4NENA

An internal ligand-bound, metastable state of a leukocyte integrin, axb2
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
1083
structure length
1063
Chain Sequence
b'FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAADQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMDPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKTRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVALHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSESNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLCFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 235
structure length 1063
sequence length 1083
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 4nenA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4nenA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 4nenA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4nenA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4nenA02
3EGDB 2M32A 3K71B 1MHPA 2XGGA 3EGDA 1M1UA 3EGXB 3EGXA 3F78A 1MF7A 4NENB 4IGIA 3IJEA 4UM9A 4NENA 3V4PB 1FNSA 3V4PA 1RD4A 1LFAA 5HDBB 2XWBF 1U0OC 3EH1A 1JV2B 5HDBA 2NVOA 4F1KA 1JV2A 3ZE1A 1M2OA 4MMZB 1ZONA 5KYUA 5KYUB 4MMZA 1RTKA 1U0NA 1IJKA 1SHTX 1U8CA 3PPXA 1NA5A 1ZOPA 3K6SB 3FCUA 3Q3GE 2NUPB 1TYEB 2VDRB 4JDUA 2VDRA 4HQOA 4HQFA 4WJKB 3QA3E 2VDOB 3T3PB 1DGQA 4PN7A 2VDOA 4MMXB 3ZDXB 3EOAI 5BV8A 4Z7QB 3ZDXA 1JLMA 1PD1A 2WW8A 4F1JA 3VI3B 1Q0PA 1AOXA 3EOBI 2B2XA 3HI6A 5KYXB 5KYXA 1M1XB 5E6SB 1M1XA 5E6SA 1FE8A 3TW0A 1M2VB 1PD0A 2X5NA 4G1EB 1M2VA 1XDGA 4G1EA 2I6QA 4NEHB 3ZQKA 3IJEB 4UM9B 1IDOA 1MQ9A 1AUQA 1UEXC 2XWJI 4CNBA 3RAGA 2VDKA 1MJNA 3ZE1B 1JEYB 1MQAA 2ICAA 1JEYA 1RS0A 1U8CB 1IDN1 3BQNB 4HQNA 3EG9B 3EG9A 3FCUB 4IRZA 1JEQA 2WINI 1N3YA 3TVYA 4HQLA 5LN1A 1DZIA 4UM9D 2IUEA 4Z7NB 1BHO1 5KYYA 4Z7NA 4UM8A 1YVPA 5FFGA 2ADFA 3NIFB 3NIFA 5KYWA 5HGJA 2VC2A 5HJ2A 4M76B 2VDLB 2QTVA 4XW2A 2VDLA 1IJBA 3GXBA 3ZE0B 3ZE0A 3PPWA 4A0QA 4CN8A 2VDKB 1MQ8B 2O7NA 4O02B 4O02A 1AO3A 1PCXA 4DMUB 2ODPA 3E2MA 5ES4B 1ATZA 3M6FA 3ZDYA 1QC5A 3ZDZA 1JEQB 3T3MB 4WK4B 1RRKA 3FCSA 4WK4A 3T3MA 3BQMB 3V4VB 1L5GB 3V4VA 3IBSA 1QCYA 1L5GA 1V7PC 4FX5A 3HXOA 3PPYA 4HQKA 3BN3A 3ZE2B 2NUTB 3ZE2A 3PPVA 4CN9A 3F74A 2NUTA 5KYYB 4UM8B 2VDPB 4Z7OB 2VDPA 4Z7OA 2I91A 4C2AA 1N9ZA 1SQ0A 4IXDA 3K71A 2I6SA 4C29A 5KYWB 2VC2B 4IHKA 1M10A 1XUOA 1SHUX 5E6RB 5E6RA 1OAKA 2VDMB 2VDMA 5E6UB 1ZOOA 3TCXB 5E6UA 3TXAA 1YVRA 3N2NA 3NIGB 3NIGA 1T6BY 3NIDB 3K6SA 3NIDA 1TYEA 1XDDA 2NUPA 3EFOB 1CK4A 3ZDYB 1CQPA 3K72B 1QC5B 3EFOA 3ZDZB 3K72A 1PT6A 4WJKA 4WK0B 4BJ3A 3FCSB 2P26A 4WK0A 3T3PA 4WK2B 4MMXA 4WK2A 4Z7QA 3EH2A 3VI4B 2VDQB 3VI3A 1BHQ1 3VI4A 2VDQA 4WFQA 4G1MB 4G1MA 4JX0A 2ODQA 5KYNA 3HXQA 4C2BA 1T0PA 2VDNB 4MMYB 5FFOA 2VDNA 4MMYA
chains in the Genus database with same CATH superfamily
4HRYA 2W0PA 3KBOA 4PGBB 4MSWB 3QXVA 2BK8A 3G5ZA 4AYID 2FX7H 3KQMA 4A2MA 2G4LA 3GQVA 4WINA 3OZEA 3UN1A 4K9RA 1YCHA 5AYQA 1D2HA 4PLTA 1QP4A 3I01A 2Z1KA 1E1CB 1N2EA 1ZHLB 3VPGA 4A2DA 1QTNA 3IDIB 1RMFL 3NWPA 2B4TO 5CB4F 4HDSA 3RRXA 3PSCB 1WM1A 3GBMH 1GTMA 1WFUA 2ZXQA 3IP8A 2DRUA 3TD6A 2WP8J 4LOKA 1A76A 4C21A 2XFXA 1J86A 3S8YA 5EA0L 1EVUA 1AO7B 3T7IA 2ZJ1A 1UM9A 4RYLA 3JYLA 3ARBD 1HOCA 2Y7SA 5G0VA 1UB5A 4AYWA 4MI1A 3NTCL 4OLVL 1XJWA 4HJTA 4GW5A 4XW2A 2Y2WA 1R2QA 1A7QH 3GXBA 1BV8A 4A5OA 1NMZA 4GI5A 4H17A 4WI1A 2A5DA 5B3JA 1QYGH 1MQ8A 2RGBA 3JQRA 4I0CC 5D7HA 1QX3A 1LO5A 3NH7H 1W59A 5BR1A 4LDCA 4J5VA 1AD9A 4RVGA 2NY2C 1UPXA 4Z7WB 4FDLA 3SC2A 2CNLA 2OL3B 1U9KA 4F15C 2H6UA 2XWTA 3M0EA 4BN0A 3UH0A 3K2BA 4R2IA 2YEVB 5CSZA 1U2PA 2HLDD 1IMOA 3IFLH 4KJPC 4AJVA 3N6XA 3I5UA 3BWSA 3M8OL 5CCKL 3F5QA 1VJGA 4IXWA 1DRJA 4NZTH 4NQEB 3R3JA 3LKZA 4R7GA 1UQTA 1BVLA 2WYUA 1B0RA 5C1PA 4YYZA 4FFYH 9LDBA 1W7AA 1XK7A 1ZVVA 3KPSA 5GTDA 4C7VA 3MBWB 3HWWA 1R7RA 1GAEO 4CTNA 4D9QE 1VGRA 4L9SA 4WUTA 2ICEC 3L8CA 4XASA 1YPZE 1N6IA 3S97C 3RSGA 4FABL 1S7XA 1HNXB 1ZV5A 1VKHA 3QHPA 5IW8A 1A3QA 2JKNA 4PJDE 5BVHB 1YEGL 3WNVA 2H7XA 2ID4A 1SIOA 2OL3L 5CMLA 4A8JC 3K7UA 5I6KA 1J5CA 3VR6H 4WEEA 2NAFA 2XKBA 4M7LH 2AFHB 3CZCA 3CVXA 1CEQA 5ADUS 1SUHA 2Z8SA 2WVTA 2CCJA 1NXTA 4QYIB 4DEXA 1GQSA 3AFCA 2WDZA 4J1QA 1C9YA 3K1AB 5HBBA 4H26B 4GU5A 2GJJA 4PLKD 2R48A 2GYUA 4PQEA 4BO4A 2DI7A 5L7XL 1O6VA 4LCYB 3OXSA 5HDLA 1S78D 4HZUA 2BZ1A 5HOEA 4ZYXA 1R18A 3T15A 3ASOB 4NJ9H 3IN0A 3T1NA 3GXNA 4HU8A 1MCCA 4QLRA 4PHFA 4NMMA 3A6HA 4P05A 5A6SA 3QXXA 5E2VH 4ICXA 1BZDA 1N0UA 1KIRB 1P7WA 3T0BA 5PNTA 5KTOA 5FDYA 1A6ZB 4WJKA 2H2GA 4EEKA 1JNNH 4IDOA 1E98A 3HFQA 3BLPX 3DBRA 3O3NB 4U1MB 1BVKA 3IVAA 1JHKH 1K5DA 2VM4A 3HAEA 1NLBL 4K5MA 3ZDXF 2GEDA 3NI2A 3LVQE 2UY6B 1A12A 2AI0H 2J09A 4M5TA 1LBIA 2GJ6E 1I4LD 3DFZA 1FHGA 4P83A 3F6JA 1KT2B 1FO0A 4MPJA 1VJRA 3NYKA 1G4RA 3EVBA 3GMPA 4YLEA 4P5KA 2ZOOA 2D7TH 3E8UH 2W2TA 3ZRSA 3T0IA 1N12A 3QNYB 4K9LA 1YS2X 2V6BA 2W2LD 2FRDC 3VU2A 5DBFA 5ALXA 3NGXA 1BBDL 4BP8A 1T1YB 1KHTA 4CUZA 4UM9B 2KLTA 2Y1XA 1BOFA 1Z4QA 1THTA 1A6AA 3CVBA 1KIMA 1E6JH 2HMSA 1LC0A 1ZKDA 3E70C 1O96A 3JR7A 4AG4L 3PXJA 1CGVA 1KELH 1DDOA 4E5ZB 4RPIA 4W4TA 3TIDB 1GR1A 3ZWVA 3Q98A 5IAKA 1WPQA 3ZHVA 1HPLA 4O02B 1GFIA 4ODUB 2IWEA 2ZSFA 