQJA 1JOFA 2P9LC 1S4UX 4JD2C 2H6NA 2XL2A 3PVWB 3HFQA 2I0SA 5AJAA 3CFVA
chains in the Genus database with same CATH superfamily
2HXCA 3EWEA 3BWSA 1R5MA 4FA9D 5SXMA 1MDAH 3DXKC 3IUMA 5AMSA 4A0AB 2CO0C 3NVNA 5IJ8E 4GGCA 1JMZB 4D6VA 4NC4A 1GG2B 3UVNA 2EIBA 2AH1A 4GM9A 1UTCA 2OVQB 4RE6A 5I5MA 4QQEA 1TBGA 3SXTD 4O3UB 3EQ7A 3JZHA 5K19A 3U4YA 1MG2A 1T2XA 4U7AA 4CI8A 1YR2A 4BP9A 4WK0A 4J77A 5E6RA 4L1QD 3SCYA 4XEIC 4JXMA 3PSCB 1U4CA 4OWRA 3NIGA 4A0BB 3FCSA 5IC7A 4I79A 5E6SA 4FAND 4A0BA 2YBAA 5H17A 2HU7A 1H2XA 2J57G 2OK6A 3JRPA 1N6DA 4CY2A 3F3GA 2UZYB 3RMZD 3FM0A 3FRXA 5C2WB 3ORVD 3GD1I 1E8NA 3GC3B 4CC9A 4PBZA 4AMZA 2H9NA 5EAMA 1GOHA 2P9IC 2OVPB 4R7AB 4O9DA 3K72A 4IMMA 2Z2NA 4FWWA 3C5MA 3OL2B 4LGNA 4X61B 4J73A 3OL2A 2H47A 4NAAA 1K8KC 1K32A 3AFCA 2HJ4A 5FKQA 3K71A 3MMYA 4ES0A 2YMUA 4Z7QA 4CI2A 2AQ5A 4L3GD 3SN6B 4AOWA 2MTAH 3AH8B 4XYHA 4E54B 3JAMg 2HU8A 5GXIA 4X60B 2CNXA 3SHFA 2IUVA 3L4MD 2EICA 5FKRA 1N6EA 3T3PA 2PM9A 2VDRA 4RE5A 4ZOVA 2I3SA 3NIDA 4ESGA 4NSXA 4BH6A 3CIKB 4EWRA 5TDHB 2HESX 1QFMA 2CE8A 5EMMB 4H5IA 4ZN4A 1O6FA 3V4VA 1SQ9A 3IJEA 3NVXA 5I5JA 4G56B 2I3TA 3K6SA 2H13A 1BPOA 1ERJA 4X63B 3UVKA 5EMKB 4J84A 2H68A 2HKRA 3IJCA 2TRCB 4KFMB 1JTDB 2VDNA 3SFZA 4PC0A 3PE7A 2HJBA 2IWKA 2OK4A 1JJUB 3B7FA 4UI9R 1VZ2A 4QT8A 4DNUA 4D0KA 2I0TA 3EI1B 3J81g 3EQ9A 1K3IA 3JZNA 5M5RA 5CYKB 1H2ZA 5HE3B 3I7OA 3AL8B 3I7NA 4GQ2P 3ZE2A 2EBSA 1N6FA 2IUQA 4GM3A 4A0AA 3RRMC 3UKUC 2QZPA 2XL3A 1YFQA 1VYHC 4CY1A 3IURA 3PSLA 3JZGA 3I89A 3T3MA 5M61A 1NR0A 3IJ1A 4BCCA 1QFSA 1PBYB 5TF2A 1GP2B 3E0CA 3QHYB 2XZGA 2YNPA 3ZE0A 3VI3A 2H6QA 4LG8A 4GQ1A 1OMWB 4JHNA 4PBYA 2H9PA 3UKRC 1B9XA 1RI6A 4JSVC 1E8MA 1TYQC 5HE2B 4O45A 3MVDK 2WQ8A 3PVUB 4L3HD 4WK2A 5H1MA 2HU5A 3MKSB 2P9SC 3JPXA 4AN1A 3DSMA 3I7HA 5IT9g 1I2MB 4QRJA 3GREA 1XIPA 3O4HA 4NENA 2GNQA 1GOFA 3IJ0A 1VE6A 3IUNA 3SMRA 3W15A 4CI1A 2VZ3A 4UM8A 1XHMA 2P9UC 5EM2B 3C9CA 4AMYA 3MUNA 3O4GA 3SVWD 2AGXA 4JSPC 3I2NA 4PSXB 3SBPA 4AX4A 5AFU3 3ZDXA 4J78A 1JV2A 4O02A 3C99A 3JROA 4PNKB 4Z8LA 3EI4B 4JHPC 1B9YA 4Y5RD 3EI4A 4G1EA 1FWXA 3EI2B 2Z2OA 4Z7OA 2IAAA 2OVRB 4NBMA 3FGBA 4BUJC 2YNNA 4J8GA 3IKOA 3P4FA 3RN1D 2AGWA 5GSAA 3RLMD 3BG1A 3UVMA 4UM9A 2G99A 5CXBB 4Y7RA 3VI4A 3V4PA 4BL0A 1JMXB 3RFHA 5TEFA 1A0RB 4E54A 5CXBA 2I0RA 3IUJA 1A12A 3EQ8A 5FKTA 1H2WA 4FHLA 4FB1D 2VDMA 5HQGA 4K3ID 4G1MA 5E6UA 2CO0A 4CZYA 3KRXB 3SBRA 4J87A 1NEXB 4G55A 2B5MA 4GM8A 5FXYA 5C9ZB 3EU7A 3IULA 4A08B 4BCBA 2QXVA 5EMLB 2H9MA 4JT5C 5EMJB 5HE1B 4FAVD 3F3PA 4A08A 4O1QD 1E5TA 2J56H 2EIDA 5M5VA 4IRZA 2VDOA 2P9KC 2H9LA 4J81A 5FA5B 4FA4D 5TEEA 3VGZA 1M1XA 1U2VC 3IVMA 2UZXB 4L1MA 5HYNB 4A09B 5JWZA 4A7JA 4CZVA 3MXXA 2Z2PA 3SLED 5IGQA 3KRWB 4BP8A 2AGLA 1TYEA 3A0FA 4CZXA 5EARA 3I8EA 2H6KA 4A2LA 2PBIB 2QR5A 2W18A 1P22A 3EI1A 1VZ3A 3I7KA 4ERQA 2AGYA 5CXCB 3AL9A 3L4OD 5CYKA 2EIEA 3MZLA 3AL8A 4ZOZA 4YVDA 3VA6A 4J8BA 4A2MA 5H14A 3SBQA 1XKSA 4QAMA 2HKMA 3NIFA 3DDUA 1UOQA 4BCDA 2B4EA 3PXTD 4AEZA 