4NENA

An internal ligand-bound, metastable state of a leukocyte integrin, axb2
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
1083
structure length
1063
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAADQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMDPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKTRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVALHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSESNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLCFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-X
publication title An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 235
structure length 1063
sequence length 1083
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 4nenA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4nenA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 4nenA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4nenA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4nenA02
1SQ0A 4C29A 1N9ZA 1JEYA 3TW0A 1TYEB 4MMXB 2ICAA 2VDQB 1N3YA 5E6UA 5HGJA 5E6SA 4MMZA 4UM9B 4UM8A 4WK2A 2QTVA 3ZDZA 5KYUB 3NIGA 1IJKA 5KYXA 4O02B 3FCSA 2NUTB 2VDNB 2IUEA 3K6SA 4MMXA 3T3MB 3VI3B 2VDMA 3ZE1A 4HQLA 2X5NA 4JX0A 3PPWA 1U8CB 4BJ3A 1RS0A 1XUOA 3EH1A 1JEQA 3N2NA 3BN3A 1JEYB 3BQNB 5KYWB 4HQNA 1SHUX 2VDKA 4HQFA 2I6QA 4IGIA 1RD4A 2ODQA 2WW8A 5E6UB 5FFGA 5E6SB 4MMZB 3T3PA 1ZOPA 4UM8B 4WK2B 4WJKA 4F1KA 3ZDZB 3NIGB 3ZDYA 1PD0A 1XDDA 5KYXB 1M2VA 4Z7QA 4UM9D 3FCSB 4WK4A 1BHO1 1QC5A 1JV2A 3K6SB 5KYWA 2VDMB 3ZE1B 5E6RA 3EGXA 1RRKA 1ZONA 4MMYA 1XDGA 4A0QA 1BHQ1 1YVPA 5ES4B 4Z7OA 1JEQB 1ZOOA 3NIFA 1U0NA 2WINI 4XW2A 3FCUA 5HJ2A 3EG9A 3TCXB 3K71A 2VDKB 3ZE0A 1IDOA 3ZE2B 1MHPA 1V7PC 2XGGA 3Q3GE 3GXBA 3HXQA 3T3PB 1PT6A 4WJKB 4WK0A 3BQMB 3F74A 2VDPA 3V4PA 3TXAA 3ZDYB 1IDN1 1MQ8B 4Z7QB 1M2VB 1Q0PA 2O7NA 4NENA 4WK4B 3NIDA 1JV2B 1QC5B 3EOAI 2P26A 4PN7A 3ZE2A 4NEHB 5E6RB 2ODPA 3EGXB 1MJNA 1IJBA 4FX5A 4MMYB 3PPYA 3V4VA 5BV8A 4F1JA 4Z7OB 1YVRA 1FNSA 1M1XA 1OAKA 3NIFB 2XWBF 3FCUB 2VDOA 3EG9B 3K71B 3ZE0B 4IRZA 2NVOA 1CK4A 4M76B 1CQPA 3IJEA 4WK0B 1DZIA 2M32A 2VDPB 3V4PB 3EGDA 3EOBI 3F78A 4HQOA 3RAGA 1FE8A 1AO3A 4CN9A 4NENB 3NIDB 1MQAA 3K72A 3ZQKA 4G1EA 4HQKA 2ADFA 4C2BA 4G1MA 5FFOA 1SHTX 3PPXA 3TVYA 4C2AA 4DMUB 5LN1A 3V4VB 1T6BY 3HI6A 3EFOA 1AUQA 3ZDXA 3VI4A 2VDLA 5KYYA 1M1XB 2VC2A 2VDOB 1M1UA 1L5GA 2VDRA 5HDBA 1AOXA 3IJEB 3EGDB 4Z7NA 1JLMA 3M6FA 3QA3E 4CNBA 2NUPA 1PD1A 1U0OC 3K72B 4G1EB 1TYEA 3PPVA 4G1MB 4IHKA 1M10A 2VDQA 1NA5A 4CN8A 1QCYA 4UM9A 1UEXC 3EH2A 2I91A 5KYUA 3EFOB 3ZDXB 3VI4B 2VDLB 4O02A 2I6SA 5KYYB 1RTKA 2VC2B 1PCXA 4IXDA 2NUTA 2VDNA 3HXOA 1L5GB 2VDRB 3T3MA 3VI3A 5HDBB 2XWJI 4JDUA 1T0PA 2B2XA 5KYNA 1U8CA 1DGQA 1MF7A 4Z7NB 3E2MA 1LFAA 2NUPB 1M2OA 4WFQA 3IBSA 1ATZA 1MQ9A
chains in the Genus database with same CATH superfamily
3Q3GA 4QUGA 3PVUB 2KC0A 3QXHA 3T9DA 1Z38A 3GXOA 5M5UA 3EO1A 2V4ZA 2VZEA 3MMYA 4PJGB 4G8AC 3OZCA 2WXPA 1KFEB 4TROA 4OQZA 3KLAA 1E3MA 1TZHA 1WO8A 1OAZH 1WCYA 2Z1MA 2G80A 1DE4B 3CGGA 4XYGA 3C60A 3H9JA 4FFWA 3RVKA 1VJ5A 1HURA 3I75B 1N3IA 4B6PA 1J97A 3ELBA 4FQHA 2AXEA 1F8TH 4FDUA 4ALAH 4HUUB 2JGNA 3IA2A 3EI2B 3DE6X 3OPYB 1ZUNB 3JV6A 4R4FL 2NY6B 1AZTA 1GGBL 2GJ6B 3KMDA 1TQ2A 4BDTA 3COVA 1MCOL 1Z6PA 5KSUA 1NPNA 3RWGA 2ZIGA 4GWLA 5LP6B 3BWUC 2QPSA 1EHLH 3ULVE 4L4TD 3QXCA 1ROCA 3HAEH 4XSHA 3NHJA 3AHEA 3IE0A 2XZGA 3S88H 4GSYA 3PP4H 3OO0A 2ALAA 2EDHA 3BP5A 1CVRA 1QAQA 4EDWL 2Z09A 4PQFA 1XCQA 4LCIL 3G1TA 2HIAA 5L0QB 4HL6A 2FJUB 3MBEB 3ED1A 3DTTA 4J0JA 4IXNA 4CV2A 3HP7A 5F6HI 1L5HA 4I3SL 4LXUA 5EJ9A 2E9SA 1P6QA 1JLLB 1R8XA 4E36A 5C5IA 1VG0B 3G13A 3LEVL 2QAGC 3KCPA 3RPIA 2VDRB 2PUWA 2VRAA 3RIKA 3MLRH 2DQCL 4FHDA 3QWRA 1VLJA 1KZQA 4B35A 5BQ5A 2LXNA 2DQYA 4DG9A 2VQ3A 4BQNA 2CF5A 2W2LD 1R75A 3V2GA 2FFBA 3ROLB 4B6ZA 4WEMB 4GM9A 4HBZA 4IMKA 1KAQA 2JSFA 4RKFA 3CVYA 1X5JA 4J3WA 2CD7A 4GPZA 4EOGA 4HIPA 1MD9A 4WA8A 1JGLL 5B38G 1MQ8A 3ACCA 2FWMX 2BGNA 1NSFA 5NLLA 3OZLA 3QR1A 4NARA 3O41B 1FRGH 4DKTA 4UTRA 4NL4H 4U6HA 3PR1A 3R3VA 4JHBA 4L5AA 4HIEB 3UW3A 1R17A 1BVOA 4B48A 1U9IC 3IETA 5TVKA 2DQUL 3DLBA 1LEHA 1QLRA 1C8LA 4AZ0B 2NY0C 3UH8A 3STLB 3Q2WA 5IDXA 2GPZA 4NO0A 4B8ZA 3ZKSD 3D25A 4BNYA 5JNRA 4LBYA 1A14L 4X71A 4ZAGA 2AOWA 4KRPC 2YVQA 4P5RA 2ZP8A 3PF2A 4Y1SA 5FO8B 1BAFL 4G8GA 5HS6A 5BYAA 2XU9A 1NYLA 2O05A 1G5TA 2Q4OA 1R3JA 4O58H 2Y6SD 5BCAA 1TVMA 4X7BA 3ZZQA 1XNJA 3AITA 4EKIA 2QMQA 3EVGA 4H0NA 4YHPA 3OH8A 4AH2A 4JHVA 4F9LC 1ZJ4A 3MLVH 1KYAA 1I82A 2KH2B 1C7JA 5A4JA 3B1WA 5J6HA 1WKBA 5DJ0B 4DN3L 2HXCA 2ZRBA 3RLIA 3NGMA 2OMZA 4II2A 4YFVA 1I9GA 5E0OA 3RANA 2QTCA 5ECGC 2XZCH 3FAKA 3B2NA 2XWQA 3WJJA 4EKGA 2H3EA 5ITSA 5HD8D 1E1KA 3KRXB 3KJEA 4JHLA 5E23A 2YIVX 1FDLL 2N7BA 1EP9A 1PQZB 3K0FB 3ULVL 4FKEA 1TJPB 4C0SA 3AUKA 4LHXA 2WK2A 5I7AA 1SHXA 2J1ZA 5HCUA 4IDPA 2B20A 3UJNA 1ILWA 5F4ZA 4MYRA 4GMSL 3P9NA 1U0HC 3QEQD 5LAXB 3AKEA 1S2EA 3K16A 1KI9A 2LE9A 3NIGE 1BWWA 5L6YL 5FNVA 2UY6A 1AI1H 4MIKA 4NC4A 3ANLA 4K94H 3LP6A 1KENH 4JT4A 3K4QA 4WKNA 2WBKA 2ZITA 3ETLA 1WQ3A 3H2QA 1R8JA 4FNUA 2E87A 5HX7A 1JIQA 2BEWB 4XIYA 1CK4A 4L3GD 4DCGA 1DEDA 1UWEL 4XMZA 