2CE7A 2X89D 4Y88A 3EQ2A 2FPRA 5I8CA 4UREA 2RJ3A 4IIQC 3P1VA 2XAAA 3V00A 3FTYA 4LYHA 4B4WA 3D0VA 1DEXA 2YN2A 2JJUA 4MZRA 1YY9D 1WPGA 3SPXA 1DAFA 2VT0A 1T4MA 4K87A 4PGHA 5AAWA 4JDVA 3HHSA 1ONBA 5HDBF 5IABA 2BL4A 5FUOH 1IM9A 1ZHKB 5D7SH 1IMJA 1RBZA 3KT0A 3EH2A 1LJLA 4PJGB 4FHEA 4Q9CA 4DMLA 4HDRB 1QLEB 1BZ8A 3MJ8B 4B9YA 1Q0TA 4MX8A 3A6OA 3VR2D 5JD3A 5C9ZB 2R6HA 4BVEA 1D6SA 4O2BB 3FFDB 4S3MA 1MFUA 1Q9KB 3UVOA 5EMLA 3B3JA 2ZOTA 4O02L 1R4MB 5EN3A 1Z34A 2YMQA 1ICIA 3DXFA 4E6PA 3CJRA 4MS3A 1H1DA 1I4FB 1MIEH 4BLWA 2HA5A 4KBPA 4KVFA 3LCVB 1OW3B 2FFRA 2HIAA 2KB0A 1X7QA 2XTLA 3F6CA 5FO2A 3S4SG 5KN5A 4EUPH 1PAZA 1QLRB 2CK0H 4LL9A 5KTSA 1ZEJA 1NMAH 3OPYB 1MAMH 3SN6B 1F2VA 3CCCA 3UF0A 5IB1B 1QHHB 2X4TA 3AG1B 3L40A 4NZMA 2OCXA 1L8OA 4XB1A 3V6ZB 5I4BA 3R74A 1FJ1B 1EU1A 2ILVA 1DFGA 1P8JA 1DFBL 2VP5A 2OO3A 2UVDA 5IF9A 2YZGA 5AM0A 4EGJA 3IFSA 2QTVA 4PS1A 3FRXA 2OD9A 5IVDA 2IS4A 4C83A 1HEZA 4M1ZA 3W8NA 3LC2O 3B8SA 2HPTA 1NI3A 4RTLA 1QH1A 3TYXA 1FNFA 4B4DA 1U63A 3D30A 3GLGB 3MA0A 1J8FA 4NFYA 4OQQA 2RGNA 4R1QA 4FA9D 4B8YA 4Q1CA 3NTOA 1PL6A 1GA1A 4H4EA 2JLLA 4RSYA 4BIKA 3DE5X 4Q4DA 1QNFA 3O3OB 1QG2A 1W0KA 4KRPD 4C55A 2D3JA 3FWHA 4RIRB 3VDQA 3H18A 1IEBA 4P2QD 2KI6A 3PL6A 5EB9A 4QHNA 1MAWA 4JBNA 1TTBA 2JI7A 5L2JA 1NX9A 4ZXBB 3H2YA 3M2TA 3VXSA 3K0EA 5JOPE 2BMWA 3T3IA 3GB9A 3Q9NA 1OOAA 3GSOB 4L4XA 1P6AB 4HUUA 5GGVY 3NGLA 2ZJZA 1KB5B 2C7GA 3HS0C 5LCXA 5TF1H 1D6VL 1JJ7A 3AQDA 4XD7D 4X99B 5MFZA 4HB2A 1D5XA 5JCOA 3MRLA 4ZMSA 3P9XA 1A65A 2C94A 3DFKA 1UBGA 1NX6A 1DKOA 3O3DA 2AJCA 3P9PA 2O9KA 4V0RA 4AT6B 1RJFA 3FIJA 3K6DA 1BQ5A 1PZ5B 1KDTA 2CSPA 4JFUA 3DMHA 3N43B 3LRXA 2K6ZA 4YWHA 4Y5XB 3AABA 1FJHA 1FVCA 4IKKA 4JKNA 3O45A 5EA2A 2A6DB 1Y5LA 1UYWL 3BYTA 1B4DA 1D5ZB 5DSTA 1XFDA 3H7AA 1AGRA 1XZGA 4LOIA 4PJFF 3EMVA 1GYWA 5FYKD 1DVFC 3MFFB 3RNOA 1WG8A 3NZHH 1XDDA 3ZKWA 3UBTA 4ENED 4A27A 3JTSB 3U3JA 3R0QA 4BX8A 2EKBA 7ABPA 5JXED 1HYBA 5ICCA 3RF7A 1E50A 4NQCB 4PY7B 2IZ1A 4P5MB 2Q2EB 5BVPL 4ZZKA 4G1VA 5H7XA 4WDIB 5FULA 3NHSA 3HCAA 3EH1A 3V4PH 5I1KH 2CLEB 3IEPA 3IGLA 4WKNA 3PY9A 3HBNA 2YXMA 4NWIA 4OI7A 4I9HA 2OW6A 4ZV7A 5FKRA 3A24A 1ZBQA 3FUXA 3RWBA 5EU6B 2BNQE 4J3TA 4J3VA 3RH0A 4AJNA 7PAZA 3FGBA 1SBNE 1YUMA 2VRBA 3EARA 1RJLA 3H2JA 4JNCA 3LRTA 1DQQB 3GINA 3DO7B 3H7IA 5C0CA 1GPAA 3PIQB 1NXWA 1BYIA 1N5LA 2JI9A 1MH5A 4DKFH 4LXXA 2VYCA 4B0OA 1CULC 1GQQA 4MVBC 1PG7W 2DERA 4WJ5A 4G83A 3KHTA 1FN4A 3NDYE 5F98A 2P9KC 3U7IA 4YBRA 3JZDA 4ONEA 4MVJD 5CEYB 1ZIAA 4GECA 3VE0A 6REQA 4R4NC 2E1PA 2E6JA 1ZJAA 1TBGA 2VJQA 4RF2A 5KPJA 3A25A 4PCUA 1JDNA 1I80A 3JCZA 4JM4L 1GGVA 3L7OA 3FPXA 2X13A 4JKPH 1W72L 4L72A 1JKIA 2X6CA 4LLVB 4P92A 5CBEB 1D1SA 4C2AA 3QJGA 3HDGA 1OAZL 4GM4A 2YWEA 1CFTA 1VEOA 2E9IA 3COOA 4M1KA 5J1SC 2A59A 3QNXA 3JVDA 3FFWA 2J3JA 3VFVB 2DKOA 2QUAA 5D96B 5D1NA 3T0XA 1XF5B 4ZAGA 5BZWA 1NTOA 4D8UA 1KJ2L 3L0PA 1NYTA 5K09A 3MJ6A 1NZFA 1YMQA 2ASVA 3MOSA 3PLNA 4UQ3B 5JHBA 2NX2A 5SWZA 2V9QA 4R0LB 4KGXA 5JIPA 1OILA 3O8QA 3FOCA 4BAGA 2B0CA 2IC2A 1H3WM 2J1ZA 3ULUH 3QE2A 3ZUPA 4ANXA 3NHWA 1T4DA 3EDEA 4Y6PA 5B7GA 2VNCA 4BMNA 4M98A 4N2LA 1DQLH 2FCBA 3TZLA 4KX7A 4BKLB 4HCIA 3AG2B 3NCJL 1KPGA 2J7KA 2O8CB 3TEXA 2YS7A 2R8BA 1Z6PA 1U8MA 3RTAA 3X3GL 2XPGA 2VLRB 4JG1H 4RRPA 5BQOA 3GJ6A 5LGKA 1LEHA 3UMJA 4PCVA 2VHQA 3O4IA 1TETH 4AIIA 5H8WA 2QW1A 2YK1L 3UMBA 2UZPA 1LK0A 3LYAA 4G0WA 2XDWA 4NARA 3DL2A 1SB9A 1R9GA 3T35A 5EWJA 1XGQB 2EVWX 1VFAB 4I8XA 3D2TA 2XD4A 3BD7A 3WAKA 4QLWA 1TTQB 5TPWB 4OBWA 4L9LA 4S1SH 5NLLA 4JDTL 1CDJA 1K5NA 3V0VA 3EXHC 3D18B 1EUDA 1JPJA 3FN3A 3FCTB 4MUNA 2JF0A 5TMEA 3E0CA 3B9DA 3K05A 4PREB 2X4UB 4CKEB 3HRIA 4I2XB 4JDEB 3QYJA 4EO5A 4BB0A 1LV8A 4KREA 3SBXA 1RIVL 5CIPB 5GGSA 4GBXC 2VAAB 2GEBA 5HZGA 3BWEA 3VV2A 1L7DA 1ODLA 1KFAH 2H4JA 3TB4A 5CCJA 1AUPA 1B15A 3NT4A 4Z8FL 4YDNA 5FLXg 1QTIA 2ONYA 2QN3A 4HADA 3FZNA 4Y0VA 2GHRA 1P8AA 2J7PA 3O75A 5AJWA 4WSGA 3VFTA 3L7EA 3ELUA 4KH9A 3K6JA 3FUJA 3U09A 3ZHSA 2OXCA 4GW3A 1YB5A 5BRAA 3BJRA 2FWPA 4F2EA 3X43A 5E6IB 3EBPA 5F7OA 4LHUD 1VLMA 3A4LA 3WX0A 1NEUA 2QVZX 1H5BC 4YHZH 3EOYG 3VD0A 2EDJA 3KKLA 1SCDA 1CICB 4QQEA 3ZYOA 2VDUE 2CJTA 2AEMA 3RJZA 1QFWH 1MOEA 4FR2A 2NTJA 1WXIA 3GVCA 3KJ6L 1UMDA 1V9CA 1ZDSA 4IGBB 3MLXH 3Q6NA 1IC6A 1V10A 3VR4H 3R3ZA 1KGCD 4BQNA 3QIWD 3D12B 3O6ML 2B69A 3O8CA 1FLAA 1A9RA 35C8L 3DRQB 2HUHA 2VXSL 1X5JA 3DXMC 2YHIA 3BH9B 1JIKA 3GGGA 4MNQA 4Q6KA 3QELA 4XCFL 4F20A 2YPLB 5DJZA 4HCRA 4JJ6A 5IYZB 5GAJA 5BPPA 1XPJA 3QH3B 3MPCA 4HIXL 3WLBB 3PVZA 3WL3A 1W4LA 5KJEA 3GW8A 3JY6A 5FEBA 5KQRA 1Z5ZA 4IMLB 4ZYLA 3OJCA 3AWDA 3RGWS 2D3NA 2P65A 3L8HA 1RYFA 1JFTA 2H3NB 4C54A 1Z4PX 5GGVL 3WGKA 4Y2DC 1YOVB 3BAJA 3ESAA 4DJMA 3C7AA 2HNAA 2HAZA 1ZAYA 3JD4A 3K91A 4OA8A 3GKWH 4F56A 4HSQA 2I07B 3ROPA 5AL8A 4BU1A 4K3DH 3OM8A 5F5XA 5ENVA 4BXVA 4NNOA 2BEVB 4ERSH 2QMHA 4WN3A 4IKNA 4Y19B 3ULSB 1ZK0A 1UJCA 4TOYL 2OMYB 3ELDA 2GJAA 4C7MA 1CXLA 5FJIA 2V59A 5DHPA 4C56A 4RWHA 1DSWA 3IHKA 4I18C 3BORA 2IAMC 4YMTA 1LK2B 2V98A 2J2ZB 1Y3HA 5CP8A 4WCFB 3ZXSA 4D46A 3PKZA 4JGBA 1A14L 2FPPA 2Y1OA 3TINA 5JNWA 3O1LA 1JDPA 4Y1SA 4RGOH 4K2UH 1DVYA 4J3OC 4Y4FD 2X0UA 4YGXB 2F68X 4DKEL 3D4CA 1JAZA 5SX4H 2GCGA 5F89B 