4NENA

An internal ligand-bound, metastable state of a leukocyte integrin, axb2
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
1083
structure length
1063
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAADQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMDPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKTRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVALHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSESNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLCFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-X
total genus 235
structure length 1063
sequence length 1083
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 4nenA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4nenA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 4nenA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4nenA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4nenA02
1NA5A 2VDRA 3V4PA 5KYYB 3PPYA 3NIDB 5HJ2A 1JLMA 1L5GA 4IXDA 4G1EB 3HXQA 3EGXA 3QA3E 3BQNB 4JX0A 3ZDXB 1PD1A 1JEQA 1YVRA 1ZOOA 2IUEA 4O02A 3EGDA 5HDBB 4CNBA 2VDLB 5HGJA 4XW2A 1M2VB 3V4VA 1YVPA 2I6QA 4MMXA 5ES4B 1N9ZA 2QTVA 4MMYA 5E6RB 3VI4A 2VDKB 3K6SB 4WFQA 1JV2A 4WJKA 4WK4A 1QC5A 1SHTX 1UEXC 1XDDA 5KYXB 3ZE1A 1MQAA 2ODQA 3BN3A 4HQKA 5LN1A 1OAKA 1AO3A 4UM8B 1IJBA 1IJKA 3EG9B 1FNSA 5E6SB 4HQNA 3NIGA 3TXAA 4C29A 1BHQ1 4WJKB 3K72A 1DGQA 3K71A 2I6SA 3FCUA 2VDOA 3RAGA 1M2VA 3T3PB 3EOBI 2NUPA 2VC2A 1M1UA 2VDMA 4Z7OB 3NIFA 3FCUB 1TYEA 3ZDYA 1BHO1 3EOAI 2VDNB 3EGXB 4MMYB 4MMZA 2ADFA 2P26A 4Z7OA 2ODPA 2WW8A 3EG9A 1AUQA 4HQLA 4IRZA 1FE8A 4UM8A 1ZOPA 2NUPB 3PPWA 2ICAA 4G1MB 1RD4A 3T3MB 1ATZA 5E6UB 3NIFB 2VDPB 1U0NA 3EFOA 3F78A 1JEYA 1MQ9A 1IDN1 4UM9B 3IBSA 5KYXA 3ZDXA 3PPVA 1SQ0A 3VI3A 2X5NA 4G1EA 3IJEB 1MHPA 5KYWA 3K6SA 3VI4B 2VDKA 4FX5A 1AOXA 3NIGB 1DZIA 4Z7QB 1T0PA 3BQMB 4UM9A 3Q3GE 4G1MA 5FFOA 4C2BA 3FCSA 1M1XB 3T3PA 2WINI 4BJ3A 2VDOB 4HQFA 3N2NA 5E6UA 3HXOA 3HI6A 1LFAA 1L5GB 1RRKA 2VDNA 3V4PB 5KYYA 2O7NA 4HQOA 5E6SA 1PCXA 2VDMB 4F1JA 1V7PC 3ZE2B 1N3YA 3ZE0A 1PT6A 1CK4A 4F1KA 3PPXA 1MJNA 3M6FA 2B2XA 3E2MA 4MMZB 1U8CB 1MQ8B 1CQPA 2VDQA 2NUTA 4DMUB 3K72B 3ZE2A 1QC5B 2M32A 1RS0A 1TYEB 3ZDYB 3TVYA 3EH1A 2VC2B 2I91A 4Z7NB 3V4VB 2NVOA 1Q0PA 3ZDZA 4NENA 1U8CA 4UM9D 4PN7A 4CN8A 5KYUB 4IHKA 3ZDZB 3K71B 1M1XA 3FCSB 1IDOA 1M10A 2XWBF 1JV2B 4WK4B 3ZQKA 3EH2A 1U0OC 5E6RA 4Z7QA 1XUOA 1XDGA 1QCYA 4C2AA 1T6BY 1PD0A 5KYWB 2VDQB 2NUTB 3VI3B 4NEHB 2VDLA 2XWJI 3TW0A 5HDBA 3ZE1B 1JEQB 3EGDB 4M76B 1SHUX 4A0QA 3TCXB 1JEYB 4Z7NA 1M2OA 3EFOB 4WK0B 4IGIA 2XGGA 5BV8A 2VDRB 4CN9A 4MMXB 4WK0A 5FFGA 3IJEA 4JDUA 1RTKA 4WK2B 3F74A 4O02B 3T3MA 1MF7A 5KYUA 4WK2A 3ZE0B 4NENB 1ZONA 3NIDA 2VDPA 5KYNA 3GXBA
chains in the Genus database with same CATH superfamily
2WYOA 1G6RA 3D09A 3H1ZA 5KYYB 4LVOC 1CT8B 3OLZA 1Z74A 2P7IA 4KQ3L 1QSFD 3VAAA 1TZBA 4YJ3F 3QFJE 5EWIH 1G6OA 3I7OA 1FLAA 2BMWA 1JMYA 4L9OA 1OAZH 3H85A 1RJEA 4AKIA 4J0XA 4K0KB 3BHNA 3CMGA 4R1QA 5IMLB 3REWB 3EPKA 3K6DA 4EKDA 3BJMA 3OKLA 1LLQA 4RIFA 1FORH 2X3UA 2W5UA 4OATA 3PLYA 1J2YA 2V59A 3AERA 2NXZB 2A7BA 3OIVA 3VZQA 3QP3A 1XL6A 1T9KA 4WWKA 1ECLA 1FVEA 1M7XA 1XFPA 3NSFA 5D1NA 1BPLB 1EXUA 3HDJA 2HFKA 5EHIA 3JZDA 5ALMA 4MFHA 4AO7A 1EA9C 3QT2A 4L5FL 5T4BA 4OW6A 3KSAC 1AGXA 5E38A 5J06A 2C9MA 2W9XA 2CFOA 3NTQA 3SC2B 1H6EA 2CO7B 4MCYA 5LGJA 2HYEA 5B3NA 1BZOA 4NYMQ 4I0PC 3PV6B 1MW8X 1SMDA 3PRJA 3QUMH 1D5BA 2Z8SA 3KKQA 1HXHA 3D3VB 2ZRLA 1YJXA 3L3OB 1HSOA 2CJWA 4UMEA 3ARFC 5DS2A 1NAHA 4KGZA 3IUYA 1VRWA 4M1KA 4JPIB 1O9WA 2IDCA 5D96C 1FFOB 1UZUA 3ARXA 3PIIA 1DRWA 2MQGA 3PAVA 1GA1A 3OC8A 4AG3A 3CFEA 1N75A 4BEIA 1A7KA 3ME0A 3HW7A 4E7PA 4ZDIA 1FW6A 5E2UH 2P41A 3KGUA 1L9OA 2O2ZA 5LZ5A 1W1UA 3W2DH 2C07A 2C5LA 3UFXA 2GNPA 4K3UA 3BESR 3BPCA 2WVGA 2P65A 4HWTA 1COBA 4L8YA 5IOPA 4HA1A 4CDRA 4NKDB 2IBTA 4PJIA 3SC2A 3HNPA 3ZX5A 2QQNH 3IDUA 1M2JA 2OLDA 3JVGA 5AHXA 3ML1A 4QTTB 1BXUA 5IQOA 3H1AA 1M6UA 3QZNA 2FJFB 2J57A 4A2WA 5AHWA 1QHNA 4PQGA 5L4FA 2CMDA 5F9MA 3QXAA 1URPA 1JR3A 1PT9A 3I9GH 2R44A 2WUDA 4M9RA 4JXJA 2WINI 1BQHB 1WU8A 4N6QA 1GQYA 4YDZA 3VXQB 3V6LA 3JD1A 3SKOA 2IADA 5ELIA 2H08A 4NJEB 4G4SP 2FFQA 3I39X 2RI0A 4RPHA 4HRAA 1OSPL 3UV7A 1S8AA 4LSZA 2Z58A 2WM0A 4JQVC 3A3PA 3I89A 3BE1L 3DXAA 4KTYA 2WP8J 4KK6D 1OZUA 1MFAH 5FFNA 3MRIA 3DDOA 1QCYA 1SOKA 3ULUF 1OZHA 4GO8A 3FGOA 1Z82A 3EXIB 3DV6B 4Q1FA 3FTPA 1XH1A 3JZMA 2J87A 10MHA 3FH7A 1G7IB 4TLCA 2X40A 3QY9A 4Z95L 2ET6A 4RZHA 1YFZA 2XA2A 5KPJA 3BZWA 4Q9RH 4M0CA 4XMVA 1O5PA 3DSFL 1ACXA 1SD2A 2AK4D 2HHCA 1QANA 5J1AB 4TMWA 3RGVD 2AJ3A 3GI9H 2E9BA 2VJOA 4R2XA 3MNWB 4FQQB 4I5BB 5E8PA 1G55A 1V54B 4ENZA 2VPPA 2CGRH 4LMQE 3WKEA 4Q6IC 3T4AC 3HZOA 2CFSA 1O94C 4RGOH 5DUPL 4LI3X 5AKXA 1XNHA 3KDSE 1V3KA 4Z7OA 1M53A 3IBOA 5CDYA 3I1JA 2Y6TE 3DTVA 4NBRA 4I3SH 1VBNA 3VCLA 1WCIB 5KKNB 4OU4A 3TYGL 3BAEL 4ZVQA 1IBKB 5JAOA 4O3MA 1MZYA 3ETLA 3KHUA 4LLYA 2JAPA 4LBEA 1IG3A 3H9SE 3M17A 1S6YA 2CYAA 3LOQA 3SZLA 3DHVA 4LC1A 1FFEA 2G75B 5HTKA 2WTRB 4L8LA 3LHSA 5BT9A 3AO0B 3WN5B 3HCVB 4QXRA 5GHWH 2R69A 4YRLA 3JXAA 4S1SL 5BZZA 1KN2L 3C6YA 3HG3A 2VVTA 2O2XA 1D5MB 3B3GA 