4HDJA 2GC7A 3QI0A 2CN3A 2QC5A 4GGAA 1PI6A 3EG6A 4H5JA 5EAPA 3UR4A 1SHYB 3OKTA 1GXRA 3MKQA 4X3EA 3OKWA 3V9FA 3N0EA 2XDWA 2JKXA 2PM6B 4QL1A 3C75H 4CI3A 4J79A 3KCIA 4TZ4A 2BKLA 2BBKH 3ULEC 5A2Qg 2B5LA 3UVLA 4JT6C 4CY3A 4E5ZB 2YNOA 1MG3A 3F3FA 4E5ZA 3BG0A 4JSNC 3V5WB 3MZKA 2IUPA 5THAA 4FA1D 3OKYB 3ZDYA 1L5GA 2XE4A 3ODTA 3OKYA 3K26A 3EI3B 3ZE1A 2HYEA 3MUOA 1H2YA 3OW8A 4PXWA 4OZUA 3EI3A 2IURA 5IJ7E 2VDQA 5EM2A 4U1EI 3NVQA 1QNIA 5C2VB 2B5NA 5FFOA 3PXWD 3VH0A 2VZ1A 3O4JA 2H3XA 5C92A 2IWFA 2CN2A 3FCUA 2OJYA 3RFGA 4K3JB 3PXSD 4ZOXA 3RN0D 5FQDA 2Q7QA 5GMKn 3EI2A 2VDPA 3O4IA 3IUQA 3N0DA 4DNVA 5M5TA 3EMHA 4PSWB 2P9NC 5M5SA 4GQBB 2CE9A 2AH0A 2YB8B 4MMZA 3SJLD 3SWSD 5HE0B 3I8CA 3DWLC 3CFSB 5EALA 4WJKA 4XYIA 5KDOB 1PGUA 2AGZA 5HDBA 5FLXg 2H14A 4IA9A 1GOTB 2VDLA 3J80g 4AN0A 2O9KA 1U8CA 5FKSA 5B4WA 1OLZA 3IIWA 3IIYA 4O2WA 3UVOA 4FA5D 4CY5A 1C9IA 4ERYA 5IGOA 1UOOA 1GOGA 4J0WA 3DM0A 5M5UA 3RSEC 4ZOYA 5I5IA 2BCJB 2XU7A 4N14A 5GXHA 4MMXA 1UOPA 2PM9B 4A11B 3I7LA 4A11A 4MK0B 2J55H 4GGDA 4MMYA 3ZDZA 4GZ8A 3I7PA 3OTTA 4J0XA 4L9OA 3JB9L 1VE7A 4WK4A 2VC2A 2PM7B 5C86A 4ERZA 5FFGA 4A09A 2XYIA 2VDKA 2G9AA 1C9LA 4J86A 3K27A 3V7DB 4O3TB 1Q47A 4J82A 3ZWLB 3DXMC 4GMBA 4JSXC 2P9PC 3GFCA 4D9SA 4Z7NA 5K1CC 2OIZA 5CXCA 3OF7A 2GC4A 1L0QA 1PEVA 4DNWA 4LG9A 1SQJA 1JOFA 2P9LC 1S4UX 4JD2C 2H6NA 1O6GA 2XL2A 3PVWB 3HFQA 2I0SA 5AJAA 3CFVA
chains in the Genus database with same CATH topology
2HXCA 3EWEA 3BWSA 1R5MA 4FA9D 5SXMA 1MDAH 3DXKC 5AMSA 4A0AB 2CO0C 3NVNA 5IJ8E 4GGCA 1JMZB 4D6VA 1GG2B 3UVNA 2AH1A 4GM9A 2OVQB 5I5MA 4QQEA 1TBGA 3SXTD 4O3UB 3JZHA 5K19A 3U4YA 1MG2A 4U7AA 4CI8A 4J77A 3SCYA 4L1QD 4XEIC 4JXMA 3PSCB 1U4CA 4OWRA 4A0BB 5IC7A 4I79A 4FAND 4A0BA 2YBAA 5H17A 2J57G 2OK6A 3JRPA 1N6DA 4CY2A 3F3GA 2UZYB 3RMZD 3FM0A 3FRXA 5C2WB 3ORVD 4CC9A 4PBZA 2H9NA 5EAMA 2P9IC 2OVPB 4R7AB 4O9DA 4IMMA 2Z2NA 4FWWA 3C5MA 3OL2B 4LGNA 4X61B 4J73A 3OL2A 2H47A 1K8KC 1K32A 3AFCA 2HJ4A 5FKQA 3MMYA 4ES0A 2YMUA 4CI2A 2AQ5A 4L3GD 3SN6B 4AOWA 2MTAH 3AH8B 4XYHA 4E54B 3JAMg 5GXIA 4X60B 2CNXA 3SHFA 2IUVA 3L4MD 5FKRA 1N6EA 2PM9A 4ZOVA 2I3SA 4ESGA 4NSXA 4BH6A 3CIKB 4EWRA 5TDHB 2HESX 2CE8A 5EMMB 4H5IA 4ZN4A 1SQ9A 3NVXA 5I5JA 4G56B 2I3TA 2H13A 1ERJA 4X63B 3UVKA 5EMKB 4J84A 2H68A 2HKRA 3IJCA 2TRCB 4KFMB 3SFZA 4PC0A 3PE7A 2HJBA 2IWKA 2OK4A 1JJUB 3B7FA 4UI9R 4QT8A 4D0KA 2I0TA 3EI1B 3J81g 3JZNA 5CYKB 5HE3B 3I7OA 3AL8B 3I7NA 4GQ2P 2EBSA 1N6FA 2IUQA 4GM3A 4A0AA 3RRMC 3UKUC 2XL3A 1YFQA 1VYHC 4CY1A 3PSLA 3JZGA 3I89A 1NR0A 3IJ1A 5TF2A 1PBYB 1GP2B 3E0CA 2YNPA 2H6QA 4LG8A 4GQ1A 1OMWB 4PBYA 2H9PA 3UKRC 1B9XA 1RI6A 4JSVC 1TYQC 5HE2B 4O45A 3PVUB 4L3HD 5H1MA 3MKSB 2P9SC 3JPXA 3DSMA 3I7HA 5IT9g 4QRJA 3GREA 1XIPA 2GNQA 3IJ0A 3SMRA 3W15A 4CI1A 1XHMA 2P9UC 5EM2B 3C9CA 3SVWD 2AGXA 4JSPC 3I2NA 4PSXB 3SBPA 5AFU3 4J78A 3C99A 3JROA 4PNKB 4Z8LA 3EI4B 1B9YA 4Y5RD 3EI4A 1FWXA 3EI2B 2Z2OA 2IAAA 2OVRB 4BUJC 3FGBA 2YNNA 4J8GA 3IKOA 3P4FA 3RN1D 2AGWA 