3RUGE 2YIMA 2Y7MA 4JL2A 5IC7A 4M7JL 1PE0A 3FOAA 1RUAL 3TCXA 3RVBA 1WZLA 4L29B 2N7AA 2P4SA 2QEQA 3U4QB 2LWIA 2E7DA 3GI9H 2EO9A 4I1PA 1G59A 1MCEA 3WJ7A 3EQ6A 3RI3A 1KYOJ 2D6FA 1JPFB 5DUBA 4JQSA 3A6KA 1XNQB 4KXMA 4KWEA 4QHUA 2G7MC 1QQDB 2XWXA 4ZT6A 4JSVC 1M6NA 1N64L 1DQIA 2VDOH 4YHMH 2RBGA 3PDGA 1NW3A 2OV4A 2EILB 1YNTA 1Z66A 3BPLB 3K9WA 2FWOB 2QRQA 2WU4A 4LDAA 1NEZA 2HF8A 2I76A 4JAMB 2RGEA 3DFMA 1TITA 2NTNA 5ESRA 3O1JC 4B73A 3MUHL 1WPXA 2H92A 1FC1A 2GY7B 4BNFA 2C20A 3PJNA 4MDJA 3H2IA 4FZJA 1R0LA 2COEA 4WENB 4L4RA 3IXMA 3QUXD 5FPQA 1UFRA 1ZRHA 4XGKA 4JFRA 3GDBA 5T8KA 4PJAE 2CBXA 1IN8A 5EIVA 2Y22A 5T1LA 1HG0A 1UMBB 1PSKL 4GMTL 3U3ZA 3KC2A 4OCRH 3CONA 4H7VA 3IKTA 2WBKA 4W9LC 3BGFB 3RTQB 2IW3A 5E8DH 2C0QA 4WBNF 1B42A 1OR8A 1BQSA 3U1PA 4RVUA 4HAGA 3I6LE 5LKNA 3LVFO 3ZD8A 2XGOA 3C08L 3N0AA 2BHSA 5AALA 2DPYA 3IOCA 1OT3A 5LQRA 3GU3A 1U7DA 3U2JA 1LWRA 3DUSB 4QICA 1FDLL 1UQRA 4Z4FA 3S2UA 3B1XA 1FNGB 3RWJB 1M7HA 3SO3B 4PW3A 2P8MA 4UATA 2OAAA 3GXFA 2VJCA 5D1QB 1HNFA 3RFZA 4JO1L 2WLLB 5FX3A 2QP4A 2YD2A 2O5YL 3WIHA 1NXSA 1RAFA 3KYIB 4BUCA 3FY4A 4RISH 1C29B 4V0QA 1JHTB 2P9PC 4CM9D 3C9NB 2H47C 4MPTA 1N36B 2QRHA 3ZT5A 1A9OA 1ZT4A 3LEVL 3U37A 4X61B 1KDRA 1KEVA 4ADJA 3EJRA 4ELKA 1D7OA 2ZDHA 3FT1A 4G5QA 4HBQA 1SOAA 5KSBA 3Q6FA 3KJ4C 4D0CB 2VJAA 2Q8BL 3MBXL 3OA0A 1OE3A 2ZCJA 3C0KA 1YZZA 1KJMA 2V1UA 3S4SB 5IM5A 4Q1DA 1NVKA 5JEEA 3AUYA 2HADA 4BH7A 4LBWA 4M21A 5JZBA 3BZBA 2VAJA 1U3TA 3FCSA 1KC5H 2F5BH 1RIIA 5CLFA 3IBSA 1XEUA 5F1KC 4ECNA 4AUEA 1IC1A 1MLBA 4OHUA 1YH3A 3H7LA 2R2EB 4MD5B 3LLMA 4G5XA 4X2UA 2FPSA 3UH1A 1N3IA 5EP2A 2JCCA 1O5DT 1K75A 1LNSA 1JNLL 3DIDA 4TVPH 3VU0A 2P5ED 4JC4A 1AS0A 2PNFA 4B45A 3GUFA 4HAUA 4EYSA 3AETA 3DKKA 2PIAA 4PAZA 4MI3A 3EEBA 4QDXA 1K0FA 1A7OH 1MFCL 1NW7A 5DTEA 4QFBA 3SSGA 3LZOA 3MRGB 3WJJC 1PJRA 4K7PX 1M54A 1BZ9B 1BAPA 4LTMA 4AQ1A 1YASA 1X7XB 3CIOA 2QJDA 4M1GL 2EBHX 3BWAA 4KQ4H 1LGVA 2WXNA 4KR6A 5AW7A 1X1TA 4BLSA 3IUYA 3HG1D 1H0DB 4LZAA 2OZEA 1BG9A 1QFPA 5C0RL 1KTDA 1U2RA 3VG9C 1O7DC 4LNUB 4C4UA 2YIJA 1LPMA 2W60A 4MDIA 1DN0B 4FEEA 1SCIA 4ZVMA 1D0VA 3NHLA 1DJWA 2M1KA 2GPBA 2RGDA 1ZLSL 4I1UA 2IH5A 2C1OB 4JHUA 1RZ8A 4LKXA 5I18H 2QRUA 3VNAA 4P5TA 2A0KA 3CWZA 4G5YA 3IDAA 2G8LA 3GFRA 1E8WA 1CBJA 2XVYA 4OD0A 4W1QA 2YPVA 1PGJA 2MQGA 4L3FA 1F0NA 4UHCA 4X8HA 2DW5A 3A6PC 2FW0A 4OHBA 4HS6B 5HSGA 3IXQA 3PNPA 2XBDA 4GM8A 1CB7A 2CKBA 4O2AA 4Q47A 3QS2A 3MHZA 3JU3A 3UVKA 5IS2A 1NQOA 2IADA 5IQ7L 5CAEB 2FPGA 1M8GA 1K88A 1TNNA 3FB8A 2Q76B 2PUQT 2QWXA 4TNGA 1ZMYA 4F3CA 5EA0H 5F3BA 1AE1A 5E8PB 3UVLA 3SS9X 3PNMA 1NKTA 2ODWA 5GZNC 3H87A 2JIQA 2Y1EA 5ANMA 1C0PA 3AT8A 2BSCA 4HJJH 4PAOA 2DQCH 2CLSA 3GFPA 3NTCH 3ABGA 3U0WL 1VFOA 1U6IA 4R8RA 3IFOB 5BNIA 3DJFA 2BCJQ 1RW4A 3V7DB 2W6ID 2F1EA 1T9KA 3BXGA 3G2JA 3I64A 3ABIA 5C7YA 1BF5A 1QFMA 5L0QC 3X2SA 1D2PA 1CFNA 3FUNA 5K0JA 3RVRA 4FG0A 3AL3A 3PX3A 4Q7LA 2Q41A 3R5XA 1ESEA 5CM2Z 5F7ZA 5AFU3 3VYVA 2VXYA 4AYFA 3BDIA 3LQYA 4PONA 1GSOA 4M5SA 2VF2A 3K2QA 5CCKH 5FYJU 4FTVB 1E5LA 5D51S 1EGVB 3NAAL 3OKKA 2WM8A 3TBBA 3UGQA 1QUEA 4XWKA 4GI3A 1A1NA 2Y2YA 1CY4A 4MSUA 5HA5A 5FYJL 3MRRB 1P73A 3MUUA 2JC3A 4BU0A 1T29A 2HT4D 5GONB 3H54A 3ARGA 5AVTA 2DM7A 3FFCB 4DZBB 5A0FA 2ZIXB 5BVJB 4DCVA 5CZKA 1DUVG 2DFTA 3CFUA 2AG6A 4FABH 1Q91A 5HHME 2WSDA 1O4VA 4MMZC 1GQFA 3EMBA 3T12A 1I6LA 1YEGH 1SXAA 3RS4A 3MOIA 1C9IA 4PV9A 4IICA 4HS3B 2E7LA 4RV4A 4GLRH 1UPAA 4LJSA 4F6CA 1XZQA 2H17A 4OV5B 1F8FA 2YBAA 2UVPB 3KQPA 3JUZA 1TEXA 4WNAB 2OVFA 3HZVA 3FT4B 4ZD3L 4IILA 5FJJA 5CCXA 3L3GB 4Z4EA 1LVEA 5C71A 1ZBDA 2PQ6A 4DW2L 3O38A 1T36A 4FFDA 4NU6A 4ENVA 1B6TA 4BO7A 1A2YB 4PSDA 1A9PA 1YZLA 5I6PA 3ORQA 4FZ8H 2YRWA 5EZLA 4NJAH 5L7XH 4ND8B 1GGBL 5B1JC 5DJYB 3UCXA 1AJ7L 3KXFE 5BV7C 4JU8A 3SQMA 3KYOB 1EH9A 3VHXB 3UGEA 5BMVB 2FQFA 4J86A 4Q52A 2WZPD 4MUFA 2VDLB 2J67A 1YR1A 3WDJA 1XRMA 4PR5B 4PWYA 5E1MA 5H35A 4ZMBA 5T57A 3B8HA 3OXRB 3BAIA 4XZ4A 4BJLA 1S6YA 5AKIA 4CG3A 5LWQA 5HFAA 1WFNA 4A37A 5HPOA 1MW9X 3UCEA 4NRZB 1FAIH 1F7VA 2FWSA 5JHGB 4QNRA 3QE4A 1OBVA 4IRSB 2IUSA 4XPAH 5HHQB 1HQ4B 3GLIA 15C8L 5HE9A 4BQ6A 4ABYA 4YT2A 1JOFA 3VTKA 2J8UF 3CNQS 1KV3A 3RVXC 2CU9A 1DBQA 1GVNB 4U7SA 5IZCA 3D7NA 1QFWI 3I5MA 2R4SL 2R68A 4ZTZB 4AN0A 3KZVA 2I7SA 1ZWKA 4EN3D 1BBDH 3MLTA 4J8RA 2CIKA 4MXWL 4I0WB 2YVAA 1L5ZA 4UBJA 2IUUA 3X12A 2WYOA 3NCWA 1CR0A 5AW6A 4U0JA 2JJ1A 3CZ9A 4QE3A 2WPNA 3TBCA 2FPLA 1JE6A 5ITZA 2XZZA 4RFVA 2C9BA 1RK1A 2NZ1A 3LMJH 4YZWA 2XN0A 1L5KA 3C4QA 3FSEA 4RMJA 2JEOA 2AZ4A 1NKRA 5AKRA 5J2UA 2F9FA 2AOWA 2X8LA 3IB4A 4ZUWA 4N8VB 2AWOA 4YT8A 4JRXE 3L4SO 2Z4TA 2R51A 2R4UA 4OZGA 1MVUA 1KGYE 3LRLA 1KFKB 5AFAA 3VXMB 5J2TB 2GRJA 4JT8A 4EW2A 3IF1B 1KI6A 3ME5A 3O2DA 3QQ4B 2OBMA 3EW9A 1E9OB 1GL7A 1MX1A 1TI7A 2FYYA 4CAGA 3RSZA 3PI7A 2P2NA 3D6VA 1HCYA 1YL5A 3DHJA 5DQDL 3WL4A 4QO7A 3WDLA 4AY2A 1HTYA 5F7XA 3JPXA 1C9LA 5CEXA 3ZE2A 2NYRA 3GQBA 4EIGB 1ID2A 2Q3FA 3H0KA 1U30A 3PAUA 2Y07L 4U31A 3HU2A 4HK0B 4YHLL 4ZC1A 3BP6B 2YPKB 1U3HA 2E1RA 4JVNA 4J3OH 3V9FA 1BXGB 3ZHZA 3VVCA 4BKUA 1QGAA 4URKA 4RPKA 3TZHA 2EXXA 3T9AA 3AKYA 1U8PB 1JHUA 4FJ1A 3ROZA 1KTKE 1U8IB 5IHPA 3CFVA 2JKLA 2QK4A 1IQPA 4XTRD 2CBZA 1OL0A 2HC9A 3WK9A 