2AH5A 1J9CT 1BVUA 4LJYA 2FO4A 2BC4A 1KPGA 5KSVA 5E08H 2LD4A 3U3ZA 2C20A 5J9PB 1MRFH 1IY9A 4HRVA 3DHJA 2FXIA 2Z30A 1PSZA 3A04A 3X3HA 4DV0B 1P7KA 2FBRA 4P0PB 4D44A 5EHQA 2PUGA 2NLJB 4UHCA 4EI2A 4AUKA 3TNYA 2BCGY 1AUVA 1Q3HA 3FSJX 3F5MA 4PICA 1X1DA 1NKOA 4E21A 4A5SA 4R16A 3ULVF 2OP4H 3BISA 3D85D 1J5OH 3WGVB 4E5ZA 2QN1A 5DDHA 2J5LB 3OF2A 1YYML 4JJAA 3SPHA 5J6SA 3EI3A 2E5LB 2X14A 3LRXA 2AEIT 1QZZA 3Q88A 2WVUA 4KI5D 4RIFA 4W1PA 1J1OH 4JHPC 1KK0A 1Y6KR 3F90A 1Q9WB 4OQPA 4ZYYA 1UL1X 1DADA 3S5YA 1YB6A 3KYMA 4KOBA 3BCHA 5AAMA 1HY3A 1EK5A 4YBLB 4HJGA 1ZC3A 3M4ZA 4DPLA 3GFOA 1BQLL 1E28A 2FX7H 3JT0A 5D1XC 4RA9A 1FP4A 5C07E 4OUDA 4E07A 5FA6A 3GNTA 1DBKH 4FHEA 3MRRB 1Y9JA 4YR9A 1HDMB 3BEOA 2XYRA 1VYHC 2J55H 3H5RA 2I24N 3VSUA 1BECA 1T8YA 5L2KD 3V10A 4ZEXA 1AZSC 5IB5B 3LQZB 3OQMA 3AFNA 5F7EH 3SVWD 2JGAA 4XVHA 3PFFA 4GMTH 5BUPA 5C9JA 1MC1A 1XTTA 2JGEA 4QTYA 3TPKA 1XD8A 1U36A 4YJHB 4RAUA 4B47A 4CN8A 4RNRB 2NW2A 4LS3A 3M1IA 2R27A 3MILA 4ZODA 5FORA 1PHPA 4BA8A 2ODNA 2CLOB 4HPOL 1WAPA 3BD9A 5M7QA 1KIUB 4URWR 4EUKA 4AGMA 3LH2L 4L37A 2XY4A 3D3WA 4RF2A 1BJMA 3NWEA 1OXBB 2PV0A 1UODA 3ARPA 1DQRA 4GJTB 1NCAL 5D7IA 3QM1A 2VXTL 1KBWA 2J5KA 1DEHA 1SUJA 2W6JA 2J30A 3UHOA 3KZXA 3JALB 2FAUA 5GGRA 3GFPA 4KFMB 4NZ8A 1JZ8A 1T1YB 3ER9A 2WW8A 1GPDG 3N76A 4KIFA 4P8QA 2K87A 5ALCL 2G60L 1UCTA 5IQ7H 5FTMA 4X8JA 3KWVA 1GQFA 5C1PA 4CM8B 2W6CX 2W2MA 4F12A 3Q0EA 3CIFA 3NCWA 4MS6A 3DYPA 4DP9X 1H69A 4PSDA 1E2UA 4MW0A 1GSKA 2XVXA 2Y7QB 2QN7A 4PLPA 4BVAA 4GLRH 1ZK3A 4EI5C 4L75A 4JZNA 1UBJS 4JKIA 5AZEH 3UWPA 5KSOA 1P17A 3GEBA 3BXGA 2GF2A 2WJ6A 4MW6A 4P3XA 4CBZA 2CMDA 3KALA 3NIGF 4UFPA 4EW2A 1CF2O 4PU2A 1SRDA 1OLXB 3GI9L 2O52A 1KEUA 3BEWB 1G8PA 1UASA 2R7LA 4TUJB 3JQGA 3BZWA 3F3YA 4MA3A 2HQ1A 5I76A 3S27A 4IMMA 1IHPA 4V33A 3OEEA 2J8UE 2UZIR 2FF5A 3QRGL 2JTYA 4WOKA 1SC4A 2FDRA 3BYZA 4OIIL 1MG2A 3JWNE 4DADA 4QOKA 1ZC4A 1GVIA 5GGTH 1RQ5A 2H32A 3ZLTA 3PTAA 1HNYA 3B9KD 1E66A 5DBGA 4LF9B 4ONEA 1O5OA 3FTEA 5LQAA 2PN1A 1YV9A 2AZUA 1THMA 4OCLC 4HDMA 4UJ5A 2C31A 1JPTL 5KVGH 4PJ5E 4BMYA 1TEHA 2HYIC 3L4TA 3PFNA 4OKVB 2FQXA 1HHJA 4AJIA 1VZ2A 1KELH 3FQXA 3BWAA 5A2LH 1IHUA 5AVSB 3IMFA 4ZFQA 2NUAB 1TUBA 4ONFL 3V4VA 4FCTA 5KVSA 2GBAA 3NDYE 1XXFC 2J6HA 2H0RA 3D0LA 5FLUA 4U7AA 1UC4B 3VRIB 3P9XA 5U4XA 4AJNA 4XCFL 3C8DA 3HN2A 2QT9A 3NS7A 3O0TA 3B1TA 2YEZB 3DXXA 4HGWB 4FQCL 4NNJA 4PJ8B 4HR7A 2VLKD 2XA2A 4L8SA 2ZPAA 1YUKB 1GA1A 3CN7A 2BFAA 4K7PL 1ECCA 1JAHA 3GNMH 1UXSA 2C2BA 2CDGA 5K3CA 1ZGZA 3OHXC 3TSCA 2V7WA 3N6XA 1SWWA 3RFCA 3WQQA 1SC3A 2YS4A 3ZCXA 1A8ZA 1G60A 1X19A 4FYPA 4TMKA 4FABL 3W5SA 2FPOA 4BBAA 5IROA 2MHCA 4WKZA 3DP7A 4MYHA 5FCSH 2HLAB 5JW5A 4QRRE 1UUNA 4FLMA 4XCYB 1F06A 1SBSH 1K8RA 1ZSHA 3IDUA 2IDCA 1A9RA 3JAMg 4U0JA 2YHIB 1KMQA 1VPEA 1XTLA 3NIGB 5DJ2B 1WBZB 3E3NA 5J5EA 1ZRHA 2HV8A 2VLRD 3GJ5A 1WSST 2GCYB 1G8MA 2WAXA 4G7SB 1A6ZA 1KDIA 3ZE0A 4OP3A 1BAGA 4AC9A 3N8NA 3Q9SA 2WN3A 4RY2A 4LPSA 1PX3A 3TKYA 4EQ6B 4ZV4A 4P83A 4Y9FA 2ZIDA 2C9ZA 3A4FA 5EF1A 3L2NA 1ZXBA 1FNSA 3D0VB 3U81A 4JO8A 1VA4A 3PSLA 4KROB 3D8SA 4N5EC 2BVQA 3F78A 2J8HA 2R79A 4IZIA 5EY5B 5SWZA 2AJDA 3TN0A 1K3IA 1Y6MR 5IT2L 4R7DA 1D6EA 4GZMA 4H0CA 4HWBH 5JDSB 1Q6ZA 4QY8A 3C5ZC 3AESB 4H0IA 4XMLL 1DO6A 2QD5A 3H5TA 1RKBA 4E08A 4YQZA 1O9VA 2ZCZA 3BGVA 5HWSA 1AHIA 1HT0A 1M2FA 3QU9A 2FWOA 1UEXC 1EIBA 2F54D 1BVZA 2GETA 1MELA 3SOZA 4RKQA 4FI3F 1RI8A 5ACLA 1PFUA 1BWSA 4A7PA 1FVEA 4UUNA 2Q6OA 2J1YA 2QVZX 3ROFA 2GT9A 2AGLA 5KYUB 4RNDB 3RL2A 3L5HA 5C0DB 5EKTA 1LC0A 3GG2A 5I1GL 2PWFA 2FYVA 2RKOA 2GY7B 4Q3LA 1DCLA 3BJIC 2ON6A 1IOVA 2NGRA 3HMWL 1LGVA 1E3DA 2QMUA 2H11A 3ZLVA 1RV6X 1CC3A 3X1ZA 2D9CA 4Y7OC 3KWWA 3LNFA 5C07B 4R6UA 2OMWB 2FR8C 1D5RA 1IC7H 4LLUB 1I51A 1G7HA 1OI4A 3VTAA 1N4DA 1QZTA 2NSYA 3U2JA 4HD9A 1UCBL 3MCTA 2VUOA 4BVEA 3CDCA 1JL3A 4XPIA 5EWJB 3EQ8A 5E2JA 2J8UF 1DG1G 3TZ6A 2RCNA 1PZGA 2D8KA 4MDEA 3TD2A 3RY5A 2DIEA 4FI7A 4Q6KA 1DV1A 4O1QD 1AMUA 2MOQA 1ZVSB 1TO1E 4ZMLA 8MHTA 5IVXE 4ZZ0A 2OUIA 5TF2A 1FF5A 3F7VB 2IYPA 3JRNA 1YN7A 2G0LA 4PG9A 4U6XA 3KZNA 2DZEA 2H2IA 4Y2SA 5FF6B 4G0PA 4OCNC 2VUHB 2VC2L 3D7KA 4HV8B 2E1PA 4PHTA 4TT3D 1M1NB 5CFRA 2LABA 5ECYA 4UM9A 1LJMA 3K6JA 1LI7A 3H04A 5EE9A 2X4DA 2IV7A 1WDMA 4D7PA 3GJFK 5FBZA 2K45A 1HEJC 1DP4A 3PX3A 1SZDA 2OK4A 3A4NA 3WTVA 1H66A 4OH7A 1L1QA 1JEOA 1DG9A 2P9EA 3VOBA 1KAGA 2G99A 2JEOA 3CX7A 3IE1A 5DLDA 4X5OA 1NQVA 1QUNA 1C7FA 1C1EL 2Y3IA 1PL3A 4R40A 5CNHA 4DM3A 2VDNH 1Z6TA 3RX8A 3WUWG 3DIDA 2WWTA 4NM4L 3KQOA 4B3SB 3TBKA 3GBNL 3O0RL 3G1UA 3Q2LA 2AYZA 5CMLA 5KAQF 2HU7A 1NMAL 1FGNL 4A6YA 2J1WA 2PRSA 3KLDA 1NLMA 4NU8X 5BQDA 2JKXA 1KIRA 2I66A 3L8QA 1QZNA 4NFCA 2VA8A 2QHRH 4RVOA 2KB0A 3QQ3B 3MWDB 1T8TA 3DQPA 5I0VA 1NKVA 1YMMA 3MRDA 4KAXA 2OMYB 1FXSA 4ZRMA 3VTMA 4TTAA 5FUXA 4JFDA 3ZRFC 3FQRA 1QHIA 3T9AA 4PWFA 5I47A 1HM5A 3MCLL 4N1EA 1UKTA 1Z3RA 1AQMA 16PKA 3B9VA 1ORDA 4LL1A 3D02A 5IBRA 2XG4B 4KZKA 4BNFA 3DM9B 4NS0A 1OLUB 4Q37A 2J8UB 1F6DA 2ZQ5A 5B3LA 4LO9A 5IYZF 1OSPL 2GEDA 1IRIA 4KODA 5LYJA 5AICA 3BYTA 3IMUA 1NBYB 4PV8A 1E1RD 3AG2B 3D05A 2QQEA 4BGIA 1OCWH 2XUIA 4GO8A 4YP7A 4U7JA 3C1AA 5F64A 1R4NB 3PDWA 3V4VH 2ZX5A 1PJTA 3FAWA 1QB8A 3OY2A 4FGJA 2TMDA 