4L9OA

Crystal structure of the sec13-sec16 blade-inserted complex from pichia pastoris
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
347
structure length
330
Chain Sequence
SHMTAPVVRNPRTQFPIFHWCRGGKALSMLPKFDTYGQSKVEINIVGSGSVTIGNAHDDLIHDAVLDYYGRRLATCSSDKTIKIFEIQRLVETLIGHEGPVWQVAWAHPKFGVILASCSYDGKVLIWKEDNGVWNKVAEHSVHQASVNSVSWAPHEYGPVLLCASSDGKISIVEFKDGGALEPIVIQGHAIGVNAASWAPISNTRRFVSGGCDNLVKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPSRLSKSYIATASQDRTVLIWTKDGKSNKWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLWKENIQGKWESAGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sec16 influences transitional ER sites by regulating rather than organizing COPII.
pubmed doi rcsb
source organism Komagataella pastoris
molecule tags Protein transport
molecule keywords Sec16,Protein transport protein SEC13
total genus 73
structure length 330
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l9oA00
3NVNA 2J57G 5CXCA 4PNKB 2EBSA 2H3XA 3EI2A 5HE3B 4CI8A 3PVWB 4D6VA 4L3HD 5CXBA 3I2NA 1PGUA 1K8KC 4BH6A 2H47A 2I3TA 2HESX 4J78A 4A0AB 3CIKB 4L1QD 4ZOZA 3OKWA 2XL2A 3L4OD 2P9UC 4BUJC 5EMLB 2J56H 5HE2B 1QNIA 2HKRA 4GQ1A 4A09B 4CY1A 1A0RB 5EMKB 2B5NA 4PBYA 1K32A 5I5JA 5GXHA 1GOTB 2P9LC 5TF2A 4ERYA 3I7NA 5GXIA 1ERJA 3EI1A 3AFCA 4U7AA 2IWKA 4JSVC 4ERZA 1PEVA 3UVLA 4D0KA 1B9XA 3EWEA 4A2MA 4FA1D 4JSNC 3VGZA 5FXYA 4AOWA 3SCYA 3V7DB 2QXVA 4OZUA 4A2LA 3F3FA 4CY2A 2P9NC 3UVKA 5IGOA 2IAAA 3EI4B 5A2Qg 3GFCA 5GMKn 3FM0A 5JWZA 1SQ9A 4GM8A 5FKTA 3I7KA 1JMXB 4O9DA 3RLMD 1SQJA 2UZYB 5CYKA 5K19A 5K1CC 3NVQA 1YFQA 3JZGA 2I0TA 3K26A 5AFU3 4X60B 2YBAA 4LG9A 3SLED 3U4YA 2H14A 1U2VC 5HE1B 1FWXA 4CZVA 5EALA 3I89A 3DSMA 4A0AA 4GGCA 5FQDA 4O45A 5IJ7E 3I7PA 4A08A 1MG3A 4J0WA 4PBZA 4LGNA 3B7FA 5CYKB 3W15A 2H9LA 3MZKA 2CN3A 5HYNB 1VYHC 5SXMA 3I7LA 3JRPA 3UVNA 2CN2A 2CO0A 2B4EA 4BL0A 1N6EA 2IUVA 3KRXB 2HJ4A 1GXRA 1Q47A 5H1MA 4ES0A 5B4WA 2UZXB 4E54A 2PM7B 3HFQA 3OL2B 3EMHA 4FB1D 4FA4D 3SHFA 3JB9L 3C99A 4X61B 1R5MA 5C9ZB 4A0BB 5AJAA 2I0RA 1RI6A 4JSPC 2YNNA 2IUPA 3AL8A 3SBRA 3UVOA 3IIWA 3N0DA 3SMRA 2BCJB 2TRCB 4X63B 2PM9B 3PE7A 3ULEC 3J80g 3PXSD 3UKUC 1XHMA 3F3PA 1PI6A 5TEEA 3I7HA 4J8BA 3VH0A 3BG1A 4CI1A 1MG2A 4K3ID 3VA6A 4GMBA 4PSWB 3IJCA 4FHLA 5HQGA 3OW8A 4FA5D 5TDHB 4XYIA 3UVMA 4CZYA 3C5MA 2AH0A 5EM2A 4J87A 4AEZA 3MKQA 2AGYA 3KRWB 4N14A 4A7JA 4JT5C 4TZ4A 2H6NA 3DXMC 2CE8A 4J8GA 2AGXA 2AH1A 4ERQA 2OVQB 5H17A 3EI3B 2I3SA 3E0CA 1N6FA 1JMZB 2XL3A 3AH8B 2YB8B 3OKYA 3RFHA 1P22A 1XIPA 5EARA 3J81g 3MMYA 2AGWA 3JAMg 4H5JA 4K3JB 3EI1B 2H13A 3RFGA 3IKOA 4CZXA 4O3UB 2Z2OA 2OVPB 3IIYA 4L3GD 1TBGA 4JSXC 3CFSB 3UKRC 3A0FA 3ORVD 3I8EA 4GM9A 4FA9D 2PM6B 4YVDA 4J73A 3L4MD 3N0EA 3CFVA 2AQ5A 4A09A 2OK6A 5EMMB 2IURA 5IJ8E 3I8CA 4O1QD 2IWFA 4J81A 4FWWA 4ZOVA 4U1EI 5EAMA 3JROA 5FLXg 5IC7A 2CE9A 2MTAH 3DWLC 4J77A 3I7OA 3SXTD 3V5WB 3ODTA 2I0SA 3PVUB 4GQBB 4NSXA 3SWSD 2YNOA 2PBIB 4ZN4A 1L0QA 3OKTA 4QT8A 3RRMC 3P4FA 3SBQA 3C75H 4MK0B 4Y5RD 2B5LA 3SN6B 3JZHA 3MKSB 5C2WB 5C2VB 3DXKC 2H9MA 4GQ2P 4HDJA 3F3GA 5CXCB 5IGQA 3K27A 2QC5A 3AL9A 1PBYB 4OWRA 2GNQA 3OL2A 2W18A 4KFMB 5IT9g 4QL1A 3SJLD 4IMMA 2H6QA 5FKSA 2OK4A 4PSXB 1NR0A 5EAPA 3JPXA 4J0XA 3FGBA 4GM3A 2OIZA 1SHYB 4E5ZA 3RSEC 3ZWLB 2B5MA 4CI2A 3PSLA 5KDOB 4E5ZB 1OLZA 4QRJA 3MZLA 3DM0A 5TEFA 1N6DA 2P9SC 2J55H 4EWRA 2H6KA 3BWSA 4GGDA 4GZ8A 3SFZA 3PXTD 2YNPA 3IJ0A 2G9AA 4FAVD 4J86A 3PSCB 4CY3A 4ZOXA 2O9KA 5AMSA 3EI2B 5H14A 2AGLA 