2NSLA 2GBCA 3F00A 1IFHH 1EGHA 2CXNA 3O2SB 5JW6A 3MKKA 4XVTL 4LPCA 5SX4I 5M3BA 4AKHA 3AY0A 2XKNA 4RENA 3BIWA 1TNMA 2J55H 1D0IA 3FPKA 3KEQA 1FMCA 5CYGA 5F96H 4RA9B 4M8KA 2ZANA 1QRNE 1AQYA 4KW7A 2VJPA 1C1DB 3QU4A 2FUG6 5I24A 1YB7A 3BUDA 5IBLC 3O3BA 1O95A 3O6VA 1UDWA 2X0JA 1YZKA 3LGXA 3NU1A 1ZFNA 2H1RA 3Q2CA 4XCYA 3MUY1 4H35A 4O4IB 1XEWY 2C2HA 2Z3WA 1HDGO 4IG9A 3SZRA 4U1LB 4XH2B 1YEHL 5LWHA 3NEJA 3VU3A 4AIXA 3T2LA 1V7ML 2GF0A 3V7WA 4L1DA 4J81A 4TSFD 3IJ5A 2R0LH 5A0VA 3PKJA 5HHOB 1TC2A 4C7JA 2ZUTA 2G6BA 1QLHA 4EI6B 1L3BA 3LW8A 3KB1A 1OSPL 2WNSA 4AIRA 1Q7BA 1A1OA 1TQDA 1SQGA 4X6LA 4PJ9A 3AB0C 2AXPA 5C0AE 1AGCA 4Y4HA 5H37H 4RL6A 4Q9JA 1FFSA 4IBQA 4BH6A 3PP3H 3B52X 1LP9A 1YIDA 1D6VH 1G7PA 5AVVA 1W8EA 4H0GA 1EHCA 1A6UL 1XWWA 4Q18A 3LNDA 4CN4A 5JPNB 4FX2A 3W1ZA 4BD4A 4OJDH 4L05A 3NW9A 4DP9X 3NYIA 1ZONA 1Q6YA 4CZYA 1E7QA 2VTKA 2WF7A 2X1LA 4EKYA 4CKBB 2NW2A 2Y36H 3EFFB 5FIEA 4M6OL 3W15A 1BQLL 1VOTA 3W8DA 2GJRA 1KY7A 4BH8B 2A73A 2AOXA 4K9EC 3SWWA 4NN6C 4KN6A 4YRNA 4BFYA 1FGNH 1TKWB 3QNUA 1ZD2P 3NIFF 4GIPD 2GC4A 2AOTA 3MC0A 2BCKA 2LR4A 2OORC 1EM8A 2FQ1A 3JYOA 4JSRA 1UYWH 1UOOA 5FV1L 1IVNA 1H0RA 3FDFA 5J1TB 2VZOA 3P2EA 4KTEH 4KAAA 5ALWA 1DG3A 1B0UA 3TG2A 5K1JA 2NY6B 2ZP1A 2IUTA 2WU0A 5LNK6 4PJBE 2OVRB 4IOSA 1M1YA 2R23B 1K06A 3FMGH 3LKQA 5L4JA 2XT9A 5DTRA 4TWRA 3QFRA 5BVPH 4O9HL 1Z6ZA 3PNWB 4DA9A 4W6ZA 3NT0A 1IOVA 5DO2C 1JR3D 1QRRA 5KNDD 1CTOA 1P1IA 3MA7B 2JI3A 1O8BA 3DMTA 3KHQA 2DPHA 1E9QB 1T2XA 2GBIA 5C09B 1B4JL 3GSUA 3TEWA 1G1KA 3BUQA 3IYLW 2EVJA 1E7UA 4J7XA 2ZIUB 1O7VA 4BQPA 1UA6L 2NXZB 4JX0A 3X3FH 4OGWA 3V1UA 3BP4A 4CMEA 2R25B 6YASA 2DQSA 5J89A 5KTYA 2DHCA 2XYCA 1SOKA 2ZG6A 1L6PA 4NLAA 4C0XA 4RJKA 4RGNC 1ZNYA 4GI9A 1SOXA 2CHVA 1ERJA 5FCSH 1LK7A 1L7NA 5CHEA 2XOEA 3OHSX 2PMEA 2BVQB 1FE8A 4UAGA 1GN9A 2A1WH 3VXRE 3NVQA 1RXCA 4NJOA 5KQGA 1F1BA 5D1ZD 4DV5B 4JM4H 1SBSH 4WW1B 1I36A 2R6JA 4PAGA 3U30C 1W72H 2EZTA 1MA3A 4JP5A 1XLVA 3I9LA 3ONFA 4APQC 3TA3C 4YFLI 3KH3A 4G67A 5IWCA 5DX1A 1RLOA 1OWWA 3MUFA 4TQUS 3UJPA 3F84A 5AVJA 3IVMA 2VTVA 1U4CA 1HE3A 3WNCA 4PJIB 1VA5A 1AFVL 2GTIA 1KJ2H 1XIWA 1UOQA 4N41A 3WTSA 5EMYA 2OGWA 4E41A 5IESL 3DVNB 3DGDA 3KQTA 1ZOLA 1KOLA 3VR5H 2BC4A 5JSYA 3WNIA 1YFJA 4ETIA 5F52A 2BFCB 4UF7C 3ZCRA 5AW4A 3NANA 3BO8B 4Y1AE 3H8VA 4IKPA 4L1KA 4NO5B 4ZZIA 3C9CA 1KXTB 2J0UB 4M1SA 4JRYE 5E7JA 1DOZA 5DMGC 3VKGA 1KPHA 1NLZA 2E49A 2X4PB 3IETA 1AA6A 3X3GH 3L17A 5B7FA 4BJHB 5GGRB 1R3HB 4JKIA 3PPXA 4H7HA 5I1DA 2QZZA 3MGBA 4YH6A 1GNTA 1RV6X 5DHMC 4LCIL 5AD0B 5KOJB 4KKNA 1XT5A 3MJWA 4H16A 5BSHA 3V5HB 1JKXA 4OJMX 5CO1A 3NJNA 2ZI3A 4HUWB 4I1OA 4Z1MA 2WXJA 4J03A 3HZMB 4OGZA 2GO7A 3IP6A 4MCHA 4WNQA 5JSQA 1FTSA 1RYZA 4P80A 4D9NA 5AVYB 2O2YA 2F74A 5EKXA 4LCUA 3BQUD 4BLQA 3QXWA 2YXNA 4RAOA 4E5DA 1OBFO 4N3UA 1MQKL 1USGA 5DMJB 1PYWA 2CE9A 2XACC 1QHXA 3ZUGA 2C9QA 2C3GA 3DA8A 2FWMX 1B0AA 3CVWA 4WVLA 3DCYA 2ZVPX 1XGZA 3ZLVA 4AMBA 5L3QA 4AV4A 2J59A 2GNAA 5E1HB 2PCXA 1FQWA 4EGFA 2DKSA 1M6EX 2NXYB 2ARWA 4WEQA 5EJ8A 2QUZA 3LPLA 2D2XA 5H4ZA 3BN3B 1EGJA 1DJMA 4LCWB 3LYLA 4KY1L 4ZQHA 4CM6A 1USIA 3DP7A 3P0GB 3GLTA 4N86A 2I67A 3BAKA 5E2BA 5EAMA 3W6NA 3NK4A 1P4BL 1MWOA 5L53A 3P4NB 2OYSA 1KVSA 1FYTD 5JS1A 3N0WA 3TXXA 2BVUA 1XXHE 3WWDA 1IAKB 2CCWA 1KZ7B 4UBNA 2BO0A 1RT9A 1QE0A 5JMTA 4L5AA 2GIYA 1W6RA 2QADB 1CRZA 4OLXL 3FDZA 3EQZA 1BSIA 4B5ZA 1I1HA 4BNDA 5TQ0H 3FB7A 2PXYA 4H1VA 3SIKA 5IEKB 3UJTL 1MGPA 4M6NL 3RNQB 4B9JA 5I0XA 1EZ1A 3KEGA 2Z7WA 4WI5A 1G7SA 1AGXA 2J0EA 3GRRA 3HDTA 5F1SA 1MU0A 2BV3A 1NDMA 3PRZA 4GXTA 3MO1B 3AWEA 1KAHA 3KJ6H 1C7ZA 3LRHA 5LUMA 3QFCA 2AEIT 3F5WB 3KS0J 3MNFA 3EYVA 3C6LD 1Q47A 4JFXA 3LHPL 3Q0EA 1WY7A 2XETA 3N53A 3O6MH 5HQGA 4GLRI 4JBSA 1OT1A 2BFVL 3VR3A 2C3XA 1Z7YA 4Y6LA 2W6QA 4JHLA 2Y06L 35C8H 4NJEB 2WUWE 3PXXA 3PFKA 1CV2A 3R09A 5BV7H 4YCDA 3VSVA 3ARDD 4P99A 2BZ7A 2DB8A 4WWID 1EEUA 3V48A 2J88H 3CRRA 1T6BX 2R00C 1CY7A 2XMQA 2JB6B 3I9IA 3T5DA 1VBMA 4JI6B 5DSZA 3UPDA 2I9LA 4HIXH 3L8EA 3NASA 3PUJA 5KAMA 2VSQA 1AANA 3HCBA 2IS6A 1SZCA 5ER6A 3ZV4A 5EF1A 1MG0A 1R88A 5D1XB 5CLQA 3HKCB 3SYNA 2UWEA 1T26A 5GGVH 3IEKA 2VBCA 3L0YA 3PX2A 4Q7KA 4ZMLA 2WP3O 4GOSA 2ODHA 2E4YA 3LBIA 5SZIA 1D2CA 3ZS8A 3RDTC 4WI6A 2WQRA 2GF2A 2Y3IA 1Z4NA 1K92A 5G1PA 1CUXA 1JSRA 2B4CC 2XGGA 2XYBA 3R7BA 3SZOA 3PWPB 1WV0A 3D4IA 2YMXL 3FAWA 3O21A 3R5TA 5FL7A 5ED0A 5E24E 2VXCA 1U2GA 4N5EC 4INJA 2PBIB 4W9JC 3C5WP 2H68A 2WLHA 5HI4D 2HLFD 4AVKA 4FTDA 5LD2C 3CUPB 3KDPB 3RWEA 4M1YA 4IBOA 3VCLB 3WLQA 2ICCA 4QA9A 1J42A 4W6YB 1D6EB 3DSRA 1RLBA 1SEQL 4P46A 3QQDA 2BHZA 3K6IA 4J0QA 5B57C 4RVBA 1QGOA 1U0TA 5HDQL 2G3NA 4X4MA 4ANKA 1VDMA 4FYVA 4MQFB 2QL5A 3G2NA 3IVGA 1ZNQO 2EWVA 1P19A 4PGFA 1OFUA 3LJ3A 4DKEH 1BWQA 4YDVB 1DRKA 3T4AA 1KDZA 2CVQA 3GPBA 4B4VA 5AK4A 3OL2B 1PZAA 3RL2B 1WLSA 5F0JB 4Z3FA 1MVLA 3WKNA 3KYBA 1DSFH 1UBOS 4KK4A 3CGTA 3BIKB 2W1NA 5J40A 3VOBA 2VN3A 1EUCA 1ISJA 2GT9B 1NI5A 1MJJB 5L2KE 3SOPA 4JR1A 2FLMA 3CKYA 1KJ9A 1AS6A 3FQUA 5A6IA 3BE6A 1NCUA 1W6LA 2XTMA 4BINA 4OUDB 5GP1A 3C8MA 3JAWA 2B1OA 3DE0X 1RFDL 3KPNA 1Z2EA 4PG6A 3P9IA 5I1IL 3V1LA 3I0MA 2K4WA 4Q4AA 3TNMB 3NRQA 5DM70 1VEMA 3GZTB 1VZHA 1ZVMA 3U9SA 4YSDA 3AF0A 2UV8A 