4ETNA 3PUXA 2DY2A 1X7XA 1VCIA 2BNQD 3U44A 2EWMA 2HFGH 4PJ5B 4JFTA 3I2JA 4DDTA 1YQEA 2ZRIA 3UP6A 3DRQA 3TGPA 5CAEB 2WWIA 1IE5A 4QWMA 3P7MA 2XMDA 5F5NA 1YO6A 3V4SA 3A1FA 2JNZA 3EI1B 2WLTA 1GKIA 4ZHQA 3D52A 4Y4FB 1T7XA 3B3IB 4WOJA 4D6YA 1FMFA 4YDIL 5A5EA 1RPTA 3IMBA 1U2PA 4EPSA 1WXIA 3IUSA 3L7IA 5KU7A 3SY0A 2WQ7A 3I45A 1A7QL 2DTDA 5KN5A 3ZD8A 2FWRA 1S3KL 5DW0A 3BJRA 1KBPA 3KLSA 1TJNA 1U2QA 1AANA 3AR6A 3SK0A 1H3PL 3T04D 3SE8H 4ELME 1YHNA 5F9OL 3OX3A 2Q6WA 5IW1A 3NP4A 5DIZA 3V7MA 4N9GB 1H0DB 2PW1B 1J9SA 1R6XA 3BSGA 1PJLA 3RYHA 43CAB 1T3TA 4J3VA 5K99A 4J1TA 3ZO9A 2JH8A 3UXHA 4BY9E 2WHPA 4B53A 4GBMA 3CINA 1WVMA 2VL7A 3W34A 1BFOA 3E6FA 1V0JA 4QRRB 3FUIA 1IBFA 5LP1A 2BEKA 3GIWA 1J0HA 2HA3A 4D1YA 3LH5A 2PXCA 4EI7A 5A1JA 3TCLA 4K9JA 1XGUA 4CY5A 2VC2B 3ETBJ 1BXXA 2LIPA 2BHNA 3LS5L 1VXRA 2E85A 3UENA 1W4AA 4KY1L 2NQ2C 1K8XB 1DEXA 4KZEH 5DT9A 4J90A 3IVRA 1E58A 1U9KA 5HHPB 4AZSA 1ZP6A 3V9FA 5JOPE 3GIZL 1JDJA 2B9AA 4B33A 1SIOA 2WZ0A 3B56A 1L4MA 1EFLA 3FIUA 1YRBA 1Z66A 4AUUA 1OLZA 4Y2XA 5CTJA 3HPJA 4H7KA 3MGBA 4J4PA 3PXGA 5JE8A 5IYZB 3EZ8A 5FUVA 3LDFA 2PGAA 2ANCA 1DJZA 3EG9A 4EIUA 1F4LA 2XXAB 2I54A 1RZKL 5AHOA 4AL8C 4R8LA 3DBRA 5IJCC 1KK1A 1PKQE 2NTNA 3JTTA 4ZFGH 4RADA 2R7EA 4MI6A 2V5SA 1GN8A 3LXCA 1XFAA 4DLUA 1B6RA 1A8PA 1XHHA 5FB3A 2W70A 5I1EH 2FR4B 3NRQA 1X7DA 2Y0SA 4DW8A 2CA4A 3M17B 3CPHA 5PNTA 4CT5A 3D6AA 4DR3B 2AB0A 3S37H 1I13A 2EKSB 2OMTB 4DGSA 4YE0A 4M8NE 4E2FA 3VDRA 4WWPA 2OSVA 3PDCA 3P9YA 4XX1G 2ZJ0A 5DRNB 1SMDA 8FABA 3S34H 2NLOA 2WYTA 2ENUA 3VFTA 3BKCL 1HZHL 2GJZB 3P4XA 1ZN2A 4G4SP 5AK5A 4RFEB 2ALJA 3QO0B 2AEFA 4JPWL 1CUGA 4JCCA 4QIRA 3ISRA 2XW6A 3D1VA 2GMWA 3FJOA 4OQNA 3LK7A 4BFZA 1RKQA 5DYGA 2EZTA 2V74B 1VMAA 1RIVH 3RFRA 1FUEA 2QR5A 3HXLA 1WBYA 2BSTA 4M83A 3IU4H 4A7SA 3TH2T 2CVFA 2FUG1 2HF2A 2H0EA 1IHOA 3WN5B 4EMTA 5HKKA 1W6RA 2JKNA 1F1GA 3MFFA 1R5WA 1JFFB 3GA7A 2EC8A 3Q10A 1T43A 1K32A 1NWHA 3SE9H 2EARA 2P5YA 1E4KC 3M0EA 1I33A 1IMHC 1Z8HA 1KJ3H 5FWYA 2C1PB 3KG2A 4FK8A 5D2LA 3JAWA 1Q90A 2B16A 2VAWA 1JF6A 4XW2A 1EWHA 2B2NA 4E9TA 1NUPA 4BQSA 4KQ1A 1OV6A 4F5EA 4PZ0A 4KH2A 3QUML 3QPVA 5IVXB 4ADJA 1GPAA 1MU0A 3QULA 4KMQA 3OZ9H 1IFRA 4TVSa 5HQGA 2C83A 2BVTA 1DINA 4PLGA 3WHXB 5HZGA 3RYCB 3ARYA 2AMLA 2FVNA 1GPLA 5EZJB 5DJ6A 2D73A 3UTOA 1AV7A 1OPGL 1SHTX 3A6JA 3OT5A 1KZHA 1WJ3A 1VPTA 5I1AB 4Y89A 4BXOA 4D7BA 2WM9B 2WDPA 4AGOA 3ZOZA 3WWEA 3D06A 3HBAA 4CADA 5C8YA 5AW0B 1AMOA 4K6CA 1FDTA 1ZTXE 2NNXA 4RJLA 5BN4A 3CFCH 4OL9A 2JZOA 4YUEL 1NRWA 3BTSA 2A74B 4ELMF 3Q6FA 3MT7A 3NTQA 1R34A 2AJTA 1ZHNB 5G0TA 2CBMA 3BD4A 3OZAA 1UA6L 2OG1A 4K9QA 3BZBA 1A9TA 4P2OD 3E8MA 3SICE 3ZKMD 1WW3A 4PRDA 2ZKXA 3V4UH 4H3HB 4HQNA 2O5CA 3IF1A 4IIZA 1OKEA 2H6QA 5LGJA 3ECSA 3U6BA 2EL7A 4FZ8L 3L1KA 3IFOA 1X8LA 5C4MA 4HAKA 3SNKA 3AM8A 1F2UB 1U2GA 2JIBA 2I07A 3TA3A 5J4HA 3SOTA 3V7UA 3KVOA 5L7YA 5HILA 3TL2A 1T8PA 3N9IA 2ZX8A 1XCGB 3B82A 3TBSA 2DR2A 3FDJA 1DO2A 5BVJB 4MJ6A 3E38A 5EJFA 3L9RB 4LJ4A 5FTKA 5TARA 7FABH 5I1KH 4HDJA 2Y2VA 4BZ2H 4ODWA 4B9AA 2PZLA 2FKNA 2FETA 4G42A 2JLAA 1C9SA 1E0KA 2KX7A 1QLWA 1TKAA 1MXDA 2QTRA 3ZKWB 3DURB 1WUNT 1XR9B 2C9AA 1SBBA 1I0LA 4AJJA 3L95B 3C6QA 4G09A 2B3RA 4X64B 4HH4A 4BGVA 5K4HA 1OX4A 3F04A 4OJKA 2EDMA 4KWUA 3UYPA 1RZVA 4C07A 5GGUB 3D0QA 3SFTA 5EOTB 4AKSA 1E2DA 5F1NB 4G11A 2X70B 1UMKA 2QP9X 3P9MB 2XB9A 4FD0A 3UDWA 5IJDC 1WHTA 4HCRA 5ANMA 3OPZL 3OHMB 2BUCA 1H05A 4MB4A 4OLVL 5D2NC 4XXWC 2JLRA 3AU1A 2CGYA 5DVMA 4Z5RB 3NJIA 4AXWB 1U1GA 1DN2A 4P98A 1A1MB 1J2YA 4LQFH 3H0EA 1WFMA 3D2BA 4YIHA 2EFYA 2DLIA 1SBYA 5TF1H 1ZOOA 2I32A 4ELMB 2X1VA 3H16A 3UHFA 3RTQA 3HNTL 4UI2A 3W5BA 3E1ZA 5DFWH 4HCJA 2W37A 4KN8A 3GPCA 1R47A 1TQ8A 2EEZA 2I3ZA 3DYIA 4XD7A 3NFSL 2Q7AA 1QRTA 3ZR6A 4KQ6A 1BYUA 3CBRA 3BILA 1OGTB 1ZTXL 1Z2PX 2UZXB 4XGZB 2WNHA 2HDOA 4KXMA 4OFQA 2PKWA 3MV9E 5BN5B 3NWOA 5K2MA 1IQPA 3DSMA 2WUWE 1M3JA 4KRXA 2XTJE 3CN4A 3N41F 5FBVB 4J3OF 5JALA 1MO5A 4MUXA 2RHOA 1MVLA 1JHQA 5E4EB 2XWPA 1NDMB 4TPRH 1AXEA 1VADB 5T5FA 1NNI1 2XG5B 5D7JD 2IV3A 3R18A 5BOSA 3BIFA 4R26L 2BOBB 4IG4A 2C3UA 5AXBA 2P30A 3USZA 2QR2A 3H7IA 4WO4C 2RBLA 3HTLX 4W68A 2J6BA 2OK0L 3BG0A 1NUSA 2VK8A 1DDHB 1TIPA 4NFSA 2YWFA 2YRPA 5TRTA 3RNQA 2F17A 4G2NA 4G37A 3V33A 4DWWA 1KJJA 4LCVA 1MH5A 1PKQB 4X7SH 1MB3A 2JLUA 2VM4A 1PL6A 4L5BA 5E70A 4OQMA 5GS1C 4PMFA 3RVXC 3PGXA 1RBZA 3RU8H 1S8NA 4GXVL 2PCJA 2X4LA 4QXRA 5KTKA 2QTTA 3HXQA 3FFXA 2XRZA 2VR8A 4MIYA 4Q34A 1A72A 3KPTA 5LZ7A 3MZTA 3OAUL 3MK31 4XVUC 1JGEA 3TLGB 5AALA 4JSPC 3J81A 1U3HC 1QIGA 1YHYA 1J07A 1XVAA 1USIA 2QLYA 2GPAA 4PAGA 5IZCA 4TUOB 1TTCA 2WN2A 1EFXD 3HAEG 5EIHA 2UUPA 4ARIA 2CHDA 4X7TB 3MNWA 5HE8A 5A2KH 3PIIA 1JZDC 3S96B 1VRCA 4WKCA 4CM9D 4NP4H 5IUJC 5IHZA 5I4CA 1FA9A 3FSWA 1E3QA 4L57A 4ZT2A 3VZRA 1ESOA 1KMCA 2YWCA 1FZOA 2R51A 5E9DA 3T8XB 4AQ1B 1QP4A 4UFNA 4GOSA 3EZ7A 2DPLA 3LZFH 1JZGA 2X53A 4PPTA 5DUBA 2BZ7A 4WWKC 4NM8L 4GW5A 4OMUA 4WAFA 1BX2B 3N41B 1RE1A 2YRBA 5EHZA 2B30A 1T1WA 3OI7A 3O45B 1H6UA 2HVKA 1OI3A 2CBQA 5D7SL 1R5IA 2R68A 2Z93B 2XICA 1UJNA 1JK9B 1BG9A 2X0UA 1U58A 1L4NA 4HLUA 5EAIA 4U7SA 1OGSA 4YV0A 4RA6A 1HMPA 2Q3HA 3CUYA 4U8HA 3ZZNA 1TCVA 4A0QA 3L3BA 4D9RE 1N1DA 1ADQA 1Q50A 