3NVXA 3PXWD 3V9FA 3OTTA 5HE0B 3OKYB 5FKQA 3EG6A 2BBKH 5CXBB 4J79A 4JXMA 2Z2PA 1XKSA 2H9NA 1OMWB 5GSAA 2P9IC 1B9YA 4CY5A 2HKMA 2HYEA 4CI3A 5FA5B 3C9CA 1TYQC 4H5IA 2XYIA 3RN1D 2YMUA 4ZOYA 4G56B 1S4UX 2P9KC 4JD2C 4O3TB 2AGZA 4CC9A 4J84A 2Z2NA 4E54B 3EI4A 4UI9R 2G99A 2Q7QA 5FKRA 5EM2B 3BG0A 4Y7RA 4FAND 4J82A 1JOFA 4PC0A 3IJ1A 2H9PA 2HXCA 3GREA 2IUQA 3SVWD 4A0BA 4X3EA 4A11A 1U4CA 3SBPA 2GC7A 3EU7A 5I5IA 2PM9A 3UR4A 4LG8A 4JT6C 4A11B 2P9PC 4QQEA 1GG2B 1MDAH 1GP2B 3AL8B 2CNXA 3RN0D 1JJUB 4XYHA 5THAA 2OVRB 5EMJB 3JZNA 2HJBA 2H68A 1NEXB 4A08B 4L9OA 4XEIC 4IA9A 3EI3A 4GGAA 5I5MA 3RMZD 4ESGA 3MXXA 4Z8LA 2GC4A 4R7AB 2XU7A 3FRXA 2OJYA 4I79A 4PXWA 2CO0C
chains in the Genus database with same CATH superfamily
3NVNA 3O4GA 2J57G 5CXCA 4PNKB 2EBSA 2H3XA 3EI2A 4O02A 5HE3B 4CI8A 1I2MB 3PVWB 4D6VA 4L3HD 4O2WA 5CXBA 4DNWA 3K71A 3I2NA 1PGUA 1K8KC 4BH6A 2XDWA 2H47A 4WK4A 2I3TA 1K3IA 2HESX 3IUJA 5M5TA 4J78A 4A0AB 3CIKB 3FCSA 4L1QD 4ZOZA 3K72A 3OKWA 2XL2A 3L4OD 2P9UC 4BUJC 5EMLB 2J56H 5HE2B 1C9IA 1QNIA 2HKRA 2HU8A 4GQ1A 4A09B 4CY1A 1A0RB 2QR5A 2WQ8A 5EMKB 2B5NA 4JHNA 4PBYA 1K32A 3V4VA 3MVDK 5I5JA 4BCDA 5GXHA 3VI3A 1GOTB 2P9LC 5TF2A 4ERYA 4WK2A 3QI0A 3I7NA 5GXIA 1ERJA 3EI1A 3AFCA 4U7AA 2IWKA 4JSVC 4ERZA 1PEVA 4BP9A 3ZE2A 3UVLA 4D0KA 5C86A 1B9XA 3EWEA 4A2MA 4FA1D 3DDUA 4JSNC 1JTDB 3VGZA 5FXYA 4AOWA 3OF7A 3SCYA 3V7DB 2QXVA 4OZUA 1E8NA 4A2LA 3F3FA 4CY2A 2P9NC 3UVKA 3T3PA 5IGOA 5M5UA 2IAAA 1VE6A 3EI4B 5A2Qg 3ZDYA 3GFCA 5GMKn 5E6UA 3FM0A 5JWZA 1SQ9A 3ZE0A 4G1EA 4GM8A 5FKTA 3I7KA 1JMXB 1O6FA 4O9DA 5M5VA 1UOPA 3RLMD 1SQJA 2UZYB 5CYKA 4NAAA 5K19A 5K1CC 3NVQA 4L1MA 1YFQA 3JZGA 2I0TA 4WK0A 3K26A 5AFU3 4X60B 2YBAA 3ZDXA 4LG9A 3SLED 3U4YA 2H14A 1U2VC 5HE1B 1FWXA 4CZVA 5EALA 3I89A 2BKLA 3DSMA 4A0AA 1UOOA 3IULA 4GGCA 5FQDA 4O45A 5IJ7E 3I7PA 4A08A 3EQ9A 2XE4A 1MG3A 4AMYA 2VDRA 4J0WA 4LGNA 4PBZA 3B7FA 1O6GA 1T2XA 2EIBA 5CYKB 3W15A 2H9LA 1VZ3A 3IUMA 3MZKA 1UTCA 2CN3A 5HYNB 1VYHC 5SXMA 3I7LA 3JRPA 3GD1I 1VE7A 4G55A 3T3MA 3UVNA 2CN2A 2CO0A 2B4EA 2VC2A 4BL0A 1N6EA 2IUVA 3KRXB 2HJ4A 1GXRA 4Z7QA 1Q47A 5H1MA 4ES0A 5C92A 5B4WA 2UZXB 4JHPC 4E54A 2PM7B 3HFQA 3OL2B 3EMHA 4FB1D 4FA4D 3SHFA 3JB9L 1VZ2A 3C99A 3IVMA 4X61B 1R5MA 5C9ZB 4A0BB 5AJAA 2I0RA 1RI6A 4JSPC 3V4PA 2YNNA 3O4HA 2IUPA 3AL8A 3SBRA 3UVOA 3IIWA 3N0DA 1UOQA 3SMRA 3VI4A 2BCJB 2TRCB 4X63B 2PM9B 3PE7A 4QAMA 3ULEC 1QFSA 3J80g 3PXSD 4MMXA 3UKUC 4Z7NA 1BPOA 3IUNA 1XHMA 3F3PA 1PI6A 1TYEA 3I7HA 4J8BA 5HDBA 5TEEA 3VH0A 4RE5A 3BG1A 4Z7OA 4CI1A 4MMZA 1MG2A 4K3ID 3VA6A 4GMBA 4PSWB 3IJCA 4FHLA 5HQGA 5FFGA 3OW8A 4FA5D 5TDHB 4XYIA 3UVMA 4CZYA 3C5MA 2AH0A 1YR2A 5EM2A 4J87A 2VDQA 4AEZA 3MKQA 1A12A 2AGYA 3KRWB 4N14A 4A7JA 4JT5C 4TZ4A 4G1MA 2H6NA 3DXMC 1GOFA 2CE8A 1H2WA 1E8MA 4J8GA 2AGXA 2AH1A 4ERQA 2OVQB 5H17A 3EI3B 2VZ3A 2I3SA 4AX4A 3E0CA 1N6FA 1JMZB 3ZDZA 3IURA 1QFMA 2XL3A 5E6RA 3AH8B 2YB8B 3OKYA 4NENA 1P22A 1XIPA 3RFHA 5EARA 3J81g 1C9LA 2AGWA 3MMYA 3JAMg 4H5JA 4K3JB 3EI1B 2H13A 4IRZA 3RFGA 3IKOA 4CZXA 4O3UB 2Z2OA 2OVPB 3IIYA 4L3GD 1TBGA 4JSXC 3CFSB 3UKRC 3A0FA 3ORVD 3I8EA 4GM9A 4FA9D 2PM6B 4YVDA 4J73A 2VDMA 3L4MD 3N0EA 3CFVA 2AQ5A 4A09A 2OK6A 5EMMB 2IURA 5IJ8E 3I8CA 4O1QD 2IWFA 4J81A 4FWWA 2EICA 3IUQA 3FCUA 4ZOVA 4U1EI 5EAMA 3JROA 5FLXg 5IC7A 2CE9A 2MTAH 3DWLC 1H2YA 4J77A 3I7OA 3SXTD 3V5WB 3ODTA 2I0SA 3PVUB 4GQBB 4NSXA 3SWSD 2YNOA 2PBIB 4NC4A 4ZN4A 1L0QA 3OKTA 4QT8A 5M5SA 2HU7A 3RRMC 3P4FA 3SBQA 2EIDA 2XZGA 1JV2A 3C75H 2VDPA 