5GSAA 3RLMD 3BG1A 3UVMA 2G99A 5CXBB 4Y7RA 4BL0A 1JMXB 3RFHA 5TEFA 1A0RB 4E54A 5CXBA 2I0RA 5FKTA 4FHLA 4FB1D 5HQGA 4K3ID 2CO0A 4CZYA 3KRXB 3SBRA 4J87A 1NEXB 2B5MA 4GM8A 5FXYA 5C9ZB 3EU7A 4A08B 2QXVA 5EMLB 2H9MA 4JT5C 5EMJB 5HE1B 4FAVD 3F3PA 4A08A 4O1QD 2J56H 2P9KC 2H9LA 4J81A 5FA5B 4FA4D 5TEEA 3VGZA 1U2VC 2UZXB 5HYNB 4A09B 5JWZA 4A7JA 4CZVA 3MXXA 2Z2PA 3SLED 5IGQA 3KRWB 2AGLA 3A0FA 4CZXA 5EARA 3I8EA 2H6KA 4A2LA 2PBIB 2W18A 1P22A 3EI1A 3I7KA 4ERQA 2AGYA 5CXCB 3AL9A 3L4OD 5CYKA 3MZLA 3AL8A 4ZOZA 4YVDA 3VA6A 4J8BA 4A2MA 5H14A 3SBQA 1XKSA 2HKMA 2B4EA 3PXTD 4AEZA 4HDJA 2GC7A 2CN3A 2QC5A 4GGAA 1PI6A 3EG6A 4H5JA 5EAPA 3UR4A 1SHYB 3OKTA 1GXRA 3MKQA 4X3EA 3OKWA 3V9FA 3N0EA 2PM6B 4QL1A 3C75H 4CI3A 4J79A 4TZ4A 2BBKH 3ULEC 5A2Qg 2B5LA 3UVLA 4JT6C 4CY3A 4E5ZB 2YNOA 1MG3A 3F3FA 4E5ZA 3BG0A 4JSNC 3V5WB 3MZKA 2IUPA 5THAA 4FA1D 3OKYB 3ODTA 3OKYA 3K26A 3EI3B 2HYEA 3OW8A 4PXWA 4OZUA 3EI3A 2IURA 5IJ7E 5EM2A 4U1EI 3NVQA 1QNIA 5C2VB 2B5NA 3PXWD 3VH0A 2H3XA 2IWFA 2CN2A 2OJYA 3RFGA 4K3JB 3PXSD 4ZOXA 3RN0D 5FQDA 2Q7QA 5GMKn 3EI2A 3N0DA 3EMHA 4PSWB 2P9NC 4GQBB 2CE9A 2AH0A 2YB8B 3SJLD 3SWSD 5HE0B 3I8CA 3DWLC 3CFSB 5EALA 5KDOB 4XYIA 1PGUA 2AGZA 5FLXg 2H14A 4IA9A 1GOTB 3J80g 2O9KA 5FKSA 5B4WA 1OLZA 3IIWA 3IIYA 3UVOA 4FA5D 4CY5A 4ERYA 5IGOA 4J0WA 3DM0A 3RSEC 4ZOYA 5I5IA 2BCJB 2XU7A 4N14A 5GXHA 2PM9B 4A11B 3I7LA 4A11A 4MK0B 2J55H 4GGDA 4GZ8A 3I7PA 3OTTA 4J0XA 4L9OA 3JB9L 2PM7B 4ERZA 4A09A 2XYIA 2G9AA 4J86A 3K27A 3V7DB 4O3TB 1Q47A 4J82A 3ZWLB 3DXMC 4GMBA 4JSXC 2P9PC 3GFCA 5K1CC 2OIZA 5CXCA 2GC4A 1L0QA 1PEVA 4LG9A 1SQJA 1JOFA 2P9LC 1S4UX 4JD2C 2H6NA 2XL2A 3PVWB 3HFQA 2I0SA 5AJAA 3CFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXC A;  3EWE A;  3BWS A;  1R5M A;  4FA9 D;  5SXM A;  1MDA H;  3DXK C;  5AMS A;  4A0A B;  2CO0 C;  3NVN A;  5IJ8 E;  4GGC A;  1JMZ B;  4D6V A;  1GG2 B;  3UVN A;  2AH1 A;  4GM9 A;  2OVQ B;  5I5M A;  4QQE A;  1TBG A;  3SXT D;  4O3U B;  3JZH A;  5K19 A;  3U4Y A;  1MG2 A;  4U7A A;  4CI8 A;  4J77 A;  3SCY A;  4L1Q D;  4XEI C;  4JXM A;  3PSC B;  1U4C A;  4OWR A;  4A0B B;  5IC7 A;  4I79 A;  4FAN D;  4A0B A;  2YBA A;  5H17 A;  2J57 G;  2OK6 A;  3JRP A;  1N6D A;  4CY2 A;  3F3G A;  2UZY B;  3RMZ D;  3FM0 A;  3FRX A;  5C2W B;  3ORV D;  4CC9 A;  4PBZ A;  2H9N A;  5EAM A;  2P9I C;  2OVP B;  4R7A B;  4O9D A;  4IMM A;  2Z2N A;  4FWW A;  3C5M A;  3OL2 B;  4LGN A;  4X61 B;  4J73 A;  3OL2 A;  2H47 A;  1K8K C;  1K32 A;  3AFC A;  2HJ4 A;  5FKQ A;  3MMY A;  4ES0 A;  2YMU A;  4CI2 A;  2AQ5 A;  4L3G D;  3SN6 B;  4AOW A;  2MTA H;  3AH8 B;  4XYH A;  4E54 B;  3JAM g;  5GXI A;  4X60 B;  2CNX A;  3SHF A;  2IUV A;  3L4M D;  5FKR A;  1N6E A;  2PM9 A;  4ZOV A;  2I3S A;  4ESG A;  4NSX A;  4BH6 A;  3CIK B;  4EWR A;  5TDH B;  2HES X;  2CE8 A;  5EMM B;  4H5I A;  4ZN4 A;  1SQ9 A;  3NVX A;  5I5J A;  4G56 B;  2I3T A;  2H13 A;  1ERJ A;  4X63 B;  3UVK A;  5EMK B;  4J84 A;  2H68 A;  2HKR A;  