4UQEA 2R8EA 5ADVA 2H7WA 4F7KA 2XOKD 3CQQA 4JG9A 4LE8A 1ACMA 5DN6D 3MD0A 1C12B 3C6LC 1CQXA 3M3HA 3UTQB 4AYTA 3IPEA 3G82C 4R7LA 2IAMD 2OBNA 5JXAL 4FDLA 1CRQA 1MF7A 4BVKA 4RO0A 4DQKA 2XXGA 1NYRA 4QPJC 3G6AA 1LBQA 2IEYA 3VXQA 3BQNB 1VJRA 2GPZA 1E5QA 3U4KA 1M71B 3IJYB 4WO4C 3ONDA 3RIHA 3K6IA 1RUKH 2F08A 2P9HA 3BN3A 3IMSA 1EZZA 4CU8A 1FNSL 2QDWA 2C26A 1RLMA 2CDNA 4JRYA 5HKBA 2IXBA 2BKVA 4JPVL 3HZRA 4AL8H 5DI9A 4S2UA 2OTCA 4UE3S 3KWVA 2VN8A 5ALCH 4D9LL 2EDYA 2JVKA 5JEEA 3US9A 2XG5B 1A1OB 4NQDD 3OZAA 2Y7MA 3WB9A 5EAIA 2ZWZA 4QBTA 4K9PA 2YRFA 1RWBA 2FJFA 1M6WA 1LTHR 3BE6A 4CIDA 4DLXA 4EVQA 4X61B 3PT5A 5C09D 5AI8A 4GI8A 5F7LB 4RA9A 4EEEA 4MLIA 2CFTA 2R39A 5TVGA 1W8EA 1E1QA 1CXIA 4PWGA 4FGWA 1T0MB 4UDTB 4QHPA 4Q2ZA 4UBLA 5BSGA 3A6JA 4RWYH 2D7DA 2PMEA 3B7SA 5A5VA 1VHQA 3IP3A 1U5CA 3VR5A 1R46A 3BI9X 3O90A 1D7AA 2FWPA 4MGKR 3E5MA 5E23A 3AI3A 1U8MB 3WEMA 4ODXA 1P45A 3AUTA 3E2PA 1H3PH 3L3JA 2ECQA 1AQMA 4DLNA 4G72B 5EC2A 3ZIAD 1JFHA 2ZAHA 4YDNA 1P9MC 2ZRIA 4F1ZA 1U3WA 5AVKA 5A6IA 5C07D 4HH3C 4P48A 5IJ0B 1JPVA 1PAUA 3C6MA 2CUNA 3U80A 5FO8A 3WS3B 3IIYA 1I3RB 1EXUB 3W7AA 3KJ6H 3IRZA 2B8OT 4GKZB 4PW3A 1ZDQA 5LBTA 3V0WH 2WXIA 4ABWA 5L88H 2YAOA 2WIJA 2L7UA 4P2GA 1ZGGA 3PJGA 3PLAE 4OB7A 3W6NA 2M2DA 3G5XB 3MIZA 3PRZA 4R4FH 4ZZFA 3KS0H 4FS0A 4UJ5A 3QDGA 4JAMB 1F0NA 5KCMA 2ATPA 1AD0B 3Q12A 1AMXA 4J43A 4DA0A 2FPOA 2JLAA 1RPKA 2P35A 5A3IC 1QZ1A 4A6YH 1F56A 2W60A 4P9MH 1QR1B 4BGDA 2UZXB 3G49A 4PGHA 1O0CA 1JNNL 4I5EA 4W6QA 3DBHB 3L0SA 3ARGB 1OO2A 2Q2EB 4QYTA 4HGYA 2MEJB 1X6LA 1B4LA 3EBLA 1KZ6A 4HXBL 2BY2A 2F5BL 1S3FA 4BGIA 2CFCA 2ZROA 1UBJS 4HVLA 1KNXA 5HHOB 4RIRA 2C3VB 2GAIA 4JT6C 2XWCA 2YWRA 3HUUA 2O61B 4IWYA 2R66A 4AURA 2HTEA 3PDIA 5ECJE 3WGJA 5EU7C 3AT0A 4PO9A 5ISMA 1USVA 5IW1A 3P20A 1COWD 4PBTA 2QQEA 2WF8A 2P7TA 2Q3EA 2ZCKL 1W0KA 1L5GA 4X6EB 2K70A 3Q1KA 4L5BA 1ZMTA 1X7YA 4GOND 2WWMD 5IVNA 2X6AA 1CUCA 5JYMA 1UM9A 3IT3A 1A64A 5SYAA 1BVLA 1ZJ6A 3LFUA 3B6SB 3STVA 4J9VA 5LP6B 4RVFA 4F21A 3K0EA 2BFCA 5DJ8A 1SQGA 1IOVA 5IT0A 1TUPA 3FCUA 3V7AE 2Y2VA 1MOPA 4LZZA 5ESXA 5LHDA 4P2BA 4GVPA 4JHAL 2X13A 4KI5C 3OQJA 3MWDB 2XI9A 3ZHUA 3ZHFA 4QHLB 3C7AA 1T21B 3MPUA 2AMLA 1XVTA 3SJ7A 3BB1A 1UINA 3E3OA 2O8FB 3FNRA 4GX1A 2IITA 1J1OH 3MERA 5DWUL 2JLPA 1HNYA 2GYVA 5JSQA 3QWIA 1JMZB 2HN7A 5A16B 5EG6C 5C92A 3D7SA 2PWAA 4URWR 4KGXA 1X1EA 3NCXA 2ZJYA 3QVXA 3WTBA 5MEPB 3WYAA 4R7VA 3OKEA 2FLVA 5FUZL 2E18A 4UAVA 2FR1A 3FT9A 5DW0A 1F7UA 1IONA 4DBLC 1PQ4A 5ANHA 4D8XA 3GXMA 4EF4A 1AAJA 1U93A 3KCQA 2JFNA 4MAUL 3L7DA 3D81A 4E5PA 4KQ4H 1G0NA 4JIGA 3P2DA 1NZJA 1JPGA 5D7LD 2W6MA 1HM5A 2ERCA 1JXMA 4RZ3A 3EVTA 4URUR 2WD0A 4BCXA 4U1KB 1Z9SB 3IPAA 1EEZB 3MO1B 5IVZB 1P9MA 4UVIA 3IOMA 5CCBA 3RSEC 1YOBA 3LX5A 4HCRH 3LZQA 3BL8A 4HXFB 2CXUA 4HEHA 5K45A 4LJLA 3ROLB 3MLZL 1EHLH 3A36A 3PIDA 1U7ZA 3HWX1 4U2BA 5F33A 4ZW8A 2PMFA 4EKYA 2X2UA 3T65B 5CSBA 3WLKX 1ZNWA 5KDOA 2WUGA 3MF4A 4HZGA 3O4GA 3IAUA 2C94A 5HCUA 4IRJB 1S9DA 2J07A 5MI0C 3QF7A 1ZAYA 1JAHA 2A6DB 1NIAA 3WTCA 4JR9L 1NX9A 2WNSA 3T7EA 3HP4A 1J1XL 5E51A 4LU5L 3W5SA 4NQED 1TZHB 4NUPA 2I2WA 3CUUA 3E9DA 3K9GA 2YIDA 3EO1B 2YFHA 2J8UE 4HLZH 3V6FA 2FETA 3ULAB 4UQ2B 1MOSA 1WB5A 4MUJA 2I6XA 4KFMA 4M7LH 2JCCA 3V1MA 2HU7A 2GJ8A 2Q3ZA 1XMJA 1SVIA 3DO4A 1BHSA 3MRJA 5F3HA 4A7VA 3T4PA 4P46B 3UHAA 5FYJD 4GZ5A 5FM5M 5HCIA 1FGNH 4G9DA 1V27A 4N8UA 1EP3B 4E3ZA 3THYB 1KF9B 5L3SA 4DDUA 4RM2A 3UPRB 1SQSA 3KVNA 4A92A 1X15A 4UHJA 4JSVC 4B85A 5C37A 1KCRH 4EI5A 5ALWA 1BAGA 2DQJL 2AJZB 2GPBA 2V5SA 1BZ9B 1C5DA 1CK0H 2CLEB 4Z4FA 4DWHA 1T2NA 4WLNA 1I7RB 1DTUA 3DOIA 5FYLL 2TECE 3X1MA 2XPCA 3GUCA 1IO4C 3ZIDA 3IGKA 4WFKA 3GA0A 3K6RA 2I76A 3I2CL 3MRMB 4N3GA 2BNRA 4N87A 1KBZA 3EVFA 4C3VA 1NCBL 5FBQB 1EFPB 4RVGA 4K8RH 3BEOA 4K3JL 5AAMA 1ZD1A 3TSCA 1PD1A 2IQIA 4K73A 1M2NA 1VJ1A 5TS2A 2R1UA 4IFIA 1KMQA 3EK2A 1H9DA 3PUJA 4NZMA 4KNWA 1XYYA 4WASA 5KANI 3FVTA 2Q7OE 2OJEA 5EO1A 5HUHA 3Q8MA 4X4MA 5JT1A 2JGFA 2PWHA 1Q2XA 3TLXA 1KCSL 4YJHA 4ELKB 4QXPA 4XRGA 1K8IA 4JDEB 2A5UA 4MA4A 2C42A 4XPTH 1CWVA 2PKYX 1ODFA 4CM8A 1J5EB 1S2MA 2HBQA 4CKYA 4RHUA 3VC7A 5DXAA 5F7BA 4BASA 3NABL 5CXPA 2HDWA 5DTIA 3VXUA 1XCXA 3K2KA 1O5TA 2HXGA 1JZJA 3JCZA 3LLSA 4KAFA 2WJYA 3PHGA 4JI8B 4I85A 1NQ5A 3LB6D 2AFIA 1M34B 4HNTA 4XNQA 1D9KC 1LSJA 1JSXA 5FBLB 4ZSOA 1VKZA 4WI3A 4NZRH 3CFYA 2XXBA 1PLGL 2P49B 1U0BB 5CO1A 4G1CA 3US0A 5A1JA 4DTGH 4ZXBB 1KDRA 2IYRA 1FU8A 4BEBA 3FU7B 5DMYA 3EXG1 1FG2A 3LKOA 2L2QA 2FT6A 3SQOL 4ZFQA 4UQ3B 2DRIA 4YGAB 5L4NA 2Z6UA 2WXRA 1EJOL 3VG9C 1QUFA 5EUKB 3QYNA 5E4AA 3T3MA 1XCPA 4LJRA 3ATAA 4WI2A 1BVUA 1LBEA 1HMPA 5JOPD 2QG6A 1J87A 43CAB 1K6QL 3VFSA 4XGQA 2CJXA 1Q9WB 4YONB 2A9NL 3RO7A 2PUFA 1S7QA 3O3EA 3PF9A 1K8ZB 2FO4A 1BXZA 2Z31B 1IY9A 5IAJA 4K3VA 3BEDA 2Q20A 3M83A 1FO0B 4H44C 5LP6A 1QZTA 3FKSD 2F8SA 3KLLA 3P0GB 3MBEB 2FZGA 5TQ0H 2NXYC 4PMFA 3AAZB 1RWWA 3MCKA 3EDMA 5DMXA 4WMLA 3WS7A 3H1TA 1GU0A 3WJMA 1CS0B 4XPTL 2DTEA 1U21A 4A67A 2E6PA 2TMKA 5EEGA 1NNI1 3JTMA 4X1KA 5HVHB 1L1QA 5DWVA 1G4HA 3PWZA 1ZM3A 4ZAKA 4ONHA 1P7QD 2J71A 3S4YA 4AQEB 4L0ZA 1IQRA 1RZ3A 2EZTA 2Y1AA 5F6HJ 4RBNA 5DD6B 3L5IA 4CDMA 3ND5A 1B43A 4BFLA 1CGSH 3MYZA 3UK0A 3L1OL 