2JKXA 4MK0B 4Y5RD 2B5LA 3SN6B 3JZHA 3MKSB 5C2WB 5C2VB 4AMZA 3DXKC 2H9MA 4GQ2P 4HDJA 3F3GA 5CXCB 5IGQA 3K27A 5FFOA 2QC5A 4D9SA 3AL9A 1PBYB 4BCBA 4OWRA 2GNQA 3OL2A 3K6SA 2W18A 4KFMB 5IT9g 3NIDA 4QL1A 2VDOA 3SJLD 4IMMA 4UM9A 3O4IA 2H6QA 3EQ8A 5FKSA 2QZPA 3ZE1A 2OK4A 4PSXB 3EQ7A 1NR0A 5EAPA 3JPXA 4J0XA 2VDKA 3FGBA 4GM3A 2OIZA 1SHYB 4AN0A 4E5ZA 3RSEC 3ZWLB 2B5MA 4CI2A 3PSLA 5KDOB 4E5ZB 1OLZA 4QRJA 3MZLA 3DM0A 5TEFA 1N6DA 4DNVA 2P9SC 2J55H 2VZ1A 4EWRA 1GOHA 2H6KA 3BWSA 4GGDA 4GZ8A 3SFZA 3PXTD 2YNPA 3IJ0A 2G9AA 4FAVD 4J86A 3PSCB 4CY3A 4ZOXA 2O9KA 5AMSA 4BP8A 3EI2B 5H14A 2AGLA 1L5GA 3NVXA 3PXWD 3MUNA 3V9FA 3OTTA 5HE0B 4AN1A 3OKYB 5FKQA 3EG6A 2BBKH 5CXBB 4J79A 3QHYB 4JXMA 2Z2PA 1XKSA 2H9NA 1OMWB 3NIGA 5GSAA 3GC3B 2P9IC 1M1XA 5M61A 5E6SA 1B9YA 4BCCA 4CY5A 2HKMA 2HYEA 4CI3A 5FA5B 1E5TA 1TYQC 3C9CA 2XYIA 4H5IA 3RN1D 2YMUA 4UM8A 5M5RA 4ZOYA 4G56B 1S4UX 3IJEA 1H2ZA 2P9KC 2VDLA 4JD2C 4O3TB 4MMYA 2AGZA 4CC9A 4J84A 2Z2NA 4E54B 3EI4A 4UI9R 4DNUA 2G99A 2Q7QA 5FKRA 5EM2B 3BG0A 4Y7RA 1H2XA 4FAND 4WJKA 2HU5A 1JOFA 4J82A 3O4JA 4PC0A 3IJ1A 2H9PA 2HXCA 3GREA 2IUQA 3SVWD 4A0BA 4X3EA 4A11A 1U4CA 3SBPA 3KCIA 2GC7A 3EU7A 5I5IA 2PM9A 3UR4A 3NIFA 2EIEA 4LG8A 4JT6C 4A11B 2P9PC 4QQEA 1GG2B 1MDAH 1GP2B 3AL8B 4RE6A 1U8CA 2CNXA 3RN0D 1JJUB 4XYHA 5THAA 2OVRB 5EMJB 3JZNA 2HJBA 2H68A 2VDNA 1NEXB 4A08B 4L9OA 3MUOA 4XEIC 4IA9A 3EI3A 4GGAA 5I5MA 3RMZD 4ESGA 3MXXA 4Z8LA 2GC4A 4R7AB 2XU7A 3FRXA 2OJYA 1GOGA 4NBMA 4I79A 4PXWA 2CO0C
chains in the Genus database with same CATH topology
3NVNA 2J57G 5CXCA 4PNKB 2EBSA 2H3XA 3EI2A 5HE3B 4CI8A 3PVWB 4D6VA 4L3HD 5CXBA 3I2NA 1PGUA 1K8KC 4BH6A 2H47A 2I3TA 2HESX 4J78A 4A0AB 3CIKB 4L1QD 4ZOZA 3OKWA 2XL2A 3L4OD 2P9UC 4BUJC 5EMLB 2J56H 5HE2B 1QNIA 2HKRA 4GQ1A 4A09B 4CY1A 1A0RB 5EMKB 2B5NA 4PBYA 1K32A 5I5JA 5GXHA 1GOTB 2P9LC 5TF2A 4ERYA 3I7NA 5GXIA 1ERJA 3EI1A 3AFCA 4U7AA 2IWKA 4JSVC 4ERZA 1PEVA 3UVLA 4D0KA 1B9XA 3EWEA 4A2MA 4FA1D 4JSNC 3VGZA 5FXYA 4AOWA 3SCYA 3V7DB 2QXVA 4OZUA 4A2LA 3F3FA 4CY2A 2P9NC 3UVKA 5IGOA 2IAAA 3EI4B 5A2Qg 3GFCA 5GMKn 3FM0A 5JWZA 1SQ9A 4GM8A 5FKTA 3I7KA 1JMXB 4O9DA 3RLMD 1SQJA 2UZYB 5CYKA 5K19A 5K1CC 3NVQA 1YFQA 3JZGA 2I0TA 3K26A 5AFU3 4X60B 2YBAA 4LG9A 3SLED 3U4YA 2H14A 1U2VC 5HE1B 1FWXA 4CZVA 5EALA 3I89A 3DSMA 4A0AA 4GGCA 5FQDA 4O45A 5IJ7E 3I7PA 4A08A 1MG3A 4J0WA 4PBZA 4LGNA 3B7FA 5CYKB 3W15A 2H9LA 3MZKA 2CN3A 5HYNB 1VYHC 5SXMA 3I7LA 3JRPA 3UVNA 2CN2A 2CO0A 2B4EA 4BL0A 1N6EA 2IUVA 3KRXB 2HJ4A 1GXRA 1Q47A 5H1MA 4ES0A 5B4WA 2UZXB 4E54A 2PM7B 3HFQA 3OL2B 3EMHA 4FB1D 4FA4D 3SHFA 3JB9L 3C99A 4X61B 1R5MA 5C9ZB 4A0BB 5AJAA 2I0RA 1RI6A 4JSPC 2YNNA 2IUPA 3AL8A 3SBRA 3UVOA 3IIWA 3N0DA 3SMRA 2BCJB 2TRCB 4X63B 2PM9B 3PE7A 3ULEC 3J80g 3PXSD 3UKUC 1XHMA 3F3PA 1PI6A 5TEEA 3I7HA 4J8BA 3VH0A 3BG1A 4CI1A 1MG2A 4K3ID 3VA6A 4GMBA 4PSWB 3IJCA 4FHLA 5HQGA 3OW8A 4FA5D 5TDHB 4XYIA 3UVMA 4CZYA 3C5MA 2AH0A 5EM2A 4J87A 4AEZA 3MKQA 2AGYA 3KRWB 4N14A 4A7JA 4JT5C 4TZ4A 2H6NA 3DXMC 2CE8A 4J8GA 2AGXA 2AH1A 4ERQA 2OVQB 5H17A 3EI3B 2I3SA 3E0CA 1N6FA 1JMZB 2XL3A 3AH8B 2YB8B 3OKYA 3RFHA 1P22A 1XIPA 5EARA 3J81g 3MMYA 2AGWA 3JAMg 4H5JA 4K3JB 3EI1B 2H13A 3RFGA 3IKOA 4CZXA 4O3UB 2Z2OA 2OVPB 3IIYA 4L3GD 1TBGA 4JSXC 3CFSB 3UKRC 3A0FA 3ORVD 3I8EA 4GM9A 4FA9D 2PM6B 4YVDA 4J73A 3L4MD 3N0EA 3CFVA 2AQ5A 4A09A 2OK6A 5EMMB 2IURA 5IJ8E 3I8CA 4O1QD 2IWFA 4J81A 4FWWA 4ZOVA 4U1EI 5EAMA 3JROA 5FLXg 5IC7A 2CE9A 2MTAH 3DWLC 4J77A 3I7OA 3SXTD 3V5WB 3ODTA 