3IJC A;  2TRC B;  4KFM B;  3SFZ A;  4PC0 A;  3PE7 A;  2HJB A;  2IWK A;  2OK4 A;  1JJU B;  3B7F A;  4UI9 R;  4QT8 A;  4D0K A;  2I0T A;  3EI1 B;  3J81 g;  3JZN A;  5CYK B;  5HE3 B;  3I7O A;  3AL8 B;  3I7N A;  4GQ2 P;  2EBS A;  1N6F A;  2IUQ A;  4GM3 A;  4A0A A;  3RRM C;  3UKU C;  2XL3 A;  1YFQ A;  1VYH C;  4CY1 A;  3PSL A;  3JZG A;  3I89 A;  1NR0 A;  3IJ1 A;  5TF2 A;  1PBY B;  1GP2 B;  3E0C A;  2YNP A;  2H6Q A;  4LG8 A;  4GQ1 A;  1OMW B;  4PBY A;  2H9P A;  3UKR C;  1B9X A;  1RI6 A;  4JSV C;  1TYQ C;  5HE2 B;  4O45 A;  3PVU B;  4L3H D;  5H1M A;  3MKS B;  2P9S C;  3JPX A;  3DSM A;  3I7H A;  5IT9 g;  4QRJ A;  3GRE A;  1XIP A;  2GNQ A;  3IJ0 A;  3SMR A;  3W15 A;  4CI1 A;  1XHM A;  2P9U C;  5EM2 B;  3C9C A;  3SVW D;  2AGX A;  4JSP C;  3I2N A;  4PSX B;  3SBP A;  5AFU 3;  4J78 A;  3C99 A;  3JRO A;  4PNK B;  4Z8L A;  3EI4 B;  1B9Y A;  4Y5R D;  3EI4 A;  1FWX A;  3EI2 B;  2Z2O A;  2IAA A;  2OVR B;  4BUJ C;  3FGB A;  2YNN A;  4J8G A;  3IKO A;  3P4F A;  3RN1 D;  2AGW A;  5GSA A;  3RLM D;  3BG1 A;  3UVM A;  2G99 A;  5CXB B;  4Y7R A;  4BL0 A;  1JMX B;  3RFH A;  5TEF A;  1A0R B;  4E54 A;  5CXB A;  2I0R A;  5FKT A;  4FHL A;  4FB1 D;  5HQG A;  4K3I D;  2CO0 A;  4CZY A;  3KRX B;  3SBR A;  4J87 A;  1NEX B;  2B5M A;  4GM8 A;  5FXY A;  5C9Z B;  3EU7 A;  4A08 B;  2QXV A;  5EML B;  2H9M A;  4JT5 C;  5EMJ B;  5HE1 B;  4FAV D;  3F3P A;  4A08 A;  4O1Q D;  2J56 H;  2P9K C;  2H9L A;  4J81 A;  5FA5 B;  4FA4 D;  5TEE A;  3VGZ A;  1U2V C;  2UZX B;  5HYN B;  4A09 B;  5JWZ A;  4A7J A;  4CZV A;  3MXX A;  2Z2P A;  3SLE D;  5IGQ A;  3KRW B;  2AGL A;  3A0F A;  4CZX A;  5EAR A;  3I8E A;  2H6K A;  4A2L A;  2PBI B;  2W18 A;  1P22 A;  3EI1 A;  3I7K A;  4ERQ A;  2AGY A;  5CXC B;  3AL9 A;  3L4O D;  5CYK A;  3MZL A;  3AL8 A;  4ZOZ A;  4YVD A;  3VA6 A;  4J8B A;  4A2M A;  5H14 A;  3SBQ A;  1XKS A;  2HKM A;  2B4E A;  3PXT D;  4AEZ A;  4HDJ A;  2GC7 A;  2CN3 A;  2QC5 A;  4GGA A;  1PI6 A;  3EG6 A;  4H5J A;  5EAP A;  3UR4 A;  1SHY B;  3OKT A;  1GXR A;  3MKQ A;  4X3E A;  3OKW A;  3V9F A;  3N0E A;  2PM6 B;  4QL1 A;  3C75 H;  4CI3 A;  4J79 A;  4TZ4 A;  2BBK H;  3ULE C;  5A2Q g;  2B5L A;  3UVL A;  4JT6 C;  4CY3 A;  4E5Z B;  2YNO A;  1MG3 A;  3F3F A;  4E5Z A;  3BG0 A;  4JSN C;  3V5W B;  3MZK A;  2IUP A;  5THA A;  4FA1 D;  3OKY B;  3ODT A;  3OKY A;  3K26 A;  3EI3 B;  2HYE A;  3OW8 A;  4PXW A;  4OZU A;  3EI3 A;  2IUR A;  5IJ7 E;  5EM2 A;  4U1E I;  3NVQ A;  1QNI A;  5C2V B;  2B5N A;  3PXW D;  3VH0 A;  2H3X A;  2IWF A;  2CN2 A;  2OJY A;  3RFG A;  4K3J B;  3PXS D;  4ZOX A;  3RN0 D;  5FQD A;  2Q7Q A;  5GMK n;  3EI2 A;  3N0D A;  3EMH A;  4PSW B;  2P9N C;  4GQB B;  2CE9 A;  2AH0 A;  2YB8 B;  3SJL D;  3SWS D;  5HE0 B;  3I8C A;  3DWL C;  3CFS B;  5EAL A;  5KDO B;  4XYI A;  1PGU A;  2AGZ A;  5FLX g;  2H14 A;  4IA9 A;  1GOT B;  3J80 g;  2O9K A;  5FKS A;  5B4W A;  1OLZ A;  3IIW A;  3IIY A;  3UVO A;  4FA5 D;  4CY5 A;  