3S29A 2C31A 1U9IC 3PFGA 5EJ8A 2GRJA 3MMPA 1S7QB 5CB6A 4Q48A 1KF0A 4JPKL 3JV6A 4XMKL 3DAHA 1Z5LB 1Y80A 2ZOSA 4QDZA 4PG5A 3QVAA 4YQZA 3RIFF 2DHEA 3RVNA 2PVPA 2UUAB 1WXGA 1G1CA 3NCJL 1EX7A 1D3CA 4DQOH 1AXSB 5LNDA 4O59O 1N5AA 3RSQA 2PKQO 4D8TA 1DADA 1UC5B 1X74A 2YC2C 1M1NB 1JL8A 2Q76B 3O6KH 4NG4A 3Q72A 4AQEA 1JKIA 3V8VA 3VXME 1YSCA 3JV6B 2IV7A 2VJNA 5JWRA 1LPSA 3VOBA 1KJQA 2XX3A 3GSOB 4LJSA 2W0MA 3QUXD 2O5RA 2FE0A 4GI1A 1RABA 4BAUA 3NIFF 5IK3A 2WC1A 3OQHA 1P1VA 1L5QA 5K19A 5EOVA 4Z6KA 1CDIA 4M7RA 2P26A 4GQBB 4DIUA 2YWZA 4AMKL 1Z6ZA 1E5BA 2HHHB 4NFYA 1GTL1 5ID1B 2XB9A 4U3HA 3EW3B 2GNQA 1GG2A 1HC7A 4OHPA 4DRXB 4MV8A 1E9SA 3U82B 3VGAC 2VCOA 4KO4S 2PR7A 4OJAA 1Y1SA 4KXWA 3WRXC 4JP8A 1THGA 2WC7A 4BQEA 4AOWA 3E4DA 4AULA 2O8NA 3T3DA 4IGFA 5EM2B 3B9DA 5T6MA 3UBMA 1VGEH 1W76A 4WLFA 3RS8A 3WMPA 4BCBA 4M8IA 3GRCA 2XDAA 1X44A 4P2RE 1OZFA 1IH8A 3PDHA 3BTOA 1NSNL 2V3DA 1VP3A 4Q12A 4D9FA 1Q94B 4RCAA 4HJRA 2V7QD 5F1OA 2F48A 4XWYA 1XCMA 4Y2HA 4S1VA 4W68A 4NPHA 3DKVA 4JHUA 4MI3A 3WJ2A 3K94A 2IBBA 1P3JA 2JAXA 4IS2A 2AGZA 5EOCH 4L8SB 5CBPB 1FZKB 2ZP8A 2DQGH 3WOVA 3BGWA 1XB2A 2RH5A 5JHHB 3CX2A 3FU7A 5EIIA 4RVOA 4A82A 1SNYA 5HJBA 1B8VA 3CV5A 4DKJA 4IF6A 1AB6A 4NBUA 2HMVA 1U3HA 3L0PA 2R7EA 3APDA 1WXFA 4P7GA 3GEPA 3AB8A 5CH3A 5HKAA 3ESYA 1ZU4A 3MRXA 2BZ7A 3NCEB 3P0VH 4IJVA 5F7DB 5F0LB 4QGBA 3G6AB 3SE9L 3TBBA 5SICE 3DURB 2Z2JA 3TLBA 1DZ3A 3IFLL 4B45A 4CWAA 3GXUB 5JJBA 3UEZA 4GYWA 4WFEE 1IL0A 1GGEA 3WY2A 3QFTA 4U1LB 2DVMA 4DP8X 1GGMA 1Q0YL 1EE2A 3RHSA 3PNRB 4HYQA 4PRHD 5DCWA 3BQMB 2JGIA 1X5AA 5ESRA 2VLRD 5M5RA 1UM8A 2QPFA 1ZA6A 3RE1A 4EKNB 2ZXQA 1TZKA 5F78A 2O05A 3IKTA 2GUOA 3RDPA 1KB5A 3NAAL 2J32A 4PLPA 4IOSA 4WJ5B 3T95A 3G5TA 1AZCA 5DSXA 1T3LA 1CQJA 4AUNA 4K8RD 5K9QI 4IKPA 1QMGA 3CGGA 3WL7A 2GLUA 4CGZA 2VDKH 1BOGB 3Q2NA 2CV2A 2OQVA 4LBEB 5SV2A 2Q0SA 1T1EA 1DDGA 3E9TA 3BZ4B 2L17A 2DQHL 5AW3B 4HSAC 3V33A 1JBKA 4GIAA 2Z6VA 3QDGD 3PQYB 3BKXA 3D1JA 3OZEA 4X99A 5JSHA 1V6CA 3F12A 3ZSSA 3IGAA 5REQB 4CF5A 2QRJA 1F41A 4Z8FL 4DGIL 1NL3A 3EO1A 2EIJB 4XIJA 4FFWA 3EASA 3AQDA 3MHZA 3LAWA 5B57C 2DYPD 3ETJA 5ITFA 3EIUA 1A47A 3M2TA 1NJ9B 1Z4NA 3EMBA 1GKOA 4K15A 4JN6B 4M5YL 4RHXA 4IHOB 3P0VL 5EU5B 1A8PA 1TK2A 2NXJA 2QZ5A 1CUZA 4AK2A 2VK8A 4F7EA 2WVVA 4CY1A 3T5BA 4I48A 5H94B 3M2PA 3E8XA 1JEYA 4QT5B 4JJ6A 3TTYA 1DHRA 3FCYA 1I7SB 4M6OL 2FZVA 4UTBL 1KK2A 1IX2A 2GTZA 1N6NA 1WAPA 4NDZA 2RHJA 4UU0A 5JPNA 3HCRA 3INYA 4CW7A 1L5MA 1SR8A 2BE9A 2H6NA 2EIEA 4F12A 3C09C 1UM6H 1TD1A 5DGIA 1T66C 3LQFA 3FU5A 1U2PA 2Z08A 4WESA 1IAOA 2V7HA 5IVDA 2VLMD 1J5DA 1TYEB 4IL5A 1NP7A 1IBZA 3HS8A 3CA8A 4HUKB 1QHSA 1EK2A 4OG2A 1E27A 3SEZA 4P5MA 3AKZA 4DVRH 4G5RA 3PWSA 2AXFB 2PW1B 2BDEA 1QHGA 4E41B 3BOVA 3K8KA 4NQDA 3H7BB 3MRFB 1KGDA 4LXHA 1STOA 3N07A 5JG7A 4F9GA 2QVYX 1SFHA 3T3NA 4A2EA 4YXKH 1AMYA 3BVTA 1FF9A 1K86A 3CZFB 4JOSA 1MRCH 3KQMA 4KXBA 1FNAA 3U46B 2X9XA 3HXQA 2GYSA 1UKTA 3EGDA 4JRYD 1SOWA 4XB8A 1AE6H 2R2HA 1YNKH 1YFJA 2OBXA 4LZJA 1WKBA 1ILUA 1NCGA 4WK4A 2J56A 3EA0A 4Q1EA 4LZPA 1OSZB 1F48A 1X5IA 5JA9A 4GEIA 1JZ4A 1A9EA 4JT2A 3L8FA 4PC6A 4B3SB 2DRUA 3KBHE 4HXYA 5JS7A 1AC5A 4N90D 1CGTA 3FCUB 1DKQA 4P3PA 1SCAA 2CB0A 4LLWB 1NEUA 1JHTB 1JK8B 4PE5B 1DKMA 2IAMA 1SJEB 4NN7B 1I7TA 4KDWA 3VXRD 1XF2A 4CY5A 2F9BT 3A6HA 2HWUA 3JYHA 1YFLA 4ERZA 2I3GA 3UK1A 5EOCJ 4NFSA 4RFNB 1AO0A 4ZSOE 2A0LC 5DE3A 3TLGB 4X64B 2ZJ3A 2ZWIA 5SX5K 1AQDB 4K2UL 2JFXA 1KAQA 3CKLA 2P24A 3ANLA 4DKAA 2LZ0A 1G9NH 3OKYA 2Z4TA 2O61A 4CUCA 5DD3L 3PD7A 2ITDB 3TL3A 3TZKA 1GRRA 2QL6A 2Y5TA 3HS9A 4NI3A 4R2GC 1E96A 5HY9B 5AOAA 2HWKA 2GFBB 5EHNA 3IJ7A 4GXFA 1LNSA 1W88B 2CXRA 3JWOL 5GJTH 1DBRA 3TSZA 1LE5B 3MJ7A 1HF3A 3LFTA 5CM8B 1CYXA 1N57A 3O3AA 4DR7B 5I76A 1L7TH 5AW9B 1VCMA 1JTPA 4WWKB 1TAQA 1AZNA 4MMXB 2PXCA 1DJLA 3QJQB 2IEPA 2W6IA 4U4BA 4JEMA 3MSPA 2ZT7A 2YH2A 3UCQA 2OJYA 1UATA 1X70A 4DCPA 5D1ZC 4PW4A 5HS4A 3MCTA 2LLNA 1CZHA 5IG7B 4R84A 2VC2L 4N6GA 4KUGA 4R1TA 4UBKA 4RW0A 4E11A 3IJHB 1EYZA 3QDAA 1TTBA 1J12A 3Q2WA 3WLBB 1XRMA 4MD5A 4BC1A 1W72L 3BAWA 4S2EA 4F0JA 3NHKA 3V0GA 1HH6A 4OUOA 3SXUB 3MLEA 5GVSA 5JAIA 3TOSA 4HH0A 4M7JL 4WRLA 2JQMA 4PJIF 4BLQA 1XMVA 2I8CA 4YRTA 5KQMA 2PM9B 4R7GA 3QI2A 3UGUA 3CHPA 1VG1A 2IBGA 3FQRB 1OWMA 3H5RA 3WBKA 1NFAA 2H2AA 5CW1A 4CY3A 1ZT1B 1EU1A 5EZSA 1XIWD 1OBFO 5F6IB 3P4OB 3KUUA 4NZUH 1G7PA 4ORGB 1HZKA 1ENYA 3O8OB 2IPXA 4GAYB 3I76A 4KP7A 4XQEA 2J3KA 5SWSD 4EITA 3WFZA 5I5GA 3FCSB 1NCAL 5TMEA 2V9CA 2WBJB 2QY9A 1A0QL 3IO5A 5FHRA 2V5VA 2YXWA 5TGBB 3JWDC 3ZYZA 1ZRHA 2JHCA 1IU9A 1SHZA 2Z64C 1WQ4A 2O6LA 2WMNB 1KU0A 5GSAA 3H3PL 2YFOA 4PLZA 4YWGL 4RANA 2B1AL 5ALIA 3OB0K 1S2EA 4N68A 2CJUH 2PZGA 5K0LA 3A6CL 3BGVA 1FVCA 1V5IA 1ZLSL 4RTQA 1O9BA 5SX4H 3FUHA 4M7KH 4PJHE 2CE8A 1IC4L 4ZT1A 1BXAA 3A37A 4BFTA 4O9DA 2VN6A 4CI2A 1XNRB 1B88A 5L9AA 5T5QA 1R19A 1PWXA 1NYQA 4JFAA 2Y24A 1QK5A 4KO7A 1R8JA 1LK2A 2COEA 2IH3A 3QUAA 3PNBA 1RC0A 4D3XA 2WQUA 1KGWA 1FNDA 5BZXA 1Q7CA 4PFQA 8ATCA 2BMKA 4RMHA 4OD1L 4IYKA 2AE1A 2C7QA 1KC1A 1VLJA 3RAEC 3EXHC 2GYUA 3STHA 3S5LG 1WCWA 5EUOB 2GYYA 4JROA 4LK4A 3RY5A 1WW3A 3V4SA 5TF1L 3R8FA 5M2QA 2FH5B 3FYHA 2X4DA 2Q9BA 2YICA 3S1AB 1QG4A 3KLSA 2I91A 