2I0SA 3PVUB 4GQBB 4NSXA 3SWSD 2YNOA 2PBIB 4ZN4A 1L0QA 3OKTA 4QT8A 3RRMC 3P4FA 3SBQA 3C75H 4MK0B 4Y5RD 2B5LA 3SN6B 3JZHA 3MKSB 5C2WB 5C2VB 3DXKC 2H9MA 4GQ2P 4HDJA 3F3GA 5CXCB 5IGQA 3K27A 2QC5A 3AL9A 1PBYB 4OWRA 2GNQA 3OL2A 2W18A 4KFMB 5IT9g 4QL1A 3SJLD 4IMMA 2H6QA 5FKSA 2OK4A 4PSXB 1NR0A 5EAPA 3JPXA 4J0XA 3FGBA 4GM3A 2OIZA 1SHYB 4E5ZA 3RSEC 3ZWLB 2B5MA 4CI2A 3PSLA 5KDOB 4E5ZB 1OLZA 4QRJA 3MZLA 3DM0A 5TEFA 1N6DA 2P9SC 2J55H 4EWRA 2H6KA 3BWSA 4GGDA 4GZ8A 3SFZA 3PXTD 2YNPA 3IJ0A 2G9AA 4FAVD 4J86A 3PSCB 4CY3A 4ZOXA 2O9KA 5AMSA 3EI2B 5H14A 2AGLA 3NVXA 3PXWD 3V9FA 3OTTA 5HE0B 3OKYB 5FKQA 3EG6A 2BBKH 5CXBB 4J79A 4JXMA 2Z2PA 1XKSA 2H9NA 1OMWB 5GSAA 2P9IC 1B9YA 4CY5A 2HKMA 2HYEA 4CI3A 5FA5B 3C9CA 1TYQC 4H5IA 2XYIA 3RN1D 2YMUA 4ZOYA 4G56B 1S4UX 2P9KC 4JD2C 4O3TB 2AGZA 4CC9A 4J84A 2Z2NA 4E54B 3EI4A 4UI9R 2G99A 2Q7QA 5FKRA 5EM2B 3BG0A 4Y7RA 4FAND 4J82A 1JOFA 4PC0A 3IJ1A 2H9PA 2HXCA 3GREA 2IUQA 3SVWD 4A0BA 4X3EA 4A11A 1U4CA 3SBPA 2GC7A 3EU7A 5I5IA 2PM9A 3UR4A 4LG8A 4JT6C 4A11B 2P9PC 4QQEA 1GG2B 1MDAH 1GP2B 3AL8B 2CNXA 3RN0D 1JJUB 4XYHA 5THAA 2OVRB 5EMJB 3JZNA 2HJBA 2H68A 1NEXB 4A08B 4L9OA 4XEIC 4IA9A 3EI3A 4GGAA 5I5MA 3RMZD 4ESGA 3MXXA 4Z8LA 2GC4A 4R7AB 2XU7A 3FRXA 2OJYA 4I79A 4PXWA 2CO0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVN A;  2J57 G;  5CXC A;  4PNK B;  2EBS A;  2H3X A;  3EI2 A;  5HE3 B;  4CI8 A;  3PVW B;  4D6V A;  4L3H D;  5CXB A;  3I2N A;  1PGU A;  1K8K C;  4BH6 A;  2H47 A;  2I3T A;  2HES X;  4J78 A;  4A0A B;  3CIK B;  4L1Q D;  4ZOZ A;  3OKW A;  2XL2 A;  3L4O D;  2P9U C;  4BUJ C;  5EML B;  2J56 H;  5HE2 B;  1QNI A;  2HKR A;  4GQ1 A;  4A09 B;  4CY1 A;  1A0R B;  5EMK B;  2B5N A;  4PBY A;  1K32 A;  5I5J A;  5GXH A;  1GOT B;  2P9L C;  5TF2 A;  4ERY A;  3I7N A;  5GXI A;  1ERJ A;  3EI1 A;  3AFC A;  4U7A A;  2IWK A;  4JSV C;  4ERZ A;  1PEV A;  3UVL A;  4D0K A;  1B9X A;  3EWE A;  4A2M A;  4FA1 D;  4JSN C;  3VGZ A;  5FXY A;  4AOW A;  3SCY A;  3V7D B;  2QXV A;  4OZU A;  4A2L A;  3F3F A;  4CY2 A;  2P9N C;  3UVK A;  5IGO A;  2IAA A;  3EI4 B;  5A2Q g;  3GFC A;  5GMK n;  3FM0 A;  5JWZ A;  1SQ9 A;  4GM8 A;  5FKT A;  3I7K A;  1JMX B;  4O9D A;  3RLM D;  1SQJ A;  2UZY B;  5CYK A;  5K19 A;  5K1C C;  3NVQ A;  1YFQ A;  3JZG A;  2I0T A;  3K26 A;  5AFU 3;  4X60 B;  2YBA A;  4LG9 A;  3SLE D;  3U4Y A;  2H14 A;  1U2V C;  5HE1 B;  1FWX A;  4CZV A;  5EAL A;  3I89 A;  3DSM A;  4A0A A;  4GGC A;  5FQD A;  4O45 A;  5IJ7 E;  3I7P A;  4A08 A;  1MG3 A;  4J0W A;  4PBZ A;  4LGN A;  3B7F A;  5CYK B;  3W15 A;  2H9L A;  3MZK A;  2CN3 A;  5HYN B;  1VYH C;  5SXM A;  3I7L A;  3JRP A;  3UVN A;  2CN2 A;  2CO0 A;  2B4E A;  4BL0 A;  1N6E A;  2IUV A;  3KRX B;  2HJ4 A;  1GXR A;  1Q47 A;  5H1M A;  4ES0 A;  5B4W A;  2UZX B;  4E54 A;  2PM7 B;  3HFQ A;  3OL2 B;  3EMH A;  4FB1 D;  4FA4 D;  3SHF A;  3JB9 L;  3C99 A;  4X61 B;  1R5M A;  5C9Z B;  4A0B B;  5AJA A;  2I0R A;  1RI6 A;  4JSP C;  2YNN A;  2IUP A;  3AL8 A;  3SBR A;  3UVO A;  3IIW A;  3N0D A;  3SMR A;  2BCJ B;  2TRC B;  4X63 B;  2PM9 B;  3PE7 A;  3ULE C;  3J80 g;  3PXS D;  3UKU C;  1XHM A;  3F3P A;  1PI6 A;  5TEE A;  3I7H A;  4J8B A;  3VH0 A;  3BG1 A;  4CI1 A;  1MG2 A;  4K3I D;  3VA6 A;  4GMB A;  4PSW B;  3IJC A;  4FHL A;  5HQG A;  3OW8 A;  4FA5 D;  5TDH B;  4XYI A;  3UVM A;  4CZY A;  3C5M A;  2AH0 A;  5EM2 A;  4J87 A;  4AEZ A;  3MKQ A;  2AGY A;  3KRW B;  4N14 A;  4A7J A;  4JT5 C;  4TZ4 A;  2H6N A;  3DXM C;  2CE8 