4NENA

An internal ligand-bound, metastable state of a leukocyte integrin, axb2
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
1083
structure length
1063
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAADQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMDPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKTRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVALHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSESNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLCFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-X
total genus 235
structure length 1063
sequence length 1083
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 4nenA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4nenA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 4nenA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4nenA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4nenA02
4BJ3A 3ZE1A 2VDNB 1M2VB 1FNSA 2ODPA 4C29A 2VDPB 4CNBA 3TVYA 4MMYA 2VDPA 3EGDA 5HDBB 4XW2A 1U8CA 5KYUA 4IHKA 4MMXB 2VDRB 1RS0A 3EGXA 3HXQA 3V4VB 1YVPA 3T3PA 3VI3A 1AO3A 1JV2A 3NIFA 1N9ZA 2VDQB 2VC2B 3EOAI 1JV2B 5HGJA 5HJ2A 2VDQA 1OAKA 3QA3E 5E6SB 3ZDXB 1AOXA 5KYWA 3IJEA 3FCSB 5E6RA 1T6BY 4WK4B 3FCUA 3BQNB 1XUOA 5KYYA 3FCUB 4WK4A 1MQ9A 2XWJI 3BQMB 4UM9D 4CN9A 4G1EB 2X5NA 2VDMB 3IBSA 2ODQA 4MMZA 2VDMA 1IDOA 4Z7QB 1PD1A 2VDLA 4Z7OA 4NENA 3VI4A 3EGDB 1BHQ1 3F74A 4MMYB 4NENB 3VI4B 5KYUB 4WK2B 5ES4B 1QC5A 1M1UA 4IGIA 4PN7A 1XDDA 3TCXB 2VDRA 4HQKA 4MMXA 2I6QA 2NVOA 4HQNA 4C2BA 5FFGA 3ZDYB 1PT6A 1ZOPA 5FFOA 3V4VA 4WK0B 3T3PB 1T0PA 4G1MB 2I91A 1N3YA 3PPWA 4DMUB 3NIGA 1RD4A 1M2OA 2I6SA 3V4PA 1QCYA 4F1JA 5E6SA 3ZDXA 2VC2A 4UM9A 1PD0A 3GXBA 3K71B 3PPYA 3ZE0A 1JEQA 1SQ0A 3ZE0B 3EH1A 5LN1A 1TYEB 5E6UB 4CN8A 1M10A 5E6UA 2WW8A 1RTKA 1NA5A 2M32A 5KYNA 4UM8A 3T3MA 3Q3GE 1JEYB 3ZE1B 4IXDA 3NIDA 4Z7NB 2QTVA 3K6SB 2XGGA 2VDOA 3K6SA 3M6FA 5HDBA 1DGQA 4FX5A 1Q0PA 2IUEA 3ZQKA 4NEHB 5BV8A 3ZDZA 3ZE2A 4WK2A 3ZDZB 1QC5B 2NUPB 3PPVA 5KYXB 4M76B 2NUPA 2VDKA 1BHO1 1RRKA 3EGXB 3EG9B 3EFOA 3ZDYA 1SHTX 3K72B 3EFOB 4WJKA 1U0NA 1V7PC 3EH2A 3NIGB 2O7NA 3VI3B 3NIFB 2XWBF 3HI6A 4G1MA 1MQ8B 2WINI 3TW0A 5KYYB 2NUTB 2B2XA 1ZONA 3FCSA 3IJEB 1JEQB 4HQFA 3K71A 1FE8A 2ICAA 5KYWB 1M1XA 1XDGA 3EOBI 1M1XB 4G1EA 3PPXA 1MHPA 4IRZA 1MF7A 3NIDB 1SHUX 3E2MA 1L5GA 2VDNA 3T3MB 4UM8B 1M2VA 1MQAA 1L5GB 1LFAA 1IJBA 2VDLB 4Z7OB 4MMZB 1JLMA 1UEXC 3BN3A 3N2NA 4HQOA 4O02A 4Z7QA 2VDOB 3HXOA 4F1KA 4O02B 4JDUA 1U8CB 4C2AA 1ZOOA 1AUQA 3ZE2B 1CK4A 1CQPA 1IDN1 5KYXA 3EG9A 1JEYA 4HQLA 2VDKB 4A0QA 1PCXA 4WK0A 1U0OC 3K72A 3TXAA 3F78A 4WJKB 4WFQA 1ATZA 2ADFA 4UM9B 3RAGA 3V4PB 2NUTA 1DZIA 2P26A 1IJKA 5E6RB 1MJNA 4JX0A 1YVRA 1TYEA 4Z7NA
chains in the Genus database with same CATH superfamily
3GRCA 1G43A 1IZ0A 1WL8A 3ELUA 2P28B 1YRHA 2NU7A 3RUIA 4FI6A 3BH6A 3ZWAA 3JXAA 2Z1NA 5I8OL 4DHLA 4LI0A 1F41A 3NAAH 1AUOA 5EZ6B 1CJBA 3OKEA 5B37A 1PEDA 4BNLA 5A4IS 2AMLA 3L18A 1PFWA 5EQFA 5AVQB 5IFKA 4OV6F 1KIPB 4GYWA 3QQ9C 3TQFA 1XV8A 3ZT7A 1HDMB 3UHPA 1NDQA 4F33B 3F85A 3IE9A 4WKNA 1QI5A 3JRNA 1ZOSA 1RZFL 3MV8D 2F7QA 2R8OA 3OESA 2ZT7A 4GF5A 3QUZA 4NC1C 4AGOA 4AJWA 1RJ9B 3VKVA 5DD5H 3KR1A 3LGAA 1KYXA 1JVBA 1UM8A 3VG0H 4FZ5A 2AANA 1P9RA 4UNNA 3DWFA 1K4KA 4ZXPA 4Y9TA 1GPDG 2OSXA 3PYLA 3RE0A 2Z5GA 5J6HA 3CEPB 5J5CA 4QQKA 4NQXA 5A2CA 2OR3A 2FHBA 1XDTT 1ZEAL 4E0RB 1JHKH 3I5UA 3S2UA 3MCG1 3R0ZA 4EW1A 4LJ4A 4M5YL 3S88H 1RTKA 5EE3A 4MRPA 3EXHA 1CFBA 3QJFA 5K4AA 1UJNA 1ZPDA 4YRLA 2IXFA 5CCDA 3D1LA 2WOYA 1T10A 1U8NB 4BNJA 3O7MA 2ZAOA 3WR5A 4U1NB 2HMYB 1GZ4A 4KFMB 1N8TA 4LNHA 4XA8A 1TUBB 1NN3A 4PQYA 1U1EA 4MWFB 1HEIA 3AFGA 4WK6A 3RY5A 1U3DA 1QFYA 4TKUB 5F9FA 3NMEA 5I1LB 1VEPA 3CFQA 4QUEA 3EC7A 2OLEA 5KNDA 3CZGA 3W5DA 2QPEB 1HE1C 4HZUB 4CQMB 3EE6A 4BCYA 1X1EA 1K98A 5LP6B 4PRLA 1YTLA 2H2SD 2DKOA 4E7OA 4P0TA 1U6AL 1WVZA 2IEIA 3UAGA 4PN7A 1NSYA 3CN0A 2G40A 2JLWA 4P82A 1IKFL 1X5KA 1GTVA 2H9NA 3UEQA 3V4PH 1F2TB 1CXLA 1TEYA 3T7SA 1WX1A 1GTNA 1D3CA 1NFDF 3VTTA 5I17A 4DEVA 5KSYA 5U4QA 3DZKA 4RMQA 1LO5A 4LLWB 3B2VL 2G07A 3K0SA 1NCHA 4RA0C 2C00A 3T5CA 3ABRB 2G3MA 2X1VA 6PAZA 4L3ED 5CAEA 4OCYH 1ZD2P 5HRCA 3W5UA 2GAJA 1T0JB 1AIFA 1Z22A 2J6IA 4FLQA 3PIRA 1QP1A 4BP3A 2HW8A 2WB4A 4DJJA 1PKOA 4OW6A 2JFVA 1A9BA 2X8LA 1DARA 2VAVA 2WWMC 4PEVA 4I5BB 4QBHA 1RE0A 4R1PA 4JSVC 3UMGA 2NO5A 2QSYA 4XCNB 5ETJA 5CYPA 3K72A 5LBUA 4F56A 3WYCA 1PO7A 4A09B 1QK3A 2C84A 3PRYA 3BIAX 3FMGL 1P60A 1PGOA 3PF2A 5C92A 2PFKA 3OKEB 9MHTA 2P40A 5FXYA 3K1JA 5CCKL 1U8OB 4MD0A 1UH5A 1SNRA 1WHOA 5FO7A 1JHYA 1TZIA 1OX4A 3WL6A 5CKGA 3FRPB 4RTSA 2YWRA 5IASA 3SGEI 1EAOA 1TO5A 4O33A 1KN2L 3CFDA 1A6VH 3OCZA 3UJPA 3IFPB 4RETA 4I77H 1TM5E 2BCEA 4K6MA 1IT9H 4U1MA 5C0RL 1XN4A 2LVBA 1HVXA 1YB5A 1NRWA 2WD7A 1HINL 1K5DA 4BVJA 3JVUA 4MQEB 3E0QA 4UQ9A 4P5TD 1G0DA 3GBMH 4QRAA 4G0OA 3U7YH 1BYNA 3CVVA 1NGPH 5JQGB 2J4WH 4P2OD 3WYNA 4BUHA 1L6IA 4D5EA 4LASL 2X09A 3SYPA 3DDWA 1RYEA 4LSRL 5IJAA 1CGWA 3RAJA 4HJUA 2MTPA 4AZUA 3MJDA 5JO5A 2Z2OA 3VFTA 4QG7A 2JKNA 4F7CB 3GLVA 3VJLA 2P80A 3HBMA 3GKWH 2QTMA 4HS3B 1MAML 3SIPA 3G2JA 4R97B 3S36H 4KIFA 3U82B 