4F33B 1RH8A 1E9SA 1DO5A 5C37A 1C16A 3SC2B 1PFYA 4DMKA 3OJ0A 3FU7A 4RTPA 4H31A 5BW4A 5JY1A 5CPBA 3VU9B 1RZ8B 2FEAA 4HEPA 3KBEA 3HB1A 1GXRA 1ADCA 4FMCF 3I2YX 4BNWA 5DMIH 3AF2A 2ZSWB 4I8DA 5EIBC 1GW6A 1M4KA 4JHAL 4HAIA 2C88A 2ZUTA 1U2HA 4XGNA 4KUZL 1ODFA 2MNWA 5D5PA 4DJ5X 5JIIA 5GIRA 3PNRB 3FKJA 2BSAA 4LCCA 1JHVA 4NH4A 3MC0A 4UDNA 2GAIA 3GSVB 1U30A 4HMPA 5A4AA 1DXOA 1QTRA 5LWYL 1S5PA 3LVFO 4M8UA 1JWLA 2PTTB 4JJOA 2MCPL 4P3CL 3NHSA 3N50A 4YDHB 3DH0A 5PAZA 1AP2B 1ZUIA 1UQUA 1SMAA 2VI5A 3VBEA 1WTAA 1DAOA 4Q4HB 4HFNA 1STOA 1WUIS 4Z3IA 4B6QA 4JSNC 2R7KA 1MEXH 3O84A 3FR7A 3ISTA 2Q7DA 1CP3A 2X3CA 4L8LA 5DNDA 3S29A 4EELA 1ZGAA 5ALVA 2P79A 1SBZA 1YNTF 3M2TA 4AKHA 2ASVA 5HYJE 4BFXA 4HSGA 4C4KO 1EEQA 3QE3A 4P2YA 2R00C 3CLRC 1ECFA 3T5PA 5D1QA 1F3RB 4TV9A 3AEXA 4Y2DB 1W0VB 3MMPA 1IMOA 1KULA 4P04A 3E7XA 4M1ZA 5JPDA 4ONHA 5LCVL 2FHSA 4A8HA 2L8AA 4IOSD 3ZDAA 1CT8B 5BVHA 1PJ8A 5FDFA 1W88A 3D3VE 3SBOA 2ZFUA 4U7MA 5EUMA 1P7WA 4XVJH 3K1AA 1NCOA 4ZVQA 2GWHA 2YGNA 3QNXA 3ZCQA 4MUMA 5K01A 2KQUA 3R6GA 4F2MA 3OC8A 3HUDA 3UGEA 2ABWA 2DI7A 3MBXL 1DRVA 1JOIA 1LBTA 1QVVA 2NTYC 3IBOA 2H00A 3QRFM 1V35A 4FMCB 4B9IA 5JXEC 1VHJA 1A2BA 3JYNA 3CXHK 1HL3A 3IQFA 4ZD6A 5T33H 3SP1A 5ID1A 4Q3BA 4ZDWA 2A9ML 1FMCA 2PZ8A 4LYAA 3HFGA 3TTXA 5MEOA 2RALA 4BVGA 2W2KB 2R0LH 3WJAA 1GGCL 1T0PB 2VWGA 4DC0A 4JI6B 3QF4A 2HLDD 2JAWA 1X5LA 5I8EB 3DIFB 1FL5B 3UZUA 1LFDB 2VK2A 3BC1A 3TRKA 4WSOA 4LSPH 2YCBA 3C6YA 4I1YA 2O2ZA 4ORGB 4YCCA 2V2WB 4ZDJA 4QUAA 4OOFA 2AN9A 5AW5A 2NMVA 3FZGA 3WK4A 3MV9B 2CO4A 5AVJA 4FN5A 4TZTA 2BCJB 2AUNA 2H2SC 5ICEA 2XTJB 5HFNA 4RKRA 2EYUA 3VR6D 2NY3B 6Q21A 2F8TA 4UQIM 1AHNA 3ZGHA 3U4AA 4IKOA 2GW5A 4S1DC 2O2XA 3DDHA 2NZJA 4I9HA 2O59A 4E41A 3EGDA 3QH3B 2O2SA 3SGKA 3F6RA 4HDKB 4ZYWA 4UQ9A 1GS7A 4ZFOB 3EGSA 5DSCA 1A4JA 4WTQA 4AJYV 3FYTA 1YNTB 1DIHA 4K3DH 3ZYJA 3HYSA 4MWSA 2ZT7A 2YXWA 3QLTA 2FZ4A 5CDFA 2EW8A 2QN3A 1ULVA 2QIPA 5LQBL 1OMOA 3B2UD 2WWNA 3MRMA 3UG5A 3OCZA 4ERZA 1E7UA 1TF2A 5DRWB 4P34A 1RQLA 2QJOA 3FHCB 3R0IA 1GC1H 3GLQA 3NWBA 3U7EB 3JD4A 4J7AA 1B0ZA 4PGBB 3LPCA 3BGAA 2WWYA 3H7AA 4YWJA 4F7PA 3Q8MA 4DS3A 4GKNA 1NFDA 3L3IA 1SC1A 1RZGB 1ORIA 2YXMA 2BWQA 3PXEA 1T1ZA 3CUPA 1RUMH 1WB5A 1JTEA 4J1UA 3AH8B 3N5KA 3J81g 1A6WL 3BS4A 4FMPA 3GJFB 2NVBA 4R7GA 4WI8A 2D9QB 2O5XH 2WVVB 2X4TB 2AI0L 1QW9A 1FLRL 4OKIA 4MRPA 3IKCB 3DT9A 3O2DL 3OSKA 1OFVA 5I66A 4MRRA 1NU6A 4R4ND 3L08A 3EPKA 2QRPA 3HKDA 4A7GA 1DBIA 3FF8A 4NNPA 3DVGA 4DSTA 1NG1A 4HPYL 3DT8A 4C4ZA 1RPAA 3QW9A 3ZSTA 5HTKA 2XVAA 5IVIA 2DX7A 3AUTA 2H8PB 4N0YH 3H9SD 3G2JA 3DV2A 5BQPA 1YK0A 3R20A 3LQ1A 3IDXL 3CVHH 2OW7A 2ZOKB 5L9DL 5K8LA 2V0CA 4D6PA 5BW5A 1TJMA 4K8RL 2PNFA 1OWWA 5TE6H 4L9LA 4GNKB 3VH3A 5JXIA 1YAZA 2OR9H 2LAGB 2AZDA 3PEUA 4BH7A 5KTNA 4YCMA 5IT5A 4ER5A 4ZYTA 4IRZH 3N59A 1ADQH 5FPQA 3KLPX 2AV1A 1P7CA 4YALA 4ND8B 4Z0NA 2OVBA 1MAWA 3MWLA 5J4KA 3GZNB 5CT4A 4F6RB 1YNLL 2VN5A 4CKEA 4WCFB 4H0GA 1NJ1A 1AFVH 3U25A 3BE6A 3FZQA 5EIEA 3FCOA 4DCVA 5DXFA 1GEGA 1RSYA 2BNRD 5I6XC 4DLZA 2OORC 1VESA 1Z56C 3IDYB 3G8CA 4TLMB 3NW9A 1Q84A 3MJ8B 4BCCA 2HP4A 1I8UA 1R24A 2IYAA 4DLYA 1PVDA 1M2VA 1OGPA 3G6AA 2VKTA 1XDZA 3BIWA 4XN1A 4PV7A 1XGYL 3EISA 1NUQA 1RLBA 4DHLA 3CZMA 4TTTS 4L9DA 1F2TB 1JRLA 4JFXB 2HA2A 1P22A 1KI3A 4H20L 1S7UA 1RP1A 1AY0A 5AHKA 4N01A 1ZIPA 3BUPA 5TFSL 1NUDA 1HSBB 3DMRA 3NIBA 2I85A 3HZYB 5B2ZA 1YEEH 5BRQA 2FMHA 4AQ8C 2WXIA 2QS9A 4NHEA 4GAEA 1BC5A 1O8BA 2A7BA 1ADFA 2IELA 2XHEA 7REQA 3FT2A 3S8WA 2E7CA 2BKUA 2OHHA 2P9JA 4Y18A 4XWWA 4K3VA 3GRUA 4ODVL 4I9XA 3P1JA 3UAVA 1GR0A 2VYND 1AYOA 3RRZA 5A4DA 1T3SA 2WVHA 4HYTB 1YMQA 4AX3A 2XIDA 2PXYA 1KLGA 1J87A 3GLDA 4JO5A 1E4EB 1TDQA 2QYSA 3PNOA 2DM3A 4QRSB 2BFCA 1OTHA 1LWHA 3PGDA 3BFWA 2QY6A 3Q9UA 3VSBA 1XBTA 2Q2QA 4HWKA 1HHIB 4PYOA 3F05A 3ZDXE 2Y7MA 3DX4A 5TQVA 5GINE 3PFKA 4D9IA 1XKXA 5H1YA 5HYJB 2B1JA 3P4LA 3NXKA 2Z8RA 4GFDA 3L7FA 1ND6A 3R8XA 4DBZA 3SY8A 1EH9A 3S6CA 2AFHE 1Q7TA 4H08A 3WP0A 3HY6A 1R1DA 3GK8L 5LPNA 2R9HD 1GTJ1 1N6LA 2E59A 1VKHA 2VQSA 1PBYA 4HOMA 4FYMA 3TV8A 4AE1A 2ZBVA 1Z5LA 3SGEI 1EE1A 3KU4A 3T6KA 1Q38A 1TC1A 2DKUA 3KPQA 3FM0A 1KY4A 2RGEA 1ABEA 3D3VB 1CX9B 3TOXA 4X4ZA 2WBJA 1B2RA 2R4SL 5H70A 5DT2A 3EQZA 1OCOB 4ZTZB 2F5AH 3ITDA 5HHQA 1J9RA 4K2HA 4WNYA 4FNMA 2RA1A 3VXRA 5G4MA 3TLEA 1BVRA 3O6LH 1U7XA 3U3DA 1FNGB 5F0MB 1N0UA 3NFNB 4GOOD 2PH3A 1M71A 4QRQB 2J88H 1T3HA 2IY8A 1AO7A 1P4JA 1RXYA 4K8RB 1P19A 3WTXA 4FR2A 4UQLA 3ITNA 3HNSH 2C1EA 3RWEA 1H8OA 4GKOA 2Z8ZA 4RTLA 3H5IA 5TPZD 1NIDA 3ZJYA 3FU9A 4OF3A 3G0BA 4P4SA 4OFYD 1UB5A 4RELA 4WNQA 3QFGA 4JLDA 3BA6A 3MRIA 3VFMA 4DAGL 4G5AA 2QPLA 5EN2B 4GBXC 1VL0A 2GM5A 2GX6A 3BZ4A 3CSYB 2JHAA 2VBFA 1SDDB 4M1TA 2OENG 5E0QA 1G20E 3ZHUA 4L8CA 5JIKA 2ZUEA 1XUOA 2FZ3B 3VFNA 5CM2Z 1F11A 2WVJA 1EQAA 3D51A 4BB9A 1A3ZA 3EYUL 4N4YB 3CBQA 1EFPB 2RGYA 2YY5A 5E2IA 3WV4A 3OXRA 5HTOA 4DFDA 4CJXA 2B4CH 1HOCA 4U1MB 3MRTA 3BD3A 2WE7A 4WV1A 4PG2C 4NQCA 3LUGA 3RTAA 1MW9X 2F1JA 1W9XA 4I9WD 1ZCJA 2A94A 1KGYE 2XADA 2CLZA 2ZIEA 1QPXA 4U5XA 5E1IA 3U30B 5AUNB 5DMGD 3K74B 2VP9A 4X9HA 3MELA 4OSUL 4E42B 5I8WA 4AU1A 2BOLA 1SXSA 5D1NA 5ESXA 3SGDH 3KYNB 4GAYA 3PFCA 3OKLA 3IAFA 3BJLA 3PC8C 4CL8A 3ZQ4A 