A;  4J8G A;  2AGX A;  2AH1 A;  4ERQ A;  2OVQ B;  5H17 A;  3EI3 B;  2I3S A;  3E0C A;  1N6F A;  1JMZ B;  2XL3 A;  3AH8 B;  2YB8 B;  3OKY A;  3RFH A;  1P22 A;  1XIP A;  5EAR A;  3J81 g;  3MMY A;  2AGW A;  3JAM g;  4H5J A;  4K3J B;  3EI1 B;  2H13 A;  3RFG A;  3IKO A;  4CZX A;  4O3U B;  2Z2O A;  2OVP B;  3IIY A;  4L3G D;  1TBG A;  4JSX C;  3CFS B;  3UKR C;  3A0F A;  3ORV D;  3I8E A;  4GM9 A;  4FA9 D;  2PM6 B;  4YVD A;  4J73 A;  3L4M D;  3N0E A;  3CFV A;  2AQ5 A;  4A09 A;  2OK6 A;  5EMM B;  2IUR A;  5IJ8 E;  3I8C A;  4O1Q D;  2IWF A;  4J81 A;  4FWW A;  4ZOV A;  4U1E I;  5EAM A;  3JRO A;  5FLX g;  5IC7 A;  2CE9 A;  2MTA H;  3DWL C;  4J77 A;  3I7O A;  3SXT D;  3V5W B;  3ODT A;  2I0S A;  3PVU B;  4GQB B;  4NSX A;  3SWS D;  2YNO A;  2PBI B;  4ZN4 A;  1L0Q A;  3OKT A;  4QT8 A;  3RRM C;  3P4F A;  3SBQ A;  3C75 H;  4MK0 B;  4Y5R D;  2B5L A;  3SN6 B;  3JZH A;  3MKS B;  5C2W B;  5C2V B;  3DXK C;  2H9M A;  4GQ2 P;  4HDJ A;  3F3G A;  5CXC B;  5IGQ A;  3K27 A;  2QC5 A;  3AL9 A;  1PBY B;  4OWR A;  2GNQ A;  3OL2 A;  2W18 A;  4KFM B;  5IT9 g;  4QL1 A;  3SJL D;  4IMM A;  2H6Q A;  5FKS A;  2OK4 A;  4PSX B;  1NR0 A;  5EAP A;  3JPX A;  4J0X A;  3FGB A;  4GM3 A;  2OIZ A;  1SHY B;  4E5Z A;  3RSE C;  3ZWL B;  2B5M A;  4CI2 A;  3PSL A;  5KDO B;  4E5Z B;  1OLZ A;  4QRJ A;  3MZL A;  3DM0 A;  5TEF A;  1N6D A;  2P9S C;  2J55 H;  4EWR A;  2H6K A;  3BWS A;  4GGD A;  4GZ8 A;  3SFZ A;  3PXT D;  2YNP A;  3IJ0 A;  2G9A A;  4FAV D;  4J86 A;  3PSC B;  4CY3 A;  4ZOX A;  2O9K A;  5AMS A;  3EI2 B;  5H14 A;  2AGL A;  3NVX A;  3PXW D;  3V9F A;  3OTT A;  5HE0 B;  3OKY B;  5FKQ A;  3EG6 A;  2BBK H;  5CXB B;  4J79 A;  4JXM A;  2Z2P A;  1XKS A;  2H9N A;  1OMW B;  5GSA A;  2P9I C;  1B9Y A;  4CY5 A;  2HKM A;  2HYE A;  4CI3 A;  5FA5 B;  3C9C A;  1TYQ C;  4H5I A;  2XYI A;  3RN1 D;  2YMU A;  4ZOY A;  4G56 B;  1S4U X;  2P9K C;  4JD2 C;  4O3T B;  2AGZ A;  4CC9 A;  4J84 A;  2Z2N A;  4E54 B;  3EI4 A;  4UI9 R;  2G99 A;  2Q7Q A;  5FKR A;  5EM2 B;  3BG0 A;  4Y7R A;  4FAN D;  4J82 A;  1JOF A;  4PC0 A;  3IJ1 A;  2H9P A;  2HXC A;  3GRE A;  2IUQ A;  3SVW D;  4A0B A;  4X3E A;  4A11 A;  1U4C A;  3SBP A;  2GC7 A;  3EU7 A;  5I5I A;  2PM9 A;  3UR4 A;  4LG8 A;  4JT6 C;  4A11 B;  2P9P C;  4QQE A;  1GG2 B;  1MDA H;  1GP2 B;  3AL8 B;  2CNX A;  3RN0 D;  1JJU B;  4XYH A;  5THA A;  2OVR B;  5EMJ B;  3JZN A;  2HJB A;  2H68 A;  1NEX B;  4A08 B;  4L9O A;  4XEI C;  4IA9 A;  3EI3 A;  4GGA A;  5I5M A;  3RMZ D;  4ESG A;  3MXX A;  4Z8L A;  2GC4 A;  4R7A B;  2XU7 A;  3FRX A;  2OJY A;  4I79 A;  4PXW A;  2CO0 C; 
#chains in the Genus database with same CATH topology
 3NVN A;  3O4G A;  2J57 G;  5CXC A;  4PNK B;  2EBS A;  2H3X A;  3EI2 A;  4O02 A;  5HE3 B;  4CI8 A;  1I2M B;  3PVW B;  4D6V A;  4L3H D;  4O2W A;  5CXB A;  4DNW A;  3K71 A;  3I2N A;  1PGU A;  1K8K C;  4BH6 A;  2XDW A;  2H47 A;  4WK4 A;  2I3T A;  1K3I A;  2HES X;  3IUJ A;  5M5T A;  4J78 A;  4A0A B;  3CIK B;  3FCS A;  4L1Q D;  4ZOZ A;  3K72 A;  3OKW A;  2XL2 A;  3L4O D;  2P9U C;  4BUJ C;  5EML B;  2J56 H;  5HE2 B;  1C9I A;  1QNI A;  2HKR A;  2HU8 A;  4GQ1 A;  4A09 B;  4CY1 A;  1A0R B;  2QR5 A;  2WQ8 A;  5EMK B;  2B5N A;  4JHN A;  4PBY A;  1K32 A;  3V4V A;  3MVD K;  5I5J A;  4BCD A;  5GXH A;  3VI3 A;  1GOT B;  2P9L C;  5TF2 A;  4ERY A;  4WK2 A;  3QI0 A;  3I7N A;  5GXI A;  1ERJ A;  3EI1 A;  3AFC A;  4U7A A;  2IWK A;  4JSV C;  4ERZ A;  1PEV A;  4BP9 