2A74C 3ETHA 1N77A 4RV4A 1E2LA 3SHTA 4W9DC 1W52X 2DQGL 4BLPA 1CBJA 1BLIA 2IH3B 1P0FA 3PNLA 1D5ZA 3PFFA 4JC4A 2HJ4A 1O0BA 2X14A 4WEEA 1Q1NA 1Z5NA 1UOKA 4S0SD 2WE8A 2XV3A 3P0GB 5JT1A 3LKRA 3RU9A 4TLSA 3F96A 4EA7A 1KY7A 3CUPA 3V8BA 3RRMC 1E3TA 1TT5A 5IGOA 3CQ9A 2IGFL 1P72A 1UJ2A 4H27A 3NYWA 4L76A 4MVJP 1NXTA 4RPJA 4I0PD 4MDYA 1IQWL 2LTQB 3VXNA 1YN6B 3BMWA 1HKHA 4JQVC 3QH3A 1WZEA 2H3EA 4N18A 4PVDA 1T9CA 3SDAD 3LQ2A 3BA1A 3FSRA 1W72L 4FHZA 4K94C 5BNWA 4PCSA 2EFJA 3RRZA 2XUFA 2O52A 2VN5A 3RTAA 1DLHB 3CVIL 5JMPA 4XARA 4BO8A 4KO8A 4IBUA 1A1NA 5K3CA 1WUYA 4GQ9H 5C09A 4M4SA 5M7EA 4PJEB 3UXHA 3MJSA 1U3UA 1GGFA 5FGBA 3OZXA 3ZK8A 2GAFA 5E23A 4MA7H 2C2ZA 3D87B 1DNPA 4PSAA 3FCSA 4L8LA 3BPLB 3OZEA 1TYJA 1H2ZA 3W6OA 3O4OC 3BXPA 2QADD 2OJ1A 3BWEA 5FF6B 3VGGA 5BUAA 3IB4A 5TXGA 4P4SB 1TNDA 4RKRA 4FQQB 1UKCA 1UKEA 4X64B 5TVGA 4EI5B 1YAIA 1RURH 3D50A 1ULTA 2VLKE 4JQVA 1NUQA 3GLZA 5THQA 3QO1B 4OI1A 4NCIA 2YNPA 4NZDA 2YJQA 1QWOA 4LWZA 5HXMA 5DIFA 1YJ5A 1ZHBB 4YSSA 1K2DB 1IIRA 1O96B 2O2SA 3QP9A 3SZGA 3SM3A 1UBHS 2Z04A 3HCCA 4XNAA 4PPFA 3VE0A 3WEAA 1Z9NA 4FQ5A 4KGLA 5FIUA 3UGJA 3NW9A 1EIWA 5C1IA 4UTNA 1QVRA 5DM0A 3K0AB 3ZUGA 3BTSA 1HILB 1A0RB 2C7QA 4IBYA 4GG1A 2ATIA 3NHWA 3D7MA 4BM7A 2DBVO 5KWVA 4ONOA 2XWBB 5AQEA 4MHHG 5HI5C 4CN8A 1MB4A 4OA8A 4YE4L 4K5PA 4HAIA 3B78A 2FQEA 3GLAA 5F9JA 1CL7I 4MV7A 1WE2A 1ZWKA 1Q38A 1V3VA 2WJ5A 4X6BB 5J1TB 4G0ZA 5AOMA 4N48A 2QSQA 5HS4A 3VRIA 1TEVA 1CP3A 2QX8A 3VH2A 3D3QA 2QUZA 2RHBA 3OAYH 4G5HA 2P5EB 5D4QA 4EUNA 3PV7A 5AKYA 5KWIA 4CMHA 5C0EB 1P1ZA 1YRQA 4NFCA 3OF3A 4I4IA 3GMIA 3GGWB 1J9TA 3OU6A 1E7QA 1O6ZA 3WADA 3CM0A 4LAQL 4UUJB 1T4KA 3EPRA 3OXSB 4UHCA 3DHYA 3DT9A 2BKVA 4ZEOA 2BSTA 3JAMA 4PJ9D 3N91A 2Q27A 1EUZA 3NKFA 1UP6A 1FVXA 3WELA 1HG1A 5H3CA 3I0MA 1W44A 5EHQA 4PJGE 4BKLB 4TZ0A 4M0UA 1B0RA 4L4RA 1E5DA 1EZUA 1AS2A 4S1WA 4OL9A 2ZPUA 3B7RL 2PZBA 3X14A 3S28A 3H1PA 5KSUA 3B7FA 4FTWA 4WO4C 2BDNH 1NOLA 2VQ4A 3KZXA 2C9SA 1J1UA 4F9FA 5IMKB 1S96A 1U8MA 4FKEA 2HFGL 3QX7A 5BUCA 4TOYH 2OFWA 2UWEE 1G5PA 1CUCA 2XOTA 3OKFA 4QOKD 3T7EA 3WHE1 3KNBA 4QEGA 5LG6A 1G7IA 1TVMA 4U1SB 1U3CA 1Q0YL 1AMYA 3E27A 3O2DL 1UJ6A 2X4GA 2H47C 3MRQB 1GLGA 5JALA 3AROA 1PLBA 2CNKA 1FE8H 4ZWNA 4ODTL 1BIIB 1IOWA 5AVTA 4G6ML 5K6RA 3QO0B 3BVXA 1YB4A 2ZPTX 5ITSA 1Z4IA 3OKCA 4A8JA 1XGRA 4PM4A 4TUYA 4PFKA 1I4TD 5KHLB 1FSFA 3E82A 5E2TH 2R39A 3MGOA 3PXDA 2XACC 2YKLL 3PRZA 2Z7WA 4E70A 4W9NC 4OUUB 1R0BA 3UR4A 5B1AB 1E1NA 1XEWY 4B7XA 5F0LB 2HKHH 3CX6A 5IT9g 2ZX6A 1LO2H 4LEIA 4Y2UA 5IVIA 2F17A 5EY5B 2OVFA 4KYVA 2EWMA 4GLFA 5IV2A 2TS1A 1U3JA 4WAFA 3DK0A 2ZUQB 3HCAA 3P4YA 3EKCA 1YCHA 4XCEB 2P2GA 2HM7A 4BSWA 4DCUA 1Z13A 5T1KD 2O2CA 4UM9D 3I34X 4DN3L 1DU4A 3TVMA 4R3UC 4M7ZB 3I28A 2GTHA 1IQWH 4L37A 3NPZB 4TVPH 4CRWB 4ZQIA 1U0EA 5EALA 2RC5A 1W0VA 3AH8B 4A2PA 3L1IA 3INRA 5ILQA 2CXQA 5T4EA 1NA5A 3CMGA 1RWQA 1OP3K 1Y5MA 4MNHB 4X80L 1JXMA 1K0UA 2IEAA 1C7JA 3CX8A 1TZMA 2J57G 2Z6AA 4LHZA 4D0KA 3SEZA 1GNRA 3B1ZA 5ADWA 3RNQA 3GA0A 2ACVA 3WNPA 4PLJD 4I2XA 5BO0D 5INCB 3VR2A 3JQ6A 2JB5L 1REQA 1U2CA 1EUDB 1JQKA 1JGIA 1O6VA 2FSUA 3TJHC 4W9NA 4Y4KD 5DM4A 3BN3A 2ZSFA 5D93C 3DC2A 4PXSA 4DNLA 2G82A 3QUZC 3GMTA 2DPGA 2E4VA 4LOJA 5TGBA 2JJ1D 3MLYL 3W39A 1L4MA 3QKSB 3VAAA 3ZVVA 2DQTH 3I2NA 2Q3MA 4J12A 5B12A 4FOTA 3IE2A 4XPGH 3M1YA 3RUGB 3KQTA 5I8CB 4MUNA 2X0DA 5F1IA 1NV9A 3OHPA 3EEFA 2CUKA 1E1KA 2EBUA 5K8CA 4CI9A 4FYVA 5DTMA 4EW3A 3SDCD 3TWCH 4I5FA 1FFNA 5EP4A 4C59B 2XG4B 4UBIA 2P78A 2ZICA 5LBSH 2H2FA 2VZOA 4XP6H 5ENWA 2GEQA 3A36A 5E6ID 1MCQA 3X3FL 4EUPB 3KPQA 1ONNA 3P3RA 1V5WA 4PO3X 5BO1L 1BWWA 4LDNA 3TFQA 3ESMA 5JS1A 3WLKX 2QX7A 4J4BA 1Q8MA 5D7SH 3SYNA 2I9TA 2GO1A 3GGGA 4AS3A 3EH4B 4PGDA 3RBAA 3N1GC 2F48A 3HWRA 4G5SA 2H31A 3SE4C 1FNDA 2I7XA 1I1CA 1W96A 3I50H 5BOZG 3TIFA 5EA0L 3WGMA 3M9XA 5LU8A 4YUAA 1DEHA 4ZCPA 3ZDZB 1UFKA 1GTFA 4IH1A 3UL4A 1PR4A 2P6RA 4K3EH 4Y2OA 3L0ZA 2PXYC 3RH0A 4D2IA 4AWJC 1Z9MA 1UXOA 5CFZA 1JI0A 3MLAA 1PJ8A 2GKOA 2GZSA 3WK6A 4N2AA 4DFHA 5K0GA 2AI1A 1A9BB 2JIXD 4O02L 2EDMA 5A04A 4Q7DA 2YKGA 2F58L 1TQ4A 4NJOA 2V17L 2ORWA 1KEML 2GNAA 2X1WL 4TRMA 4BO3A 3ECVA 2I7SA 3RY4A 1J7VR 1VZHA 4OBEA 4IXNA 2HWZL 3GDBA 1MHTA 3JZDA 1IC5L 3ABMB 2J2ZA 5J4MA 1E2MA 5L9DH 4NWTL 5KVQA 1B3JA 4HSGA 5EUBA 2D1RA 1UUNA 2D0OB 5AOIA 3T5TA 5EE0A 2AKAB 4YRMA 5FO8A 1D6MA 4FMCB 5DEIA 1RYDA 1J8SA 1LGVA 2FDRA 4OG2A 3VOAA 2Z8YM 1QTQA 3G9QA 2H29A 1TZGL 3TO5A 5LP6A 1G6RB 3KV1A 1V3KA 3WFDL 4AFNA 3QMVA 2OAAA 1G55A 3QIUB 1ZXQA 3B2UC 5HOEA 2IPTL 4PR0A 3NS7A 1X7YB 2H4EA 2IS1A 2O6PA 2XL3A 3H86A 3IMSA 3C7CB 2R7KA 4OVUA 3D2UB 4YXKL 1XVAA 4PPTA 3DX2A 1RAFA 3QBTB 4HOZA 5KVFE 5IKCA 1KEEA 3SGDH 1GTG1 2BX5A 4AJYV 5LMCA 3IJ1A 2JIBA 1MCWM 3LPDA 4GW4B 3JQFC 5JCXA 3LW8A 2O7RA 1N9GB 4KC0A 5EWLA 5C5IA 4AD8A 4Y2JA 1NJSA 4O9DA 1HC7A 1MW9X 3ULUF 3OH8A 3BP5A 1YR3A 5K9JL 2EDRA 5L4IA 3TBYA 2PCPA 1RNLA 1MKYA 1J0IA 4RWYL 3KJGA 4TYQA 3UQYS 1N9KA 2D0GA 3QH4A 3RVTD 3KWWB 4LTDA 4TXJA 1J48A 2AD1A 4TS4A 3IEMA 3LKRB 5BNFA 1KQNA 2K6ZA 1F0PA 2CUZA 4HAGA 4ZTEA 4F58H 3MBKA 3AVVA 1PLGH 4OUUA 3VU9A 4YWJA 5L4JA 3B6JA 5FPQA 1Z6XA 1JYFA 2A6PA 5AUMB 2NUAB 1SXIA 1PTKA 1K66A 3ZHRA 4EZBA 3VYTB 2OVQB 