5FHRA 2FAUA 1ASPA 3RY4A 2JAHA 3MWGA 3AI1A 4AAYA 1FFCA 4DDHA 4IDEA 1IQRA 1OP5H 3W0WD 3U7QB 1YKGA 1SR8A 3IUMA 3HB3D 1RPUA 3HMXA 2WWXA 1WZKA 3DJRA 4ELMA 3N1UA 4XDHA 3M46A 2R1TB 3ZU8A 1I6WA 2BRRH 2A67A 1PSKH 4GMTH 3KNBB 2APVA 1PK7A 2DIJA 1Z4OA 2PLWA 3STWA 1S7SB 5JCPA 3IIIA 4MZ2A 3V4UH 3NLLA 3QXAA 4LSRL 4KNWA 3WFHA 1ENOA 1MREL 4CUKA 2Q7AA 2XVLA 3RSQA 4W9NC 3SQWA 4EX7A 2P2CA 2HVBA 5AG9A 3C08H 2PZLA 2YBRA 4ZK6A 3H9HB 4FN0A 4HIPA 2NLJB 2F5AL 5CT9A 5D7NA 3ZBUA 1FDLH 3FROA 2C9RA 1UWLA 4GX2A 2ODTX 4FA4D 2FUKA 3STLA 1FSSA 3W6ZA 3T0EC 4Q9KA 4FMDB 3J7AC 4DLBA 4TYPA 1JSCA 4JEHA 4BO2A 2EKQA 4TL9A 2HVJB 5JNYA 1P5UB 3MBEC 5HHVH 5CK4A 3FT3B 4JO1H 3TUJC 4KLNA 3GHEH 1UXOA 1CDOA 2O5YH 4PINA 3SJVB 3JVGA 1D9XA 5HGGS 5E5MB 5C8ZA 2BP8A 1USKA 2ZRMA 1CLZL 4JG9A 3ZDXE 5G4LA 1XHMA 3LEVH 2F8VA 4ZBJA 2FSIA 3RK1A 4I0PB 3DHYA 4AK9A 3IDXL 3KLDA 4HIEB 4FSDA 2GJ6D 3OPYI 3OHMB 4FTWA 3A1UA 2CXXA 3EGCA 3KT8A 1MX9A 1IBRA 2V6MA 3NCYP 5EUOA 2Q8BH 4JREB 4EUFA 2ESVE 4A10A 3K0CA 4BNTA 1C2TA 3S81A 2GGSA 1QS0B 2Z57A 1CJVC 5G02A 2P6PA 3CZFA 5K03A 2F1OA 1QTSA 2TRYA 4WRLA 2Q6LA 1CVLA 2WG1A 5JPCA 1HTWA 1HOEA 4M54A 2PXCA 4EHAA 3ZE1B 5E0KB 3CIKB 4M0PA 4JROA 3SDXA 1J05A 4K9EH 2ENJA 3QWRA 1JEQA 4QHMB 4ZZFA 1GZDA 2GZSA 5F1IB 3IU4L 3UYPB 2CSXA 4DLAA 1E4EA 2ZCVA 1NGYA 5CLJA 1VLZA 5C6TH 3GIZH 3T1FA 2IKSA 1I7TA 4J0DA 4LFAB 1MFPA 4ZMWA 2CNOA 3CC5B 3KE9A 2ZSVB 3K6NA 3D43A 2OFXA 1YBMA 4IDNA 2B3TA 2QVTA 4F92B 2DBRA 4KQ1A 4R2KA 5F7LB 3BVWA 1L5GB 3UO1L 1KE1A 2ZAGA 3AM8A 7TAAA 5EM2A 1YMMA 1B9YA 4PJHA 1JXJA 3WK4A 1MFCH 2ZXUA 4FFBA 1AKPA 2FEPA 2VNHA 1U0EA 1KAEA 3O9ZA 1GY2A 3VD2A 5I5EA 4NAJA 1SAYA 4MJIA 4ALAL 4UQBA 1WIUA 4BFBD 4QOGA 1Y8QA 4OB5L 4LK3A 4E2FA 5IFJB 1KJYA 2YAOA 1DIAA 3WRXA 3OM0A 4M1GH 3NJKA 2IP2A 5HK8A 1SBBA 4ANFA 4K5OA 3P9WB 4DSNA 1PZXA 2ATVA 4JFHD 3E7JA 5EO1A 4NK5A 2L18A 2GTZA 2VJXA 3GSRA 4ZS6D 4LYYA 1H1LB 1C3OB 4LLUA 3VDMA 4JQIA 2ZX7A 2YD8A 2UZYB 2ECOA 4S0TD 5I4CA 4V2IA 4H6XA 5KSAA 4G07A 3U6KA 3VSEA 1TJHL 2FU5C 5FGSA 2D0GA 1CVRA 1MB0A 2FW7A 5HQ3B 4X5LA 1LV7A 2F53E 1T1JA 1NW8A 2FP4A 2XVXA 3X13A 4CVUA 1TKBA 3QPBA 3KQHA 1E79D 2CHXA 2RC6A 1LK3H 3FMIA 3QUYC 1MPAH 4AYMC 3RVTC 5KSVB 3L3HB 2DAPA 3GFCA 1NFDB 4HS4A 1GXRA 2IHTA 3D9AL 4UQLA 4BIIA 2VIRB 5DMYA 3WYFA 3WN5C 3EA5A 4OP2A 5KVFL 5C7LO 3RN0D 5GRXG 1EJ6A 2ZXWB 2OCIA 3V95A 4XMLL 3CR7A 1XF2B 2VDMB 4HYQA 1KYTA 2GZHA 3U7RA 3ZTCC 3P0YH 3G6JA 1NOFA 3MV7E 4P3DA 3PVSA 3ESYA 2C96A 4AWBA 5JC8A 3GARA 2WJ4A 3N55A 5ACMA 3U0WH 2XMDA 1JFFA 2YOAA 3RWIB 4DUWA 3JQ6A 3DKIA 3HUJB 1I2DA 1U7WA 1T6VN 2FZ3A 5BRQA 3PNBA 2WHXA 1JD9A 3B9QA 3LT1A 3O8OA 4I9UA 2IFTA 3ZWQA 5HK9A 4GYBA 5D2CA 3J7TA 1S8DB 2Y9PB 3ZZ0A 3V97A 1CZ8H 1R0BA 3R20A 2HPOA 4ARSA 2CGRL 5AW0A 3PHGA 1HSAA 4KWCA 5ICYB 4MJ7A 1R5BA 4HZLA 1Z5VA 1OW0C 4C6RA 4JGMA 2OCYC 4HYYA 1CFSA 3P97A 2PCJA 1BE0A 3ER8A 2REXB 4LGNA 3KPQB 2WSIA 1K7EB 2VP0A 3NAAH 4PC0A 4OLZL 4QG3A 1G2PA 3QA3B 4LFCB 1MXDA 5LN1A 1Z08A 2AI2A 5L9DL 3GBDA 43CAA 5DNUA 5FYJH 5M95B 4DEUA 4E9WA 3MG9A 5BOJA 3P40A 4N3TA 1T7YA 2O8VA 4RORA 4OQTL 2WQ8A 1P0IA 2FMUA 1EAOA 3K8YA 4KJYB 4ZEOA 3HHRB 3P11H 4HAOA 1YEEL 4M9ZA 4AUMA 1BFVL 3L4OD 4MR7A 5IQOA 5T1JA 1T5KA 4XX0A 3P2DA 5E1IA 5EZOH 1PDKA 4E3ZA 1Z2OX 2B1RA 1NBZA 3PNLA 1ABEA 5ALBH 5DLML 1UM4L 2IVZA 3VJ6A 3GREA 2Z2YA 2HXAA 1CP3A 4U8GA 5H4GA 4FEGA 1K4KA 2ZIZA 4H8HA 3FO0H 2LCQA 5CFNA 5L3SA 1F2UB 5MEOB 1ZA6B 4HWUA 5AKSA 5HG0A 4XOEA 1I7LA 3CVHA 1L0BA 5C07E 4XBEL 1BD4A 3KS9A 2H5IA 4EGAA 1EHYA 2ARJB 4XRRA 2W0MA 1E2NA 2Q3JA 1VFMA 1ZD6A 1YUHB 3RUCA 4NUJA 4ND1A 1P2SA 3GUYA 3FQTB 2EAUA 1NI4A 4N0EA 4O2FA 3G9TA 3BPNC 1U8QB 2PBFA 3JWDC 4IRMA 3T9EA 4NNPL 3ONDA 1HT3A 2OV3A 1QSFE 1DC8A 1CJUC 1H6DA 1KK0A 1DI0A 1R8JA 3WL5A 4AY5A 1FFNB 3QEQA 4JZNB 2HO4A 3UTTE 2VJNA 5BSGA 4FLRA 3SDSA 4XRGA 3TTUA 5EFIA 5CEZH 4G56A 2XNDA 5DHXB 3LXUX 15C8H 2PMBA 3LO8A 2OX5A 2NW3B 2HXGA 4M00A 3S29A 3G3EA 2VEDA 2AV6A 1K8DA 1UZNA 1DLHA 3ISRA 3KXDA 1SHSA 3PXUA 4MUJA 1JZEA 4L3GD 4JNKA 3V5WB 4LE1A 1CI5A 1U80A 4MXWH 2QT6A 1WEJL 1M71B 3SHWA 3DIVA 4L6CA 1DQRA 4X6CF 2IY8A 1EPFA 2PGJA 2F9LA 5B8CC 4LDRA 4EJ2A 4IEFB 3QI0A 3BXHA 2WY3B 1ZXBA 3HZRA 1JTDB 3DDFA 3I2CL 2HRRA 2NYKA 3IDJA 3F49S 4JOBA 1PG7X 3AU1B 1S7RB 2LVEA 4OFDA 5HJ5A 4DPKA 1XIVA 3HJNA 4ZT3A 3V7AG 3ZBTA 3A6CH 1GXEA 3BEWB 3KR3H 4L0PB 3C3BA 3S8FB 4RPLA 2B14A 4S0ZA 3FUDA 2FVXA 2EIBA 4NYMQ 2R56L 1PR3A 1Y80A 5FHBH 2FPXA 4Z95L 4WJG3 1WWKA 2XR1A 1JPNA 3L6EA 4NU0A 2QAJA 1HE4A 1WWWX 4TV9A 1A9BB 5DQDH 4BEWA 4LK4A 4OD3H 5KOHA 3S28A 4UU9B 4F9LC 5LC1A 1FPQA 2XUGA 2ACKA 4HQLA 4KN5A 4P49A 3KCPB 3FDJA 1FX1A 1ISGA 3JS5A 3AEKA 4ES8A 4R9HA 5IBRA 3EGVA 1CDIA 3OO1A 2AXEA 2XCTB 4HEA6 1KLFB 3P45A 2JD1A 2VT6A 4NO3B 4R2GC 3KHUA 1KEGH 4KPHL 1BFDA 4BNIA 2DGDA 3M1LA 1CY6A 1NM5C 3L8MA 3BKYL 2IHJA 4YTEA 3L6BA 4LF9B 5LSAA 3D4GA 3I3BA 1UCFA 1FCCA 4F12A 1FSPA 1WL8A 2B61A 2LVCA 3R7QA 2V5AA 2A99A 1E9BA 4R9RA 1ZHBB 3QU9A 2HHCA 5BPHA 1SXHA 5LLIC 4YYEA 3KOYA 4BO5A 4XVTH 5FKJA 1JPVA 1FFAA 3HHEA 4BZ2A 4DIMA 1N1MA 1HLFA 5EKUA 1HT2E 3L4JA 4KE8A 2BS8A 1HORA 3C1TA 4IDGA 4DEVA 1AKJB 4LIQH 3OPQA 2OY0A 3T8XA 5CIYA 2P62A 3DVAA 2EBFX 3GAAA 2DH6A 3LF2A 3ABMB 4JQXC 4FFVA 4EHBA 4YWJA 4ZTEA 