4DGVL 3LO5A 3F6SA 4F3KA 4F6RA 2CQVA 4P7JA 1KAGA 5HQTA 5H4YA 5LBUA 3CFUA 3ISTA 3FRPB 5FHBH 4OZIA 3CLRD 1B74A 3MTBA 5E5MB 2Z4QB 2E46A 1HLGA 4DKXA 1KI4A 1D2HA 5GS2H 4YFLF 3US1A 5F1NA 4MCMA 1IWPB 2PA3A 1WDAA 2QRVA 1GVHA 4J16C 4P5TD 2UVPB 2EEFA 3WA6A 1EXHA 3H8NA 1PI6A 5I30H 1C41A 1TTTA 3CC8A 3LEYH 3CH7A 3K15A 5E7JA 4H8QA 1NGZA 3EO0B 2OCGA 3THML 4LAQL 5SWZA 1ZKDA 4FQJH 4O0MA 3WIHA 3TRJA 3VSBA 2UAGA 1AO7E 1CNMA 1SKAA 2QR0A 4DMKA 4QPEA 1KTDA 3I02B 5I16B 3DX7B 4B7AA 3Q6FA 4LLQB 2EQDA 3W0LB 2KHAA 3R5HA 5EOQH 1E2GA 1UPUA 1C0PA 2YWXA 3SDAD 3C3EA 2AKAB 3NFPB 1GCFA 4LOFA 3DYVA 3F6CA 5BWNA 2ATKB 1OH5A 1GSOA 1OFTA 1O95D 6TAAA 4XWOA 2QMUA 4JO2H 2OV3A 4H1LA 5IMKB 1T80A 1Q11A 4QRIA 3ORSA 5JCJD 1Z9LA 4D4HA 3A2NA 5FEUA 1T0UA 4XQ9A 2CDGB 3MNWA 3GJSA 4RTPA 1OGPA 1RP8A 2P5YA 1ZOXA 1CHDA 2HG5B 3U1SL 2V6BA 2A67A 1AKQA 3C6LA 4WUUB 5DO2C 1A3LL 3NGBC 2SECE 3OMNB 3ZDZB 4YDJA 2AYYA 5KSVA 4H7DA 5LJYH 2A94A 1I4TD 3FFOA 2DUJA 3RVLA 2AR9A 3AUFA 3MA9H 3GDFA 3GEIA 1A5ZA 4IK6A 3F67A 3AHIA 1IXYA 2FT8A 4V38A 4GG6A 2V6GA 3ZWPA 1PVHA 5CDFE 3B3IB 3O31A 3JV4A 3CFBB 2ZTUA 5E5UB 3BVDB 3BBPA 4BNXA 3U7WH 5IHHA 5L8KB 2Y3IA 4DV5B 1N2CE 5C8XA 1R7RA 4IP0A 5BUQA 4RHTA 3ACDA 1DTWA 2G08A 2Z1KA 4HHWA 1Q7TA 3TSAA 3CXHK 4PJIB 2OVBA 5JU6A 5LR6A 3AOEA 3NETA 1WDLA 2VHZA 3NHFA 2C0QA 4BE4A 2UYOA 4GM1A 2ODPA 1XGRB 2EDCA 1O94A 1UWYA 4RKYA 1ULVA 2A1IA 2CJ3A 4N2LA 1NNUA 3NBZC 4N0QA 4G2NA 1C8LA 2Z2XA 1T1WA 4QJBA 3KFVA 2WWNA 1H69A 1T3HA 5CHNB 3VB8A 3PWPE 2Y36H 4NN6C 5EBMB 3AI7A 3PNLA 5IF3A 1X86B 4PTUB 1SHSA 3OZLA 2E87A 3EYUL 4LSRH 2HUNA 4IFBA 4ZQBA 2A6KA 4RNRA 3MHTA 1ICEA 3JD3A 1CD5A 2VLJA 1QB8A 1GP2A 4J3OC 2PIAA 5JOPE 3V0EA 4EOWL 3CAFA 3DHEA 3WCYA 5E6IC 4YY3B 4Y89A 4BCZA 4LSVH 1KVUA 4UBIA 4M37A 5BP7A 1O8CA 2VLKB 3P1JA 4J49A 4R90L 4FXLA 2QT0A 5IGXL 3L1OH 1A1SA 4BK8A 4BWWA 2OULB 2MIZA 3UCXA 3AACA 2I3DA 4CZYA 1C14A 4M5TA 3P4FA 2PX3A 2ZJ8A 1G6VK 1FPQA 1R5IB 4JFOA 2MTAH 1MFBL 3MUZ1 3ZVKA 1T4KA 1H85A 1OH6A 4NBWA 1SC3A 2ITEA 1A3RL 1W29A 3IE2A 5K4HA 2R11A 4TKUA 3LBFA 3FTSA 4CI0B 3QR2A 2EV9A 4WX2B 1CHNA 2VXOA 3RI5K 1OXTA 5HDWA 3EW7A 4OQNA 4GPAA 5FBHA 3EZYA 4PP2B 3ZCRA 4EN3A 4UMFA 3OTIA 3RUGE 3SSGA 3ZZNA 1I8MA 2LXNA 4U2FA 4M03A 5ALOA 3CUTA 3AUYA 4N6NA 3MWEB 1RXSA 3ZW8A 4B95C 5F9WC 3IDXL 2HW8A 5J56B 5A2IH 4EA6A 2FWJA 4GPD1 1D6VH 1M7BA 2Z09A 4NN5C 3P96A 4P22A 4BK5C 1WBBA 5C0DB 4DQVA 2VXUH 5SY9A 2X22A 1FF5A 1A5FL 3AR9A 3QVGB 3BF8A 5C0BB 2VRQA 1OAKL 2VRNA 4G9FA 5KYWB 1SIUA 2XZLA 1TZAA 4Y0GA 1R8SA 4GIOA 5G1NA 1DBBH 2C4TA 5BXFB 3PFQA 4WJZA 4NH0A 2ETXA 3DOSB 3IE1A 2OM5A 3VDXA 5GONA 1JNYA 4OF6A 2OKGA 3QWAA 2RCYA 4AMVA 5CILH 1SEQL 1N9ZA 5JY1A 4EW2A 4FYPA 2PD4A 4AIRA 1CD8A 2JBWA 3K5RA 1ZHLA 1J49A 1OXUA 2YRWA 3CUVA 3E80A 4QJ4B 5IB2B 4A66A 4FEYA 3G5ZA 4MAYB 4XUDA 1UOLA 3QUGA 3S37H 1YDEA 4OCWL 2XHNA 2LU5A 1PKEA 3MV7E 5L3QB 3G17A 4K0RA 1M73E 1KK3A 4NQEE 5EQTA 5AW8A 3WXBA 5AW6A 4EB6A 3HPJB 3HVJA 1TZMA 3U3KA 3RN0D 1X3DA 4B3TB 2D73A 4D4JA 2HO5A 3PICA 1F51E 1IGTA 3KT3A 2FP4A 3UIEA 1EFTA 2B92A 5FLYA 1R3IL 1TEFA 4TQPA 2GC7A 1R0XA 3UJDA 4MWZA 1BEYL 3BVUA 4DR2B 1E6OH 1UWCA 4PJXB 3BWVA 1MQ8B 1G3IA 1UMKA 1D9XA 4QFDA 3ZKMD 1HZHH 1QPGA 2NVOA 4QT0A 1NBVL 4LAQH 3RWHB 4X8JA 5FPKA 2G71A 1BYUA 1Y48E 4RDXA 1T2XA 3ZV7A 2JK0A 4QKTA 3HKDA 3L9EA 4YAKA 1FFYA 2PKXA 4AN0A 2Q8BH 3GU3A 2GA8A 2Q5JA 3I4FA 1EEHA 4EHBA 4GLLA 4B46A 4YXLL 4MJLA 3L16A 1O6VA 1NUGA 3PE9A 1IHDA 2WQVA 2A5JA 5J8OA 2OHGA 2XSZD 3CCBA 5DT1L 4LLVA 2AJVL 4JO8A 3EGOA 1JA1A 4D9MA 4J6FA 4CEJA 1ZH2A 1BMFA 1YUHB 3FQYA 1YJ5A 5BV7B 5TDHA 1HCVA 4LPCA 4XX0B 1REQA 2RKOA 4TWAA 3F3SA 1I9CA 3OPYB 3L5XL 5FNZA 2I3AA 4MI1A 2JGNA 1IVNA 1BZ8A 2CUIA 4EYEA 3WS6C 3LLVA 3CSGA 2Y4OA 5CEEA 5C0AB 4BXOA 1OAYL 3BW9A 4IRSA 1JK9A 3ZH9B 5H70A 1L7AA 1TQSA 5BO5A 4A9AA 3HJCA 2BS8A 3HN2A 3C2QA 4BNHA 2KWIA 1BS1A 2WM9B 3DT9A 4XVRA 1A5BB 2HJ9A 3H5VA 2QLMA 2AQ1A 3SM9A 4PWFA 5CN2A 1IAII 3HMWH 2AK1H 2R86A 9MHTA 4HAZA 1GRVA 1WDKA 5AO9A 2F54B 4ABUA 1EE9A 3NORA 3SCMD 1UZ6E 3ZUNC 2PWGA 2OENG 2C7OA 5LLTA 3G68A 3WFDL 1VTKA 3GVIA 2J55H 2KZKA 4UM7A 1DWOA 3JV0A 1VJ5A 5IXJA 3SNKA 2NTFB 1E43A 1TM3E 2Q3XA 1E9PA 3HUJE 2Q5OA 4XTRD 4V0NA 4F8TA 3HN6A 4OXRA 1I8IA 3QZWG 3VMMA 2QBWA 2SODB 4JCMA 4BNGA 3OUUA 1RK1B 3IVXA 1UVQB 2VR3A 3LKPA 1ZAKA 1YG9A 2OGUA 2FVXA 3JPYA 4ZUWB 2J3EA 3GVCA 3NS7A 3CB4A 1J06A 4MDYA 5J5EA 5ISZE 3WADA 2QTRA 2MH4A 2WTAA 3TTXA 3P9NA 3B52X 3VWJC 1FBTA 3LECA 4U1SB 3CVIL 1XFDA 1E61A 2VAJA 2YD5A 5JISA 3T6VA 1NKGA 4KH2A 1AN0A 4CMJA 3UH8A 5LMNB 2P9SC 2VUIB 5KTNA 3O3DA 2GM5A 4D0CB 3P77B 1XGUB 4NOJA 1QA9A 2VIRB 3R9IA 1NMAL 2BWJA 4HQ6A 4FXKA 3GSQB 4L9LA 1VSVA 4O6VA 3NIFB 2ANBA 4NQZA 2FPGA 4WN9B 4TLAA 4IYRA 4EFNA 1QZNA 4ZJYA 4HAUA 1TJIH 1XVLA 4E30A 4PVNA 1P84J 3KVRA 1UZ8B 4KVNH 1GITA 1WEHA 4BRWA 1G87A 1AQKH 4FFVC 4XQGA 3KFLA 2FRDC 3EYOB 3PP4H 3A6EA 4GMTH 2MCFA 5D6CB 1TEYA 4H3SA 4KKAC 2FSSA 1V8PA 2RHGB 4KH9A 1YVUA 1TMQA 2P1YA 1CQYA 2BFEB 1QH0A 5FO2A 1NRIA 1PZCA 3QVGA 3WELA 4FHZA 4Z7NA 2DIJA 3AEUA 3L41A 4PJ9A 5IXYA 5BXFA 1EBUA 3RVUD 1TC2A 3L4VA 2VUTA 4AW4A 4R9HA 4B60A 1JQJC 4LOUC 2OW7A 4K7PL 2VJBA 3GJQA 2VQUA 3AVVA 3RZCC 4JSYA 1SYVB 1DRUA 4IIQB 3CSSA 2OMWB 5F9JB 4K7JA 