3Q8KA 2PL5A 1SOAA 4IVNA 3HHSA 2QOEA 2P30A 4M9UA 3WSQH 1W4CA 3FUIA 4UTAA 3VR1A 3F6RA 4WVLA 3ZHBA 2JI3A 1I6MA 1OBHA 2ACKA 3VPAA 1LQSR 4ZMWA 4DKTA 5DUPH 4IHBA 4NBSA 2PT6A 3I30X 1OPGH 2H3XC 4EUKA 5KMGA 3P32A 2E9IA 4D3DA 1JQAA 3OZCA 3VKGA 4E9LA 1KYOJ 4X0KB 4TS3A 2FRDA 5C0FB 4B2PA 4IJUA 3SQOL 1CF9A 2QE7D 3KWFA 3DCJA 2XPZA 1VCBC 3A6EA 3O6FD 1V7QA 3DAPA 4PWJA 1WE5A 5ESVA 2HSZA 3ILQD 2WGNB 2YWYA 1UMBA 1QLWA 3X3GL 2VHCA 4P83A 3WIIL 1D0SA 2COVD 4K9PA 4NWIA 3MSXA 3FTGA 4W81A 3OAYK 4EKXA 3GSWA 3NSDA 5EBLB 2JAUA 1YN7A 4JO4L 1KS9A 1UFRA 4WXYB 2WZ6A 2ARJQ 1MVOA 3OAUL 5AM4A 2YRWA 1YAZA 5L3QB 4BZWA 4L29A 2QZPA 1GY2A 3G6DH 3BRDA 5J1TC 2WLNA 1LE5A 2B9VA 2C42A 4CHGA 3Q2VA 1RC0A 3GLUA 1DKPA 2WB7A 3BAIA 3W3ZB 3WLPA 2WAHA 4AXWA 2Z2JA 4QGFA 1E96A 2PO6A 3CQQA 5I9QC 1RI1A 3QSGA 3RVJA 1EEHA 1YC8A 4MR7A 2HJWA 2VW7A 2J32A 2XRAL 2B2CA 1EEZB 4PONA 3R5XA 3E0XA 3TRHA 3TNNB 2XFXB 4I5BA 1J8HE 4D3ZA 3UC5A 3GBLA 2P5EE 3IAS1 3FFDB 1YS6A 2FZ3A 2J31A 3AM5A 1TT7A 3DVAB 2C61A 3R3WA 4ZX6A 1QK4A 4I5GA 3L6FB 4DBLC 4RX1A 3AG4B 3GX1A 4PHCA 4XBPB 1VE5A 3M81A 1OP3H 2ZJ5A 4LNRB 3RTLA 3P9MB 4IIQC 2LU4A 2H4XA 2J6WA 1I1AD 2O7NA 3VXOA 3DETC 1NOIA 3IEPA 4V1CB 4N85A 5HQTA 1PT7A 4BXOA 1SVSA 4RL4A 1ZICA 4H6WA 2YW2A 5FBHA 4RK1A 1U7ZA 1TCUA 2V0AA 1IQPA 2WZ5A 2CUMA 4FFWD 1FLAA 1B0ZA 4JOQA 3T6VA 3O7WA 4G5ZL 3SHVA 3MV8B 5LWHA 2VKQA 1EFUA 3AJ8A 1Z3GL 1WZUA 3PQYD 4F8QA 4IUBS 2O59A 4YFEA 3TN7A 4PTTB 3WLRA 4BECA 4HCGA 1J90A 2DPLA 4YDKL 4G7RB 4ONFL 2BIMA 1GCUA 4WTZG 3T3DA 3IFSA 4QQFA 3EA4A 4RELA 3P9NA 4Q3DA 1USQA 3FO9B 2GEVA 4PRIE 2FWOB 4XPFL 1VMAA 1L7OA 3D59A 4NWUH 3Q87B 4CRPA 3WFEL 3UAWA 3KEOA 3DXKC 1CR1A 5FF6A 1LK3H 5HJEA 4TTQA 4D9LL 3IMWA 1GSOA 5TF2A 3S3JA 3TCXB 2Y6SD 2E4UA 3C5HA 3QORD 2GCPA 2VE6B 5AQ0A 1HPLA 4A1OA 3GIZL 3KOMA 2C4XA 5KVGH 3RVVC 3ESUF 2RBEA 5A9SB 4Y9UA 3GHBH 2OXTA 2BFWA 2NYVA 4XD7D 5FR2A 4F6CA 1DIGA 1MFBH 4LHYA 1PQWA 3LT2A 1Z8FA 1YS4A 4YX2L 2EXYD 4YSQA 5BP7A 1EB8A 1Q7TA 1R9MA 1OTUD 1BEYH 2QLTA 3OKKA 4PSDA 1UMDA 1NANH 5L6YH 4NZYA 4N39A 1KFCB 1TM3E 4BMSA 2AS5M 3DP9A 4R54A 1B9YA 4XVRA 4F4IA 1RBYA 1MJNA 4X93A 1F97A 3Q0TA 2X8JB 4J0QA 4UILH 4Q39A 2EWVA 1J4AA 4I5EA 3P30L 3ZN6A 2I0TA 4W6QA 4BE4A 3DAGA 2PA0A 2UVDA 3FZUD 5AFU3 4O5LH 3H11B 1XEDA 2QX9A 2CMKA 2D8KA 1FW6A 2VDMB 4R1MA 3L6DA 3HCEA 4ID3A 1Q50A 4EHKA 4ROSA 3WGNA 1VBKA 2X2HA 2OBYA 3O3CA 1EXUA 3GRWL 3FHTA 4I50F 1VLVA 3NCYP 2XRFA 4J3VA 1AKYA 2WSMA 1AZCA 1RUAH 3VI4E 2YQ2A 5CP7B 2IIPA 1XROA 2MMXA 4D0NA 5EF3A 2GUOA 3OJVC 1YB2A 2J1KA 3LHPL 2GCEA 3SB3A 1J0EA 5D2NA 2QP4A 2OCXA 4FTVA 3FNIA 2CNWA 3L81A 5AI8A 4RGOL 3KHUA 5H5JA 2DL9A 4JFFA 1IZ7A 3PD7A 1T1YA 5C8ZA 3SMVA 3MNZB 3CEMA 3FPXA 2W2QA 4M0LA 1PNTA 1OANA 1OGAD 1INQA 5BUPA 4V1DD 5E8PA 1CK4A 3IJYA 4U05A 3GY0A 1ODLA 5DMYA 1NU8A 1GQOA 5KTMA 4FJ6A 1HH9A 2KYRA 3NJMA 1I8IA 2JKYA 4FL4C 1FVCA 2JAHA 3MRHB 3VGDA 3AEYA 1G20A 4RCVA 5JOQA 4RWHA 4URZR 2DY1A 5GS2H 3T12A 4XGZB 2ENPA 3J7TA 1MKFA 3I1FA 2CJYA 3QG6B 4N1HB 2BSSA 2WM2A 4ED9A 4A6YB 1RCUA 3BTVA 2YXMA 5I66B 2D9QB 4LQFH 2BFVH 2X0NA 4CR8A 5FL7D 3WKBA 3H6KA 1ZFNA 2CHZA 4NZNA 1IVNA 1F4YL 1A6AB 2EJTA 2X5XA 3NP3A 3MRRA 4G7VL 2R6R1 3AI2A 1Y5RA 1E5AA 5SYNA 2EIMB 4BN0A 3A4DA 2IO5A 1CIDA 4INZA 3EBOA 4H17A 3EJJX 4DIEA 2XA8H 2EZ4A 1ZPLA 1GYUA 3CX4A 1GSKA 4M4RA 2FRVA 1QRUA 1W36C 4FKHA 3U9PH 5E1AB 2XJ9A 3U9SA 4JG1H 4CDHA 1EX6A 1L3NA 3SF8B 2ASEA 1DUYA 3IN0A 3WQQA 3H8JA 4W9EC 1C9DB 3IXTA 5D96C 1XXHA 5DS1A 2ENWA 3T65A 2FVNA 3N0RA 2FJGA 2NY1C 4HAFA 1SB8A 3GD1C 3B82A 1JK8B 2JFUA 5GV8A 3FF7A 3B7UX 5CBAA 3NAZA 4XD7A 4Y9CA 4GLOA 2CJTA 4J0KA 1M1NA 2WDPA 4QDJA 1M2VA 2WQZA 1H5QA 4D3CL 1BVNP 3IS0X 3NH7H 4Y1TA 3W3AA 1P7BA 5JATA 1KRXA 4MSWB 3OX1A 1IEBB 4NYMQ 3UATA 3IAXA 2KZBA 3PBKA 1QLEL 1R5JA 2V2TB 2PL3A 1SOMA 5K0ZA 1NHGA 5ICEA 1Z35A 2X7JA 2Y1DA 3QVTA 4KJXA 5I7FA 3DBRA 3ZR4B 4NE2A 4N0MA 3D34A 1C0IA 5D5PA 1P7QD 3PB3A 3UTQB 3H16A 4ELMF 3KYBA 4OB6A 3FNKA 3BSFA 2VDRH 2OJEB 1E4KA 4LB8A 5JXWA 4S1NA 1GMEA 2HKAA 1J05A 1JU9A 1AQDB 4HAOA 1M42A 1U0GA 1PYOA 3QQ4A 3VSBA 2W6PA 4JXXA 2OFQA 4BMNA 5K5YA 3CF4A 1TZCA 4MA1B 3PNVA 2VDLA 2R1YB 4PYGA 3L1FA 4PJ7A 4YBLC 1MCEA 1H6TA 4GPTA 1B43A 1R12A 1E94E 3A4NA 4JGGA 2XNCA 3PGDA 2VC2A 3PPYA 1PZ5B 4ZAFA 1K7EB 4U1LA 4PJFE 1NUTA 4LZPA 1O9HA 5BWNA 4PJ7F 4R2LA 1BD3A 4PQEA 3ZQKA 3VFOB 5SWSB 4DUWA 3T3GA 5TS3A 1C1DB 3DOCA 3OKMB 1A4RA 1FU4A 1QLHA 5ANMB 1U5BB 4ZEXA 1W49A 1JU3A 4UAGA 3VI3B 3IBCA 3C85A 2Y92A 4FQIH 2B2XA 1PW3A 2MR6A 2AEWA 4BEBA 1WW2A 3EHDA 2AXPA 1PK7A 5CH3A 2E59A 1TFUA 1PNOA 1XB3A 4JLMA 3RAJL 4C7MA 4PI2A 2R0WH 4CW1A 3PL1A 2XGSA 4PRPD 4YI3A 1SGWA 4Q9RH 3T7CA 5J47A 2EYSB 3OIVA 4G6FD 5KVFH 2JBHA 4WVRA 1BWRA 4ODHL 1E1CA 2AH5A 1YG9A 5CZVH 4K05A 5BUQA 1T7WA 4B6PA 5JNRA 1DUZA 1CY7A 2W48A 4OLYH 4MW4A 3EU7A 3CJQA 2CE9A 4G8AC 3GSUB 4PYNA 4UT6A 4TQPA 2B8WA 3H8WA 2XZDA 4UILL 1ZZGA 5F0MB 2BGLA 1KBGH 3FWNA 3FTWA 4GEGA 2IGFH 4BGLA 3RFZA 3NGXA 4QPNA 4C7OA 4Q03A 4HDKA 5DF0A 2ID4A 3GJ5A 3L1KA 4IFIA 1YS9A 2C7RA 2ODQA 1PEZA 4GXUN 2LLNA 5H17A 2VLKB 1E64A 3TD9A 4ABTA 2YXLA 5IVXE 1ONSA 1R6DA 2GDJA 2Y7QB 3K2QA 4Y16B 5FH9A 4HTFA 2A7BA 4AQ8C 4IHOB 3KP1A 3CZPA 1KCLA 5ELMA 3X17A 3R3UA 1RUAL 1ZCJA 1MJ7H 4UM8A 