3SDDA 1JAEA 1RUKH 3EZFA 1L7VC 2HLFC 3R9XA 4J7RA 4A6EA 4B87A 4ZNEA 3QVMA 5C0BD 5AIBA 4BNTA 1HHGA 2Y0DA 4N82A 4H8VA 1CDIA 2J9RA 1D3AA 1MGPA 4Q3NA 3B2VH 1KWGA 3L7EB 3RVSA 2PG3A 3IP6A 1P1KA 4OCYH 4Y6OA 5H82A 1DC5A 1M6WA 1MB2A 2OCCB 1W4ZA 2CDRA 3W5HA 1LD9A 1HRKA 4QFBA 4E33A 4GW4A 2VXVL 4BXSV 3TX4A 1Z47A 5FECB 1T7VA 3CURA 3MUJA 5T41A 5B58T 3KJZA 2DKSA 1KO8A 2FOLA 1J8VA 1A7OH 3ZE7A 4JX9A 2EDFA 2A7QA 1JNJA 5FYDA 4BLWA 3LUDA 1P9NA 5IS2A 5HDQH 4KC0A 1N59B 2IYRA 3L3JA 3GDOA 3ISYA 5C0AD 2DMRA 3GQBB 1M72A 5EBMA 5FQOA 3QVWA 4JN1L 4B3RB 2ZI9A 2Z7ZA 4LF6B 2C82A 3UJ7A 4B09A 3HDJA 1KCSH 5GRUL 1NJ9B 1M8GA 5ITVA 3HJEA 3ZDXF 1TAQA 4AO8A 2MCFA 3RN0D 1JHAA 2YUZA 3QA9A 4NAVA 3RDTD 4AICA 3VJLA 3EZNA 3GEPA 2LU4A 2VDOL 4A0BB 1EXVA 2DQEL 4MCYA 3EOBB 2X9ZA 5ALWA 4V1DD 4DUZB 3SE6A 1ZW6A 3UCXA 2BONA 1JUFB 3P3UA 2I7CA 3QVGB 5CJOH 3ORVD 2QGCA 4OJEH 2O48X 1I1QB 3BX1A 2GUOB 4P3OA 3GD1I 2PLTA 1ECPA 1W85A 1VSCA 3N40P 4TKVB 4PJHE 4JDUA 2JNWA 1XSKA 3TLAA 2AL7A 5JTWA 4KMRA 5EXTA 1J8HE 3F64A 3Q87B 2OCDA 4JL5A 3COZA 1F4VA 5BP7A 3BUTA 4GG8B 1VLZA 3RUPA 2QTLA 3OUTA 2NM0A 3CZLA 4DGIL 4P5EA 4XYEA 4XBPB 5EJMA 3CH8A 1XF3A 3KO8A 3RGVC 3QXAB 3U6KA 1QHQA 1T7WA 2BRRH 3VHQA 5DHYB 1FQJA 4M38A 1D7AA 1CGXA 4RGOH 3VU2A 2VLJD 2JFPA 4P99A 3MINA 3VFGH 3UCFA 1ZINA 4G8DA 3NOVA 1PJ4A 5MEQB 3PP8A 2PZGA 4URVR 4JGBA 1FW6A 5GJTH 2NOAA 1VB9A 1CGWA 4MAYC 2GJ6E 3SJZA 1VIVA 1WT5C 2JRLA 4M7LL 4Y9GA 1DBWA 2DYRB 2OV0A 3AINA 3WSTA 3FYCA 3KZOA 4YSSA 5E4FA 2WCSA 2UX7A 1P6AB 1XNHA 3PFIA 3VMNA 1RZ3A 2VNJA 3PWZA 3HR8A 4JROA 2H59A 4L3AA 2J7PD 4NPCA 2ILVA 1TVKB 4UBOA 1Z75A 4NKDB 1VJRA 4LDPA 4G1EA 1DVXA 4LJ9A 4HT3B 3TVYA 2LU3A 4J0DA 3GKWH 2SCUB 4UINH 3S68A 2XIQA 4PWKA 1T6BX 3I9FA 4Z0HO 5DRYA 4S1PA 1Y9DA 3P0RA 1OBHA 1E6JH 1WUYA 2JKVA 1QU3A 2OWEA 3ZDXB 4ZTPL 1AGNA 1OZTG 1IKNC 1KF0A 3MXWH 1OCZB 1FZTA 3MGOA 1CPYA 4KKPA 3EFBA 4FYXA 3WGKA 2AFHB 2JGMA 1W4CA 3QEHB 1KDPA 3GEHA 2FLRT 4JAMB 2MH4A 1XH3A 3WO0A 3RC7A 4ZZ2A 1VSBA 2WWGA 3WFDH 4YUZA 3SO5A 3I72A 4WWNA 3KP1A 2L7JA 1EU1A 3UAZA 1ZCBA 1ZOPA 4G0MA 4JM2A 2FW7A 1C7RA 4ODBD 3OIGA 1QHXA 4B8YA 2QQKH 4BO1A 5F3DA 4F3FA 3US0A 4JO3H 2AVDA 4E7OA 1FTSA 5DK6A 1Z18A 4ICXA 1VM6A 3OLCX 4JK0D 1T5SA 2VN4A 3IXAA 1MAKA 3X1EA 3SCMD 3WV5A 5I1CH 5FKTA 3BUDA 1PNTA 3NJHA 2G5CA 4BFKA 1JG2A 1KDZA 3C6SA 2P3LA 1WFUA 4FDAA 2BDEA 2RTTA 3RB8A 1NZFA 3RKPA 3G82C 2BSCA 1JTVA 3P8ZA 2RD2A 4KE6A 5LWHA 4KFCA 2VDOB 1GZVA 3VD1A 5DBFA 1Z0UA 4Y67A 3HDGA 3LS4H 2P65A 3HZMB 1KXZA 3GJ3A 2I71A 1YUHA 2XMBA 3KSDO 2W07A 1BE1A 5D8JL 1WXEA 3GJSA 4EHIA 2ZKLA 2RHEA 3QXTA 1G20B 2OB1A 4YLGA 1BCIA 4LCUA 3EO9H 4JXMA 1RTTA 4TTQA 1E4YA 3APFA 3ZZTA 2AGJH 1JR4A 2FTKE 3WGIA 3U56A 2EDJA 3EHBD 3RIMA 3G0CA 2GAZB 3KE9A 2OYRA 4LARH 3QNZA 3N1GC 2CW5A 1XFPA 4RANA 4MDYA 2W2QA 4E03A 2Q7YB 1CU1A 2Z6FA 5JNYB 5J43A 2VDML 1WETA 1FNCA 1W1UA 1A77A 4BSWB 3JYPA 5C1BA 1EK3A 2ZVQX 1AHPA 2XWJB 2PO6D 1NUTA 2VXUL 5EZIL 2QVXX 5SV4A 4EYKA 3C2AL 1PJ9A 2P80D 4PJHF 1Z3GL 5JIDA 5KBPA 2XMPA 1TSHA 1SC9A 1UDXA 3AREA 5AKGA 1MJGA 4MXDA 4CQLB 4M98A 2VJLA 4TLCA 4A4DA 3VYWA 3L17A 2DTEA 3GFSA 3NYIA 1CF4A 3MLZH 3QUXB 3PRHA 1OGAA 1TCAA 1RJWA 1M7IA 1U92B 5TE7H 4G5FA 1GZ4A 1KY6A 3GJRA 2DAPA 4IDNA 3OKOA 4BQBA 4Q4IA 1USZA 3RWCB 4I81A 4PV9A 1UMBB 2NNAB 4CDGC 4PJAE 4X95A 4EBQL 2F61A 2CJFA 4NBXB 1T0OA 3V4LA 3LBFA 3CV5A 3OSZA 2BNUB 2FWPA 4OJMX 2QX8A 3CFMA 3U4QB 2FIKA 3AABA 5KSAC 1Q74A 4N7MA 2MOGA 2NY4D 2EG5A 1MFNA 3IBSA 3PQ5A 4KPFC 4RQTA 4EL0A 1GUZA 4KLNA 2LPMA 1UJ3B 3FQWA 3PU7A 4DIMA 4KTDL 3I6KA 3KE8A 4LA4A 4TUUA 2ADIA 4OXKA 3E7FA 3TVMB 3L0CA 2NWQA 3REVA 4DETA 3EYAA 1AGPA 4B7ZA 2V54A 5BZWA 4QGFA 2BOVA 3APCA 1NFIA 3RD5A 3TFKC 4PY8I 2XUHA 1ZHKB 1JVNA 4BB0A 3CLSD 4AWJC 5EQFA 1D2AA 1SVSA 2ERYA 4WGFA 3DV4A 5T57A 1YEFH 2FL5A 4YHHB 1DJWA 1OSZB 2HFKA 1PY0A 3MRNB 3T38A 3ZC3A 1BCRB 2GPBA 4P7FA 1U1CA 3A6BL 5D72H 4QU0A 3ZDFA 1LK2B 1EZLA 3O83A 4F1WA 1THGA 3FONB 3ETNA 2HFFB 4WIAA 1G9SA 1FZKA 2ZYDA 1AD9A 3VFVA 2P91A 4U1GB 5E9NA 4EHDA 3O6ML 3A8TA 4D2NA 1H4VB 4M43H 5J1AA 4O2LA 1DJSA 3QPBA 3O6FD 1WHSA 2WWFA 4A2EA 1E92A 1WP4A 4J82A 3TNNA 1K0UA 1CULC 2H2FA 3HG4A 5KCMA 1E3XA 4PQXA 4PJHB 2ZWSA 2YHGA 2YY7A 4I99A 3L9EA 1J8HB 1ZT7A 2I3DA 3PABA 4NRXB 1MRNA 1NH6A 1F86A 2QXVA 4P2QA 4WPGA 4DMRA 5E7FA 3G8YA 3BLPX 5JQ6H 3H19A 1L5GB 2RJMA 4M5TA 2C00A 4NCDA 4G24A 4PBSA 2CLCX 4I4CA 2VJ0A 3L4MD 2CDFB 2FW6A 2V2TB 1G6Q1 4GW1B 3F1KA 4PM1A 3RL1B 2BC9A 3LOUA 3AJ9A 4CF5A 4R5XA 3V1TC 4NI3A 3BCSA 4DCSA 2H26B 4KJWC 3MJCA 3ICOA 2QRMA 4C7MA 4QQ8A 2BAGA 1DMSA 2VG8A 1P84K 3D6TB 2YRFA 2WJVA 1SD5A 1JTTA 1XLVA 1UVQB 3UG7A 1NFFA 5JFOA 4Z78A 4PRPE 1CTOA 1NOLA 3FFCD 3CXDH 4X5LA 2VDMB 1JG3A 3DV0B 3V6BR 4HNVA 3W38A 1YPZE 1RZFH 5D96C 3CEAA 2FPIA 3G04A 4MR8A 1SCKA 5LVEA 4I1PA 4OCSH 1YAJA 2RGAA 2WQAA 4CM4A 1GQSA 4HDNA 2Y1AA 4N14A 2J0SA 1C3LA 4V1CB 2QJTA 4RENA 3A58B 5K0JA 3V4PL 5TGBB 1J0JA 1YEJH 3KPMB 4NJAH 3DTNA 1QYGL 1V71A 1MCFA 1TVHA 4EVIA 1SUAA 2AJBA 2QMKA 4WHTB 3KLBA 3LV3A 3OVUB 4EVQA 3GTVA 2X76A 1B3IA 1KSGA 2PBRA 3FB4A 3V2IA 4M29A 3TKLA 4BVKA 3HH8A 1SNRA 1W0JA 4QBTA 4FHZA 4B0MM 4QUHA 5HDOA 4GX5A 1G1AA 1BVKB 1D9KD 3KSBC 4FFVA 4I88A 5DBHX 2VJBA 2V6MA 2NMSA 4IMLB 3GSOB 3U0TA 