3P3SA 1L9TA 1GYRA 5DVNA 4FAND 2CA4A 1U4CA 1K5NB 1UJ2A 1ZIBA 3T3ME 2FPGB 4OZFH 3BW9B 4IRSB 4LHSA 4DW8A 3SODB 4JG0L 1NU6A 3E81A 4JLUA 4X62B 1I13A 2ITCA 4AJ0A 2QTBA 2YNMA 2FNWA 4N2OA 2AF4C 4PLCA 3MBED 1XNGA 4Z9XA 2HTLC 3NVMB 2GEJA 4GMKA 3FWNA 1H22A 2Y7NA 2BFVL 1T1SA 3ETDA 5TEEA 4U7AA 2C54A 2FFRA 4G8IB 3D6HA 4HWKA 4ND8A 1OGAD 5GGVL 3DAGA 1I2MB 1GNLA 1N34B 3OLVA 1J8HA 4WZ6A 3BKJH 5H2BA 1M7IB 2R0KL 4QWWD 4FI6A 5EMNA 2ICWJ 1R5WA 4XB6B 4YB8A 3SIKA 1BIIA 5CLQA 3LEXA 2O7VA 1F2TA 3AETB 4XCEA 5DLPA 2OXHA 3DYOA 2QLJA 2ZR8A 1SHXA 3QF4A 4WQMA 4P23D 5C07E 3I5AA 4M54A 3BVNB 5FFFA 4XBPB 4NAHA 4N7RA 4ODXB 2WAAA 4X90A 3BSZH 1WCQA 2UV8A 1Z35A 5COAA 3E48A 4FZ3A 2R1XA 2VRCD 5IEJA 2P9CA 5D7SH 1HYHA 2Q6VA 5EINA 4EW3A 3EZJB 2MMGA 2E7MA 3DUHA 4PSXB 1A7BA 2IHBA 4A11A 1EGHA 5IW3A 3TWOA 5D1QA 2X4UB 1EAYA 4MHHG 2YJ3A 4KO5A 3K74B 1NBZB 1NG9A 4WTOA 2WWVD 1TLKA 3REQA 1PJQA 3DP9A 2X3YA 3H2PA 2WFMA 5GRVL 4Q9RL 3D39B 4FI3F 1E1KA 4NZRL 5DHTA 3L2MA 2IFFH 3G2LA 3PHQB 3DI2B 4D81A 4NSKB 4OAQA 4J91A 2ACEA 1THAA 1NDMB 1XRLA 3W15A 4QRSA 2IIQA 2EE2A 3KWUA 3K92A 2A0XA 4L4ZA 5HDRA 1QBLL 5K01A 3KCPA 1NR0A 1A7QH 3SDZA 1RQ5A 3WDMA 3Q85A 1DQJB 3FT0A 3VNVA 5SX5H 5HPMB 3LD8C 4RTOA 4P54A 2V7TA 4PBRA 3JQGA 1MCCA 3BUBA 5A2KH 3RFZB 1RWVA 5T1DL 4JCWA 2BHUA 3FPAA 3KYNA 2XQ0A 4C59B 4KMTH 6GPBA 5JIKA 1FP7A 2XB2A 1UK8A 2GZHA 1RIHL 1U8XX 5FKTA 4YDMA 4JB8A 2X9LA 3N5CA 4D97A 3G7UA 2NYRA 3CUWA 4AJNA 2IKQA 1YYMH 1PLLA 1XMWA 1JCVA 4YDJB 5EO0A 1JXFA 3R7DA 3LQAL 1NA8A 1TQBB 2O2DA 3FTEA 3A6GA 1R6AA 5IYZB 1DE4B 1Z3RA 3DSNB 3AJ9A 1MCQA 2V9PA 1ETZA 4Q1DA 1SF3A 1L0BA 1XEDA 2FATL 3L92A 1MDBA 1W9MA 1TZGL 3BEWA 1HRKA 3PC7A 1P91A 4TV9A 4OP2A 1QQ6A 5I30L 4CMKA 4B7LA 1FNEB 2YIMA 1QOQB 2EDXA 3IDIB 1O0BA 2QT1A 2Q86A 5SWZB 1ERJA 1DIOB 2H8KA 3GMIA 2CZNA 2NIPA 4YUEH 2ZXEB 5KSBA 4WD3A 1C3JA 1UBLS 2OX5A 3ZJYA 4CDHA 3I8XA 4XOAA 4L07A 2YOHA 3FB1A 5H4HA 1UBHS 4PXSA 2VOTA 1YS2X 4KITB 2Y1VA 4PZZA 3RASA 2C98A 4R5VA 4PJ8A 5K2OA 3UAFA 1BN6A 3BUPA 4IKLA 3U1QA 2BH0A 4IHKA 4E1AA 2DQFA 4OGFA 3APCA 4Y1AB 5AOMA 5J6GB 1V05A 4AO6A 1S7GA 1S4QA 3U30C 3THXB 2PJRA 4KI5D 2DQHH 3WO1A 1L9SA 1FIGH 1O97C 4Q9JA 3HZYB 2D4FA 3PNQA 4N5EC 1ZD8A 3NBFA 3JW8A 4I89A 1QCZA 4MD0A 4ZVTA 2RGUA 3NWEA 2X4TA 5CGMA 1AS0A 4Y1RA 2KDYA 4F33B 3LUJA 3DXKC 5DMGC 1U4EA 3ICQB 3V6OE 3C7TA 2ZB2A 1N7MH 1OFUX 1OM3L 4H20H 4ZANA 4X9FA 4BQSA 1ZEJA 3DRTB 2IH3B 3WIIL 1I6MA 1VHDA 1S8DB 3FTQA 1BPOA 2ZCUA 3D4NA 1RRMA 2BF4A 4EI5C 5IN4A 4PB0H 3L5WB 5D7JB 1Z9NA 4P5TA 3JR3A 1VKOA 4XP6L 2MTAA 1TJPB 3ZI7A 1ZOPA 5D2NA 4IUDS 4HHEA 1T6YA 2OW6A 2RHBA 4W1PA 3E18A 2F6AA 3UGXA 1F4LA 3V1KA 4FKEA 1RI1A 1GY2A 4P3WA 3RC3A 4OUDA 2PO5A 5F7ZA 1V1JA 4NUMA 4OXKA 4UOEA 3CRQA 2YJ6A 5KJRH 1R5BA 4WINA 4ZFFA 5DNUA 2QJDA 1UWEL 2X1MA 3S7ZA 1GPYA 1UB6A 4U7JA 2K45A 3T71A 4PONA 3DFKA 1OW0A 1CLUA 3FCGA 1L8XA 2QM0A 3ZWQA 4JDVA 1O2DA 4EG7A 4A7SA 3D07A 1BD2B 4C4UA 2WT9A 3WLEA 2O5YL 5EVJA 1MG0A 2IXEA 4RNRB 3IT0A 1G9ML 1M0SA 1JXOA 5EERA 4MUGA 4EJSA 1NW5A 1HEHC 5EC1B 4DNLA 3LX4A 4YXKL 5KMGB 4LSRL 1KXJA 3IKKA 3H9ZA 2WQ7A 4ZQCB 4OHBA 1SRRA 3UWMA 5TTRA 3B4NA 1NKSA 5KC9A 3I09A 3ZDYF 4KMLB 5GISL 2NWQA 2HZ7A 2QEQA 2RHEA 1JQEA 4E15A 4NBMA 2WHRA 1XHMA 1Y8AA 1GPH1 2BOBB 4E41D 1QNFA 5BYKA 3OOYA 5JROA 4AK9A 3VFRB 2BNQE 5I7EA 1VE1A 1JXQA 2DQYA 1KIQA 3KKNA 4D3ZA 5DNWA 3ZQ4A 4PJHF 2E47A 2ZT6A 1OFIA 2ZG2A 1N2SA 1POWA 5BYBA 1Z8DA 5TDOB 1I1FA 2YD3A 1GPOL 4L48A 2FSHA 3BK1A 3EIOA 5ALNA 3A31A 1TZ2A 3IJHA 3K7UA 3QHPA 3P30H 2RALA 5IG7A 5FM4A 4GKNB 1GG5A 2WVJA 3HE3A 4RK0A 3FMFA 4IFEA 1YRQA 3LKNB 1MFEL 3PXLA 3FNFA 3KLBA 1AV7A 4J1TA 4P7KA 1NNEA 1LLAA 1OAXL 5BO1H 3ULUL 2NDGA 2GXSA 3WNVA 3CVCA 2OK7A 5E0KB 3ZDZA 1KPRB 3GZTB 5I76B 4IDHA 1L3BA 1AHKA 1DRVA 3LSOA 1YEGH 1TECE 3LNHA 3MNZB 1MEEA 35C8L 4R8RA 3C98A 2ODBA 3N0PB 2ZE6A 1E2IA 1VA4A 1W4CA 3SFVA 2ILTA 2XV3A 3CT6A 3MNDA 4A2FA 3QUTA 4HDRA 4WI7A 3CZCA 2Y6SC 1KERA 3QULB 4Q7KA 3T1FA 1E3FA 3GA7A 1Z83A 3V4VA 3F1KA 3FF1A 4Y6OA 1KPUA 1PJWA 1OB1B 2QWXA 3ZVNA 1E18A 4LVEA 3V7YA 3G5VB 2DQUH 1EVJA 5I1EL 4JJGA 3LMKA 4BEJA 3NAMA 1N5OX 2CXQA 4LKXB 2AQ5A 4HC1L 4L37A 4JUFA 3PHLA 1MJ8L 3RG1C 1TT5A 1QB7A 4CM6A 4YP5A 4ZCPA 3TB6A 2VMEA 1MXFA 1GOTB 1XROA 4BVHA 3GSNA 5EZLA 4K6FA 4ZMLA 5HYJB 2BVPA 4HDKB 1XJ0A 1LEKA 3K5WA 4I77L 3FRHA 1II4E 3QQ5A 4M8KA 2FW0A 2AMYA 3GYBA 4L3HD 4CZ2A 1WWWX 4NQDE 1V7PC 1S7CA 1AHNA 1UXGA 3H8JA 3GAZA 1T7ZA 4IO1A 1NPYA 4JBHA 2J5LB 5KJFA 3ZWNA 5IP5A 3FUTA 1UBFA 4A8JB 4DLVA 4XI9A 5JOQA 4KK5D 1X5KA 1IM5A 4WNAA 1JAEA 4QBHA 2Y9PB 3EU7A 1TMGE 3STUA 4HMOA 1INQA 4KQWA 1K8KC 4WNYA 1QIJA 3HJNA 1IBRA 2ZP0T 1UK7A 5HJGA 1JPEA 3GLZA 2WY2D 3UTCA 5KTYA 12E8H 3KR1A 4E9VA 4GYBA 4OBWA 5KREA 2WM8A 3F8UB 1E62A 2E4UA 4AKOA 4P84A 4F6RB 2QW0X 1XGZA 3E9RA 4X42A 3A23A 4EA9A 2WBJD 1CK0L 2B83A 4U4AA 3SGKA 1UDAA 3K9NA 1N0LB 3CW9A 2QYTA 3MTEA 2P8PA 5EIWA 1AI1H 2YBAA 4L4SA 3R6TA 4OFWA 1H2WA 1QM5A 3PJSB 4JFVA 3NZUA 1JRHH 2V7NB 2H85A 3OCVA 1SVBA 4CC4C 2P4UA 2VBFA 3MRBA 2FMKA 4XAWH 3B9AA 5KBLA 1E60A 2XTJA 5HW0A 3N9IA 1T8TA 2GSGB 3ILYA 4I48B 3FQUB 2VXTL 4QWWC 4I99A 2ONCA 4G23A 1X1TA 1TTHA 2XQBL 4DGQA 3C9NB 4C8XA 4OJNA 5IQ7H 2EG9A 2XN9D 1U9ZA 3CGWA 2JJTA 1J5HA 3OJLA 