4UBDC 2FLKA 1CDGA 4B1FA 3TT1L 4ON9A 2OV8A 1ZHNA 5JADA 4BP9A 3M4ZA 1EXUB 1BEXA 3FSEA 2YNMA 4PV9B 5K59E 1ZT7A 3CXDH 3ULEC 4AJJA 2RHWA 4RFNB 3LCJA 1F3RB 3B3IB 3VXTA 3ORJA 5CK4A 4NCC1 1D8TA 3BWBA 2YXVA 4YZFE 4H26A 2CYAA 5JTWA 2O6DA 2FW1A 4DUGA 1NBZA 2XMQA 1IJEA 2J1LA 4KR9A 1WLYA 3L9XA 5C8XA 1A7PH 1LTXA 3QEGL 1VYHC 3TJEH 3I8CA 3PREA 4WFED 3PP3H 4C5CA 1RURL 2W18A 1V1JA 3JV7A 4O9HL 1SUPA 2AIRA 1H6BA 3ANLA 3FUVA 2NT1A 1NZJA 3L84A 5A5FA 2P5WA 1Q9LB 4FFZH 4XNXH 2NXWA 3N9GH 3K1AB 4CUKA 1PJCA 3IR5A 2CMHA 2IFFH 2FYYA 3LIUA 4EAAA 2YBRA 1SBSL 3JUZA 5F1OA 1T7VA 5KNCD 3GHBL 3CUYA 2MCPH 3P27A 1I9EA 3WO4C 4C3VA 1F8XA 4IF4A 2DIJA 2ZI5A 2VC2B 4Y2TA 5JSYA 4HDQB 1K6QH 2YJ4A 3OQHA 4S11A 2BD0A 3RSQA 3ZIAA 2DT5A 3ZY6A 4LQ1A 4J87A 5C9KA 5EWLB 3RWJA 3OPUA 4JFPB 3CVHL 5JZSA 1W0KD 2LW3A 4NZ9A 1IOVA 1VMDA 4PM1A 3UTPE 1PKEA 4P1ZA 3UWDA 3GSXA 3ACDA 4G1MB 4RWYH 4FZEL 1DBPA 3BEVA 2X4LA 4NU0A 3KB6A 1D7OA 1GG2A 5LP6C 4BJ5A 3AEQB 1U81A 4DWHA 2C88A 4MDJA 2C04A 4RDBA 2BGRA 3WK7A 4XYBA 3RVKA 1RMFL 1KACB 3GZJA 3U79A 2F3UA 4WUUB 3HO8A 3RJMA 2NUAA 3L7FB 5D1ZI 3LKSB 2HRZA 3MWEB 4NU8X 1AD9A 1P4AA 3OE7A 1WDTA 2BOLA 3ODTA 1JCKA 1UEYA 1YI1A 2XX3A 4CKEB 1A1OA 4MAYD 5LCVH 3EZJB 3CRMA 1NBVL 4L1SA 4L9AA 5KS9F 1LQBC 2YPLB 4Z8FH 3F58L 4YUVA 3WLFA 3MBXH 4NC9A 1F4XL 5J40A 1RSZA 1HHHA 4LG1A 3H1ZA 4R5XA 2NYYD 3HY6A 1D7AA 3HEMA 2Q7AA 3AQZA 1YEEL 3GU3A 4I5IA 4ENEC 1WQ4A 5AENA 3Q2IA 4CLOA 3ER9A 4U1HA 3W7AA 2M6RA 2DWDA 2RFLA 5TH2B 4HZIA 3NPAA 2A33A 2QORA 4ZW7A 4RZ3A 1RTTA 4H5JA 3PK0A 4A2WA 3BGFB 2CN2A 4DLZA 1WZCA 1RWOA 4G26A 1NBIA 3M34A 3MHPA 2ZJAA 3GLGE 3N1PC 2DQMA 3EI4B 1RXCA 4GI2A 2HFGH 5TJ9A 1U9ZA 3HM9A 2GRAA 4KN9S 4M9CA 5BURA 5EOCL 1H1LA 4JHPC 2P9PC 1ZVYA 3IOCA 1IEAA 5A2QA 1A4XA 5ESQA 2Q7YB 1NBZB 4PQRA 2WYUA 3E6FA 1PHRA 3BSZL 4B3VA 3CZUB 1CS0B 4ODIA 1OA0A 3HS0C 1L4FA 5EXXA 4LF7B 3HMXH 2BGIA 3FN9A 4HWBH 3P9CA 1R37A 3HVHA 3LPPA 2GFQA 2NOAA 4F71A 5K1JA 1KOAA 3GSRB 3DD5A 5BVGA 4D2NA 1RPAA 2FSVA 1V96A 1CFNA 5BW8A 1CLUA 1CY2A 1U94A 1WOYA 4KVFA 2RA1A 1MAMH 4Z7QA 2QZSA 2DTXA 4QXOA 2QT1A 2Y9MB 2YNMD 1KEVA 1TVBA 5IU6A 4N4YB 5BYAA 4BMOB 4TUKH 4A7SA 3GT7A 2Y23A 2X9XA 5FWAA 3UUGA 4OLWH 3RT9A 2R29H 4LC0A 4OLWL 3M88A 2VAAA 4WW1A 2QMJA 2P6OA 3QBVA 3FCAA 1C41A 1I10A 4XVUA 1WCBA 1SKYE 1T1ZB 1KZ4A 2EADA 2FQGA 2VHUA 1T3ZA 2WQ6A 1NOJA 3RVPA 3EGCA 2OV2A 3ZE2E 1H85A 1XVUA 2BYTA 4KYIB 4EKGA 1J25A 4U6HB 2WC1A 2RKOA 3WQHA 3W8DA 5TQ2B 3VC2A 1DUZB 3HHPA 2Y5TA 2NQ2C 3L3IA 3N2KA 1U2HA 1O95C 1GCGA 1GVNB 3MAGA 2WWVD 2BXYA 5JYLA 1NCIA 2X9YA 1EGJL 2R15A 1Z39A 5C0CB 3STLB 2HVJA 1EGJH 2PO6C 4FPXA 4ACPA 3U6KA 5ILOA 4CG1A 4L07A 1DCTA 1N8KA 1AGFA 4HT3B 2B25A 1KEPA 5AVXA 1CPUA 1JNHB 1YHYA 4JFXA 1WDWB 2FZWA 3KDPA 3DKVA 2WJHA 2YV3A 1FFXB 4WO0A 2WWXA 1I1YA 3VRJB 4E5DA 1M7XA 2J55H 1IY2A 2A4MA 2ICES 2AV6A 4NRYA 3C3WA 3I9LA 3HVKA 4GEKA 1I3RB 5D70L 1B14A 3AF5A 3L0IB 1N8ZB 3MJWA 4HDOB 1FN4B 2BY2A 1X38A 4KQMA 3T5AA 3ZQJA 4CQLB 1IQDB 2G4GA 3ZIYA 4GOKA 3L5HA 1WRFA 1CL7H 2ORBL 3PQ6A 1K89A 3WWDA 1QFUH 1L5OA 1XTKA 3T0FA 2WWTA 4Q16A 4CNIB 2IQIA 4FP8H 1O7DC 3MRJA 2BMJA 3U5ZB 3I45A 3IIYA 4BNZA 1BVYF 2LDBA 3NRJA 3WL4A 4Q7MB 1J20A 1ROCA 2HJKA 4HFUL 5C7YA 3ZJVA 3TEFA 2XLCA 2JGDA 4FUTA 2R65A 3G02A 4RZIA 1AHNA 2A9RA 4BEIA 3VQLA 1BX1A 2Z2IA 3L8GA 1KXZA 4D8UA 1DC4A 4QU5A 3ED1A 1XCBA 1ABBA 3EHBB 1O4VA 3D6NB 2PM7B 4AULA 2ZUWA 4H8UA 3Q5DA 3EG6A 3Q0IA 2D3WA 4R9NA 3EIWA 1E3MA 3JVGA 5DLML 1JNJA 4M03A 2QXTA 4QXGL 3N2YA 1OX4B 2YJ5A 4WUKH 4MH0R 4W5HA 3JVDA 4H7PA 3RYMA 4KK8C 3NRBA 5LZ2A 1KDRA 1VCIA 3NACL 2YY5A 4HC1A 3BGDA 3UB3A 3TTYA 3TS1A 1WKVA 1RHQA 2BLNA 1BXKA 1QABA 1LP9F 5AKHA 3RL1B 1FSKC 4PRIA 4BGIA 1KQGA 4YP9A 3IBEA 1P17A 4DSNA 4G56A 2Q50A 4CLRB 4Y2DC 2J9YB 3ESOA 3DSNB 3QNYA 2VZSA 1JHXA 4M3NA 1G1CA 1TLTA 5DJ0A 4P0PB 3UJHA 4XNQA 1C8VB 4F3TA 3BCFA 3RTQB 1K2WA 1BVKA 5AOZA 2RH4A 1H2WA 2PLWA 3DE4X 5C6TH 4HRAA 2JCXA 3ORYA 1WTCA 1G4MA 1X1QA 1G19A 3I9NA 2Q4EA 4G41A 2V37A 1IC5H 5CJQL 2G0TA 4NI6A 3ZLJA 1YA6A 3DE2X 2O5VA 1E79A 4XGZA 1HL8A 3PR1A 1A8IA 4S1DC 3MWDA 5D86A 2CMRH 2O05A 3ZNOA 2VR7A 3C2SA 1EK0A 2YC2C 2D1YA 3RC2A 3EW3B 1T1YB 4FYHA 4J4PA 4C4KT 4LCIH 4JN6B 3FFTA 4P3PA 5D1QE 3OQVA 1WG8A 3EGVA 4APXB 4PY2A 3LKPB 2CBOA 4HIEA 5BV7B 5CCGE 2VYND 1S2NA 1U31A 3QC6X 1WR8A 3VYUB 3MRDB 4PG6A 1DAGA 3BRSA 4WXPA 2GTPA 4YYEA 3OOSA 1TAQA 4NP4H 3DYVA 5EIIA 4X3CA 4HLEA 3RWDB 1QCZA 5HZHA 2D8AA 3BGVA 1Z8NA 2E86A 3ON5A 3EWAA 3ND8A 5A0VA 4G9FD 4EOWL 3I7HA 3LX9A 1OLZA 2JK1A 4TS1A 4G1EA 3ZW7A 5JHDD 1RI4A 3BP6A 1N2BA 1PR0A 4O02A 2PGIA 3WBJA 1AI1L 5JDIC 2ZPAA 3FTFA 1LLCA 1FTNA 1JE6A 3C70A 1JNYA 4BFIB 3QU7A 3LRSB 1GLNA 3D43A 5DOVA 1DZIA 4JVWA 1O95A 2GWHA 1UMCB 1HURA 1VB5A 3FR8A 4ZT1A 4MB3A 2I62A 3CLFL 2YMMA 2PGJA 5FHRA 2E74C 5M7QA 5M61A 4R8RA 3DTUB 5LA6A 4DJFC 3JQRA 3FO1B 4KX7A 2CYBA 4UT9H 4RE5A 3R06B 1HZLA 4AEIH 1S78C 4LVOA 4OQ1A 4RVFA 2XWSA 4UTXA 3S1AA 2QAGA 3U0PB 1Z4KA 2C9BA 4Q01A 5JPDA 4OTXH 1M0EA 4XTCS 4S1QL 4QBGB 3DLCA 4OD1L 3NIGA 1XBDA 1DVXA 3EZ8A 2PYEB 5E6SA 1SOVA 3OJCA 3SDZA 4KI1A 5J89A 4HDMB 4L9SA 4P2AA 2ILVA 1EP2B 4A7GA 2RGAA 3F58H 1F4PA 4CZYA 1ZD1A 3ASVA 3FX2A 2UYOA 3RTQA 3WIBA 4J3OG 4PV9A 2PWGA 5KYTA 4PVLA 1WEJH 