4FZRA 5FJIA 2A30A 4M0FA 3ZJUA 2PMCA 4U1HA 3PD7A 3PITA 2HGSA 2EC9T 4UT7L 4YO8A 2H5JA 5DU2A 1DVFB 5GISH 4MS1A 5HPYB 3G5XA 1AHMA 1GGEA 2A1TS 2X4GA 3S36X 1GKYA 4CDRA 4RVCA 1CQIA 5DXAA 3T3PA 1KVQA 3EFEA 3JARA 3U80A 4LKCA 4PJAF 5GGSB 2YINC 3V9PA 1T2QH 4BKTC 1MAVA 2EVWX 4P38A 3USES 4L48A 2W0SA 3C99A 2BPBA 1U5BA 1W93A 2NTFB 3BESR 4I77H 5LXGH 3VHXA 1T2DA 4G23A 1P2VA 4TULH 5IB1A 2IBBA 3X13B 2DUUA 3OHPA 4LXFA 4WACA 3QBTA 2IMMA 4LDEB 3JQAA 5DURB 3T5WA 3COOA 5E99L 3MSCA 2A83A 2W2NA 2GVZC 4WW2F 1PG0A 4XR4A 3MUOA 3PXHA 1TF4A 5HIJA 3U9TA 1VPDA 3ARFB 3LPAA 5A3JA 5T1LB 3RVNA 2GERA 3LX8A 3NVDA 5D7LE 4D3FA 2GSMB 3ZHTA 1UJ2A 3V46A 4I2NA 1YTLA 5TQ2L 4LOUC 1F7VA 4LGSB 1Y3CE 4JBIA 3AK4A 4ZXBB 1TIBA 2INGX 3IOBA 4DV6B 4KRFA 1K3ZA 4G5RA 5JQIB 5JBIA 1Y4UA 4I4WB 3MRXA 2ZIXB 1Y6QA 4ODHL 2QX7A 1G9XA 2CMRH 1NL0H 3E9MA 4M0LA 1KVSA 2WIKA 3GFQA 1N6HA 1QRUA 3E1F1 1RBYA 2BMEA 2WYVA 1HE2A 5D9SA 5JHDA 4MD4B 2B8OT 2XQYG 3RZCB 3E84A 1LQTA 5EVCA 1R9NA 2HW8A 4TSBL 5J13C 5FBRB 5ID0A 3K6SA 3PC4A 4TUYA 4PW0A 3UAAA 3ARSA 3HEAA 1DSFL 1N9PA 5E2TH 5DGIA 4CC9A 5ESRA 3F96A 3E6HB 3E15A 4G6JH 4MGKR 3JQEA 3PEWA 3WA6A 1SG0A 3DPBA 1U80A 6AT1A 4M62L 5K6AA 3TLZA 1GUYA 4RPIA 4E5MA 5LBVA 4LJRA 2F4NA 1UXWB 5ADUS 3DJSA 3EOZA 5T3ZL 1OWOA 3N0WA 1ZT1A 4IGBB 2EZ8A 3BMCB 4M5SA 2QPTA 3OIWA 2QUHA 2P48B 4FYHA 1TJHL 1YC2A 3PD0A 5EMMB 4DR1B 5L2JB 1QNZH 4M61A 1V3TA 4R97C 4GLJA 1Z9LA 5D93B 3AY7A 3UTSD 3W6OA 4MWTA 4XT1C 3OESA 3V4PB 1UPCA 2HRZA 2V33A 4PJAB 4HKTA 2X15A 2C9UA 4CCYB 2R60A 1U2RA 4JY5L 1AU9A 2X2OA 1K8IB 3CUVA 1YPZF 5I6NA 4NSKA 5AKRA 3VX0A 5D3MB 3VQTA 5GV7A 4IJUA 3EGIA 3CVBA 3U0BA 2Z5GA 3CONA 5THKA 1UWXH 1G8AA 4X50A 1U8LA 4OF8A 1DC7A 3C75A 2VLME 2M6SA 4WZAE 4LG8A 3WAGA 4I9UA 4IBLT 2I4OA 3C1UA 4UOQA 5AB1A 3TW8B 3UVNA 3P9QA 4ZW8A 2ONCA 2OPHA 4UAOC 4O6VA 2HA4A 3X2SA 4NQSA 1O9ZA 4QTZA 1QA9B 4L4JA 1T03H 4DR7B 2YEVB 3W0WA 2WUVA 2RDMA 4FOMA 4JUSA 5GONA 1FH5H 1QH1B 4FXGB 3SO3C 1FG2B 1SG9A 4HEJA 1FL3B 3M8OH 3BDYH 2AEEA 5B3JC 3QDGE 3PUYA 3MCKB 5IASA 3OKDA 4KQ4H 4G6KH 1PJZA 2WIBA 1XTIA 3KTDA 2QYTA 1TVCA 4JFED 3BN3B 1BGXH 4QLOA 2W9LA 3TM5A 3FMGA 3QKUA 3GBML 3GYBA 2QUZA 3ARBC 4AZUA 1ZTMA 2VHXA 1PLAA 1QBBA 4J78A 2FZVA 1I7ZB 1R3HA 4R4BB 3AVEA 1ZR4A 3WEOA 1N6IA 4JJ6A 4BBZA 3CKMA 1JERA 5AZ2L 1J23A 1IL1A 5F77A 1NP7A 2CHGA 3ZX5A 3DT6A 5JCJA 2O2GA 1HWYA 2VKXA 2NY2C 1A8SA 2BBOA 4KJQD 1GFIA 1H2EA 1MCNA 4U1LA 3GTNA 3STZA 2HFTA 4FQJL 1OFHA 1YECH 2NY5C 5LBGA 3P2EA 4KK6D 1OGYA 3HO6A 4CFSA 1QSEA 5EJ4A 3KD3A 2OMVA 1MAMH 1A5BB 3FYUA 1FVCA 3C6LA 5HPMA 1USGA 4AZ3B 25C8H 4IOIA 4PAWA 5HOEA 2HT4D 4XCNA 4JO4H 1J25A 2QG6A 2PK3A 4IDCA 1PWHA 2QNRA 2OFQA 1WH0A 4MCHA 4DCNA 5AD1A 2C7QA 3L8CA 3TLCA 2DWEB 2F3QA 4FQPA 4DG5A 4H26B 4OHFA 3DEKA 4XCVA 4PRPB 4XPTH 1W6UA 2PXXA 1YPZB 1DE0A 1GYUA 1NF2A 3LN4A 1AIFB 5BWNA 2WKOA 1A69A 5I74C 5GGQH 3TLMA 4S1QH 1HQCA 2NX5E 1P9MC 4B85A 4FQXD 1LWOA 4J4HA 5FUCE 2R8PA 2E4ZA 4X60B 5JHGB 3DTUB 5GS0H 2YRZA 3TZVA 1X86B 2C2WA 4DR4B 1VERA 4OJFH 3CX3A 1EMDA 4WEOA 4YOKA 2BKLA 3PWVB 3IQGX 3X2FA 3UZEA 3S2ZA 1QFJA 1Q0PA 1NGXA 1VL1A 1KVUA 4NABA 3NHPA 3PJFA 4L74A 3ELAT 4NAQA 1XMPA 2ZJ6A 5IKOA 5P8WA 5EZ6B 3Q5YA 4EJ1C 2CO7B 2WXMA 3T0WA 2O8BB 2IGFH 2JELL 1U6IA 4UIKL 4GZ8A 4FDMA 4G89A 3UPCA 4OZIE 1C9MA 5CGQB 4KOEC 1G6OA 1AUQA 2YNPA 3TRFA 5ISZE 3EHEA 3HK2A 1NBCA 2LAAA 4TKZA 2A4ZA 4GSXA 3W2DH 4A2CA 4G1MB 2AFIA 1OH7A 2ZBRA 5I15L 3D43A 2VAAA 3LDBC 2IHVA 1R4XA 5IQ9B 2PR7A 3S40A 1GZHA 1IB5A 1YSCA 5D70L 4YE4H 1GTG1 3BHBB 4EN3D 2XZAL 2ZQKA 3BGDA 5BV2P 5F93C 4IBOA 1T80A 2JIMA 3L41A 4FF9A 5K4AA 4IRSA 3AZUA 4N8VA 5J3HD 5L3SA 2OCFD 2QROA 1E7SA 3H9ZA 3ULUH 4DEVA 4L4VD 3I3BA 2OQJB 4S04A 4ZCTA 3BQNB 4W5NA 3BT2L 4K3UA 3O8LA 2BGMA 4B40A 5DZJA 3SPVA 4D57A 3BFJA 3WKMH 5IK2D 3QEMB 2NRDA 4M7OA 3FSGA 5F4BA 1ZA1A 4YXHH 4MD5A 5JXAL 3FB5B 3QUKA 4K86A 1WD8A 2XVLA 1SQ6A 5D7LB 5FHQA 1LNUA 1ECZA 3U4EB 5ECWA 1HI6A 1Y6GA 1TPXC 4DUWA 2MYNA 4QFDA 4M1QA 3O74A 2HCBA 1RW4A 3PGA1 2BVYA 4MV4A 3D18B 1IGML 3RODA 1RMQA 4R0LC 2IE0A 2XTZA 3KK0A 3UAFA 3VH8A 2YXVA 1J0AA 3HZVB 1D2RA 1V5IA 4BV9A 1NA8A 4X3EA 4A7QA 1FAKT 3Q01A 4LLYB 3L5WA 4GXNA 5AM0A 1CL7H 4PJCE 2OGTA 4CZ2A 2WU4A 1MVFA 4MRSA 4BFRA 4XPGL 4L2IA 4RYDA 1WE5A 3QZUA 1PCXA 4X41A 5JAOA 2H2AA 3NVNA 3LT0A 3N44F 2N0SA 1PZBA 3IJYA 4MBOA 1G5QA 1JSZA 3IEXA 1ATZA 4OK3A 2P45B 4GD3Q 4E2WA 4DNOA 1LF5A 1S2OA 3UATA 4ZCRA 3A25A 3LB6C 1D7BA 2QVBA 1OYVA 1ECGA 2NUTB 4AJLA 2BMKB 2XUAA 3D87B 1ERNA 3ZT5A 4HFRA 3T1QA 4OJAA 1MFDL 3P2OA 3PXLA 4I2XE 3QEJA 5GZND 3DSNA 3E2HB 1OTSC 5ANHA 4G0OA 4IIQB 1MLDA 1V8BA 2H16A 2W43A 2X9NA 1JR6A 1BZEA 1N2SA 1CR4A 1LPBB 3F12A 3VD5A 4Z8FH 4C4OA 4FHGA 4QHUB 1KEGL 1ZE3H 3FRPA 3GMRA 1FYWA 2H1OA 1SXAA 3X44A 3ET4A 3F58L 4B83A 3A9SA 2D7NA 3ABIA 2WEKA 3DHEA 3ARDD 2GAOA 1QKZL 4R98A 3NDIA 4LVCA 2NPIA 2XX3A 5H80A 4Z4IA 1GQOA 4K71B 5M95B 2QV0A 4OI2A 3RNOA 3FTCA 3WMRA 1SEBA 3AWGA 1CV2A 8LDHA 2VPZA 2WSBA 2AQRA 5TLSA 4OUUB 3K8KA 3ULSB 2CR3A 4UTVA 2FSEA 3DDUA 1FE8L 5GS2H 4WZAB 3CFDA 4ER3A 4R96A 1S7VB 1Q94A 4ESKA 2JQAA 2CV2A 3ILEA 4FMVA 3QHQA 5L53A 2VISB 3QTBA 3R6TA 4MXQD 4PJ9B 3EDYA 2RAVA 3VWKA 3U82B 1LE9A 3F4BA 3FMGH 4HDSB 4PG6A 5BNFA 3MFGB 3ML1A 3LUBA 2A8YA 1DRJA 