4ERY A;  5IGO A;  4J0W A;  3DM0 A;  3RSE C;  4ZOY A;  5I5I A;  2BCJ B;  2XU7 A;  4N14 A;  5GXH A;  2PM9 B;  4A11 B;  3I7L A;  4A11 A;  4MK0 B;  2J55 H;  4GGD A;  4GZ8 A;  3I7P A;  3OTT A;  4J0X A;  4L9O A;  3JB9 L;  2PM7 B;  4ERZ A;  4A09 A;  2XYI A;  2G9A A;  4J86 A;  3K27 A;  3V7D B;  4O3T B;  1Q47 A;  4J82 A;  3ZWL B;  3DXM C;  4GMB A;  4JSX C;  2P9P C;  3GFC A;  5K1C C;  2OIZ A;  5CXC A;  2GC4 A;  1L0Q A;  1PEV A;  4LG9 A;  1SQJ A;  1JOF A;  2P9L C;  1S4U X;  4JD2 C;  2H6N A;  2XL2 A;  3PVW B;  3HFQ A;  2I0S A;  5AJA A;  3CFV A; 
#chains in the Genus database with same CATH topology
 2HXC A;  3EWE A;  3BWS A;  1R5M A;  4FA9 D;  5SXM A;  1MDA H;  3DXK C;  3IUM A;  5AMS A;  4A0A B;  2CO0 C;  3NVN A;  5IJ8 E;  4GGC A;  1JMZ B;  4D6V A;  4NC4 A;  1GG2 B;  3UVN A;  2EIB A;  2AH1 A;  4GM9 A;  1UTC A;  2OVQ B;  4RE6 A;  5I5M A;  4QQE A;  1TBG A;  3SXT D;  4O3U B;  3EQ7 A;  3JZH A;  5K19 A;  3U4Y A;  1MG2 A;  1T2X A;  4U7A A;  4CI8 A;  1YR2 A;  4BP9 A;  4WK0 A;  4J77 A;  5E6R A;  4L1Q D;  3SCY A;  4XEI C;  4JXM A;  3PSC B;  1U4C A;  4OWR A;  3NIG A;  4A0B B;  3FCS A;  5IC7 A;  4I79 A;  5E6S A;  4FAN D;  4A0B A;  2YBA A;  5H17 A;  2HU7 A;  1H2X A;  2J57 G;  2OK6 A;  3JRP A;  1N6D A;  4CY2 A;  3F3G A;  2UZY B;  3RMZ D;  3FM0 A;  3FRX A;  5C2W B;  3ORV D;  3GD1 I;  1E8N A;  3GC3 B;  4CC9 A;  4PBZ A;  4AMZ A;  2H9N A;  5EAM A;  1GOH A;  2P9I C;  2OVP B;  4R7A B;  4O9D A;  3K72 A;  4IMM A;  2Z2N A;  4FWW A;  3C5M A;  3OL2 B;  4LGN A;  4X61 B;  4J73 A;  3OL2 A;  2H47 A;  4NAA A;  1K8K C;  1K32 A;  3AFC A;  2HJ4 A;  5FKQ A;  3K71 A;  3MMY A;  4ES0 A;  2YMU A;  4Z7Q A;  4CI2 A;  2AQ5 A;  4L3G D;  3SN6 B;  4AOW A;  2MTA H;  3AH8 B;  4XYH A;  4E54 B;  3JAM g;  2HU8 A;  5GXI A;  4X60 B;  2CNX A;  3SHF A;  2IUV A;  3L4M D;  2EIC A;  5FKR A;  1N6E A;  3T3P A;  2PM9 A;  2VDR A;  4RE5 A;  4ZOV A;  2I3S A;  3NID A;  4ESG A;  4NSX A;  4BH6 A;  3CIK B;  4EWR A;  5TDH B;  2HES X;  1QFM A;  2CE8 A;  5EMM B;  4H5I A;  4ZN4 A;  1O6F A;  3V4V A;  1SQ9 A;  3IJE A;  3NVX A;  5I5J A;  4G56 B;  2I3T A;  3K6S A;  2H13 A;  1BPO A;  1ERJ A;  4X63 B;  3UVK A;  5EMK B;  4J84 A;  2H68 A;  2HKR A;  3IJC A;  2TRC B;  4KFM B;  1JTD B;  2VDN A;  3SFZ A;  4PC0 A;  3PE7 A;  2HJB A;  2IWK A;  2OK4 A;  1JJU B;  3B7F A;  4UI9 R;  1VZ2 A;  4QT8 A;  4DNU A;  4D0K A;  2I0T A;  3EI1 B;  3J81 g;  3EQ9 A;  1K3I A;  3JZN A;  5M5R A;  5CYK B;  1H2Z A;  5HE3 B;  3I7O A;  3AL8 B;  3I7N A;  4GQ2 P;  3ZE2 A;  2EBS A;  1N6F A;  2IUQ A;  4GM3 A;  4A0A A;  3RRM C;  3UKU C;  2QZP A;  2XL3 A;  1YFQ A;  1VYH C;  4CY1 A;  3IUR A;  3PSL A;  3JZG A;  3I89 A;  3T3M A;  5M61 A;  1NR0 A;  3IJ1 A;  4BCC A;  1QFS A;  1PBY B;  5TF2 A;  1GP2 B;  3E0C A;  3QHY B;  2XZG A;  2YNP A;  3ZE0 A;  3VI3 A;  2H6Q A;  4LG8 A;  4GQ1 A;  1OMW B;  4JHN A;  4PBY A;  2H9P A;  3UKR C;  1B9X A;  1RI6 A;  4JSV C;  1E8M A;  1TYQ C;  5HE2 