5ERWA 4DMHA 4RIRB 4TL7A 1P4UA 4R5TA 3WXMA 3HI5H 2WHQA 4NO0A 4DGVH 3V6FA 4G43B 2E3JA 2C8JA 2O2EA 1SURA 2A9QA 3BILA 3GPLA 2ACWA 4WFKA 3LN4B 1YY8A 5GRJL 3IUBA 1VRWA 5DCUA 2AGJH 1QYCA 5DD1L 4CW7A 4LLQA 3H9YA 4JRLA 1MJ8L 4QD2E 5C8JA 1U3HC 4RNDB 1XTJA 1ICIA 3WZMA 2UXDB 3MYZA 4R26H 4NC0B 3GO1L 4RF3A 4Y2DD 2UZPA 4FQXA 4TTJA 2IAMA 2QNRA 4JFDB 4N3CA 1Y1SA 2E0IA 4JRYD 3ROLA 2B82A 2YDYA 1TIBA 4X65B 4IHKA 1RAMA 4CGZA 3O2DH 3MLRL 2Y2YA 4LDJA 5T67A 3IMEA 3U7YL 2BEWA 3KSUA 3RG1C 4N2NA 4MW2A 2NZXA 2BLFA 4QYAA 5D01A 1NVWQ 3C60B 4CILA 4Q9RL 4JP3A 4NENB 4F9PC 2GWRA 3T0ED 2NVOA 3N5AA 2MIIA 5TE6H 4KRPD 4TT3D 3OO1A 1JQ5A 2QQKL 5JD4A 3TOPA 1TUGA 5FYLL 3O4IA 1NI5A 2YXNA 4BUJA 1DJZA 1M8GA 2VJMB 2VABB 4X7SH 2G0KA 3CFEB 2R7LA 4H8WH 4KIJA 4GQIA 1ZIDA 4UUJA 3PGFL 2AJCA 4NHOA 1IGJA 4Q4JB 2HJGA 5CZVL 4NQQA 4RA6A 3C5SB 5EIBC 3V2AR 5U1PA 2ZYAA 2KBGA 2XXMB 1IRXA 3WNCA 3HB3B 2BEJA 1RZ3A 1GG9A 2CDRA 4X54A 2PX6A 4OZUA 1MABA 1HXKA 3CFNA 5EDXA 4ES0A 2CHVA 2PNJA 3BK1A 1DO8A 3ANSA 2VN7A 2FXVA 1HHKA 4G9BA 1X7ZB 1XRPA 2W6CX 4ND4A 5CIPA 1EEUA 2P49B 3GLKA 1U92A 3E22B 3RX8A 2DQFB 1QTRA 5TE4L 1PIFA 2QPSA 2BVEA 1Z17A 3IVMA 4PMFA 3QSYA 5CD5D 5IF0B 2V03A 2KMLA 4X99B 2B1IA 1UTDA 4BZ1H 4DWWA 3OA0A 4CWAA 2HJSA 3JTTB 4DR6B 3FT0A 1L7QA 1TQHA 4I1NB 5DJZA 4K8RH 3M6XA 1UFOA 3KYKL 4P3OA 3BPCB 3LPLA 1GC1L 3JSSA 5F5NA 4A36A 3TK1A 3KZNA 1HSZA 3L9EA 4G7QB 1F2TA 2GBVA 4QGHA 4NLAA 1Q7GA 2IPTH 4O51A 4XNYH 2V59A 4RZCA 4Y19B 1RD6A 4L3WA 3LFUA 4JG0L 3K0KA 2GHWB 4L23A 1NJ6A 5DFAA 1QIEA 1AH1A 4FCHA 4F06A 3OZDA 3ORRA 5KVVA 4H7EA 4YHZL 1YNKH 2RGDA 2O8CA 2ZVJA 4Z7NE 2NVUA 2VUYA 4UDOA 3II3A 1N67A 2O0MA 3F7RA 2BBSA 1NEXB 5I76A 3TYFB 4RVDA 3U0TA 5H4ZA 3DOJA 3R7RA 1P53A 4N3BA 3UTTE 3E4DA 2O93L 2GF2A 4UNPA 5L2JA 4MZ2A 2VO1A 4XM0A 3A6LA 5K8TA 1XKSA 4QPDA 4QQNA 3QDMA 3FHAA 2E7MA 3VMPA 1YKGA 4E15A 5DULA 3MJ7B 1BQ3A 2JIXB 5D7SL 2Z0MA 1DHRA 4UEQA 3QUCA 4B4OA 4PIBA 1EQAA 1MIML 4NP9A 4J8PA 4J81A 3ZO9A 3A4YA 2D6FA 3NYIA 4PNHA 4KUHA 1BRTA 2V45A 2C4UA 3SDXB 1ECPA 2ZSVB 3S5LG 4EYSA 2OL3H 3QE2A 5J2UB 3RPIA 4A8HA 3GXDA 1R3LB 4BPRA 4KFUA 1X14A 2QR3A 4LVOC 1Q7CA 4HXFB 2BCKA 1L4EA 2WSIA 2R44A 3DP7A 3MZLA 2FEAA 1A3RL 4HG4J 5FECA 4MGEA 2QW0X 5FOBB 1LWNA 1BQHB 1D2GA 2NXEA 3PU6A 1BM7A 1E43A 3Q1LA 4BU1A 3SGKC 4V11A 5I1KL 3S34H 3MWYW 2Q62A 1X7WA 4OLVH 4OSEA 4M9SA 1H6CA 1O5OA 3BDIA 5E4FA 4FZ8L 3U2SA 3KVRA 2BM0A 5HK8A 2J8HA 3H3JA 3F4KA 1H93A 4EPTA 2IH3A 3LRHA 2QKYA 1I1FA 3NHBA 3V8RA 2YN5A 4LLAA 4E03A 2YBRB 2NY4D 4Z5RA 1Z6GA 2PY6A 3VU2A 1EHXA 4PC1A 4M1GH 4OM8A 2JIPA 3MMPA 4YBHA 5ESXA 1XK6A 3DZCA 3FIUA 5DBOA 3TH5A 1DUIA 4BZQA 4OJFH 5EVJA 1V8FA 3KQWA 1XTZA 3P5BA 421PA 1MFDH 5ADHA 1OF1A 4XC3L 2QDVA 4R40A 3RUPA 2CEAA 3JTBA 2I2DA 1YRYE 1XMXA 3U4BL 3GMOB 3RAGA 4RVOA 4KGJA 3HNPA 4FZRA 4HLJA 2ZQZA 1BOOA 5KSVA 1PMYA 2CH8A 3IDMA 2RSLA 5IZ4A 1IHUA 4AY2A 1PT5A 2FECL 4MQUA 4FBLA 3R7SA 2EDFA 4QRRA 3QM1A 2HZ7A 1T9HA 2Q8QA 3L4OD 4TQAA 4RFSB 1YDFA 1N0LA 1KEUA 2BI4A 1XDWA 3RSEC 3CDYA 4HGWA 4ZHSA 3POHA 3CY6A 4KXLA 1J5CA 3CBRA 3GRGA 4MMZA 3L3IB 3A0OA 2XBMA 1N2IA 3NP4A 4RIEA 1WXFA 2R1TA 3TECE 5DS8B 1U6AH 4XN4A 2FUG1 3BVNB 1KJ3H 1UASA 2PUEA 4MNGB 1N3IA 3D9AL 1FDUA 3PE6A 3TYXA 3L4EA 1M71B 1YJDC 1O54A 4WEBL 4JN2A 1ZISA 5LYJF 1MH1A 2AKRA 4A2EA 5I5IA 1L8OA 5AVXB 3VNZA 5E38A 4MXVF 4N8VA 1QE0A 1SD1A 1CEYA 2JFHA 4TMTA 3V10A 1YACA 1Z8DA 3QV2A 3RG2A 3R24A 4GOJA 5DGXA 4UMFA 4R8KA 1JVLA 2X7LA 1QGZA 3FQUB 5B1JC 3WMXA 3CNQS 3VD2A 1F0YA 1GPNA 1D5RA 3RURA 2NU9B 1RERA 1HU8A 3HLTA 3KKOA 3TTSA 3V52H 3ACCA 4PC0A 1EVZA 3HCNA 4IIJF 2HT2C 3EZ7A 3L7EA 3ADDA 4K2UL 1HKUA 2X2IA 1R17A 4M1WA 3TR6A 5EMLB 3ZDYE 3BSGA 5D6DA 3OFKA 2L3BA 2XYCA 4OCNC 4LX8A 3T1YB 4RDQG 3LOWA 1U6JA 1UPXA 5JXGA 3IEAA 4YWHA 3WLWD 5DZJA 1HYQA 1JPNA 5HYFA 4R01A 5JHDE 3GMPB 3TL5A 4F6RA 2B3IA 4KDEA 2FGKA 2DCMA 4X6EA 3NG1A 4KQ3L 3HR6A 1DEEB 3LPOA 3OQOA 2QTVB 2QADC 3T3NA 3G79A 2PL9A 2GYVA 4Z0TA 4Z8XA 5CVCA 5E5MA 1BYUA 1OARL 1F3DH 3CFIC 3L5OA 4EL5A 3MUOA 2IZ0A 1BKDR 4BDSA 4U1EI 2DQIH 3V5NA 2FR4B 2YZ7A 5IJBC 1IEWA 3ATEA 1SUJA 1NBWB 2FX9H 3PYMA 1KELH 1E4YA 5EU7E 2ZF9A 3GDGA 5K99A 3PLRA 4QXUH 4BCXA 2IUEA 1V4NA 1G8AA 4JRWA 1NCAH 1SWVA 1KJ2L 3UIYA 4A63A 5LBSL 2MYPA 3VHRA 3WA6A 1G9XA 4NSKB 3CFKA 3OD5A 4E1AA 1JWBB 1H0RA 4K6GA 1OM9A 4MAUL 4OFZA 4EITA 2GN0A 4RSVA 5JXAL 2OP1A 3T8VA 1HJBC 4X6FB 5ESRA 1JMZA 2JGEA 4OQ4A 1C50A 1TQCC 4Z7OB 4JHWH 2J9FA 1FG2A 1V2GA 2ZQKA 3OCVA 5F1NA 2XRAH 2CLRB 2C7FA 4ALJA 1CY0A 1S46A 5HGHA 1JEOA 1ACYH 3LC2O 4OXRA 3G2QA 2WNWA 1P2CA 4FNAA 2QW8A 1HYHA 3QQDA 3VNQA 5KSZA 5C0AE 2WUCH 1N7JA 5EEVA 1RSFA 4BVLA 5DI3A 3FH5A 1UF9A 3OG9A 2UYLA 4AB1A 1Q11A 1RLWA 4IDAA 1YO4A 2J08A 3DTVD 3NHLA 4MQ5A 4CJXA 1E1YA 3C2AH 1F0NA 3DX7A 3EO0A 3DBLB 5L4MA 4EDWL 3K46A 5CVEA 4JRYA 3BAEH 1RJDA 3CAFA 3K1TA 4GMKA 1JMXB 3WIHA 3UEOA 2OHOA 4ZOLF 4XUCA 4HQNA 1CEXA 3FCBA 3I1YA 1CC3A 1F5SA 1IY9A 4J0FA 1GRCA 4KAJA 3U3XA 3MRJB 4XODA 2R4UA 1X3SA 8ATCA 3BMCA 3A9SA 1EZVX 1J8MF 1JHPA 2Y8EA 3FFCA 1YBFA 4U6XA 2VT6A 3ELBA 4GUDA 2O8FA 1KCRL 1N4AA 1Z29A 5ALZA 2BZ7A 1IEHA 2FH8A 3TU6A 3ZWVA 1Y5LA 2Q3EA 1FRGL 5DURD 3UAYA 2IZ6A 4RADA 5C0BA 4MPPA 5IG2A 3OZFA 5F2FA 3U4EA 2O19A 4NUGH 4S1SH 