1XTRA 4WI3A 2AN4A 1KRWA 2DMKA 2P2DA 4HN4B 3QDGB 5IMLA 1XKSA 1BXVA 1KBBA 2AR7A 3FAZA 3EXEB 1RZJL 1VGEL 4OZIF 3DHNA 2EBUA 5FKSA 2H92A 2ZJBA 4F4JA 1USQA 1VG9B 1KNOB 2XDWA 1RRMA 3JX9A 1J7KA 3ABSB 4CMJA 1JF1A 1N5YH 2BY4A 4HP8A 4DQDA 3MOBL 4S1VA 1SF5A 2QENA 2JLCA 2HCTA 3N44B 5KVDE 3T6VA 1KJZA 4HQQH 2BRQA 1JA1A 3WHPA 3HKBA 1N2XA 3IAGC 1HYSD 5A6MA 1D4AA 4OB8A 2YYSA 2WD0A 3CLTC 1I24A 3FTDA 1HX0A 1FNFA 1EESA 5A3QA 3ZNNA 2O19A 3GJEB 2HPTA 2H1SA 5A62A 3AVWA 5I1LB 5IVZA 4YY3B 1TPZA 3AW5A 2C77A 1V96A 1TOXA 4GSRA 1HA3A 3VPSA 4QWWD 3Q11A 3CVVA 3UMVA 1K3TA 1P1ZA 2YVKA 5MDHA 3ALPA 1DFGA 3O95A 1ENOA 3KFLA 2NW6A 1I1AD 3WNKA 4ENRA 3DXAD 2AK4D 1LDNA 1MN4A 3GBSA 3KIPA 1AXTL 1JBQA 5DNCA 1V4BA 4S1RH 4TTPA 5HJBA 1IC4L 4BRWA 4DO5A 3ZHQA 5FPIA 1FSZA 1OZFA 4G2TA 1Q0XH 1OK0A 2OZEA 4R01A 2K4MA 3A1VA 1A7UA 2ICWI 5E6IA 1QTQA 2JFGA 3B89A 4R9SA 1OXSC 1O1YA 3RBVA 3UIYA 1MQKH 4O4LF 1QTNA 4NOMA 3EDEA 1FBIL 5TE9A 2NX5B 4ZUWA 2TRSB 1IUNA 4IKEA 4Y6QA 2PH1A 4KACA 2EZ4A 5CAYB 1UPFA 5K0BA 3D64A 2G06A 5C92A 2IEZA 5HHOE 1QP8A 1YEDB 2B0SH 3EYWA 4YFEA 2XE8A 1S7XB 2AJ3A 3WL3A 4GI7A 3GMDA 3HFQA 3PGCA 4PJCF 3X1KA 4E5VA 2DKNA 2D1TA 1K0FA 5CU7A 2VJCA 5LZ8A 3MNZA 4DSOA 2BTQA 1R27A 3HE7D 3EC7A 4U1JB 2DFVA 4PQYA 1UFVA 3MRBB 2W59A 5B1SA 3FBQA 2EXYC 4G0YA 1SBTA 1S9VA 4EUPB 2PLRA 4OZIB 3F6EX 3RWDA 2H32H 2Y5EA 4ZMOA 2FPKA 5IK3B 2B1AH 4RVDA 4OHCA 1S9YA 5ISZB 2YGOA 1HYGA 4M4SA 2YGVA 3GZOA 5L6MB 2ZJAA 2BSRA 2A1WL 2FJFB 4N12A 2X5OA 2R2GA 5AW9B 2PTVA 5FL7D 2Z6AA 3SBRA 4XZ4A 4DYDA 3MYJB 3GFCA 2DD8H 1KERA 3P45A 9ATCA 4LYFA 5C0CD 4YPJA 4KPHL 1Y1TA 1TCRA 1XQ4A 2H1VA 4Q7KA 3TUZC 2HEGA 1IZYA 3AIKA 2O2JA 1N0LA 4GGDA 1YEKH 5I71C 2IPTL 1TL7C 2D2CC 3ANSA 3Q1KA 4N6NA 3ZHVA 3JWJA 4WU7A 2D62A 5EXXA 2QMOA 4H5SA 4WCYL 2YZ2A 3D2TA 5F9JB 4D42A 4O4IF 2X0WA 4XLZA 4HWTA 4UZGA 5K45A 5CLIA 2EQDA 1NW6A 1DN0B 5E2WL 5KVDL 3PIRA 5SZJA 1KEML 1CDZA 2WNSA 2PNJA 3WK7A 2Y1YA 2PWEA 4OKDA 3H5LA 1J8FA 3D6MA 3W04A 2Y0BA 4YRMA 2QADB 3KPSE 3GRWA 1GFZA 4ZPXA 4KNUA 4A7TA 2YNNA 1BD4A 4LZLA 1W2WB 1JXGA 4C5CA 3JTMA 4R1QA 3VI3E 3QJZA 4PMEA 4O4LB 1RR6A 3M1BB 3RIAK 1Y9ZA 1JWUB 4LHQB 4OATA 3LHSA 1UJ4A 1CUWA 2V98A 1EFDN 4UVDA 2KLRA 1E2BA 2GAJA 1U8UA 5CWSB 4FX5A 5E7MA 5DQ9B 1T89C 2P2ZA 4K3HA 1J12A 4P4KC 4F8NA 4DYVA 3BVNB 4KYTA 5AUMA 1JWSA 4XTRD 4PJCB 4ZMZA 2WLZA 2OR3A 1WPXA 5KTOA 1L7IL 5JG7A 5B5SA 1SB9A 3SZGA 3S99A 4D26A 1MX3A 3V2UA 1EVQA 4EUNA 3R3HA 3LQRA 4V2UA 1FPTH 2JCCA 3W4JA 2XWBA 1YZZA 1XTKA 1JHKH 2JB6A 2I3AA 3UAJC 4B9GA 1PNCA 5KTEL 1K89A 4E5NA 3IODA 3FBKA 1FNSH 2J3EA 5IMKB 4BFBD 2KPNA 3GLKA 2WUEA 2W2VA 4JZJB 1DBBL 1U8ZA 4M1DL 2FJHA 2BOCB 4I2XB 5E94B 1G6RL 5E00A 3A6FA 5BV7A 5IT4A 5FLKA 3JSXA 2IUPA 2WMPB 4AQZA 1H8HA 3AF0A 1A9SA 2MSEB 3Q85A 3M6MD 1J9QA 2BR4A 3T7KA 2ZQZA 4HUJA 3NJNA 4DA9A 4Q97A 1KYXA 2CK2A 3EBOA 4Z3KA 2R8EA 3NZEA 2ZB2A 5FEMA 1JSXA 1TQ6A 1WA1X 3U6RA 3LAWA 4WE3A 2QGFA 3ORYA 3DDWA 5ENZA 1P1BA 1BIHA 2HTLD 3MLUH 2H5IA 2XMGA 1AG0A 2E75C 3LXUX 4WUUD 3C3AA 1ZEJA 2FMTA 1BCSB 4P35A 2JJQA 1N57A 1A1NA 5CVDA 5B8CB 4RH3A 4MQEA 1QFZA 1E4OA 1DKUA 1XQ6A 3FCXA 4HDOB 5DQDH 5D1ZD 3QYMA 2JH9A 3ZIYA 3E5NA 1P5VA 1IQDB 3I2FA 1B0RB 1UBLS 3JQ9C 4G4SO 1BQEA 3F6PA 4FS3A 3U4BL 5JORA 3I12A 3R7SA 4OAWB 3SYPA 4CUZA 5H8DA 1AHWB 1OAUH 2HXYA 2Q4TA 2ESVE 4FYQA 5AD0A 3FTUA 3K3PA 3G5ZA 2R48A 2D2OA 2W71A 2H2PC 5HF6A 2IF2A 1Q77A 2DJIA 1LDPL 4Q9CA 4NKQB 4WDIA 2CJSA 4XSGA 3ECQA 2YD9A 3ECAA 4N3TA 2BZGA 3U61B 4BD4A 4DA0A 1NKGA 1XGPA 4M9RA 4X61B 2BJMH 3SVLA 2NV6A 2W92A 2WWXA 5TPZA 4NKOB 2SEBA 3AM5A 3S2AA 1Z5VA 1HKLL 4LN1A 2H8KA 2J4FA 2Q9AA 1ZT4A 1RE0A 2WJ7A 3JQ8A 4JIMA 4XN5A 3AF1A 1G5IA 3VGAC 2HKFH 3O3OB 4KR9A 1LF0A 1X5ZA 4RIGA 4JJ4A 4MGXA 2OFOA 3GARA 1C8QA 3IXTA 3ZU8A 4Z23A 2KQNA 4PJDA 2G9VA 4EI8A 2VM9A 3KJIA 1JPFA 4M56A 3MVDK 3ZXUB 4XFJA 5HM6A 1AGBB 4XHJD 3DDNA 1N7HA 5ALUA 3PDOB 1Z6XA 3JATB 2ZKHL 1XV5A 1GNLA 2NXZB 1NDGA 3EGVA 1IC6A 1WPRA 5ICXB 4NZNA 2HG0A 2OGSA 1Y8ZA 1VCOA 4ENEC 1A71A 2CNKA 1XK6A 2GTQA 3ADPA 3BD8A 1LGYA 4W9MC 5CXCB 3SPCA 3WWPA 5FOUA 4MYTA 2GC7C 1GTNA 4ILKA 1O7JA 4ND2A 1Z5HA 4JQZA 3QQ9D 3WLLA 4PJBE 2IEBA 1WZUA 1JZJA 1FSGA 4W6YB 5B3NA 2QL9A 4NC1C 2I65A 4JFFE 4ZD3H 2GRAA 5EORH 5AMSA 5HI3D 4A6YH 4JLNA 2YR3A 2V9QA 4NECA 3OFSA 2JASA 3Q0TA 3S5LA 5FYJH 4H7EA 3VI3F 3WJ7A 5CDGA 4CEIB 1TRHA 1NPTO 3QPCA 3KM2A 2GTHA 2CB0A 4RZCB 4J0XA 4FL4B 5DTIA 2DAVA 3IJEB 4CNBA 5TJHA 1U0OC 4P5MA 5IFHL 5AJVB 3N6YA 3IJ0A 1H0KA 1Y81A 4FLSA 4QXVA 1TAGA 4H88H 4YCBA 4BUZA 1IOWA 5K3BA 3CDZA 5HHOB 3BWVA 2KJQA 3B7PA 4JVUA 3VXTA 5FEUA 4N2FA 1DDGA 4XNMB 4RA0C 1I85C 3MV11 4NDMA 5CM1A 5H14A 2VERA 3L1EA 4RTOA 1G6RB 3DW1X 4PTUB 2RI0A 4GXUN 4E5DA 5J47A 4IDBA 5BRZA 3KQYA 5KNLA 1JJBA 3VC3A 3OKEB 1N32B 1U8JB 4LRNL 1NEZG 4BKRA 4D74A 1F4WH 5LO7A 3QK0A 3OX8B 5D5MA 5IFKA 5DD0L 3I9JA 3RBXA 1YNOA 3ESQA 4I4IA 5FA8A 1DUVG 1G6VK 3ZY5A 5JPMA 1VDZA 3MCAA 4WK0A 2GYSA 3FBTA 3ZW3A 3ZGVA 2VZLA 1Q92A 1XKQA 3GUFA 1F2QA 3GRGA 1BG6A 2HZ7A 4NIMA 3IOMA 5E8RA 4HMCA 5HVNA 2BMFA 1SPBS 4MXWH 3VPGA 2JGIA 4K6HA 4F91B 1CY8A 1IM9D 2UZ0A 1FLTX 4PBXA 5CKAA 5FKJA 5IU6A 2CDEB 2D59A 2H9AA 5DHVB 4R8WL 4Q9IA 5LNK6 4EB6A 2XGOA 4OM1H 2UZPA 4XB3A 5DLML 4OVKA 5JS8A 3ZHNA 3KWUA 