B;  4O45 A;  3MVD K;  2WQ8 A;  3PVU B;  4L3H D;  4WK2 A;  5H1M A;  2HU5 A;  3MKS B;  2P9S C;  3JPX A;  4AN1 A;  3DSM A;  3I7H A;  5IT9 g;  1I2M B;  4QRJ A;  3GRE A;  1XIP A;  3O4H A;  4NEN A;  2GNQ A;  1GOF A;  3IJ0 A;  1VE6 A;  3IUN A;  3SMR A;  3W15 A;  4CI1 A;  2VZ3 A;  4UM8 A;  1XHM A;  2P9U C;  5EM2 B;  3C9C A;  4AMY A;  3MUN A;  3O4G A;  3SVW D;  2AGX A;  4JSP C;  3I2N A;  4PSX B;  3SBP A;  4AX4 A;  5AFU 3;  3ZDX A;  4J78 A;  1JV2 A;  4O02 A;  3C99 A;  3JRO A;  4PNK B;  4Z8L A;  3EI4 B;  4JHP C;  1B9Y A;  4Y5R D;  3EI4 A;  4G1E A;  1FWX A;  3EI2 B;  2Z2O A;  4Z7O A;  2IAA A;  2OVR B;  4NBM A;  3FGB A;  4BUJ C;  2YNN A;  4J8G A;  3IKO A;  3P4F A;  3RN1 D;  2AGW A;  5GSA A;  3RLM D;  3BG1 A;  3UVM A;  4UM9 A;  2G99 A;  5CXB B;  4Y7R A;  3VI4 A;  3V4P A;  4BL0 A;  1JMX B;  3RFH A;  5TEF A;  1A0R B;  4E54 A;  5CXB A;  2I0R A;  3IUJ A;  1A12 A;  3EQ8 A;  5FKT A;  1H2W A;  4FHL A;  4FB1 D;  2VDM A;  5HQG A;  4K3I D;  4G1M A;  5E6U A;  2CO0 A;  4CZY A;  3KRX B;  3SBR A;  4J87 A;  1NEX B;  4G55 A;  2B5M A;  4GM8 A;  5FXY A;  5C9Z B;  3EU7 A;  3IUL A;  4A08 B;  4BCB A;  2QXV A;  5EML B;  2H9M A;  4JT5 C;  5EMJ B;  5HE1 B;  4FAV D;  3F3P A;  4A08 A;  4O1Q D;  1E5T A;  2J56 H;  2EID A;  5M5V A;  4IRZ A;  2VDO A;  2P9K C;  2H9L A;  4J81 A;  5FA5 B;  4FA4 D;  5TEE A;  3VGZ A;  1M1X A;  1U2V C;  3IVM A;  2UZX B;  4L1M A;  5HYN B;  4A09 B;  5JWZ A;  4A7J A;  4CZV A;  3MXX A;  2Z2P A;  3SLE D;  5IGQ A;  3KRW B;  4BP8 A;  2AGL A;  1TYE A;  3A0F A;  4CZX A;  5EAR A;  3I8E A;  2H6K A;  4A2L A;  2PBI B;  2QR5 A;  2W18 A;  1P22 A;  3EI1 A;  1VZ3 A;  3I7K A;  4ERQ A;  2AGY A;  5CXC B;  3AL9 A;  3L4O D;  5CYK A;  2EIE A;  3MZL A;  3AL8 A;  4ZOZ A;  4YVD A;  3VA6 A;  4J8B A;  4A2M A;  5H14 A;  3SBQ A;  1XKS A;  4QAM A;  2HKM A;  3NIF A;  3DDU A;  1UOQ A;  4BCD A;  2B4E A;  3PXT D;  4AEZ A;  4HDJ A;  2GC7 A;  3QI0 A;  2CN3 A;  2QC5 A;  4GGA A;  1PI6 A;  3EG6 A;  4H5J A;  5EAP A;  3UR4 A;  1SHY B;  3OKT A;  1GXR A;  3MKQ A;  4X3E A;  3OKW A;  3V9F A;  3N0E A;  2XDW A;  2JKX A;  2PM6 B;  4QL1 A;  3C75 H;  4CI3 A;  4J79 A;  3KCI A;  4TZ4 A;  2BKL A;  2BBK H;  3ULE C;  5A2Q g;  2B5L A;  3UVL A;  4JT6 C;  4CY3 A;  4E5Z B;  2YNO A;  1MG3 A;  3F3F A;  4E5Z A;  3BG0 A;  4JSN C;  3V5W B;  3MZK A;  2IUP A;  5THA A;  4FA1 D;  3OKY B;  3ZDY A;  1L5G A;  2XE4 A;  3ODT A;  3OKY A;  3K26 A;  3EI3 B;  3ZE1 A;  2HYE A;  3MUO A;  1H2Y A;  3OW8 A;  4PXW A;  4OZU A;  3EI3 A;  2IUR A;  5IJ7 E;  2VDQ A;  5EM2 A;  4U1E I;  3NVQ A;  1QNI A;  5C2V B;  2B5N A;  5FFO A;  3PXW D;  3VH0 A;  2VZ1 A;  3O4J A;  2H3X A;  5C92 A;  2IWF A;  2CN2 A;  3FCU A;  2OJY A;  3RFG A;  4K3J B;  3PXS D;  4ZOX A;  3RN0 D;  5FQD A;  2Q7Q A;  5GMK n;  3EI2 A;  2VDP A;  3O4I A;  3IUQ A;  3N0D A;  4DNV A;  5M5T A;  3EMH A;  4PSW B;  2P9N C;  5M5S A;  4GQB B;  2CE9 A;  2AH0 A;  2YB8 B;  4MMZ A;  3SJL D;  3SWS D;  