1FC0A 1C3OB 4IDBA 5IB4A 4RA9B 3TQHA 2WLZA 1WV7T 5ITFA 1RP9A 3NVAA 4IL5A 4KBGA 1JP5A 5JRZA 4H1UA 5FDWA 3GJEA 3CSSA 3EMHA 4R7LA 4LRQA 3LRSA 5FJJA 2A84A 4K1LA 4ARVA 3TW4A 3QDJB 2NZ2A 4ORZC 1D7BA 3TLRA 2XNSA 2J07A 4JEGB 4MTMA 4U7DA 1FPQA 4OCMC 2N3JA 4QRBA 3U6XA 5FUBA 3VV3A 5IVDA 1SBQA 3WYGA 1LQUA 5LQRA 2O5ZH 4HTAA 4OBXA 3UKRC 3FO1A 4JBSA 3VXPB 2WWIA 3QOYA 4MB6A 4IJ3C 1HG0A 1S9WB 2W0LA 5E9NA 1UR5A 1OAUH 1QQAA 1JW9B 3NJLA 4GT1A 4Q6YA 4C2BA 3CZ5A 3ISYA 3GHPA 3QULA 1AC6A 5K19A 1S5HA 4K3DL 5EWIL 4OF7A 4C56E 4B71A 5I3ZA 3EODA 4YLYA 3W39B 1W8DA 2ZCHH 7TAAA 5F4BA 2GABA 4HC1H 1WZKA 1Y1QA 4Z3KA 1JTPA 3NTRA 4ECAA 5FLYA 1E6LA 1DDIA 3ZHSA 3MRMB 2NY2D 3HW7A 1XYYA 2VOEA 5F1NB 5DRXB 1AJ7L 3S3BB 3HLAB 4PLTA 5K9ZA 2ZZNA 4QYTA 4GOMD 1T6WA 4BMCA 3HKBA 3JQ9A 1MSPA 4MW7A 3IFPA 4RETB 3EISA 1PBYB 4DILA 1T7YA 5LG1A 5C09D 1MR3F 3TB4A 4Q0XH 2G9AA 1E7WA 2VDNA 4GOSA 4D6YA 3M9LA 1CQXA 4EFDA 2J6HA 4Z0XB 3TFKD 2GASA 3V1MA 2WHVA 4MR8A 2DKFA 2XTAA 4YLEA 4YDIH 4CADA 4XCQA 5LYYA 2JD2A 4N2LA 3AW5A 4XPZA 3R09A 2E85A 4D7PA 3ETBF 4KQ0A 4BOYA 4H25B 3IJRA 4XR8C 1U92B 2AJSH 3JTSA 3F67A 4OI0A 4EECA 2BC4B 4ELMA 4K7PH 1QJ4A 4NQDA 2D2IA 5K09A 3GLGB 1GAEO 2ZS7A 4A37A 3TLZA 3VR5D 3MV7D 5GGTA 4S1OA 2E6UX 1CLOH 3GIVA 1R24A 2G6BA 4ZT2A 1KJ2B 4Y2HA 2GBFA 3R4VA 1Z28A 2ZNXA 4XKJA 2C8LA 2E6QA 3P9QA 4RVGA 4TUUA 4OGYL 2HTKD 2B1JA 2WAAA 3A3KA 4PIRF 1EK2A 1IGMH 3VKWA 3QR1A 1UGKA 1RWPA 2XCSB 1R18A 2P1ZA 4UVEA 3UJDA 1YIDA 3C5ZA 1OD9A 4B76A 3HP1A 4WCFB 5EJEA 1IBFA 4QT0A 4P23C 4IDCA 5E0FA 2XVKA 3T0VA 3RVQA 2O3QA 1CDHA 2P69A 1Y6JA 2FA9A 1O5IA 3HI6A 3C8ZA 5E3IA 2DQDH 1CQIB 5YASA 2BTOA 1BBDL 1FF9A 3IU4H 3EVGA 1MFCH 2EJWA 3VX4A 2QSVA 2NZ8A 2O3JA 1ND6A 2VMCA 3KOYA 2R751 2AMYA 1AHPA 1KB5B 2WQAA 1DSWA 3WGUB 2EIHA 3CFJB 3D07A 4G3YL 5ADPH 4RHEA 2YOGA 5DE3A 1EXGA 1T4WA 3T2QA 5KHOC 3FS9A 3ILVA 4J27A 5E2UH 3T65B 4GMFA 4PR3A 3T4EA 3BFOA 3ESRA 2AMVA 3PIQA 3P9ZA 4JCCA 5IC7A 4HDMA 4UQDA 2J1XA 4OI7A 4OHCA 1A1NB 1NSNL 1A3CA 4Q37A 1FW8A 1RM3A 1DUSA 4JC5A 4UAJA 3FWZA 2AZMA 3CZ9A 5HHOB 2Z3ZA 1JS4A 1H4VB 3KQLA 2WWWA 4IJKA 1KIQB 1A02N 1SY7A 3HV0A 2PWFA 2E4AA 1I8TA 3GRRA 3SCZA 3SQOA 1N9GA 5KU7A 1VRSA 1P5UA 4K6KA 5DMKB 4J3UA 3I0NA 3RODA 4O1QD 3IPAA 3ZDYB 5KKNB 4P8RA 1FL5B 2EDOA 4XN7A 5KSWB 3UH1A 4Z9FA 3BMOB 2YIMA 3U2SB 1MBZA 3QR0A 1OTYA 2IYEA 2QSTA 2HRPL 2C54A 3AG1B 1K08A 1PZXA 1RT9A 2JH8A 4PWEA 1YRBA 1QQ6A 2ASVA 4HZLA 3GEGA 5IQ7H 4HUTA 5DCCA 5AW3B 4ARSA 4MAFA 3T3ME 4LLMA 2GEEA 3H8VA 4O5OA 2NRDA 3KPOB 4HUWA 3EIFA 3BVDB 4ZCQA 2B6NA 1IJBA 5F7LB 1TLFA 2P4AB 3FTCA 5TDNB 4Y8AA 2X3AA 2CA3A 1ZOOA 1UH2A 1QS0B 2CBPA 2VDKB 4KO7A 3BE1H 3UYRH 5IFLA 4BH8A 3ME5A 4JLNA 1SHYB 2VNSA 1P5UC 1N5OX 8PAZA 3GMQB 4KZCA 3ZL1A 1ADWA 3SCMC 3W5VA 5ABDE 4IS2A 1NDGB 3T9EA 2OBNA 2VATA 5F7JA 4GX0A 3HE6A 3ZKXB 2WF6A 2BJML 3MDJA 3U4KA 4BK4A 1DKOA 2YOHA 4KXFB 3KL5A 1QAQA 2C9DA 4ZMAT 5I2IA 1R88A 2CGYA 2Z57A 3HFRA 3EDKA 2HVJB 2NUBA 2UXVA 1KFKB 3MV11 3BLKA 5CUSL 2CUAA 4P49A 1COBA 5DLMH 3B36A 3A23A 3X3FH 4HJ0D 5JG7A 4BSVB 1QDLB 3RRFA 3S3PA 3C1AA 4RD1A 1T4DA 3T54A 2IWRA 3OU2A 2GSMB 3LQAC 3MUGB 4UM9A 1W72B 5CEYA 5PAZA 1X7YA 2AXNA 4N2CA 1ULZA 4FW8A 3QFDA 1H3WM 2ZAIA 1GYQA 4UTBL 3GLIB 3L9RA 4XZ3A 3HPJB 2IANB 3IDUA 3FDFA 4HGQA 4JB2A 3GFCA 3AJEA 1ZM3A 2JJMA 1JOIA 3ZPXA 2CLFB 4IHOA 4JFQB 4I0CC 4XP4L 4CY2A 1QGDA 3LSOA 4LYJA 1K3UB 5CBEB 3K35A 4JQZA 5I15H 4FMKA 1XTUA 4GE0A 1XVSA 4HNQA 5IJ0B 2FHCA 3QKRA 2J0UA 3LV3A 5JOPE 4X66B 2DMCA 1MVFA 3OLCX 5TFSL 4MGHA 3NZHH 5IH3A 3BOSA 4LFCB 4IU3A 3EI3B 2Z5VA 3O75A 3U81A 5KS9A 3O6FA 4KHXH 1V8DA 1Q0UA 4YPFA 3ECUA 2B7DT 2YWHA 4Z7JA 1J56A 5JYEA 1Z82A 4YI5A 5F7ZA 4RKWA 4LRSB 3LY5A 4U3XA 3L6FA 5D8DA 3V4UL 3FT3B 4DCSA 5AW7A 1W5BA 3BE6A 4D0LB 1YZHA 1IGTA 4JEUA 4EEZA 3HBLA 1NVVR 2WYVA 3CIKB 4BDTA 1HWHB 2IXAA 4QRRB 2KQNA 1TF5A 4UBJA 4ZIRA 1YQQA 2ZUEA 3HZKB 4YUXA 3H7BA 2YYSA 2BOCB 2OHGA 5G55A 2XT1B 4HUQB 1HEJC 4TUYB 2ZIWB 1BLNA 1N4XL 4AX8A 2D4FA 2XTJA 3PQYB 4ELME 4OLJA 1S2MA 1BH2A 3VO2A 5H35A 4RC9A 1QMPA 2ZUYA 2RHTA 4KVCL 5ER6A 2WJ3A 1OV8A 3CN9A 1R3HB 1LW6E 3K8LA 5GGVY 2FN9A 5K3DA 2FO1A 3LT5A 2NO7A 3GUFA 4G9GA 1RH8A 5T3ZE 2ZDGA 5JRJA 4LBVA 1E77A 5K0LA 3GUCA 5E8NB 1UWVA 1FLRL 2Q49A 3F5SA 3GV0A 3NDIA 4GW1B 3HZMA 2NY3C 4NSNA 2OX5A 3C6YA 2O4CA 3HQ4O 1WU8A 3JSXA 3JWGA 5DJDB 4E6PA 5HDBE 1ZLEA 1JXDA 821PA 1XR9A 3ZE9A 1MJHA 2PGXA 4KK9D 2Q5JA 3FUMA 2ZS8A 2N1TE 2EATA 4PTZA 1JEJA 1MTZA 2ICEA 3GSNB 3FPKA 3BKMH 4QGAA 5K6AA 4L15A 1G3MA 2ZG6A 2JGNA 5CR9A 4X2UA 4NXSA 3NEXA 4OAQA 3X1FA 3GGCA 4PAMA 4NFBA 4Q3LA 3UAXA 1F11B 1I1FB 1KJ3L 1CG6A 5BVPL 3RBSA 4F2ME 3DWGA 2RIPA 3DZDA 4Y5XA 2IU4A 3Q5TA 2DEXX 3ZXXA 4OBBA 3CDZB 3EBGA 3WB0A 1RKQA 2X2FA 4C9BA 5D93B 1V5JA 4FFBA 2H0JA 1ESNA 2WLKA 1OWPA 5L2KB 4MULA 4GGPA 1WB4A 1YOVB 4ACAA 4G6KL 2YMOA 1JFFB 2WVAA 4O63O 5FQNA 3NV9A 4P5MA 1DP0A 2Z4RA 1T3GA 3IP5A 1Z4MA 1X19A 2AF3C 4DJTA 3SG0A 3BKJH 1JSZA 3LOQA 3KPSD 1D07A 3SVTA 1BXRA 1I85A 3LH2L 2FT8A 2YJGA 1A2BA 1DQVA 1GZQB 4XJSA 2GCGA 1MAWA 5FUWA 4OAPA 1KGIA 1G5HA 4LL4A 1QZ1A 3UUWA 4PYOA 4I4TF 3FCCA 5GS0L 3MTAA 4WFFE 3B8YA 2YOFA 1GUFA 4C4RA 4BFUA 1V48A 3AR7A 1D6JA 1S7QA 3NBUA 3DMMA 5HVNA 3VPSA 3B9VA 5HIIA 4IDFA 1R16A 