3IDMB 1JGVL 3IJEA 5CFHA 1FORL 4PJCE 4NBMA 3DLHA 3I1YA 2WE7A 3WFEL 5A3JA 1A25A 2EJVA 2C9CA 2IPLA 1AGNA 3HRZB 2EIZB 3CO5A 4JW3A 3GFGA 1JGEA 2RGYA 3CX4A 2MT9A 3RJDA 5C0FA 1DNPA 2AFIB 1GZ3A 2XUZA 5KBLA 5DSCB 4NNYB 4YRJA 2R7LA 2PO6A 3H9EO 4XUEA 2BY4A 2XN9E 4YUXA 1PTJC 1YEHH 3NIGE 3QIUA 1V7MH 3DGCR 4N3AA 7YASA 1DBIA 2W6JD 4PWJA 1W4ZA 3MV9A 5CR8A 2O2XA 1O87A 3DTXA 4MCZA 3VFGL 1NVEA 1CC1S 4PS8A 5JAPA 4Y1EA 5CVDA 3DULA 2DQ4A 1J9SA 3VH8B 1OSPH 3T4UA 2V6JA 4IAOA 1U95B 2QVXX 2DN7A 3HCOA 3HY6A 3P54A 3O4VA 4W82A 5AHRA 2NY5L 5DP2A 4FFWD 5EMJA 3L6OO 2XZTA 3ABKB 2WJ6A 4H1LB 4BAZA 1HFEL 1I8LA 3FPYA 3W5HA 421PA 3FTFA 1KCBA 1A6UH 3LNIA 5MERB 4O5OA 4NYLB 2J9FA 1WD9A 5DM60 5ELIA 2XZDA 4JC0A 2CB9A 2JAQA 1F6DA 3WTBA 3IOEA 4FGUA 5GQSA 2DS4A 2Q46A 3QKSA 5KKCA 3WIFB 3OCZA 4NO2B 3G9QA 1H2WA 2VDQH 1P0CA 2I2BA 4JR2A 4PE5B 3ISTA 5JQGB 1OXKB 4IVPA 1ZSYA 4QQKA 5CVVA 4B8ZA 1H15B 4BLOA 5ERGB 1ZT7B 1D9KC 5ID1B 1EAQA 1MNNA 3AK4A 3ZLTA 3I01M 3PA6A 4DLTA 3GLKA 3V6FB 3IEXA 1M0SA 4ENZA 1YE3A 3SQLA 3V4SA 1V3TA 1ACZA 5FWYA 2XG4B 3P4UA 3TT1L 1F17A 2JI4A 5L7YA 4ZCMA 1E92A 4J9UE 1EAPB 2JKTM 4JMLA 5CU5A 3RM3A 3I76A 4AJJA 1UMCB 2ZJ3A 4Y2OB 2MSKA 2RGSA 2PWZA 1K6QL 2WLNA 3ZH9B 5I47A 3BCDA 1OTYA 1VSCA 3AINA 5J4MA 4ALAC 4KGJA 3GWGA 3L7CA 5CXSA 1N5AB 3H2KA 4YDLC 1QQAA 3EOAA 1AV6A 3LTVA 2IXDA 5C2BL 3E6AA 1L5RA 1B4JH 3OZBA 3BIXA 2G40A 3DTYA 1SVZA 4HEMA 1GOHA 1D04A 1KMIY 1J18A 1UA6H 1P75A 5DJCA 3KYDB 3N1GC 3T3DA 2MMGA 1JU4A 1FZJA 5EULV 3QJRB 2DWSA 4U2DA 1AZBA 4DCQA 1NG9A 3EXEB 3NFNB 3RDJA 2CSUA 1BE8A 4AJHA 4OKNA 4A3SA 1USVA 4KTVE 3VRJB 2V3FA 1KXQA 2FATL 3JX9A 3THWB 4Z7IA 4ZYKB 1MFZA 5HE2B 3UDWA 3H2WA 5CVCA 1KAOA 1TJ5A 2PLRA 5IHLB 4N3BA 1DARA 1P1JA 4XNBA 1N59B 3ZGXA 2WU8A 1CGYA 3D81A 4MXVE 4PN7A 4YSTA 3OAWA 2VW7A 1PFCA 1C7IA 2EXTA 2JLSA 3HE3A 1KCUL 1K2WA 1UKSA 1N2ZA 1TENA 4I8DA 1AB6A 5FUWA 3MSPA 3WNDA 2JJSC 1BF8A 3NZUA 5F3FA 2CBPA 1CF8L 3LZFH 3AVVA 5D8DA 3PGDB 5MN4A 3NV9A 1S8OA 2VZ3A 1L3WA 4XPBH 5IESH 5D5PA 1KA9H 1NF2A 4Y2QA 4GLLA 3ZBPA 4UTBL 4XCEA 4QXAA 3IJSB 4PP1C 1UURA 3IQGX 3LCJA 3BESR 4ZJPA 3CRQA 5DNYB 4HUCA 1BSVA 3FWPA 4E9VA 2BTEA 4DIUA 1B8NA 3NXKA 3ZZ1A 1ZHOA 3DZDA 5IMOA 3I6LD 2YNPA 2WKOF 4R3WA 3DOFA 3VI3F 1QFXA 5L40A 3BGWA 1FFYA 5LXTA 1CFVL 1YKFA 2EH8L 4YL4A 2VUTA 1FFRA 1PUJA 4K55A 2LIVA 5A2GA 4CE6A 2Y68A 5A05A 4B0PA 3T38A 1LW7A 4WOBA 3U13A 2ZPUA 1KXJA 1IAQA 1UZ8B 3ZG6A 3IVRA 2J6BA 3ULVE 3LIUA 1X9UA 3S1SA 1IZYA 3C15C 1IJKA 2IYOA 1IGML 4L5YA 5JPDA 2AYZA 4W6WB 1V5GA 1FYDA 2ECPA 4JFEB 4GRAA 2XTSA 1LF0A 3A4MA 5ESAB 1Z2PX 2DUMA 1LTHR 2E75C 1XAIA 1J8MF 1QLEL 3DBLB 2OQRA 1FLTX 2CHWA 1ZVSB 2IZZA 1SM3L 3GRUA 2QENA 3H11A 3RT7A 2HCZX 3PUKA 2WF9A 2JTYA 2WQAA 4Y89A 2Q10A 4B6QA 3KM0A 5B38G 3JZNA 3QUZD 1Q77A 1P4BH 3CH5A 3DGEC 3HE6D 4WO4A 4Q9LA 3C6ZA 2FNWA 2AOUA 3NBKA 4MPPA 1IG0A 4JFZH 2DMCA 5D4QA 3FRUA 4HAZA 2EGHA 3V2HA 3BTVA 5E3IA 1G20A 1WSBA 3FKJA 3EJUA 4WI7A 4D9RE 2P48B 4KRLB 5K0LA 1F6AA 3NVAA 3NDZE 4MWSA 4NV3A 1C1EH 3QDME 1YA6A 1RUKL 1W6UA 1C5BL 3N50A 3O4LB 3Q8AA 4HUVA 3GMIA 3QPUA 2C42A 3WOHA 3C6EA 2DJSA 1AZUA 1U0RA 3UJTH 1Z4JA 4M6NH 2J8HA 1IHXA 4C08A 2YXBA 1T80A 1HQCA 2DAVA 2YNMA 2UZ1A 4ZKEA 3V8RA 4HJUA 3FHOA 1DJGA 2C03A 3ABQB 1UBSB 2ZJ2A 3M7FB 3KGSA 4JUAA 1G8AA 1J0DA 1MOQA 1ZGLA 4EZEA 3BZ4B 2X28A 3AAZA 3ZVNA 3VJRA 2BY2A 5SWSD 3WLOA 3QY9A 1NVWQ 3WIOA 1U93B 1HFKA 1NJ9B 5HXAA 1WBYB 2BFVH 1O94D 4F1JA 4ES9A 2BNRE 1YR2A 2BFGA 2VWGA 4HH9A 2Y06H 2B8WA 4LPKA 4ZFZB 2HH9A 2D03L 4MJ3A 4GDFA 3QDJE 4WI8A 5TK4A 1RYEA 2B78A 1PFVA 4XNMB 4QO8A 3SPJA 4Z0NA 1UEIA 2DZEA 3ZTTA 2ATKA 4JV5B 5J43A 3NVXA 4K9PA 3UUEA 2AGLA 3JWDH 1B6UA 1ZGAA 4WJLA 2A6KA 1KB5L 2FF7A 4PM1A 1JSZA 3CVJA 5JJBA 2WNXA 2FN9A 3ATAA 1XEDA 3H4VA 1EP1B 2CDAA 3VKHA 1E4VA 3TUIC 4RGBA 5CT5A 1N5KA 3VB9A 1EANA 4XWYA 1BW9B 1MNAA 3C1AA 2Q2LA 3T8YA 3ILDA 5F7NC 1GNPA 4CVXB 2EX0A 3U5ZB 3IEMA 2YR3A 4AYDC 1FL6A 2VDPB 2EBWA 1H6EA 2Y1AA 3DV4B 3U4GA 3GRVA 2YMXH 2LTQB 1DRVA 5TT0A 4EKXA 3CFYA 1W30A 3U4KA 3IR7A 4Z7UA 1A4JA 2A4ZA 2F90A 4H44C 4MZXA 2XI9A 3ULUF 2MMXA 4WTZG 4G1MA 5HKLA 3TVMD 2XA3A 1QGZA 1M67A 2IYQA 3PHLA 1MCIA 3NQKA 5LAXB 2C7PA 1IU1A 2FGJA 4IBSA 3SJAA 4BV9A 3MRSA 5JZOA 1D6JA 4PJEF 2RH9B 5HDQH 1O9VA 4JPIA 2AHIA 2M2IA 4PS4L 1T3FB 3AKCA 2ATPA 1CG9A 5EOCH 1CUEA 1YQDA 1OFTA 4LF3A 4H7FA 4UUPA 4XLLA 1KIUB 2CL6X 2VDPL 4G1EA 4DV4B 1BJ8A 4BFIB 4YWGL 5CJ5A 1PWEA 4OZHB 2XTJE 3P9CA 2YD4A 5JUEL 3AMLA 2QR2A 5BQFA 3DE4X 2ED8A 4R2JA 4ZZ2A 3BKJH 2O06A 3V5DB 1II0A 1CETA 2YYYA 4PRPB 4UCFA 1CBUA 1DCLA 1NSTA 2C54A 1NC1A 1EK2A 2C5BA 3QCTL 1CYXA 3M81A 2JK0A 2PWAA 4NQXA 3CSFA 1FUYB 2WTRA 4P23B 2DLFL 1YZFA 1RFLA 4GEKA 3OKOB 5DD3L 4WUUA 2WKGA 3FLAA 5IAGA 4KITB 4GYWA 2X0RA 3SSMA 4GQ2P 3FH5A 4DZZA 4BCYA 3FHEA 1P1FA 3PQYD 4YIQA 3ZO9A 4LOAA 1PCSA 1FU4A 5HHMD 2I29A 2BIIA 2Q8QA 3T1QA 3C5SA 4GSQA 3BSZL 4N2MA 5GRWA 2OMNA 1LE9A 2EUXA 1ZNZA 5G1OA 3CF4G 4BRZA 2CF6A 4KFSA 4RA6B 2ZU6A 4DRYA 3GAMA 2HSIA 5DC2A 2F61A 4B2PA 3N5AA 1JIJA 3FOWA 3R0XA 4PG5A 5FUMA 3RR2A 2KC0A 4LSRH 2DEUA 1ESZA 1MFEL 2IGLA 1VECA 2ZYDA 2GYVA 4YR6B 3WNKA 1IB6A 4FNTA 4CQLA 2C2ZA 1YS6A 4C6HA 1NY6A 1B6RA 3KPYA 3NSXA 1SHYB 1AUQA 4CLRA 3U7HB 3FCEA 3KXFD 2GYYA 