1KARA 1E1CA 3PFWO 3LCMA 4OK5A 2WO2B 1Z6GA 1F97A 4JDEB 1GGIL 4FE4A 1DRWA 3IJCA 1MIMH 1PYOA 3O4HA 2AKAB 1YE3A 2D4FA 3BHNA 2GB4A 4ALAC 4PS4H 3NN8A 1EK1A 2A9NH 4ZO6A 1ET5A 3V42A 1INQB 3QLUC 1U9YA 4TTGA 4PE5B 1X3LA 4UBNA 3MD9A 3L82B 2XNAA 3KPSB 4UD6A 4A5OA 4YJKA 1SVMA 3EXHB 1C9IA 3RFZB 5CO1A 3TASA 4G70B 1DSWA 3NDPA 5FC9A 5KYKA 4U39A 3VI3B 5JSQA 3H87A 2CN1A 2XCOA 3GGWB 3HKEB 3GLFE 1X1TA 3HE6B 4K2UL 4H0FA 4W8HA 2QBYB 3NMUF 2P9YA 1ULHA 3N5AA 1E5AA 3SHTA 1CR6A 3GVIA 4IRJB 3QUMB 4NDZA 2YWEA 4KR6A 3NVKI 2Y36H 3MUGA 2HU8A 2XB6A 1JNNL 1BGXT 1PEYA 4LMPA 4IKJA 4NXNB 2P7TA 1W94A 5B12A 4MSWB 5AVQB 4IIVA 1II8A 1W0KD 4MQXD 2LNDA 1G21B 3MOAL 4C59B 4V2IA 4W8GA 4YRKA 4A09B 2JFZA 1G3QA 4NBLA 3GPEA 1Y7VA 4HUMB 2R85A 5J7CC 4BE7B 4NKMA 1WD5A 4PHHA 1U4FA 1IBYA 3L77A 1SFRA 2QI9F 3ZKXC 4LSVH 4UWQB 1QTPA 3NIFE 4RETA 1F6AA 4LBZA 4ZARA 4AROA 4JOCA 5DC0A 1PD1A 1UP7A 2IDJA 2W42A 1XZAA 3AUUA 1IKOP 3WKPA 2A5JA 5ES3A 3ARVA 2EVGA 3HY3A 3SLGA 1EGVB 4MA5A 3QIBD 2VPQA 4PJBF 4O63O 5KJ6A 3S36L 3D6FA 5ADOH 3P0GB 3QV1A 1CVSC 4Q7MB 2DWUA 4PHXA 5K0SA 1G9EA 1FS5A 2IOOA 3W9EB 1O89A 1C1DB 3A14A 2ZWAA 3D6NB 3ARTA 2GHQA 1LWJA 2Q3ZA 4L23A 4YJ2A 4U6NA 4DGVH 4MVJA 4ZXFA 1LBHA 4LASL 4CT0A 2F7QA 1G87A 1T6VN 4H40A 1LXMA 4G3XA 5I8CB 3DMMA 2MIIA 4BMDA 1TT5B 2ESVB 5MERA 1LI4A 4F71A 4H27A 3UHAA 3QG5A 4ZMPA 5CLFA 4EM6A 5E2BA 2YQ5A 3KQLA 3KVQA 4DK6A 1E18A 4AG6A 2P8MB 5BYKA 2H6OA 1SVLA 1KFAH 4LC0A 3HWSA 3V7FA 2CDCA 1XRJA 1MO4A 4ARBA 1TQ4A 4HF5L 1S7CA 5ILTH 3WYGA 3TYFB 4QVGA 3QEBZ 2N1TE 4MQ7A 1IB6A 3AR2A 2EJCA 3TEXA 1PZSA 4ALMA 1JILA 3U4GA 3LD9A 3HWRA 3AUFA 3CBJB 2FWUA 4LP5A 5MHSE 2ZOLA 2IEAA 3RS3A 2IIPA 2LGNA 3F7MA 1LEIB 4X20B 1KIQA 3QFTA 1L9PA 1FRFS 2BIHA 2GLTA 3DUFA 1DQDL 1H0RA 2CCJA 3GT0A 1JYXA 4APQC 5HP5A 3DD5A 4YBHA 1MFUA 4D4LA 5BWMA 3T3IA 1VFBA 5T1DH 1LVGA 1E2EA 2VUSA 2LW3A 4HEA6 3ILSA 2WBXA 4HFUL 3DL7A 5H1MA 1K2DB 4G8EB 2IYOA 4G8BA 3QU7A 1SHZA 2J9ZB 4Z53A 2P6MA 2XZQL 4OAPA 3PL6B 2VDKA 4GQ2P 2EYRA 2K70A 4TUKH 1BDJA 4HAGA 4FNLL 5L8VA 2ZAMA 3IAAA 4RL4A 3A1WA 5SZIA 2BHYA 2WSSA 4XOUA 4PJBB 2A3NA 1VFNA 5F35A 1F6LL 4IBQA 3HN6A 3PWJA 5I4BA 4DKFL 2VCYA 1J90A 4RBNA 1W36C 5EOCL 4LHUB 4X4YA 4JFFB 4N2IA 4KEAA 3VSCA 3ONEA 4Y8VA 4M5ZL 2HTKC 4BFFA 2CLVA 4ZAKD 1N8TA 2AYXA 3PE9A 4CSZA 3CHPA 1QFSA 2YV4A 1GYCA 5DTEA 2QSTA 1RQ7A 3GZKA 3PSCB 4ZFFA 4DV1B 3SQOL 4J16A 1M2HA 3G6JA 2OHOA 1KNXA 2NYAA 2IXDA 3ZDYE 4Z7UA 3HBPA 4N85A 4XPHL 4CLHA 3EXG1 1SKAA 3LEYL 3GMPB 3VCLB 2NSQA 1R3KA 4KN6A 4K03A 5DF1A 1AJ7H 4BFIB 3BAYA 1I6WA 4F2WA 2N56A 4MVJM 4OBXA 4NV3A 1P0SE 1QF9A 3AEKA 1U0SY 1COBA 1IXKA 2AEQL 3THML 2W6IA 3PT5A 1XHLA 4DA8A 3R1GH 2ZRKA 5JJCA 4XBGB 3DDCA 3BL8A 2XETA 2NZ1A 1I4FB 1RIUL 1BH6A 2YPLD 2VHWA 2R1XB 4OPMA 4FQLL 1V7ML 3VR2D 1FTYA 4RD6A 3TFWA 3MUNA 4BAGA 3BWZA 5D51S 4TPKA 4N2MA 3EYQD 1WWKA 3NIFF 4OBWA 4GEGA 3VDCA 3EJWA 1NUHA 4PLWA 4B80A 2G07A 5KOHB 1ZPLA 3IU3B 1I7RB 3QFFA 4O4YL 3WBJA 1FRQA 1AMXA 3PUVA 3UTTA 1X9RA 4ZA2A 4H7FA 2P68A 4YVNA 4HG2A 4HCRH 3NHLA 3IEVA 2FNWA 1A3LH 4Z2YA 3BD5A 1MFAL 2VVTA 1T9DA 2JGJA 4DCCA 2YXDA 3S81A 4XOEA 5F9AC 2GJPA 3FOBA 2D03L 1EA7A 4W5TA 2H07A 1SOWA 5K1ZA 1BQ4A 4MA1C 5EARA 1JKJA 2D0DA 3WE1A 4O3TB 1FVXA 5H4YA 1BXGB 2AQ8A 5DEFB 3L7AA 2Z8XA 3DZGA 2A88A 1A6VH 1DBAL 1Z9BA 4HDRB 4M9ZA 3G68A 4FPXA 5DJDB 2OBBA 1ZRNA 2F59A 4UQ2A 4QXUH 4TSKA 2VAJA 4L5FH 4P4RB 3VXPA 2NXYD 5KWVA 3P4MA 4Y4KC 5F3HB 4JXKA 1TQVA 2X2FA 1WIPA 3CRW1 3QG7H 3B43A 1XYVA 1WLSA 3LKQB 4NT6B 3H86A 3LLMA 4ZPVA 2XA8L 5EJ2A 4U3JB 1JIKA 4Q2ZA 1XR8B 2APFA 5HFAA 3BERA 4DDUA 1JPSH 4QDZA 2TRCB 3H5OA 3BT0A 3AG1B 4JVMA 2P8PB 1RRGA 2JAUA 3KJ6H 3K70D 2BP8B 3GLFB 5MEPA 5BSMA 4CETA 4G7QB 5FGCE 2EVJA 3EOYG 3LF1A 3HSYA 4AOWA 3I6LD 3CFBB 1IJKA 5T5FH 2JFHA 1CYGA 1NGWB 4L4TA 3R5KA 1RULL 2ZXAA 4XMXA 3FN0L 3KS0H 5EPOA 2EDRA 3R7WB 1PZ5A 3EYOB 3MUY1 2E48A 3QAZB 2IBTA 2HJVA 1ZMXA 1XLTC 1Z5GA 1KSRA 1IGJB 1WSAA 2HYDA 4D9QD 3OJLA 2QT6A 3QWNA 2HRGA 1KY3A 3GGJA 2CV0A 4ENZA 3AVYA 3WFBL 3PHQB 4OD3L 5K3SA 4NZMA 3K31A 1DU4A 6FABL 1B4TA 5AKHA 1FZMA 4ZICA 1IN8A 4OFZA 3WXVH 4F8PA 1PV4A 1QFWM 3PWNA 3LUJA 3NIFB 2X5PA 5D71H 5HGHB 3MLBA 4XDZA 3ARWA 3UB4A 4C0KA 5A2FA 3AIOA 5BMFL 4HLCA 2DB8A 4PJEA 2W2LA 3H11B 1CUEA 3E18A 4N9QA 1QFPA 3VFOA 4LZAA 4JFZL 4OCXH 4MVJH 1I4OA 2I9TA 2FEOA 2VH2A 2Y1GA 4LWZA 4S1NA 3EIOA 3QA3E 1G7IB 3IDGB 1LO2H 1TUGA 3ER8A 4NO2B 1JWAB 4DZRA 4EA8A 3UBMA 4UU0A 1V2GA 4RGBA 4YRNA 3FTNA 1W5TA 1G3UA 3UBXI 4M9OA 4BUJA 2BGJA 5AG9A 1AGXA 5IHBA 5FA5A 1L5LA 3UJPA 1AK9A 4WEQA 4JO1L 3ZDYF 3RWIA 2HL6A 3FOAA 2IYVA 4NNYB 5IQMA 3AXLA 4HS6B 2RSLA 3A3YA 3K2UH 3I3SR 2RGXA 4CU2A 5FHAL 3EVCA 2WYHA 1UMCA 3E4DA 3ND8A 2DLEA 1YDPA 5CU9A 1M54A 1QCZA 2JVJA 2PZJA 1E8XA 4X54A 5HMLA 1IK6A 2PR4L 2IWHA 4JCLA 1NW5A 4DJEC 3RIAF 1WAEA 5KQSA 3FGNA 1X87A 1BJ1H 1S1CA 1AIZA 2G3MA 1XIWC 4W7SA 5EU4A 1RJDA 1V1RB 2KBGA 1LB1B 2EKPA 2OZVA 3L4ZA 1BJKA 3QDJD 3KPNB 3B7SA 5F12A 4WY7L 2C97A 4ANXA 1XF9A 4R7TA 2FY8A 2Y76A 4K0RA 3FJ1A 2QVFB 1QQ7A 1K8ZB 2Q6LA 2YV1A 2YICA 2PYIA 4ABQA 4NF2A 4A8JA 4PJXA 3ESAA 3NAGA 4ZZ1A 1ZMBA 1GCYA 3SYKA 4YQFA 5JPNB 3ESCA 3U0PA 2R83A 1KN2H 3M4NA 1A5FH 2HB0A 4XM2A 3PIQB 5DE3A 4BE6A 1TE2A 2VDKH 3IK2A 3P4NA 4RZSA