1A0OA 5ID0A 1W6RA 4GUAA 5DHEA 5E5MB 2AV1B 3VMMA 1E5YA 1U63A 3PGLA 4J9VA 4ARZA 3HK2A 1P0SE 3F6JA 1G9SA 5BS0D 3UAOA 1CIPA 3C9NB 3M6IA 4JPWL 1A72A 2WTXA 1TVKB 3HC2A 1E5TA 4MJ2A 1X15A 3L8YA 3KL3A 3M45A 5C08A 4MVJM 4FD3A 5GSVA 4KQHA 5AJVB 5C34B 3ZWLB 4TKMA 3B53X 1PZSA 5A2IH 1EFXD 4KOBA 4PSRA 5DLLA 4LSRH 1ZXBA 1K8IA 4I79A 3JZIA 3TP4A 3FH8A 4JFOB 5K3BA 3EI2B 1ZGJA 2Q3ZA 3L3JA 5I9NA 3ZSTA 3NCHA 1KO4A 4H0GA 4TTDC 4X5RA 1MOPA 3ZQ9A 4MV5A 3V4RA 3FF1A 1UC9A 3T0IA 1LHZA 1OHHD 1NMCB 2WKPA 2CJWA 2OXEA 4LF5B 4GKBA 1PLJA 4J91A 4C0AC 2PH3A 3BMCB 4HS3A 2RAPA 2Q6VA 1P1RA 4ZUSB 2P3QA 3WV0A 5DK6A 1EFRD 3HKDA 3KUXA 2ZJYA 5B3NA 1FQOA 5K2OA 1QJCA 5C0CA 3PZBA 1QRSA 3QNZB 4K3EL 2ZJOA 2FPOA 1BHJA 3IJEB 4G4SP 3UROR 3PJLA 4C08A 1ZOLA 3W8FA 2X7XA 1GYCA 4PYHA 1JEYA 1T36B 1X7GA 1JJVA 4K81B 2Q7XA 2IXDA 5JZ7D 3LNTA 4LKXA 1CF4A 2CNWD 5F71A 1XEXA 2BW4A 4H88L 3A1SA 3B5EA 4LPKA 4HY3A 3E80A 4JOSA 3RGVD 5GVRA 4YBQC 4LLYA 2MPAL 1SCDA 2C4KA 3UJBA 1F1DA 1FZJA 3ARRA 1X0XA 3RASA 1A5BB 3ZJTA 1VJDA 4GKZB 1DTWA 2Q6LA 4EY4A 5FYJU 3ARDA 4FG6C 3MERA 4WDIB 4ZV9A 4BFWA 4LPXA 3HR8A 4B84A 3PV0A 4J7XA 2GI0A 3KVPA 1GY8A 2RBGA 3CNHA 1KAOA 1G8KA 3ROXA 3T99A 1UBTS 4QUKA 5D1ZB 3QEGH 1G4HA 221PA 3NDYE 4IRJD 1W2GA 4EMTA 1TYDE 3RUCA 5SX5K 2ZWOA 1WFMA 4LCIL 2GZRA 3BP4A 2FUNB 5IB2B 2BHUA 4YMSA 2Y6TE 1GDHA 1XTSA 3K0CA 1RKXA 4XO9A 4JUFA 2HO4A 5A4KA 3JYPA 3KS0H 2SNIE 5B30A 3ZU4A 4G86A 4LXFA 4RTLA 4RGMC 3TEWA 2PCJA 3MO1A 3JWNE 1KBKA 2BSAA 5KQSA 4U9HS 3EDOA 3MQIA 3ZZNA 4DIXA 2Q0XA 4L8GA 2O5CA 4FHFA 3PXXA 1OW0A 7PAZA 1ZVHA 3WCYA 4UT7L 2YKKA 1RZ8B 1ZV2A 2L7QA 4RMIA 3HKBB 5D55A 4QYMA 5B1JA 4WI0B 3B6SA 1K1EA 1WSBA 2O5YL 2HYEA 1P39A 1ZMRA 4XB8A 4UZSA 1UD8A 3IE1A 3I2CH 3R9XB 4XUDA 3SEAA 4HKBB 5C8DA 3K80A 4WCYH 5A1TA 2D4AA 2EKDA 2WK1A 1FSSA 4C30A 3N2LA 5JWOA 2H1XA 5T7BA 3D8RA 2PSSA 4G81A 4MA7L 2V8MA 3R75A 1N5RA 1FDWA 4GAJL 3DJYA 1KP9A 1YNSA 3V55A 2R1ZA 4GBED 3NBKA 2EW8A 1KTIA 3O6LH 1OWOA 1W9MA 1L4UA 1IBSA 4ZJYA 2NXYD 1CLEA 2GBPA 2RB5A 5A71A 2G5GX 1ET8A 1U4SA 1XF1A 3DAHA 1IBGH 4Q4AA 4MCZB 4CEIA 5LGHL 4MW9A 3WJJA 4QF1B 2A6KB 4GSLA 1X9LA 1QEWA 3VXRB 2VZVA 2K4MA 5ECJE 5EN2A 2K0RA 1KT2A 1PUIA 5GGQH 3C15C 3LBHA 2IXBA 2DYSB 4O1HA 4ZOLA 1H4QA 2X8AA 4IOMA 4N0CD 2CHDA 3DLBA 1N3BA 4CM6A 3N2EA 3W90A 2Z98A 2BSEA 1P0CA 5LNK1 2BF4A 1T80A 4MXWH 4PLGA 1NWHA 3E23A 4DP7X 1X5FA 1LDBA 3UAJD 2FW6A 3A31A 1YIOA 3D4OA 3LRXA 1CD9B 3RWFA 1TEHA 3WJLC 4QULA 3DWEX 3TN0C 3AHDA 3IOEA 2MR5A 5F3BA 1JAXA 2W65B 1MCPL 5JOPD 3V0VA 1MQKH 2J9ZB 4JLJA 5IROC 1FFGA 1WISA 3N50A 5IN4A 1N6HA 1UBRS 4FG0A 2QAIA 1M8JA 5CK5A 1A5FH 3V4OA 4PU0A 4ID9A 4FQLH 1LDEA 1WZMA 4KROC 4UMDA 1TYQC 4C87A 3EI1A 3OHMB 4Y0VA 5LLIC 4OXNA 5JSKA 2PW1B 4IM7A 4HBQA 2W6IA 1HH6A 2HUNA 4PJDF 1SU6A 3V1NA 3EYQC 4DZBA 2PZKA 1SUSA 1DCMA 3FGOA 1LO3H 5LZ8A 3OE4A 5BWOA 1DIRA 3P26A 1O7DE 4CM3A 3BOVA 4TN1A 3M46A 5BT8A 2VRCA 4XCCH 5E99H 3UXFA 3T3PA 4PCLA 3B3BA 1MW0A 3JT2A 2F8SA 2PKQP 3OFJA 5CPFA 3R8CA 3WHKA 3EBPA 1WD7A 4ELKB 2JAQA 5CA0A 1KIUA 5DJ5A 2W07A 4Q1EA 1IM8A 4KPGA 3H85A 5HGAB 1A7KA 3MLXH 3MVEA 4EW6A 4PJCF 3HG1D 3BHIA 3N85H 2XQYK 4JZNB 1EUTA 1K4YA 4YRQA 3V0GA 5LNGA 4CUJA 4RSMA 4IKJA 5DMJB 4IRJA 4PFEA 2EKPA 3ZQUA 5BQOA 2O8BA 1EH5A 3OBBA 1CE8A 4ZTZB 4I9FA 4HKBA 3GJQA 3UK0A 4ORGB 5EXTA 4LX0A 3G5ZA 1T1XB 4JM2A 4AJPA 1CLZL 3ZBTA 2W0PA 2CM5A 4IJ5A 4ZPTA 1YQ2A 3BN9C 3JQBC 5DNYB 5GRUL 5G4OA 1JDBB 1WGVA 4JHUA 4XPBL 5GRVK 4L4XA 2QVMA 1CZKA 3R7NA 5K6AC 1XNJA 1BFTA 1Z2DA 1NFIB 3T2NH 5KJ7E 1AGXA 3NBNA 4K03A 3QCTL 5AVTB 3ODGA 4X6BA 1XQ1A 5DZAA 4F11A 1MENA 3FPEA 1T0BA 2MNUA 1E7YA 2FEKA 5EU5A 1JAEA 2PUWA 1QKZH 4QJIA 3L06A 3W1WA 3IJHB 3L9WA 1IIIA 5DK0B 1RU3A 1NSFA 3LH2H 2R2HA 2BP3A 1XWIA 3A4VA 1C08B 2F3QA 4PWIA 4W68A 1VFOA 5IF3A 1K97A 2V5AA 1NWCA 4N8VG 1XD1A 3ROMA 3CQFA 5EMKA 4D1YA 4PJGB 1F6LL 2EDDA 4XMLH 3MNWA 4G5GA 4JHNA 5F21B 3CRNA 1CY8A 4RXTA 1LP9A 4NESA 1JVKA 3ULVF 5F52A 1YDPA 3F8WA 4HN9A 4ZUTB 1KB5A 4A67A 2Q29A 2YIVX 1QIFA 3BZ4B 4JEIA 4MCNA 4LIPD 1ABEA 5F1KC 3ZTNH 2J57A 4ATTA 1OBOA 2N46A 5CXQA 3FUXA 3L8FA 3MD0A 4H4EA 3BXNB 1DBRA 1H8NA 4GM9A 2Q1WA 4L5AA 4R71A 3MB8A 1DANU 2BNQB 5C0AD 2APSA 2JRCA 4KRLB 4MNTA 1DANT 1A0QH 4MD5A 2H85A 2VERN 3IUYA 1QRNA 1QSED 3D4CA 1RHRA 4YCAA 3QZWG 1MN6A 5AKIA 5FPSA 3IIMA 2FFAA 3MACL 4IDQA 2FMTA 3VD7A 2RFXA 3MLVH 2O0LA 1HV8A 4ZMQA 1ODFA 1QCCA 4B74A 2HLFC 1DAOA 4JY5H 4NDZA 1JP7A 1K27A 1U0HC 4WUUE 2BNRA 2JEZA 5IULC 2ZT9C 5AZ2H 4BCBA 1KTLA 2AW3A 5DZPA 3PJGA 2H9GA 3P4MB 2HA0A 3DTXB 1CUBA 4X1IB 1GGUA 3BJEA 1ZPUA 3EY4A 3IJ9A 4URXR 3AZPA 1V2HE 5D6NA 2RE8A 4FHKA 3WTVA 6REQB 2JVKA 3L9YA 1YUNA 3OM1A 5L7YA 5D7KE 4UUNA 4WD3A 1E9SA 2R2BB 1AU9A 2OQ2A 4ZQKA 1MQ9A 1G6VK 1NG1A 2J0UB 3G2KA 4LSQL 1GYAA 1N7GA 1Q19A 1DJSA 4HA1A 1JNLH 3S2ZA 2AXJA 1M9SA 2A9OA 4RH4A 2QLJA 4K3UA 2XT9A 5I7HA 3PJDA 2PS9A 2XUAA 3RK0A 1TW3A 1L0PA 2XODA 3MBIA 3ZLBA 4WK0B 3IXAB 3GMMB 2ZB7A 1R5VA 4PZPA 2NU8B 4TNVF 1WS8A 2EXTA 4MB4A 1J2TA 5C5CA 1W46A 4TL4A 1NAIA 1XJ0A 4ZZ2A 4DMKA 1VFAA 1ZC3A 3TQOA 43C9A 3RIKA 1Z5LA 1XJQA 5EEWA 3Q10A 4C4PA 5CCJA 3WGVB 3DXZA 4RHUA 2K2WA 5IVPA 2GEUA 1X6VA 4QEKA 2FKNA 3QXCA 4FN0A 4X4KA 4DIDA 3GGDA 1IM9A 5JS2A 3IFNL 3UGKA 2AFHB 