1NUGA 2L2QA 2HJFB 4QYTA 1QP8A 4MR9B 5JRJA 1A04A 1HSOA 3GJ5A 1E6EA 2FQEA 3W2DL 4QRSA 3W82A 4M3HA 2F9MA 4C59B 1A9EA 3RT9A 1WV1A 2I3GA 2NYYC 3I50L 5JOFA 1PJ9A 5EARA 4WU5A 1EHKB 3HB9A 4K1XA 2Y71A 4KV5F 1LB1B 2DTML 2WU3A 4Q9QH 3VNBA 2XCOA 4AP9A 1C9SA 2Z2PA 5ES3A 1AG6A 4U6HA 1L4FA 4JL1A 2IZ0A 4YPOA 2VSKB 3GPEA 4WQMA 1MI5B 4LWZA 4FQXB 4D0RA 1WQVT 4P34A 1O5IA 4IFIA 1K2DB 4N8VG 1EDDA 3RFGA 4RMSA 4IR7A 5AW3A 1ORSB 1OGIA 2GWHA 5IFAL 3TH3T 3NIDB 3O47A 1QC5B 3INOA 3FTCA 4GR5A 3HC0B 1Q0YL 3QFDB 5TPWL 4LOFA 1HTBA 4YQXL 3ZTWA 2ADIA 3KOWA 1HYEA 4MAYA 1TM7E 5DULA 5TQ2B 1XCPA 4LNRB 1KCVL 3CX5K 2QC5A 4IBLT 5E9DE 1H8OA 1GPYA 4OQXA 1O2DA 3BD6A 3SKJH 2GW5A 1GKYA 1VZ2A 5HYSA 1KIAA 4QHKI 4UB0H 3L3OB 4LNAA 3GZ4A 4EJSB 3SYKA 3IU4H 4QAWA 1G1OA 3OTWA 2DMBA 5FOXA 3UAJA 2BMKB 4YV1A 3QUBA 3NWOA 2Q1EA 3QDGE 5B58T 4RRPM 4JRXD 4K9NA 4P4NA 5FHAL 3V1KA 2GKIA 1QA9A 1FPMA 2O2DA 5IASA 3OETA 3UB3A 1JV5B 3FKSA 3HE7D 3WY4A 1D07A 2WF8A 1RQNA 1YB2A 3LZ6A 3L9EA 1QQ5A 1SY7A 5BSKA 1VG8A 1M7DB 4PHCA 4PQXA 4G8EB 1ZK4A 3VZPA 2ZS7A 1QRUA 4XWOA 2OCCB 1C7EA 4ALAH 2I4LA 2XOXA 4DMHA 3PDOB 5I8EA 1V7QA 5DLLA 2BBOA 3ZTYA 4RX4D 3MLAA 1KQNA 1EEYB 4OB5H 1EX7A 2ODEA 1J20A 1JGTA 5KVGH 2CC2A 2GBVA 4D99A 4Q3DA 2D1TA 2IDZA 4ENWA 1TJMA 4PRAA 1X7YB 1QF7A 5CJXA 4G8IA 1WBBA 1QBBA 2RIKA 1ZU5A 4BE6A 3S2SA 4DJ5X 3JWNE 4EELA 3M5WA 2BP0B 1H5QA 2M2DA 3DP9A 4UU7A 3RADC 2VO5A 4F11A 2GXUA 2OSVA 3TNNA 3GNQA 1X1AA 2AQ5A 3SDAA 1KDJA 2TMKA 5HD8D 2CKDA 2DWQA 1TJHH 4I85A 5ID0A 3T9BA 3F96A 2R69H 5LCVH 5IB5B 3GWJA 3ML1A 3RL1B 3HKEB 1A9ZA 3ANTA 3CNOA 1BCIA 5TGBB 5GRYA 1SN0A 5HVNA 1CF2O 2LLNA 3DBHB 2QZQA 4L8SA 1QRND 4K9OA 1FIEA 1Q1JL 5C0DB 4CDGC 2GVNA 4XC3H 3GBPA 1H2ZA 3M3DA 2PWHA 2NZJA 2DWXA 3WTTA 3L45A 1KYQA 4YMUA 3Q3GA 4UBDC 5KVFH 2WAQA 2E9GA 1AZWA 5LOVB 4OLHA 1QHOA 2MSCB 1CUOA 5K0CA 1FP4A 2IDFA 3RA7H 5JHLL 3ONVA 5CCBA 3OSVA 3SLGA 3OKFA 5FBKA 1QKKA 2DCMA 2D7OA 2R6DA 3DM9B 2QN8A 4V0SA 3N85H 4GRLB 3GDFA 5B58C 4MUYA 4NI3A 1IBSA 3S2AA 2EFYA 4UV7L 2WGNB 3TW8B 5DGRA 4H20L 1V4NA 3SQNA 5J0BA 5GMKn 4JK3A 2G30A 1SOSA 1C08B 2PSDA 4AECA 2SCUB 5C0AD 2ZUQB 4TRMA 3IU3B 1A7JA 3V6OE 4J8PA 1RXIA 2CA3A 3JQ8A 1JLLA 4LL4A 3WGHA 4XVJL 1OMOA 2O61B 3RKPA 1T2FA 1XD8A 1BA3A 3KV1A 4PLNC 3VVBA 2X9YA 1SUFA 3O3AB 1KY5A 1O1YA 2C9VA 1GHTA 1OBHA 4JHBA 3BDAA 3RGVA 1TO5A 3DYVA 1U1CA 4S0XA 2VDRH 3FUKA 1FS5A 4HJXA 4BN4A 5L9DH 4AOFA 1FNBA 4OYLA 2XZAL 2EDQA 4RD4A 1JG1A 1DDIA 4Q7JB 4YPGA 4QOIA 3EXIB 4MYSA 1EXGA 2ZUFA 4HIQA 4MYUA 3UWSA 1BFVH 5HJBA 1HE1C 3TO4A 3E7WA 4CC9A 2ORIA 1II8A 3HNVL 1JAHA 3KYKH 2D7DA 1F4WL 3JT2A 4Y9GA 5CGYD 4YP7A 3KPVA 3QG7L 5IJDC 4M0UA 1BCSA 5DLMH 1GZPA 4EKEA 3MXTA 4KQ2A 2K3TA 5I5GA 2A1UB 1MJUH 1LSJA 2I8AA 4F1WA 3LO5A 3MV8E 4KI5E 1ZWIA 2RAVA 2L19A 1N8ZA 2REBA 2PNDA 5K59E 2SKEA 4NHOA 1OTXA 5LLDA 3IMVA 1E66A 4XBEH 3TR6A 4FYQA 4PNEA 1VHTA 5I8OL 2OMVA 5JE8A 4ODWB 1OOWA 1RYDA 2OBFA 3FYUA 3U4IA 2NNWB 1P4JA 3N2NA 3OF6D 1UXLA 4YL9A 1Y3IA 1SUWA 2DWPA 3DJYA 4KRYA 4OFZA 3ZT7A 4ZXBC 4KE9A 1C12B 2FHPA 1JYFA 4IOFD 4P58A 3HNTH 2VT2A 3IE2A 2A5YB 1XAUA 4ESKA 3A6BL 1XZWA 2AMLA 2G17A 3TX4A 3N8GA 4QGYA 4RGQA 2AERT 4N26A 4NNPH 2XGJA 3FCXA 3I74A 1A88A 3H6JA 2J25A 4F8OA 4AZ0A 1PW7A 1R5MA 3ED1A 3HI6A 4ZJ9A 3CT4A 3VXRD 4W4NA 1PQWA 1T1XA 1E6OL 4ZSOB 1Q4NX 3IN2A 4B7LA 2YRBA 1QYCA 5K69A 5M34A 3PWNB 1RRCA 4M7RA 4DP1X 4DWVA 5ACZA 2BM8A 4J3UA 4Y5XC 4KDWA 3NAQA 4BFOA 4G25A 2FQXA 4LY3A 4IS2A 5K0ZA 5TDOB 1JK9B 1KSJA 4WVRA 3U4DA 4E70A 5G4KB 3NR2A 3GJ3A 4YJ3F 5KQSA 4HIJB 1KRXA 2VLBA 3R41A 1UBEA 3UA4A 5KJ1A 1N92A 2O5CA 5PCYA 3I2CH 2RHHA 1USWA 1R3KA 2J5RA 5DHTA 1IBGL 4BV8A 3OQIA 1BXUA 1MT0A 1FRNA 2A0YA 1Z5LB 5B38B 1TUBB 2FAXA 4R7DB 3LDGA 3D09A 5T3XE 5C0JB 3I9V1 2AXWA 4Y1AD 4G82A 4G97A 4HTFB 3WUWA 4OQEA 3WB9A 4C5CA 4MZIA 3U1QA 1FEZA 4EY4A 2POCA 2AVGA 5KQLA 3QFJA 4HQ0A 4LZNA 4JO4H 3DMRA 1WCBB 4Z95H 5FWRA 5MENB 2JKSA 1M6WA 2AQSA 2IOYA 2Y7QA 4JRYD 1PL8A 1F41A 4O58H 4DQOL 1T22A 1HURA 3AS2A 2O8DA 4MA4A 1A4KA 1JU9A 2B9AA 2MPAL 3VNQA 3G04A 2CLOB 4KK9D 4RQQB 2XX1A 3TSZA 2ZBFA 4GE3A 4ODVH 1TT7A 4P5SA 3GMNB 3EVNA 4IKOA 3L6FB 2D2EA 1S3RA 2XIJA 1WA0X 2XWBA 5HHXL 3OVMA 3MHTA 2Q20A 1SIBE 2WXIA 4PSPA 5A2CA 4KPHH 4FMPA 3D7RA 1DEDA 3GB7A 3WL9A 5DHDA 4R7VA 3S8MA 2WQXA 4DV2B 2OSWA 4JJ7A 1WHOA 1QH8B 4E1AA 1P7QD 1N3YA 3HN2A 3EYOB 4PV7A 1C9KA 1UBFA 3MRMA 8GPBA 3GC3A 4TTDD 3MZKA 4RDQG 2BFFB 4QJ5A 3QX3A 2QXUA 1W52X 2R5FA 4KK8C 4UYPA 2CYBA 3ABLB 1HOXA 3TJRA 3TQTA 1P84J 4HAXA 2P9HA 2HIGA 1YZVA 4BXOA 2P8SA 1RMFH 2DBYA 1IH8A 4GWGA 3VTAA 5K0BA 2VQ1B 1KULA 1OASA 1I32A 1Y1QA 5ALMA 5KYWB 5AR1A 1FORH 4UDUB 1G6Q1 5D96C 2GC7C 4EEEA 3DLPX 4JJ8A 3MTAA 3OQNA 1DPGA 3GVIA 1I9RL 2EDDA 1NR7A 2AN1A 1ZCZA 4U2BA 3D1LA 3QLVA 3UPRB 4R0LC 1SXJA 3ZOKA 3UOGA 4OLVH 3HVJA 4KX9A 1NCWL 1GOTB 4DGQA 1ZH4A 5I7VA 2WBJB 5HEKA 1BMZA 4KGLA 3LNGA 1U9YA 2WT9A 2FT6A 3D0LA 5BQ5A 4HVTA 3HCWA 2OCAA 4LVOB 1Z62A 3U2IA 1QE5A 3VFGH 5IN5A 2PGAA 2EIXA 3UVNA 5CLGA 5LN4A 1Y6ZA 1IBKB 4MGYR 1O9WA 2Q0ZX 4CEIA 5KU7A 3MLZL 2YA2A 5F12A 4G1BA 1MZZA 4L28A 3STZA 3EPLA 1FS6A 5FUXA 1A5AB 3PU7A 3ZDYE 3OI7A 3KHOA 2F4VB 1OP5K 3M8OH 2JJQA 4NMLA 2VTBB 4ZCSA 3MGOA 4GICA 1YMUA 3AF4A 4BFEA 3OKEA 2MOQA 