5L8LB 3X0DA 4N28A 4ATTA 2VDLL 2IGFL 4JLRB 2FYYB 2NNCA 4FZ8H 4WFHD 3RDTB 4YSAA 3LZNA 5JAUA 1E0KA 3MREB 3WIIH 2XZQH 4X6FB 2ODNA 1LLFA 5GIOE 5IUKC 3L4KA 2VTBA 2HZBA 1LE5A 5DHAA 2G80A 2RBLA 1B14A 5JXAH 1H0KA 3BAXA 3QHTC 4I4NA 1E6CA 1E90A 3AITA 1E3JA 4BFWA 5LXVA 3AG4B 1PIFA 2QYOA 5KG9A 2R8PA 2QN3A 4GO6B 4B97A 5JVDF 1YNLL 2XACC 2PPCA 3L5KA 5FECB 4N2MA 4KQ2A 2BTEA 1TTUA 3GI8L 4FCTA 1L5LA 4FFWD 3U4IA 1CY7A 1JTOA 4HC4A 4WZAB 1DUYB 1TT7A 3D3QA 1QHFA 3ARGD 4PRAA 1WHTB 2OV2A 3TUIC 2NP6A 4B32A 4EJSC 1KQPA 1EQ2A 1T0JB 1A0RB 3VZSA 3EHBB 3M6DA 2Z6FA 3W5CA 1ZLVK 5MN4A 4UDYX 3DUFB 1N1DA 3FQNB 4N7MA 2AC7A 4G9EA 3LRHA 5D70H 3KU4A 5LD2B 5ABPA 4L2LA 2A1WL 2YKLH 2OPHA 3M1LA 1RPTA 4UDUB 2I4TA 3AR6A 5AMSA 2EJWA 2VDNL 3P0YL 4R54A 3BVWA 4DN6A 4NZ9A 2VCHA 1MSPA 4MD5B 3L1VA 3BIWA 2QK4A 1UQUA 5GAJA 1SM3H 2JEYA 3LYAA 5FOBA 4P80A 3M5CA 2F74B 3TT1L 4JJKA 5CIWA 4E1BA 4YRRA 4DXDA 3RKPA 1W88A 3E3QC 2PUCA 5T1LA 1OXSC 3TKLA 2QKYA 3IKJA 4HX1A 1QSEE 4Y1AE 3HZKB 3KPJA 2QD4A 2CXSA 2PW1A 2NYZA 2UYGA 5KX5F 3FBKA 3QWOA 1R6DA 3T9AA 2OEPA 5IR1A 3RCBA 1XPJA 1CDEA 4XJVA 3DJRA 3QUQA 4C56B 1COZA 3MJFA 3QO1B 2GFBA 4IUCS 2IVFC 3M3PA 3DAPA 2FW9A 2VJ8A 1DX9A 1N3BA 4JVMA 4HIIA 1NUUA 3LG2A 2JFFA 2UVFA 4ZZKA 3PNPA 4IIJB 4L4VD 4M99A 3HRIA 1Y18A 2FX8H 3M4XA 1C9YA 3DAOA 3HPLB 4LWQA 3DVFA 4BYMA 1UD3A 1QFWL 3FO9B 2P2CA 4L3FA 1OAXH 3M8OL 4D9QD 3T2QA 3ULUH 2P77A 4WI6A 5I6NA 3VSQA 3U3MA 3ZCQA 2CUAA 4G80B 4RH3A 2CBMA 2YHSA 2Q2WA 3G6JE 2C7UB 3O6KL 5D7LB 3TFQA 2FWOA 1OT5A 4G82A 1IN6A 3LN4B 4U6YA 3VPDA 2OWEA 5T8IA 5KS9F 4GW4B 2Z3VA 3GRFA 4KXDA 2J9YB 5BW7C 2ESVD 2B5LA 3RPBA 1K6XA 3WIEA 4XPGH 5T3XE 1NMSA 5I1KH 1A88A 3TURA 1IEBA 1E2PA 3DETC 1M66A 1XL4A 2OL3A 1HCYA 1UJ3B 3UV3A 1HOCA 1Z28A 3WK4A 5LZ9A 3PB3A 4PC7A 1T5WB 1XVUA 2KJQA 4KHTH 3MYYA 4I50B 5DMGD 4I3FA 3HB1A 3T94A 3O84A 2AKEA 4OJFL 1U9CA 3HG1A 4J2OA 3TQOA 2WWXA 3FW6A 4L1KA 1BMDA 2ZG3A 1AG9A 5K8UA 1MJ7L 1HKUA 4MB6A 2NZ9C 5C07B 5PAZA 4P5MB 2VDRA 4H6WA 1BN7A 2A6PA 2R2EB 2GUOB 5BOSA 2ZOKB 4WGVB 2QENA 1Q5PA 1S9WB 3RFTA 1Z0NA 3O41B 1UGKA 1Z5PA 1YCFA 1JAYA 4OA8A 3PIQB 2HYMA 1GRNA 3X3GL 5TH2B 3GC3A 4XXDB 1Z0UA 5C0NC 4QRTB 1ZNYA 1Z66A 3CFNA 4LARH 4JN1H 4X6DF 2C3YA 3PWJB 4RK5A 4JHAH 3JSXA 1C1XA 4MMZA 3EH5B 4D7PA 4UM8A 1G8HA 1T1IA 4GAAA 2R6DA 1YTUA 3RQIA 4JLMA 1U0SY 3AKEA 5DMHA 5H68A 4R8WH 3STTA 4F5WA 2Z2YA 3ZN2A 6REQA 4YQYA 2IPAB 5K9KA 4UUAA 3PE3A 1KSRA 3II2A 1RAEA 1QVOA 4C1BA 3IVRA 2ZLBA 3LVTA 1XX6A 2V55B 1DKRA 3RBVA 1YJCA 4PYHA 3M6FA 5JXHA 1HXYA 2DI8A 4BQRA 3ZE2A 2ZYVX 2YHGA 4WI5A 5JAHA 2BRUC 3BAYA 5AJTA 3TNNB 3B13B 4N3TA 4ANWA 1IT9L 2WBKA 4R41A 4II3A 4DR1B 5ICXB 3DE2X 2XOXA 5J6GA 1ZD5A 3HRZC 1TF2A 2YFNA 1EI9A 3WIBA 5BV7H 4TYUA 4OQFA 1JRHI 1SKYB 1SWVA 3V5NA 1XTVA 3O1HB 5LWHA 4N0CC 4XCCH 2GN1A 3DMDA 2R1YA 4N3NA 16PKA 2BNUB 3LT1A 3ZTDC 2A0UA 2QSCH 2OLJA 1W6LA 3KVPA 2AK3A 3TPUB 4F2DA 4Q14A 3M0EA 2EJBA 3VISA 1QHOA 4FNGA 2ZUDA 1HE4A 5L2JB 3KUCA 4KK8C 5M94B 3O2WH 2VJYA 2YLHA 5L7YA 4MULA 4N5LA 1TJGL 1ZSNA 4QXGL 2R27A 1HT3A 4MASA 3DURA 5BSUA 1A9PA 4OZGB 4PI0A 2IRWA 4B3FX 2OK0H 1Y1RA 2YVAA 4TRMA 2YN5A 2MSCB 3KLPX 4LCJA 3IUMA 4YZFE 4BD4A 5J1TB 1XWIA 2FCAA 2WSYB 3PYMA 2H00A 3WGOA 3AJRA 2FECL 1FQKA 1U90A 1SQ2N 5B37A 1VSQA 1LU9A 1E5AA 4PCYA 1N1EA 2ECOA 2ID8A 4GRIA 2Q76A 1KCRL 5IVKA 2H5EA 1DBIA 3ANMA 3AP1A 1DKOA 1AG6A 3GZPA 1DCEA 4ZQTA 4EHIA 5ICXA 1I2AA 4OH2A 1ONPA 2ZYDA 4MS8D 3DLTA 4R6XA 3AB3A 5ILTL 3HYNA 4J8RA 3R7SA 1L7VC 1E4XL 3LRXA 3BAIA 1C2YA 3B2QA 4PFSA 1KQFA 1O87A 3CQ9A 4RGNC 1LA2A 4WWPA 1W0JA 3BBLA 3AZUA 1NMEA 5GGRB 1NBZA 2AMUA 1VG8A 4CG3A 5K6AC 3FTGB 3Q7TA 7MHTA 3ON5A 2VQ6A 4D4LA 1BROA 2CK2A 2NNXA 4EIBA 1YDHA 4KB5A 2W6JA 2H7VA 3KZKA 5FHAH 4KZEL 5KOHB 1PEWA 3MS7A 1YR9A 4L6AA 3COWA 3OCXA 3THYA 4ZAKB 4B71A 2VYVA 1DJGA 3N2KB 4RACA 5KSAC 5JATA 3U16A 1YLBB 1T3FA 4UHKA 2GHWB 2VDRL 1XN4A 1D5IL 2GJ6D 4LPVA 3IAM1 1V7QA 2RTTA 4XEHA 1IIBA 1XG5A 5KTMA 2DLDA 6PFKA 3ZGXA 3TJMA 3DDNA 4Y4HC 4RLDA 4H20L 2UXBB 4FHFA 3X44A 4GP4B 4WDIA 4PANA 3PJEA 4POUB 2W2LD 5AP9A 1U8YA 1KDVA 2OXGB 2DQIH 3VI3F 4JJ5A 4GOOD 3PXDA 5C18A 3BC1A 4J1UB 3AQ4A 4ZQFA 1F2TB 1ENOA 3IAAA 5LXGH 3DMTA 3GEGA 1CFSB 4E2XA 5BRJA 1JZHA 3EVEA 3PD1A 2V8LA 2JLLA 3O3OB 2PMDA 3W5AA 4NMMA 3TW0A 1A25A 2CNZA 4MKHA 4RETA 5TMBA 4D57A 2NSDA 5ED4A 5EIOA 3KPVA 5IC7A 3MU3A 4HS3A 4Y19E 1KPIA 5DEJA 4PBDA 1IEBB 3TLYA 4DH2A 1E3EA 1NKVA 1IC6A 3A6PC 3QUZA 1Q4NX 1I9IL 2GPNA 4Z49A 4H8WL 1W47A 3GLEA 5BUSA 2R00A 5ICZA 1G64A 4BLPA 1XDDA 1H6DA 2FN7A 2P6OA 2YCBA 5DYGA 2PR2A 5BS0D 3IAPA 1VZIA 5COBA 3GJFB 1MRZA 4F4DA 1L7TL 5L3RA 2PXYC 2BFDA 3VE0A 1HY3A 2WHXA 5HF9A 5BN1A 3NEAA 5JFGA 4FB1D 1FO0A 3EEBA 4PX9A 3TIVA 3JZAA 5B1YA 5EMMB 4Z2YA 4IBWA 4NYMR 2O8DB 5EKSA 1GZVA 2PM7B 1MVYA 2CO0A 3EI4B 1F17A 3I8SA 5L51A 2APWA 2DIEA 4ZJZA 4DADA 4E32A 1SBTA 4HHAA 5I66A 3DMFA 2R69H 1L5GB 2AFHB 4OQ1A 2BCKB 3WWZA 3QRGL 3VUAA 1X1SA 5CLIA 2JGDB 1V16A 3Q5OA 4XGRA 3NUZA 1EFPA 4YHBA 5FUXA 4ZT2A 1C8BA 3IXLA 4TPRH 3S8MA 1JDSA 2YD8A 2EC9U 3VFSB 1HWWA 4TM7A 4UEOA 4DLUA 4URZR 5BZWA 3RWGA 4XA8A 5AALA 2YXDA 2DUMA 1ORSB 4FK8A 4K40A 5D3MA 2R6CA 2DOCA 4EEXA 1C7EA 4UC0A 2ADJA 1JN6A 4FXKB 3EJ6A 3TNYA 1I3MA 1XZPA 1ICTA 