5HE0 B;  3I8C A;  3DWL C;  3CFS B;  5EAL A;  4WJK A;  4XYI A;  5KDO B;  1PGU A;  2AGZ A;  5HDB A;  5FLX g;  2H14 A;  4IA9 A;  1GOT B;  2VDL A;  3J80 g;  4AN0 A;  2O9K A;  1U8C A;  5FKS A;  5B4W A;  1OLZ A;  3IIW A;  3IIY A;  4O2W A;  3UVO A;  4FA5 D;  4CY5 A;  1C9I A;  4ERY A;  5IGO A;  1UOO A;  1GOG A;  4J0W A;  3DM0 A;  5M5U A;  3RSE C;  4ZOY A;  5I5I A;  2BCJ B;  2XU7 A;  4N14 A;  5GXH A;  4MMX A;  1UOP A;  2PM9 B;  4A11 B;  3I7L A;  4A11 A;  4MK0 B;  2J55 H;  4GGD A;  4MMY A;  3ZDZ A;  4GZ8 A;  3I7P A;  3OTT A;  4J0X A;  4L9O A;  3JB9 L;  1VE7 A;  4WK4 A;  2VC2 A;  2PM7 B;  5C86 A;  4ERZ A;  5FFG A;  4A09 A;  2XYI A;  2VDK A;  2G9A A;  1C9L A;  4J86 A;  3K27 A;  3V7D B;  4O3T B;  1Q47 A;  4J82 A;  3ZWL B;  3DXM C;  4GMB A;  4JSX C;  2P9P C;  3GFC A;  4D9S A;  4Z7N A;  5K1C C;  2OIZ A;  5CXC A;  3OF7 A;  2GC4 A;  1L0Q A;  1PEV A;  4DNW A;  4LG9 A;  1SQJ A;  1JOF A;  2P9L C;  1S4U X;  4JD2 C;  2H6N A;  1O6G A;  2XL2 A;  3PVW B;  3HFQ A;  2I0S A;  5AJA A;  3CFV A; 
#chains in the Genus database with same CATH homology
 2HXC A;  3EWE A;  3BWS A;  1R5M A;  4FA9 D;  5SXM A;  1MDA H;  3DXK C;  5AMS A;  4A0A B;  2CO0 C;  3NVN A;  5IJ8 E;  4GGC A;  1JMZ B;  4D6V A;  1GG2 B;  3UVN A;  2AH1 A;  4GM9 A;  2OVQ B;  5I5M A;  4QQE A;  1TBG A;  3SXT D;  4O3U B;  3JZH A;  5K19 A;  3U4Y A;  1MG2 A;  4U7A A;  4CI8 A;  4J77 A;  3SCY A;  4L1Q D;  4XEI C;  4JXM A;  3PSC B;  1U4C A;  4OWR A;  4A0B B;  5IC7 A;  4I79 A;  4FAN D;  4A0B A;  2YBA A;  5H17 A;  2J57 G;  2OK6 A;  3JRP A;  1N6D A;  4CY2 A;  3F3G A;  2UZY B;  3RMZ D;  3FM0 A;  3FRX A;  5C2W B;  3ORV D;  4CC9 A;  4PBZ A;  2H9N A;  5EAM A;  2P9I C;  2OVP B;  4R7A B;  4O9D A;  4IMM A;  2Z2N A;  4FWW A;  3C5M A;  3OL2 B;  4LGN A;  4X61 B;  4J73 A;  3OL2 A;  2H47 A;  1K8K C;  1K32 A;  3AFC A;  2HJ4 A;  5FKQ A;  3MMY A;  4ES0 A;  2YMU A;  4CI2 A;  2AQ5 A;  4L3G D;  3SN6 B;  4AOW A;  2MTA H;  3AH8 B;  4XYH A;  4E54 B;  3JAM g;  5GXI A;  4X60 B;  2CNX A;  3SHF A;  2IUV A;  3L4M D;  5FKR A;  1N6E A;  2PM9 A;  4ZOV A;  2I3S A;  4ESG A;  4NSX A;  4BH6 A;  3CIK B;  4EWR A;  5TDH B;  2HES X;  2CE8 A;  5EMM B;  4H5I A;  4ZN4 A;  1SQ9 A;  3NVX A;  5I5J A;  4G56 B;  2I3T A;  2H13 A;  1ERJ A;  4X63 B;  3UVK A;  5EMK B;  4J84 A;  2H68 A;  2HKR A;  3IJC A;  2TRC B;  4KFM B;  3SFZ A;  4PC0 A;  3PE7 A;  2HJB A;  2IWK A;  2OK4 A;  1JJU B;  3B7F A;  4UI9 R;  4QT8 A;  4D0K A;  2I0T A;  3EI1 B;  3J81 g;  3JZN A;  5CYK B;  5HE3 B;  3I7O A;  3AL8 B;  3I7N A;  4GQ2 P;  2EBS A;  1N6F A;  2IUQ A;  4GM3 A;  4A0A A;  3RRM C;  3UKU C;  2XL3 A;  1YFQ A;  1VYH C;  4CY1 A;  3PSL A;  3JZG A;  3I89 A;  1NR0 A;  3IJ1 A;  5TF2 A;  1PBY B;  1GP2 B;  3E0C A;  2YNP A;  2H6Q A;  4LG8 A;  4GQ1 A;  1OMW B;  4PBY A;  2H9P A;  3UKR C;  1B9X A;  1RI6 A;  4JSV C;  1TYQ C;  5HE2 B;  4O45 A;  3PVU B;  4L3H D;  5H1M A;  3MKS B;  2P9S C;  3JPX A;  3DSM A;  3I7H A;  