3MYJB 3E53A 3RU8L 1IB6A 2OHFA 3HI6H 2VJCA 3ISJA 2GBLA 3U37A 2ODEA 3OZRA 4WF7A 4JUAA 2HVKB 3WHPA 3JVFC 5C07E 5IQ9B 2J0SA 1ZA3A 4Q4JA 1H2HA 4M6OH 3IDGB 5CSZA 4LK2A 1BDMA 2DR3A 3HJRA 1HEYA 3KW7A 4O4HF 2EABA 5M34A 3B1XA 4MP6A 1P22A 4DTGL 8MHTA 2BCGY 3TKAA 1IY8A 2J73A 4YJKA 3SWWA 5I6PA 4GRLC 1X7SA 5E9JA 2WVSA 1FTWA 1OH7A 3O9WD 1A7NL 1N5JA 1MJGM 3VG9C 5JHAA 3HUJE 4DZZA 1OE2A 5DHSA 5JLJA 4POUB 5I8CA 2OXRA 4NAJA 4PW3A 2V6BA 4TZ4A 2FNAA 3L0CA 3RWCB 1HEUA 4HQKA 5BRZD 2WABA 1TENA 1XCLA 2IPAB 1EHLH 2VJOA 3D39E 1SM3L 4NX2A 2OV0A 2FX3A 5SX5H 5IBRA 1VI2A 3V32A 3D4ZA 1AGBB 1OB1B 1UWEH 2OMTA 1QKKA 1G6RA 3CEHA 1KIRB 1YJDL 3UTQA 2CMFA 5CFLA 4RA9A 1KFGA 3FCOA 4JL1A 2OK0H 4J3TA 4R96A 2F55A 4UT9L 1JTFA 4GUCA 4WI8A 3HXLA 5JPMC 3JV4A 5HYJE 5BNXD 3OWRA 3QYJA 2ODWA 2XR1A 4L1TA 2ZOLA 3FPHA 5T5FA 4KZ0A 3P0VH 1B4RA 1UEXC 5PGMA 1M56B 5C9JB 1JRHL 5FUQA 5EZPA 1DV1A 2GX6A 4PV7A 2C26A 3FVRA 3WGIA 3IFOA 3TBKA 1XTQA 1KBQA 1Z5PA 4PJAE 2I1QA 5DSXA 3TYFA 1E2BA 4I1VA 3DJRA 1VDGA 1SXZA 5A7EA 4ZYKA 3LPCA 5ICZB 4RHYA 4D6XA 2FOLA 4PGBA 2PBLA 4OI4A 1Y8RA 1QUNA 4FUQA 4IUDS 1UWXH 2JI7A 4IBZA 1ZIXA 4X6XA 1P1JA 3M6VA 4UD6A 4JI0B 2MSWA 2X4OB 4D8YA 1Y9EA 3CPUA 1B0IA 1H65A 3QA3E 1ZJ4A 2HCFA 1HTTA 1N57A 4Z7WB 2XLBA 3TO4C 3FHEA 2G5UA 2BUCA 1G6OA 2OHIA 2GIYA 1NUUA 3FOWA 4LK4A 1RXSA 1TA9A 2CNLA 4UCXA 1ZHOA 4OHYA 2R2HB 2I6QA 4E3WA 1ITZA 1O5TA 1J2JA 3C41J 5KEIA 3AL2A 2WWFA 4BZZA 3A22A 1Q92A 2VZ3A 1ZOIA 5F1PA 2B5NA 3BSZA 3AJ9A 2WU8A 1KMGA 3ZLTA 3UVMA 2MU1A 7MHTA 2ZR8A 1N12A 2VXQL 5KOHB 1SFHA 1IPHA 4YXHL 1V55B 3MA7A 3CHYA 4QHYA 4KKCD 4P06A 2VTVA 2IP1A 3MROB 3EJCA 1FYFA 2BSED 2HFEB 1DBML 3QVUA 3NJFA 2EUWA 4XTRC 4P4KC 5JROA 2WWKO 3B8SA 4AZSA 2XETA 1DC7A 1YRWA 3VXUA 4ARAA 4MVJG 4ZD3L 5AW2B 2I3ZA 1RK1B 4E5KA 3MACH 4G9FE 4PSWB 1IXSB 1N7HA 3PNYA 2EX4A 1HILA 25C8H 4ZQCB 4BGVA 2DYKA 2VAPA 1GQQA 1G6Q1 4IS3A 4QQRA 1NAKL 1IM9D 2G1UA 4Q3KA 5AHKA 2W70A 3H53A 2PGAA 1X39A 3EYUH 4Z7QF 2R87A 3W2DH 4ZVQA 1JPJA 2NY1B 1T91A 2IOIA 3WEBA 4Q12A 3D4GA 2GJ6A 4BHUI 2F5AH 3F5WA 5HHOD 2PN5A 4JQOA 1RFDH 1VLLA 1NRJB 3HL4A 4Q9QL 1DTUA 3FNQA 3IC5A 3AWGA 2GCOA 1Y0LB 2D7QA 3FCUA 3X1YA 5JXEA 2BERA 3N1QC 3QUZD 3OPNA 1SK9A 3IBSA 3OCYA 4K9MA 4OCRH 4YRAA 1T66D 3LDGA 1E3JA 3IJSA 3O9WA 2MSNA 1D0VA 4JREB 4N7MA 5DYNA 2ZKIA 3QXTA 5M5SA 5E4YA 5HZGA 5DI9A 4AG5A 2FEOA 1VSCA 2Q45A 2Z7ZA 3JV4B 3UMJA 3EHBC 2XZOA 2CNYA 3B34A 3PHQB 2VJQA 3H3KA 2JKXA 1F9AA 2VM9A 4GKZA 1WD8A 4ECNA 3ARVA 3B9PA 5F3DA 4IOSA 4U1IB 1F1BA 2ECFA 4OTZA 5SV2A 1O7SA 1AXEA 2IUFA 2ARJA 5JJCA 4NQXB 4IKIA 4GAFB 1KSRA 4X9GA 3BTUA 4K5LA 1S4IA 2CJPA 4B83A 3PCRB 1BDYA 35C8H 3H2JA 2CCVA 4KQ3H 3R5TA 1U58B 1U8HB 4UQ2A 4WLEA 3AGQA 1MC5A 5IESL 1AQKH 3P0RA 4MVCA 1HNNA 4OXKA 3CZAA 3RYFB 4QUIA 3RRXA 5DEJA 1WLSA 4EYQA 2PYEA 1NJ5A 1IJKA 2C5DC 4CLDA 2Z6FA 4ZUUA 1OSPH 2EC9T 3N2JA 3F71A 2C4FT 3D6AA 1OVGA 4LARH 4NL4H 1YF3A 2OYRA 4UE3S 2H3HA 5A3JA 2G9KA 4PNEA 3LDHA 1X2BA 1K7YA 1ZANH 1TIPA 5AJAA 1IBYA 3OM9A 4E42B 3GJ0A 3I8SA 3KWJA 4Q4AB 4Z0BL 1J86A 2YAHA 4AL8C 5L7XL 4O45A 4YHIA 4O0MA 6FABL 2WF9A 2CCLA 3Q2KA 4BKPA 4J16C 3UZUA 2GJJA 4QIHA 4HKXA 4OJYA 3UKUC 1KO8A 1SXNA 3U1SH 1BXAA 2O2YA 2HESX 4ZO8A 4LRYA 3QRWA 2J71A 3HB3D 3P96A 4FQHB 3RWCA 3FCTB 1UD2A 4DEYA 3AMLA 1PJZA 3VR3D 2D2VA 3KPPB 4Z23A 4L48A 1EUYA 5G5DA 1D2EA 3D51A 2AV7A 4ZCSA 3RC9A 2C9MA 2X6QA 5DHRA 1S7XB 4W4OC 5DWVA 3TLAA 3RTQD 4ZT3A 1P2FA 3ZGXA 3T7TA 3SVWD 2EVGA 3F7KA 1R0CA 4WGGA 1Y81A 5IF9A 1J9QA 4LSVL 1YQTA 1OB2A 1ATZA 1T25A 2MWCA 1ZRNA 1P7VA 4FWWA 4KHXL 2UYQA 1P2SA 2WLMA 1W36D 1P5RA 2E5LB 1MZZA 5EEYA 4PNKB 1XYGA 4O1MA 1I2ZA 3DVNB 3H83A 3EO1A 4US1R 1FP2A 5AW9B 3OFND 3S5LB 3ZWWA 3Q1EA 1L9XA 2VDQB 1BVUA 5E24E 1JBEA 4QOKA 1X1AA 1U1GA 1BDJA 2FO8A 1PZHA 3DGEC 4LIQE 3AJAA 1FEZA 5IFJB 1K06A 5KDOB 3QQDB 1YASA 3I39X 1X6LA 1BO6A 2GTQA 4JLUA 2KSQA 3VDAA 1XZBA 2CVFA 3I0ZA 1DELA 3WGHA 2H4FA 1JHAA 2AAAA 2VUHB 3P4FA 4FC6A 5E4JA 4X7MA 3UZVB 1T1EA 4MRVA 3II1A 1WAMA 5K6TA 5EFIA 3EZNA 2C9PA 4JGUA 2EEZA 2YRFA 4JFFB 1L8QA 1QZ3A 4AH2A 2Q5LA 5EFOA 4EJMA 4LE0A 4AYSA 1UWKA 3G8DA 1EIBA 5HDQL 1HL9A 3RJTA 4EB0A 5FI3A 3T5GA 4YMTA 2E46A 5DA4A 4W6ZA 4QGGA 4WW2B 4X24A 2GERA 1K32A 4PJIB 1J5EB 2CGRL 1RZFH 5DJCB 4S2SB 4HVCA 3ULSA 1PBNA 1E3SA 3WJMB 3JCZA 1H5BA 4Z1PA 5IARA 2ZDQA 2RHCA 4D8OA 1QUPA 2HPHA 2VQEB 3VVMA 1EAYA 3RKDC 4PLYA 2JKSA 1PWYE 2ZOKA 5EO0A 2OCJA 3PA8A 4FTVB 3KDMA 2DTEA 5AVRA 4ZV4A 2AEEA 4NIYE 3HFFA 1OUMA 4LTMA 4FDTA 5KSBB 3FTEA 3Q7IA 3OPVA 2CFSA 3CTTA 1FWXA 3RILA 3HG5A 4GX2A 1VIAA 2RI6A 3GC3B 5CT8A 4PFJA 3JXEA 4N82A 3Q3GA 2IWGA 1EFVB 4CCWA 3AONB 4F8OA 1DJNA 4PPYA 2IDZA 2QJOA 3S7ZA 5DISB 2XN9B 1PLKA 5CHNB 2AUTA 4QASA 1XTRA 1AKJD 1M1UA 2HX8A 1IARB 1WYJA 2HXCA 2OCAA 2J8UF 2EDNA 2GJRA 1DR9A 2VJBA 4KZPA 1X9RA 2FJGB 3HHMA 3D54D 3SNHA 1O6CA 4G80A 3HUFA 3AFLA 1MREL 3V0EA 3E81A 3HNRA 1XH2A 2NXCA 1NAHA 4IKKA 4KAQL 5LDUA 2MRYA 3O5AA 1XH0A 1JLRA 2WTPA 4X8JB 1SBYA 5E08H 3A0UA 3FLEA 3BH4A 3GB7A 4DSTA 2ZRGA 1WBYA 3KZCA 2XVAA 4M1EA 3I32A 6PCYA 5GWXA 3C5SA 2IXQA 3HU2A 3AR6A 3UO8B 4WBNA 1MVUA 3D0KA 4TOIA 4PJ5B 2X77A 4Q19A 4BYGA 4RMBA 2FSEB 2JCCE 2BVPA 1G9NC 5FOBA 3EXG1 1HE7A 2QVYX 1R6VA 2JLAA 3EJYC 4C7JA 4OZG