3IUEA 3AEQA 1AGDB 2AABH 2XRAH 1WE2A 3L4UA 2YAMA 4TWRA 3CUPA 1OQAA 1B26A 1UZ8A 2UX7A 1O6ZA 4PLGA 4TYNA 4N8SA 3SJVB 1QFYA 3E9QA 5JH7F 2ZXUA 1TKAA 3QIBA 4JB3A 1L5ZA 1GDDA 4BZ2H 3C3MA 4BFNA 3GH1A 2HL6A 2IFTA 4PPQA 1BCSA 4BSWB 1P7QB 3H3PH 4JLPA 1CZKA 4Q4DA 3NA9L 4KN5A 4YE4L 4I7ZC 1UQRA 3RODA 3AHHA 4ECAA 4JR2A 3ROPA 2OV6A 1Z73A 2B08A 4IRJA 1MDAA 1TQUA 4L3VA 1Y6JA 3KVVA 5IFKA 3CO5A 1YECL 4E5XB 3VD0A 4ONGL 3G5XA 4F5ZA 3GZJA 2BPOA 3IDOA 3O2NA 3D30A 3TZEA 5IJKA 1GEEA 4UDNA 3QRGH 4EUPA 2NTFA 3W0WE 4ZYXA 3BGSA 5CEZL 3QZWA 1WG8A 3L3DB 2YVKA 1RS0A 3SYPA 1BVZA 1LNQA 5T3ZE 3LQAC 4E4YA 5FNVB 3CWZA 5BRAA 1QYXA 1ABFA 2P5EA 4FQ2H 3IDNB 3DVQX 5JHLL 2HWZH 5J2UF 5GGRY 4B17A 2ROYA 2OD9A 2ZSVB 2YWJA 3EJWA 4B6JA 3RSLA 1OXBB 1OHHD 3D6FA 3LF1A 1DC5A 1EVQA 3UAJA 5F3HB 3A2LA 2VDJA 1X5FA 1OX5A 3JD2A 5KWIA 2IUEA 1RQ7A 3QW4B 1BZDA 1KFJB 3F9CA 4GT0A 4Q6YA 2PP9A 3OEEA 4C6HA 5PCYA 2H41A 1EO8H 3G8CA 4X4YB 5DQDH 5AM1A 2FYYA 3KHSA 3OSVA 1O58A 4V1CI 3CX5J 1G3UA 3WV0A 1AO7D 1F2UB 4EMUA 1RZIB 4PRPA 4F8JA 2N0MA 4FG6D 2E9SA 1PU0A 2QX4A 4FYQA 4BJHB 2NSMA 3FT2B 2MKLC 1D6SA 1TRKA 4F96A 1P7HL 3MA9L 1EMDA 3GROA 5F7FA 4A15A 4UOJA 2WVTA 3IT8D 2VYRE 2EVJA 4EGFA 4U0JA 2PYFA 3PF2A 2PXXA 3SY6A 3QKUA 2GCOA 2R7AA 2A6DA 5FI3A 4QXUH 1NCHA 3QKRB 4L95C 3HI6A 3W05A 1O7DE 1K08A 3PU7A 3NCWA 1N0WA 3M6VA 3T1HB 4LCCB 2W2OA 3MRSA 1IM3B 1HE7A 2DBLL 3R3WA 2I69A 4UF7C 5A5DA 4KE9A 5DHEA 3N1FC 3D39D 3GEFA 2AXWA 1SUFA 5EWJA 3ZTYA 4UQIM 4HAWA 3I01M 3PDIB 2GZAA 2PZLA 2G5CA 5SZJA 4X85A 4Y2UA 2HV8A 2PLRA 3M4ZA 4Y8DC 4O1IA 3S8GB 5AB9A 4DHLA 1QSEB 3UOAB 1A6UH 4KKBC 4X2UA 5MEPA 2HCZX 5JDSB 2X0RA 3H4VA 2ORWA 3L0IB 4MV1A 4MXQD 1EERB 2OAEA 4TTQA 2O6CA 2XTLA 4BFBD 5H37G 1VPEA 1FTYA 4N03A 5DYOB 1EO8L 3GEDA 1G20E 5EU6A 1LEKB 5F7WC 4Y2OA 2H07A 3HYLA 1AFVL 2A6JA 2CMRL 2P6NA 2YYAA 1E4KC 3K3PA 2CO1A 4E1VA 5JHGB 5EZLB 3G5ZB 4MAYA 2C2BA 4DW2H 3MODH 3HBGA 3WAJA 3PGDB 3ZDXF 5C2JB 4UUQA 3MZTA 1U3JA 5ADOL 2RFLA 2AVGA 5CWSB 1NTRA 3MS2A 2NV0A 4MJID 5EAMA 1OBVA 2EWWA 2YFYA 3QLJA 1RQXA 5HD8D 4IBQA 4Y7OC 1D7CA 3WO0A 3ZZ0A 3RSZA 4FHJA 4WLCA 3FFTA 3RYCB 5FUQA 3N91A 1Z16A 3GQBB 4GKKB 3AFLA 1NGXB 5J4VA 1RZ8A 2E5LB 1UBCA 3OPQA 2EDRA 2DQCH 4UNSA 4R01A 4JKPL 1N1GA 1EIZA 4DLPA 1X14A 5ANRB 3R3HA 3QUKA 1YAJA 3Q8AA 5A2AA 3IAEA 4Z7IA 1J0HA 4HH9B 1X4YA 1MIOA 5B3AA 3F3YA 4KV5E 1F20A 4C4OA 2DWCA 1HL3A 1XAJA 4KV5F 2BT4A 5A6VA 4TTJA 5KYVA 3DO3A 3LNFA 3VWKB 3VTKA 1JVNA 1CZOA 2VF4X 1J9EA 5I15H 4ITRC 4GKBA 4BO2A 1YEDB 5I1GH 4P9ML 2Y0CA 5ALVA 5TFSL 3QI9A 2FQYA 5HRUA 4QYWA 2WGNB 1E6MA 1Z6AA 1Q12A 1UBNA 1BE6A 2VJMB 3BWMA 4AJ9A 1T2AA 2FRVA 1AQLA 3I12A 1JIXA 1F18A 1FYTA 2LVBA 4U1NA 5ADPL 2WIBA 4GQ9H 4RJJA 3PCXA 3PGFH 1XNJA 1W36C 4QAQA 3C43A 3NRJA 1XMQB 3PREA 3IFSA 4RD0A 3D18A 4EG0A 1XGKA 3OQPA 2AH0A 1QGOA 4KQ9A 3EDKA 4QATA 1G7RA 1BFVH 3B60A 1Q0YH 2XBTA 5F1KA 1T6NA 1U2ZA 1M67A 2ODWA 4HRYA 4PM4A 4TNGA 1ZA3B 2VDWA 4YDLB 1AD0A 2EZ0C 4UCFA 3OE1A 3AF6A 1P4LB 1TXGA 1E28A 3DBIA 5IMSA 1G7JA 2EIXA 3GEBA 4KOCA 2NY5L 3A67L 1D5CA 4GG6F 4Y6RA 2XNHA 1IQDB 3PJNA 5FA8A 3GFPA 4WSJA 3PWTA 1MI5A 2ZSWA 4I4TA 3VFRA 3JYOA 2WXJA 3IPFA 3F5WB 1ZS2A 3TVMD 3VR5H 3NHAA 4N01A 1L8OA 1XZKA 3HP7A 3UZEC 3F0TA 2A7QA 4NATA 1MIHA 5GGSB 5ABZA 5JYCA 3DHPA 1ACCA 2WZBA 3ZJ5A 4N9WA 5A2GA 4G6ZA 4HEMA 5EP3A 5LU9A 5LGJB 2XGGA 1U2TA 4U1EI 1MCFA 5D9SA 1AR1B 4RCYA 4HG4J 2EGUA 5C5CA 2GBLA 1JEEA 1C9DB 2IG2L 3ZL1A 3SJAA 1XT5A 2YLKA 3HCVA 4JR1A 4TN5A 4ZFFB 3D4LA 3P1VA 3LP6A 2XZAH 4P4SA 2YGOA 4CHGA 1NCNA 3FLEA 3DV2A 1XRQA 4J0CA 1Z6TA 3GJRA 3ARVA 4QO8A 1PZ2A 3VTTA 1PWYE 3UTTA 1CG9A 3ZY6A 4WUVA 1MT3A 4TV8F 3MGGA 4YFYA 1P4LA 4G1MB 3DK0A 1G17A 1R0SA 1UENA 4MVJE 1KPVB 4A8TA 3OQOA 4REOA 1I33A 4WIAA 4C7BA 2BVOB 4RK4A 3PS6A 3CVHH 2QLFA 1L6XA 2YPKB 3WIFB 1IGFH 5K6AA 1OGAE 4RHCA 3MOBL 4BKQA 3VO0A 3R7BA 4DSAA 1E9CA 4W5JA 4Y7CA 3CDYA 3COPA 5KOYA 3HUDA 1RFLA 3ONFA 2Y7SA 4N9GB 1OHZA 3ME5A 2YDYA 1IEXA 2Q6LA 3ABQB 3EEIA 2QX7A 2PZ8A 4YV7A 3VWJD 4FYMA 4FYJA 4HOXA 5EZOL 3G08A 4A08B 1P7ZA 1MRCL 2X4IA 1IBYA 2W37A 4U39A 4WWKD 2BMDA 2MNUA 1QS0A 5KX5A 1P6WA 1RVFH 2C8JA 2JI4A 2ZUSA 2Y1XA 1YBHA 2BSAA 3SLGA 3DE1X 4RA6B 1C8PA 4Y4FD 3KKLA 4PNZA 5KDDA 3JQPA 1IZ0A 3VTAA 4KQ4L 3ZTNL 1NG1A 4UOZA 1EHNA 4R4NC 1EH9A 1UEYA 4I88A 2PL1A 1D5ZB 2G8NA 1OAAA 3ZE1E 4LLQA 1RRGA 3TECE 5EBGA 1SPXA 1M8FA 5GOTA 2M6LA 3OJOA 2GO1A 4BY9E 1LEHA 2QT6A 3N0EA 2I6SA 4TLMB 4FQLH 3GT3A 4B76A 1Z38A 5DUPH 1DG1G 1HLDA 2Q0XA 1TCRB 1DAGA 1IY2A 4D45A 5CIPA 1FTQA 1ZN8A 3DNFA 1NCIA 4XNUL 3D85A 1JXAA 2ZUCA 2O5NA 5F0MB 2C8LA 3MMNA 5LZ8A 1FNEA 2DKMA 1E6JL 4Q6BA 2L69A 4LNRB 1BU5A 1D07A 2WTNA 1NGZB 3EO0A 1PSDA 4PBWD 4PGBB 3EUAA 1P5ZB 1NDTA 4QT8A 5CP8A 4HGRA 1LTQA 4RPKA 5B7MA 3E03A 5CJOL 2KQMA 2QKIB 4EVNB 1DL5A 5F7MC 5SYNA 2CHWA 2BS9A 1DJYA 2EKQA 2IYQA 1S9XA 3C60B 1FFOA 3OUZA 5AKLA 3W3ZB 6LDHA 2H9GB 1PNRA 3KKZA 4LN1A 2PYZA 2O3RA 4M7PA 2J48A 5IT9A 2HTLD 1P7KA 1GKEA 1ZVJA 3BGOS 5HI3C 1RM0A 2O0MA 5B1AB 3I04A 2RH9B 2PR4H 2INGX 3I32A 1ELOA 3D1VA 3QUKB 3MRIB 3SOTA 1NM5A 3LIZL 3GFSA 2CHZA 2JLSA 4X98B 2Z56A 2XDHA 3LHDA 1NOJA 4ICIA 2XMDA 2MOQA 5IFJB 4GOMD 4J4PA 3DEIA 3DL7A 3RUGB 1GT6A 3SX2A 3IDJB 3EOBI 2BMKB 3ABOB 5DVPA 1QFHA 