5IT9 g;  4QRJ A;  3GRE A;  1XIP A;  2GNQ A;  3IJ0 A;  3SMR A;  3W15 A;  4CI1 A;  1XHM A;  2P9U C;  5EM2 B;  3C9C A;  3SVW D;  2AGX A;  4JSP C;  3I2N A;  4PSX B;  3SBP A;  5AFU 3;  4J78 A;  3C99 A;  3JRO A;  4PNK B;  4Z8L A;  3EI4 B;  1B9Y A;  4Y5R D;  3EI4 A;  1FWX A;  3EI2 B;  2Z2O A;  2IAA A;  2OVR B;  4BUJ C;  3FGB A;  2YNN A;  4J8G A;  3IKO A;  3P4F A;  3RN1 D;  2AGW A;  5GSA A;  3RLM D;  3BG1 A;  3UVM A;  2G99 A;  5CXB B;  4Y7R A;  4BL0 A;  1JMX B;  3RFH A;  5TEF A;  1A0R B;  4E54 A;  5CXB A;  2I0R A;  5FKT A;  4FHL A;  4FB1 D;  5HQG A;  4K3I D;  2CO0 A;  4CZY A;  3KRX B;  3SBR A;  4J87 A;  1NEX B;  2B5M A;  4GM8 A;  5FXY A;  5C9Z B;  3EU7 A;  4A08 B;  2QXV A;  5EML B;  2H9M A;  4JT5 C;  5EMJ B;  5HE1 B;  4FAV D;  3F3P A;  4A08 A;  4O1Q D;  2J56 H;  2P9K C;  2H9L A;  4J81 A;  5FA5 B;  4FA4 D;  5TEE A;  3VGZ A;  1U2V C;  2UZX B;  5HYN B;  4A09 B;  5JWZ A;  4A7J A;  4CZV A;  3MXX A;  2Z2P A;  3SLE D;  5IGQ A;  3KRW B;  2AGL A;  3A0F A;  4CZX A;  5EAR A;  3I8E A;  2H6K A;  4A2L A;  2PBI B;  2W18 A;  1P22 A;  3EI1 A;  3I7K A;  4ERQ A;  2AGY A;  5CXC B;  3AL9 A;  3L4O D;  5CYK A;  3MZL A;  3AL8 A;  4ZOZ A;  4YVD A;  3VA6 A;  4J8B A;  4A2M A;  5H14 A;  3SBQ A;  1XKS A;  2HKM A;  2B4E A;  3PXT D;  4AEZ A;  4HDJ A;  2GC7 A;  2CN3 A;  2QC5 A;  4GGA A;  1PI6 A;  3EG6 A;  4H5J A;  5EAP A;  3UR4 A;  1SHY B;  3OKT A;  1GXR A;  3MKQ A;  4X3E A;  3OKW A;  3V9F A;  3N0E A;  2PM6 B;  4QL1 A;  3C75 H;  4CI3 A;  4J79 A;  4TZ4 A;  2BBK H;  3ULE C;  5A2Q g;  2B5L A;  3UVL A;  4JT6 C;  4CY3 A;  4E5Z B;  2YNO A;  1MG3 A;  3F3F A;  4E5Z A;  3BG0 A;  4JSN C;  3V5W B;  3MZK A;  2IUP A;  5THA A;  4FA1 D;  3OKY B;  3ODT A;  3OKY A;  3K26 A;  3EI3 B;  2HYE A;  3OW8 A;  4PXW A;  4OZU A;  3EI3 A;  2IUR A;  5IJ7 E;  5EM2 A;  4U1E I;  3NVQ A;  1QNI A;  5C2V B;  2B5N A;  3PXW D;  3VH0 A;  2H3X A;  2IWF A;  2CN2 A;  2OJY A;  3RFG A;  4K3J B;  3PXS D;  4ZOX A;  3RN0 D;  5FQD A;  2Q7Q A;  5GMK n;  3EI2 A;  3N0D A;  3EMH A;  4PSW B;  2P9N C;  4GQB B;  2CE9 A;  2AH0 A;  2YB8 B;  3SJL D;  3SWS D;  5HE0 B;  3I8C A;  3DWL C;  3CFS B;  5EAL A;  5KDO B;  4XYI A;  1PGU A;  2AGZ A;  5FLX g;  2H14 A;  4IA9 A;  1GOT B;  3J80 g;  2O9K A;  5FKS A;  5B4W A;  1OLZ A;  3IIW A;  3IIY A;  3UVO A;  4FA5 D;  4CY5 A;  4ERY A;  5IGO A;  4J0W A;  3DM0 A;  3RSE C;  4ZOY A;  5I5I A;  2BCJ B;  2XU7 A;  4N14 A;  5GXH A;  2PM9 B;  4A11 B;  3I7L A;  4A11 A;  4MK0 B;  2J55 H;  4GGD A;  4GZ8 A;  3I7P A;  3OTT A;  4J0X A;  4L9O A;  3JB9 L;  2PM7 B;  4ERZ A;  4A09 A;  2XYI A;  2G9A A;  4J86 A;  3K27 A;  3V7D B;  4O3T B;  1Q47 A;  4J82 A;  3ZWL B;  3DXM C;  4GMB A;  4JSX C;  2P9P C;  3GFC A;  5K1C C;  2OIZ A;  5CXC A;  2GC4 A;  1L0Q A;  1PEV A;  4LG9 A;  1SQJ A;  1JOF A;  2P9L C;  1S4U X;  4JD2 C;  2H6N A;  2XL2 A;  3PVW B;  3HFQ A;  2I0S A;  5AJA A;  3CFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...