A;  3ZE2 A;  3UVL A;  4D0K A;  5C86 A;  1B9X A;  3EWE A;  4A2M A;  4FA1 D;  3DDU A;  4JSN C;  1JTD B;  3VGZ A;  5FXY A;  4AOW A;  3OF7 A;  3SCY A;  3V7D B;  2QXV A;  4OZU A;  1E8N A;  4A2L A;  3F3F A;  4CY2 A;  2P9N C;  3UVK A;  3T3P A;  5IGO A;  5M5U A;  2IAA A;  1VE6 A;  3EI4 B;  5A2Q g;  3ZDY A;  3GFC A;  5GMK n;  5E6U A;  3FM0 A;  5JWZ A;  1SQ9 A;  3ZE0 A;  4G1E A;  4GM8 A;  5FKT A;  3I7K A;  1JMX B;  1O6F A;  4O9D A;  5M5V A;  1UOP A;  3RLM D;  1SQJ A;  2UZY B;  5CYK A;  4NAA A;  5K19 A;  5K1C C;  3NVQ A;  4L1M A;  1YFQ A;  3JZG A;  2I0T A;  4WK0 A;  3K26 A;  5AFU 3;  4X60 B;  2YBA A;  3ZDX A;  4LG9 A;  3SLE D;  3U4Y A;  2H14 A;  1U2V C;  5HE1 B;  1FWX A;  4CZV A;  5EAL A;  3I89 A;  2BKL A;  3DSM A;  4A0A A;  1UOO A;  3IUL A;  4GGC A;  5FQD A;  4O45 A;  5IJ7 E;  3I7P A;  4A08 A;  3EQ9 A;  2XE4 A;  1MG3 A;  4AMY A;  2VDR A;  4J0W A;  4LGN A;  4PBZ A;  3B7F A;  1O6G A;  1T2X A;  2EIB A;  5CYK B;  3W15 A;  2H9L A;  1VZ3 A;  3IUM A;  3MZK A;  1UTC A;  2CN3 A;  5HYN B;  1VYH C;  5SXM A;  3I7L A;  3JRP A;  3GD1 I;  1VE7 A;  4G55 A;  3T3M A;  3UVN A;  2CN2 A;  2CO0 A;  2B4E A;  2VC2 A;  4BL0 A;  1N6E A;  2IUV A;  3KRX B;  2HJ4 A;  1GXR A;  4Z7Q A;  1Q47 A;  5H1M A;  4ES0 A;  5C92 A;  5B4W A;  2UZX B;  4JHP C;  4E54 A;  2PM7 B;  3HFQ A;  3OL2 B;  3EMH A;  4FB1 D;  4FA4 D;  3SHF A;  3JB9 L;  1VZ2 A;  3C99 A;  3IVM A;  4X61 B;  1R5M A;  5C9Z B;  4A0B B;  5AJA A;  2I0R A;  1RI6 A;  4JSP C;  3V4P A;  2YNN A;  3O4H A;  2IUP A;  3AL8 A;  3SBR A;  3UVO A;  3IIW A;  3N0D A;  1UOQ A;  3SMR A;  3VI4 A;  2BCJ B;  2TRC B;  4X63 B;  2PM9 B;  3PE7 A;  4QAM A;  3ULE C;  1QFS A;  3J80 g;  3PXS D;  4MMX A;  3UKU C;  4Z7N A;  1BPO A;  3IUN A;  1XHM A;  3F3P A;  1PI6 A;  1TYE A;  3I7H A;  4J8B A;  5HDB A;  5TEE A;  3VH0 A;  4RE5 A;  3BG1 A;  4Z7O A;  4CI1 A;  4MMZ A;  1MG2 A;  4K3I D;  3VA6 A;  4GMB A;  4PSW B;  3IJC A;  4FHL A;  5HQG A;  5FFG A;  3OW8 A;  4FA5 D;  5TDH B;  4XYI A;  3UVM A;  4CZY A;  3C5M A;  2AH0 A;  1YR2 A;  5EM2 A;  4J87 A;  2VDQ A;  4AEZ A;  3MKQ A;  1A12 A;  2AGY A;  3KRW B;  4N14 A;  4A7J A;  4JT5 C;  4TZ4 A;  4G1M A;  2H6N A;  3DXM C;  1GOF A;  2CE8 A;  1H2W A;  1E8M A;  4J8G A;  2AGX A;  2AH1 A;  4ERQ A;  2OVQ B;  5H17 A;  3EI3 B;  2VZ3 A;  2I3S A;  4AX4 A;  3E0C A;  1N6F A;  1JMZ B;  3ZDZ A;  3IUR A;  1QFM A;  2XL3 A;  5E6R A;  3AH8 B;  2YB8 B;  3OKY A;  4NEN A;  1P22 A;  1XIP A;  3RFH A;  5EAR A;  3J81 g;  1C9L A;  2AGW A;  3MMY A;  3JAM g;  4H5J A;  4K3J B;  3EI1 B;  2H13 A;  4IRZ A;  3RFG A;  3IKO A;  4CZX A;  4O3U B;  2Z2O A;  2OVP B;  3IIY A;  4L3G D;  1TBG A;  4JSX C;  3CFS B;  3UKR C;  3A0F A;  3ORV D;  3I8E A;  4GM9 A;  4FA9 D;  2PM6 B;  4YVD A;  4J73 A;  2VDM A;  3L4M D;  3N0E A;  3CFV A;  2AQ5 A;  4A09 A;  2OK6 A;  5EMM B;  2IUR A;  5IJ8 E;  3I8C A;  4O1Q D;  2IWF A;  4J81 A;  4FWW A;  2EIC A;  3IUQ A;  3FCU A;  4ZOV A;  4U1E I;  5EAM A;  3JRO A;  5FLX g;  5IC7 A;  2CE9 A;  2MTA H;  3DWL C;  1H2Y A;  4J77 A;  3I7O A;  3SXT D;  3V5W B;  3ODT A;  2I0S A;  3PVU B;  4GQB B;  4NSX A;  3SWS D;  2YNO A;  2PBI B;  4NC4 A;  4ZN4 A;  1L0Q A;  3OKT A;  4QT8 A;  5M5S A;  2HU7 A;  3RRM C;  3P4F A;  3SBQ A;  2EID A;  2XZG A;  1JV2 A;  3C75 H;  2VDP A;  2JKX A;  4MK0 B;  4Y5R D;  2B5L A;  3SN6 B;  3JZH A;  3MKS B;  5C2W B;  5C2V B;  4AMZ A;  3DXK C;  2H9M A;  4GQ2 P;  4HDJ A;  3F3G A;  5CXC B;  5IGQ A;  3K27 A;  5FFO A;  