5G41A 1SVUA 1Z5OA 4RMRA 4P4SB 2EP6A 3NDIA 4OZFG 2RBEA 2YQZA 4G56A 3GQFA 4FXGC 4UBOA 4M1OA 1KEVA 1DC8A 4HSCX 1EXGA 4CMAA 3Q9SA 4U7SA 5HTSA 3C4QA 3EPRA 3KSUA 4HFWB 1XN1A 5IYZF 3RBXA 4MV6A 4R1LA 5B22A 3T3PF 3TFWA 1M1XB 1PW7A 4JUIA 2XNJA 1E8XA 5E00B 2Q6WB 1E9OA 1CK4A 1WZ1L 3FT1A 5HYQA 3UXYA 1E1LA 5I8CB 5GSRB 3EF1A 1OBCA 5IKCB 5L9DL 4DG8A 3INRA 3TCNA 2RAVA 4QJ5A 4CBVA 1Q8MA 4L9WA 1HV8A 5FNVA 1XSEA 1ZGBA 4EUFA 4M46A 1Y6GA 1F8TL 2CT8A 4EUPB 4XFKA 2NO9A 2PPFA 5TR9A 3LNIA 4FG6C 3O2VH 1N8SA 3DBXB 2Y1FA 1EXDA 1WUTA 1N26A 4AYFB 2WJHA 1YA8A 3O6ML 4X80H 5H35B 5T8KC 2NTEA 1M7IA 5FKAA 3WYFA 3F98A 3P4OA 2XE8A 2OSYA 2R1VB 1HH6B 1MQAA 3FU0A 5T1MB 1CY8A 1DFIA 5GGVH 3VR4D 4TKZA 4FA9D 1EDQA 4URXR 3ADBA 3RRZA 2CF5A 5HGDA 2OORC 1OLXA 1L5FA 3CWGA 1I1OA 2WIIB 2G5UA 3K80A 4J5VA 2HCFA 3PUYA 4X8OA 5CXCA 4W4OA 1YA6A 3CDFA 2NV2B 1NRWA 1E30A 4JMLA 2ICEB 2H4ZA 4FA8A 3NXSA 4M0LA 2VNSA 2KBFA 4OXXA 2PIDA 1QTYT 2C7VA 1TQTA 1NFIA 2YUWA 3G9TA 1H94A 2NVWA 1GUZA 4HYTB 1T0NA 3SXTD 4OHYA 4L3EA 1ADGA 4FUQA 3MYRA 4CG1A 4O02H 4PS0A 1R15A 2XN1A 1P4IH 2JBAA 4XOUA 3A9VA 4YX2H 3WN6A 2G1PA 3O4HA 3RX8A 4ORZC 3QWRD 2VJMA 3MAJA 1QG6A 3VYUB 1YS1X 3QBDA 5IESL 4JHPC 1VIAA 3LOWA 1GQQA 1RI5A 1ZISA 1SXJE 4BVFA 4PBZA 1P6XA 2P0EA 3GX1A 1XDWA 3OIDA 4JP2A 2JGRA 1CR2A 4P3OA 4XNAA 5DU7A 1C5BL 4F7PA 1PZAA 3TZVD 3C41J 2H65A 2PN1A 1SZCA 2PQ6A 2R47A 3OQRA 2LT9A 3TOZA 2H3XC 3I6ZA 2H0PA 1AZSC 3STXA 4HWEL 2ILVA 3JRPA 4KV7A 5HD8C 2H2SD 1U2DC 2O5ZL 5J4MA 5JFTA 4F3FA 1F1AA 3CLFL 3DFMA 4K9KA 3H19A 1VMIA 1T0BA 3I2HA 1NVBA 3KD2A 1B6SA 1RJYA 4OT1L 5HXAA 2QV2A 1YEWA 1GTJ1 4PVMA 5I66B 4WNQB 5DYYA 1YA4A 4XN5A 2JD1A 3EDOA 1NR1A 1E9BA 4Q0XH 4ZOLA 1BH2A 4X83A 4AJ1A 1VFMA 1BE1A 3F73A 1YZVA 4ZRNA 1VGKA 7FABH 3X1GA 2IF2A 2JJ2D 1UUFA 1I7LA 4Z5XA 4K3EH 4WW2A 1KI2A 3CUPB 4CMHA 1A5TA 3U37A 4G1EA 1BFTA 4G7SB 3WJJC 1SBHA 1R88A 3T77B 3TEMA 4IJKA 3OKAA 1G3QA 1CUYA 3HCFA 1JJAA 1JBQA 5F7EL 1KEGL 1Z12A 2BEJA 4TRJA 4HFUL 3IQDB 2GEQA 2DEYX 2VZ1A 1R0BA 5T4HA 4Y2XA 4D8OA 3M8KA 2E4TA 2AE2A 4K86A 1IM3A 1YVLA 3OJVC 3F49S 4FKMA 5JI3E 4PY2A 1Z33A 3EUEA 3H42L 3QVWA 3JQRA 4O1MA 4AG4L 3L3IA 2Z8XA 1E9AA 1YBVA 2JIMA 1RQ2A 1PFVA 2C95A 3ITNA 2YRLA 2J3SA 4I0PB 2Z2NA 4YRFA 2VITA 4LGRB 1ZJ5A 4H26A 5TQ2L 4DQDA 3OIGA 4PS4H 3QORD 4MV5A 2CAKA 2R23A 6CHYA 1O6SB 1M2VB 3N5AA 3FRPG 3RS2A 2QPTA 1GR0A 3X13B 4IUYA 3OXRA 2ZJ0A 3HHPA 1A7QL 5JALA 5CXXA 5GMOA 2GC7C 4CHTA 5ITFB 2VJAA 2F54D 2H7YA 3L1EA 3GWJA 4ZO9A 4XEIC 2P68A 4EY8A 4AC9A 1QD0A 4POZD 1T10A 5E8RA 1M3JA 4GSYA 1ADBA 5H1YA 5FYKD 5GS0L 1DQIA 3MJCA 3VYOA 1G84A 2PYEA 5IBPA 3IN2A 4PR5A 1JNHB 2H32H 1OP5H 2WUCH 3F97A 1UTDA 4DGUA 4EA7A 1LJ8A 2IE8A 3BXXA 4Z7WA 3NSCA 4KKQA 4BNWA 5DMKA 1E6WA 4L8VA 1U4NA 3M45A 5FBKA 5EWIL 3FUWA 2NTYC 4I7EA 4GG1A 4OH7A 3TBCA 1TU2B 1BX3A 1UFRA 5KBKA 1VOTA 5AQEA 1DSFL 3U9SA 4IXWA 4F7MB 1E6LA 4D5EA 1Q90A 4ERQA 3VKFA 3TB4A 3IXMA 3FJTA 2V7EA 1JR6A 3ZMNA 4M1QA 4IRMA 3H13A 3QH3B 3ZDZE 5G0SA 5GM2A 2VDLA 4Y2DB 3FB6A 2V2WA 2LE9A 1JFFA 2K6YA 3T6QC 4NS4A 3OLXA 1SURA 2DIAA 3ARSA 1IY1A 4EB3A 4HFNA 4CVZB 3FYUA 4GXTA 4F24A 1BCSB 1HMYA 4OZGA 1AKTA 4HLJA 4RAVB 1QO0A 4NKOA 1YIDA 1RJDA 3LBIA 1UB5B 2WUVA 3L7EB 2QQQA 3QIBB 3NCFB 4B80A 3UG4A 3PVUB 3GM8A 4QLRA 1JDVA 4BB5A 2HT6A 2P9ZA 5ALEA 4X4XA 4BK4A 3NBUA 1ORHA 1D1TA 1BEZA 1EIWA 3LQZA 1L9QA 4DCQA 3K1YA 1USIA 2ZUFA 3FD8A 4FGSA 2BNQA 4KK6C 3OL2B 1ODSA 2ZRNA 4UUJA 4UOW0 1XNQB 1RIIA 1UWXH 1RD6A 1FUEA 1ISIA 2Q8AL 1TA4A 1WZNA 1QRUA 1YEIH 2YPVA 1OJ7A 1X3LA 4MZRA 4Z7WE 1HX0A 3GDBA 3TAUA 4MR9B 5FFOA 4Q19A 4YA6A 5HVNA 1ZVVA 1PX8A 4MPDA 1GNTA 5B39B 3RUDA 4K26A 3FCTA 2PLTA 3ZVRA 3HPRA 2CWWA 1ORQB 3CZPA 1P4BH 4N1EA 4A55A 1DPFA 1ZAGA 3V6BR 2B0JA 4W4OC 4LXUA 5EIIB 3VGPA 3L6BA 5K59F 4QVIA 3DF9A 5IKPA 3STLA 2HAEA 1CURA 1JG4A 1MO3A 1ADJA 1EFVB 3GRRA 4BO1A 4TUYB 4UQOA 1QFMA 4V1CA 4LDQA 5B1JA 5C3UA 3IUPA 3PJRA 2W42A 1CCZA 3L4TA 4IMKC 3U13A 2YPLA 4QM7A 2IP2A 4HGWA 3LYRA 4DRXA 1WCYA 5C0RL 3AT9A 4EKJA 2RQ8A 2JQZA 2X5JO 2X1PA 2VLRE 1JP7A 2H2DA 2HRRA 5DVZA 5LM3A 4QUGA 5JASA 5JS6A 3V52H 4K9JA 3VVCA 1G0XA 4X6CE 4G1BA 1JG3A 4BN5A 3LQYA 2V6HA 3LC1O 1JD7A 2VNJA 4C06A 4DRZA 4C2TA 3EI3A 1P81A 3QFSA 4AC2A 3T1NA 2VH5H 3VVVA 1FVFA 3X3FH 1LQUA 4GRWE 1F0PA 1E9QA 4MZ2A 4F8LA 4CL3A 4EGSA 2IWHA 3ZT7A 3BB3A 4F3NA 4FMFA 1X8JA 1G6RL 3OZXA 1SUWA 2FDXA 3HAEB 2J31A 5LGKA 4JASB 4WLVA 1JPNA 1EP1B 4G07A 1HZHL 4UJ3A 4AB1A 2X4QB 2NW3A 3P11L 1G9HA 1ZIXA 1PBNA 1ISRA 4G6AC 3IOCA 1TKWB 3GFBA 4M53A 2KYRA 1ZT7B 3BGAA 3QDHA 4GSRA 1G9EA 2B2XA 2CK0H 3UAWA 3V9EA 3DP7A 4NO0A 4ETIA 1T4MA 4ZI3A 4CM4A 3V9AA 3ZH2A 1UT5A 1NW3A 1LE9B 2J21A 1F8FA 4H5JA 3H65A 3HE6D 2BP0A 2YJZA 1KYDA 3FROA 4B6FA 3D06A 4M9OA 4GZ3A 4OIAA 4TSBL 5FFMA 1HFWA 1ZW6A 4ZPTB 4CZVA 4ZREA 1SO8A 1KGCD 3Q3VA 1KI1A 3KXFB 2MWCA 4HWOA 5IT2L 5E1DA 1O9HA 3U36A 5T57A 2QSCL 3AQZA 5ICMA 1OAUL 5F8RC 3ZBQA 4MLPA 5DP2A 3BQUA 1HT2E 1IKNA 3SGEI 5DHSA 1K5HA 2VQ4A 1T2CA 1V2GA 1TYBE 5B3KA 1HOCB 3LKRA 2DWPA 3MJ6A 3AMVA 3TPFA 5DIZA 3TTTA 1NX6A 2CD7A 3LQMA 2JAHA 5IHZB 1X7WB 1YZQA 2JF0A 1IEAB 3MTQA 3LOUA 2QE6A 4L0YA 3DMMC 1XF1A 4JJEA 4JJAA 3U4EA 1G8KA 4DZBA 3J7AC 1J0AA 1Q9WA 2FWOB 2EBWA 4LUCA 1FXSA 1ZLYA 4EOG