2P9TA 1J2RA 1IBFA 4TROA 2X4QB 4UKDA 4GT1A 3IH5A 2BSQA 2J72A 3G82C 2C5FA 5I9MA 3KD4A 1P6QA 2ODAA 2SEBB 2HCFA 3QEMB 4G9GA 3MN8A 4PRIA 3UJ8A 2IJGX 3T3MB 1M76A 4X4KA 1OKKD 2YLKA 1OWMA 1M1SA 4F1ZA 3DOCA 4BV3A 2ZOKB 4DCTA 3KB2A 4RH3A 1W2HA 3UGUA 2OL3H 4KGDA 4LJ9A 3B5HA 4JT4A 3P9MB 5EFOA 4D7AA 1W4BA 1CQYA 1GUYA 1MDBA 4BDTA 4FQ5A 4MPRA 4BE5A 2XWZA 1EZ4A 1SM4A 2A9FA 3GLFA 1J10A 5E1DA 3NJIA 1QVOA 3RZCB 4BHUI 1XH2A 3TT1H 2I60L 2GARA 3G8BA 2GASA 3EGXA 4GW1A 2A0LC 3LHAA 1UTCA 3DSNB 1BBJB 2CK3A 4YK4B 2O2IA 5GSVB 5AKXA 1K6QH 3KZ8A 2PPLA 4PFKA 3KSDO 4RK7A 4CF4A 4YP1A 1I0IA 1Y82A 4PY8J 5JLZA 2DWTA 5C0NC 2XWSA 2NR6A 3PDIB 3UZVB 3T0WA 5E6IC 1YJAA 3I8SA 1XKLA 4N8CL 4NBKA 1PZ2A 1TVMA 2WZ6A 4MYRA 2ZB3A 2TRSB 4JT9A 1XVSA 4AUNA 3K8OE 4Q6YA 1YBFA 3VDAA 1NLBH 3N2GB 3H1AA 5ALFA 2V6IA 2AVNA 3CXHJ 4IGBC 3L1IA 4ZVRA 2Z5FA 2YZNA 2WZDA 3H1ZA 1YU6A 3A06A 2OXIA 3OMXA 5L2KD 1AVTA 1PLCA 1C3EA 4UIMA 4J3OF 2O5EA 2BEWB 4EW1A 4X7TA 4HQKA 2FATH 1GRQA 1ZH2A 3U60B 3LMKA 4HFMA 3WJMA 1AZZC 2VDLL 1E2EA 3MRPA 1VBNA 4P2OD 1AE6L 4I89A 4LX0A 4RFSB 4EPTA 1KBKA 4KX8A 2ZSDA 1AUXA 1C4WA 1Q6ZA 1GJWA 3H9ZA 1PLLA 4FYIA 4X8JB 2MCAA 4AG4H 4BMDA 3UK7A 2HQSA 3D8SA 5FH9A 1KCUH 2WM2A 3KWFA 4CNBA 4DM3A 4MZDA 2YGPA 1RYBA 2BCJB 1P4LB 5DM4A 3U4AA 1U0SY 3E0XA 1BFOA 3MRDB 4YHBA 3EXAA 4CTMA 1RUQL 4HGPA 5BN3A 3NRBA 4MCMA 3H9SD 1JLMA 4L3EE 2PYEE 5GS0D 4D56A 2FSHA 4OQFA 2ZQKA 4PV8B 1MOPA 4DQ0A 5IB4A 4GX1A 5L8KB 3OOJA 4K5LA 1P6XA 3IDSA 4D57A 3ZIYA 2X1WL 1KYWA 3DDHA 4NBWA 1PZUB 2GEQA 5GGRY 1QSEB 3O8XB 3HG7A 3KWUA 4WCFC 1L7EA 3NDPA 1HE5A 3L82B 1YRKA 3AHDA 3UQYS 3CXFA 1IE3A 2V4UA 5F9HA 1LDSA 3KW7A 4ZGGA 2R62A 4X4YB 1CFVH 5EBLA 4QUGA 4O02H 4CUCA 3O92A 1TM4E 2DLCX 2PX4A 1N5MA 2FO4A 2PH5A 5ALNA 1HGXA 2NTSP 2IURA 1G8GA 1G21A 5DJ0A 1N6EA 1B0PA 4HLJA 1JLHA 3ILYA 1NNSA 3T3PF 3CFDA 4HNVA 5AI9A 3FRIA 4XNDA 2NMSA 5DEJA 1DC7A 4M5ZL 2A83A 2H54A 4YXLL 4KROD 1IGMH 5TX7A 5ALEA 1V71A 4NCIA 4JM2B 4OXXA 1UUFA 2PMWB 5EEYA 2BSTB 3LSOA 3CMOL 5TE9A 5CB6A 1KYFA 1E6MA 1KY3A 5CT8A 3CKLA 1DFBH 3EVCA 3DWEX 1TR7A 1MHEA 3UTQA 3VZSA 1PS0A 1JNHA 4WWNA 1QLEH 2XKSA 1FXSA 3QVKA 2Q9UA 2NV6A 4EI0A 1SM3H 5CLYA 3CBRA 1UJMA 4EUKA 1DBAL 4X6XA 1KIPB 2HLAA 3BPLC 1S2NA 3MMSA 2G9NA 3MBKA 2YFOA 2ESVD 3L5WA 4QQ8A 1ILEA 4E68A 2FUQA 1G7RA 3EW3B 4RYDA 4DVRL 3ILQD 1DUYB 2ZWAA 1KWGA 3VSBA 3A32A 3NHBA 4E9QA 4XPGL 1W87A 1IAIM 2DBLL 2XN2A 3R7NA 4QEZA 2AG1A 2A4EA 5A2AA 3TEYA 4HPJB 5J3HD 1A21A 2BVYA 4FNAA 2AP2A 3KCWA 3WIUA 1S6NA 1M5TA 3X1ZA 3QVUA 1W0JA 1CCWA 1GC1L 2C5LA 4W4OA 1RVFL 4FFZA 5JDIC 1NCCL 3UG4A 2BMFA 4MV7A 3BGFC 2IH3A 2JL1A 1RUKH 3RTQC 4HR7A 2ST1A 1XZLA 2H3EA 3QCUL 4WOJA 3BHMA 1THMA 2I1WA 1V96A 2JVKA 3H19A 4EITA 5IN4A 2P8LB 4M5YL 5FL3A 5ITFB 4YCLA 3OT1A 1L1QA 4OGAC 1QFOA 5JW5B 1YNSA 5JDCC 1TTTA 4I14A 5EZ5A 3EJTA 1FFEA 2BDTA 4F80A 3SCMB 3ZBQA 3SO3C 2MJLA 4V1DE 2GJZA 3L9YA 5CA0B 3DZFA 5F35A 4FI8A 3I6IA 1XCWA 2OS7A 1E9RA 3B13B 3OCVA 4MVWA 4DB4A 5D1QC 3IV6A 5LMZA 4YJHA 3X1EA 5IBCA 5BOSB 5EEVA 2GCEA 4ZMNA 2XH8A 4DT1A 5CHNA 1EZVY 1V3JA 3E22B 3SX2A 4QRFA 4OCYL 4YNYA 1F2XK 1N3BA 5ED4A 1L6IA 3AUVA 2NRDA 2V7TA 3C2QA 1CF1A 3TS8A 2WXQA 1B93A 3J07A 2W42A 4YSOA 3DX4A 5IJ7E 1LPOA 5E94B 2RFLA 4JMXA 2J56H 2N1BA 1KB5H 3LQ2A 5IVIA 2YJZA 2GJ9A 5M7EA 2P30A 2O1WA 1T6ZA 1KMGA 4QI3A 1N0IA 2B39A 4TUOB 2F53D 4DC1A 3ZJUA 2PTHA 3QZPA 4CEJB 4P8QA 2OQJA 4FQPA 3OZSA 1J00A 2GZDA 1IZJA 4AX3A 4IXMA 4B4OA 1KZYA 2NTFA 1QFSA 2HOQA 4EFKA 4B80A 3P8ZA 1TYAE 1SXSA 4KWHA 5AFSA 3DOHA 2Q5OA 2NDFA 2XFXB 1RRMA 2ODPA 4Y5YA 5ESVA 3SDYL 3SKVA 4CXMA 3B1FA 1UH2A 3I0ZA 4AXXA 1S2IA 2UAGA 3L92A 4B3IA 5EXXA 3MLWL 3PJLA 2XRZA 1PEVA 2QLLA 2X0NA 2I9TB 4DLSA 2JRCA 3DZBA 2ZKMX 3MV7D 4LFHG 1PVOA 5DFAA 4ALMA 4YALA 2YWZA 1WC7B 2QKIA 1CE6A 2ZI6A 3LRSA 4PS4H 2OVPB 1LO5B 2ZPAA 2XQGA 1E5ZA 5F7HA 4Z7NE 1XZKA 1TUIA 3SC2B 2WZCA 3T9FA 4OLFA 2XTZA 4MW6A 4YWGH 2Z2NA 1WF3A 3G88A 1QVAA 5LYJA 1NR0A 5CSZB 7REQB 3GD5A 1N2CE 2FCAA 2IFGA 3MI6A 2DETA 1YUNA 4AKIA 1QIMA 1DV2A 2D7MA 1OAZH 5BS0A 1ZESA 5C7XL 2P6NA 1M2VB 2X1QA 4TM9A 2PVCA 4J4BA 1ZTXL 2G76A 2KMLA 2OZKA 1MCPL 2DLFH 4K7PL 4QJBA 1N78A 2A7BA 1SPDA 4LARL 5ENWB 1U8KA 4YMGA 1MRSA 4IDHA 1CGSL 2AXGB 1XHFA 4O63O 2PXAA 1S7XB 1PT5A 1SDDA 4PJ6A 3F67A 2Q6VA 2J30A 3PTLA 3RTDA 4UQ2A 2QX7A 5G3YA 2RH4A 4MNGB 3SPVA 1XCGB 3H84A 8MHTA 3D2UB 2FWIA 4AH2A 1T04B 3QRWA 1XMEB 1XBRA 1PW3A 5J9FA 5JI2E 4YLQT 3O2JA 1QQ7A 4I9WE 3QYMA 1R37A 1KY6A 3AI7A 3ZDZF 3GVXA 5D5MF 4CKQA 3PDUA 1P4IL 3NCJH 3RU9A 2J4CA 3PS9A 1QXSA 2GI7A 1YVRA 2FWAA 3V0EA 3GXIA 3CTTA 2YWJA 1Y1TA 4HZUB 4CMCA 1F5NA 4XEUA 3WHPA 4GQQA 3K5RA 5KWEA 3T4YA 4WZBE 2RARA 4E14A 2YK1H 3KBBA 5C07D 1CJCA 5ISZA 1FDRA 3Q4GA 5I26A 1I1AD 4WWKB 4OLJA 3DX7A 1R0AL 3H6KA 1FFHA 1RM3A 1JV2A 4ZI5A 5A6SB 4XMXA 3P02A 2DBJA 1L7PA 2RSLA 2O23A 5E4EB 4BV2A 2EIDA 1E3WB 2COUA 3T04D 2WV7A 4LHJB 4WJKB 1I2CA 4JDTH 3DL7A 25C8L 3L5XL 3DBRB 1ZVKA 1P2FA 4W7IA 1BVKB 1H3VA 1AG0A 4DN3L 3DNKA 3HAEB 2MFNA 2N46A 4AQAB 3WEMA 3BGSA 1UEXC 1QWHA 4PXYA 2CJUL 1QSFD 3QHFL 4UT7L 3GGOA 2G3ZA 1GGYA 1RIVH 1CDCA 4PC3A 4MICA 4XPHL 4J8GA 1FO0B 5FWQA 4PFQA 3RSFA 2K7QA 3UTTD 4ZJUA 4P5KB 3WRYA 4W9CC 3VYUB 2CVPA 5EWLB 3QRGL 3HC4L 3IERA