2QC5 A;  4D9S A;  3AL9 A;  1PBY B;  4BCB A;  4OWR A;  2GNQ A;  3OL2 A;  3K6S A;  2W18 A;  4KFM B;  5IT9 g;  3NID A;  4QL1 A;  2VDO A;  3SJL D;  4IMM A;  4UM9 A;  3O4I A;  2H6Q A;  3EQ8 A;  5FKS A;  2QZP A;  3ZE1 A;  2OK4 A;  4PSX B;  3EQ7 A;  1NR0 A;  5EAP A;  3JPX A;  4J0X A;  2VDK A;  3FGB A;  4GM3 A;  2OIZ A;  1SHY B;  4AN0 A;  4E5Z A;  3RSE C;  3ZWL B;  2B5M A;  4CI2 A;  3PSL A;  5KDO B;  4E5Z B;  1OLZ A;  4QRJ A;  3MZL A;  3DM0 A;  5TEF A;  1N6D A;  4DNV A;  2P9S C;  2J55 H;  2VZ1 A;  4EWR A;  1GOH A;  2H6K A;  3BWS A;  4GGD A;  4GZ8 A;  3SFZ A;  3PXT D;  2YNP A;  3IJ0 A;  2G9A A;  4FAV D;  4J86 A;  3PSC B;  4CY3 A;  4ZOX A;  2O9K A;  5AMS A;  4BP8 A;  3EI2 B;  5H14 A;  2AGL A;  1L5G A;  3NVX A;  3PXW D;  3MUN A;  3V9F A;  3OTT A;  5HE0 B;  4AN1 A;  3OKY B;  5FKQ A;  3EG6 A;  2BBK H;  5CXB B;  4J79 A;  3QHY B;  4JXM A;  2Z2P A;  1XKS A;  2H9N A;  1OMW B;  3NIG A;  5GSA A;  3GC3 B;  2P9I C;  1M1X A;  5M61 A;  5E6S A;  1B9Y A;  4BCC A;  4CY5 A;  2HKM A;  2HYE A;  4CI3 A;  5FA5 B;  1E5T A;  1TYQ C;  3C9C A;  2XYI A;  4H5I A;  3RN1 D;  2YMU A;  4UM8 A;  5M5R A;  4ZOY A;  4G56 B;  1S4U X;  3IJE A;  1H2Z A;  2P9K C;  2VDL A;  4JD2 C;  4O3T B;  4MMY A;  2AGZ A;  4CC9 A;  4J84 A;  2Z2N A;  4E54 B;  3EI4 A;  4UI9 R;  4DNU A;  2G99 A;  2Q7Q A;  5FKR A;  5EM2 B;  3BG0 A;  4Y7R A;  1H2X A;  4FAN D;  4WJK A;  2HU5 A;  1JOF A;  4J82 A;  3O4J A;  4PC0 A;  3IJ1 A;  2H9P A;  2HXC A;  3GRE A;  2IUQ A;  3SVW D;  4A0B A;  4X3E A;  4A11 A;  1U4C A;  3SBP A;  3KCI A;  2GC7 A;  3EU7 A;  5I5I A;  2PM9 A;  3UR4 A;  3NIF A;  2EIE A;  4LG8 A;  4JT6 C;  4A11 B;  2P9P C;  4QQE A;  1GG2 B;  1MDA H;  1GP2 B;  3AL8 B;  4RE6 A;  1U8C A;  2CNX A;  3RN0 D;  1JJU B;  4XYH A;  5THA A;  2OVR B;  5EMJ B;  3JZN A;  2HJB A;  2H68 A;  2VDN A;  1NEX B;  4A08 B;  4L9O A;  3MUO A;  4XEI C;  4IA9 A;  3EI3 A;  4GGA A;  5I5M A;  3RMZ D;  4ESG A;  3MXX A;  4Z8L A;  2GC4 A;  4R7A B;  2XU7 A;  3FRX A;  2OJY A;  1GOG A;  4NBM A;  4I79 A;  4PXW A;  2CO0 C; 
#chains in the Genus database with same CATH homology
 3NVN A;  2J57 G;  5CXC A;  4PNK B;  2EBS A;  2H3X A;  3EI2 A;  5HE3 B;  4CI8 A;  3PVW B;  4D6V A;  4L3H D;  5CXB A;  3I2N A;  1PGU A;  1K8K C;  4BH6 A;  2H47 A;  2I3T A;  2HES X;  4J78 A;  4A0A B;  3CIK B;  4L1Q D;  4ZOZ A;  3OKW A;  2XL2 A;  3L4O D;  2P9U C;  4BUJ C;  5EML B;  2J56 H;  5HE2 B;  1QNI A;  2HKR A;  4GQ1 A;  4A09 B;  4CY1 A;  1A0R B;  5EMK B;  2B5N A;  4PBY A;  1K32 A;  5I5J A;  5GXH A;  1GOT B;  2P9L C;  5TF2 A;  4ERY A;  3I7N A;  5GXI A;  1ERJ A;  3EI1 A;  3AFC A;  4U7A A;  2IWK A;  4JSV C;  4ERZ A;  1PEV A;  3UVL A;  4D0K A;  1B9X A;  3EWE A;  4A2M A;  4FA1 D;  4JSN C;  3VGZ A;  5FXY A;  4AOW A;  3SCY A;  3V7D B;  2QXV A;  4OZU A;  4A2L A;  3F3F A;  4CY2 A;  2P9N C;  3UVK A;  5IGO A;  2IAA A;  3EI4 B;  5A2Q g;  3GFC A;  5GMK n;  3FM0 A;  5JWZ A;  1SQ9 A;  4GM8 A;  5FKT A;  3I7K A;  1JMX B;  4O9D A;  3RLM D;  1SQJ A;  2UZY B;  5CYK A;  5K19 A;  5K1C C;  3NVQ A;  1YFQ A;  3JZG A;  2I0T A;  3K26 A;  5AFU 3;  4X60 B;  2YBA A;  4LG9 A;  3SLE D;  3U4Y A;  2H14 A;  1U2V C;  5HE1 B;  1FWX A;  4CZV A;  5EAL A;  3I89 A;  3DSM A;  4A0A A;  4GGC A;  5FQD A;  4O45 A;  5IJ7 E;  3I7P A;  4A08 A;  1MG3 A;  4J0W A;  4PBZ A;  4LGN A;  3B7F A;  5CYK B;  3W15 A;  2H9L A;  3MZK A;  2CN3 A;  5HYN B;  1VYH C;  5SXM A;  3I7L A;  3JRP A;  3UVN A;  2CN2 A;  2CO0 A;  2B4E A;  4BL0 A;  1N6E A;  2IUV A;  3KRX B;  2HJ4 A;  1GXR A;  1Q47 A;  5H1M A;  4ES0 A;  5B4W A;  2UZX B;  4E54 A;  2PM7 B;  3HFQ A;  3OL2 B;  3EMH A;  4FB1 D;  4FA4 D;  3SHF A;  3JB9 L;  3C99 A;  4X61 B;  1R5M A;  5C9Z B;  4A0B B;  5AJA A;  2I0R A;  1RI6 A;  4JSP C;  2YNN A;  2IUP A;  3AL8 A;  3SBR A;  3UVO A;  3IIW A;  3N0D A;  3SMR A;  2BCJ B;  2TRC B;  4X63 B;  2PM9 B;  3PE7 A;  3ULE C;  3J80 g;  3PXS D;  3UKU C;  1XHM A;  3F3P A;  1PI6 A;  5TEE A;  3I7H A;  4J8B A;  3VH0 A;  3BG1 A;  4CI1 A;  1MG2 A;  4K3I D;  3VA6 A;  4GMB A;  4PSW B;  3IJC A;  4FHL A;  5HQG A;  3OW8 A;  4FA5 D;  5TDH B;  4XYI A;  3UVM A;  4CZY A;  3C5M A;  2AH0 A;  5EM2 A;  4J87 A;  4AEZ A;  3MKQ A;  2AGY A;  3KRW B;  4N14 A;  4A7J A;  4JT5 C;  4TZ4 A;  2H6N A;  3DXM C;  2CE8 A;  4J8G A;  2AGX A;  2AH1 A;  4ERQ A;  2OVQ B;  5H17 A;  3EI3 B;  2I3S A;  3E0C A;  1N6F A;  1JMZ B;  2XL3 A;  3AH8 B;  2YB8 B;  3OKY A;  3RFH A;  1P22 A;  1XIP A;  5EAR A;  3J81 g;  3MMY A;  2AGW A;  3JAM g;  4H5J A;  4K3J B;  3EI1 B;  2H13 A;  3RFG A;  3IKO A;  4CZX A;  4O3U B;  2Z2O A;  2OVP B;  3IIY A;  4L3G D;  1TBG A;  4JSX C;  3CFS B;  3UKR C;  3A0F A;  3ORV D;  3I8E A;  4GM9 A;  4FA9 D;  2PM6 B;  4YVD A;  4J73 A;  3L4M D;  3N0E A;  3CFV A;  2AQ5 A;  4A09 A;  2OK6 A;  5EMM B;  2IUR A;  5IJ8 E;  3I8C A;  4O1Q D;  2IWF A;  4J81 A;  4FWW A;  4ZOV A;  4U1E I;  5EAM A;  3JRO A;  5FLX g;  5IC7 A;  2CE9 A;  2MTA H;  3DWL C;  4J77 A;  3I7O A;  3SXT D;  3V5W B;  3ODT A;  2I0S A;  3PVU B;  4GQB B;  4NSX A;  3SWS D;  2YNO A;  2PBI B;  4ZN4 A;  1L0Q A;  3OKT A;  4QT8 A;  3RRM C;  3P4F A;  3SBQ A;  3C75 H;  4MK0 B;  4Y5R D;  2B5L A;  3SN6 B;  3JZH A;  3MKS B;  5C2W B;  5C2V B;  3DXK C;  2H9M A;  4GQ2 P;  4HDJ A;  3F3G A;  5CXC B;  5IGQ A;  3K27 A;  2QC5 A;  3AL9 A;  1PBY B;  4OWR A;  2GNQ A;  3OL2 A;  2W18 A;  4KFM B;  5IT9 g;  4QL1 A;  3SJL D;  4IMM A;  2H6Q A;  5FKS A;  2OK4 A;  4PSX B;  1NR0 A;  5EAP A;  3JPX A;  4J0X A;  3FGB A;  4GM3 A;  2OIZ A;  1SHY B;  4E5Z A;  3RSE C;  3ZWL B;  2B5M A;  4CI2 A;  3PSL A;  5KDO B;  4E5Z B;  1OLZ A;  4QRJ A;  3MZL A;  3DM0 A;  5TEF A;  1N6D A;  2P9S C;  2J55 H;  4EWR A;  2H6K A;  3BWS A;  4GGD A;  4GZ8 A;  3SFZ A;  3PXT D;  2YNP A;  3IJ0 A;  2G9A A;  4FAV D;  4J86 A;  3PSC B;  4CY3 A;  4ZOX A;  2O9K A;  5AMS A;  3EI2 B;  5H14 A;  2AGL A;  3NVX A;  3PXW D;  3V9F A;  3OTT A;  5HE0 B;  3OKY B;  5FKQ A;  3EG6 A;  2BBK H;  5CXB B;  4J79 A;  4JXM A;  2Z2P A;  1XKS A;  2H9N A;  1OMW B;  5GSA A;  2P9I C;  1B9Y A;  4CY5 A;  2HKM A;  2HYE A;  4CI3 A;  5FA5 B;  3C9C A;  1TYQ C;  4H5I A;  2XYI A;  3RN1 D;  2YMU A;  4ZOY A;  4G56 B;  1S4U X;  2P9K C;  4JD2 C;  4O3T B;  2AGZ A;  4CC9 A;  4J84 A;  2Z2N A;  4E54 B;  3EI4 A;  4UI9 R;  2G99 A;  2Q7Q A;  5FKR A;  5EM2 B;  3BG0 A;  4Y7R A;  4FAN D;  4J82 A;  1JOF A;  4PC0 A;  3IJ1 A;  2H9P A;  2HXC A;  3GRE A;  2IUQ A;  3SVW D;  4A0B A;  4X3E A;  4A11 A;  1U4C A;  3SBP A;  2GC7 A;  3EU7 A;  5I5I A;  2PM9 A;  3UR4 A;  4LG8 A;  4JT6 C;  4A11 B;  2P9P C;  4QQE A;  1GG2 B;  1MDA H;  1GP2 B;  3AL8 B;  2CNX A;  3RN0 D;  1JJU B;  4XYH A;  5THA A;  2OVR B;  5EMJ B;  3JZN A;  2HJB A;  2H68 A;  1NEX B;  4A08 B;  4L9O A;  4XEI C;  4IA9 A;  3EI3 A;  4GGA A;  5I5M A;  3RMZ D;  4ESG A;  3MXX A;  4Z8L A;  2GC4 A;  4R7A B;  2XU7 A;  3FRX A;  2OJY A;  4I79 A;  4PXW A;  2CO0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...