2OK4A

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct oxidized with ferricyanide
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ok4A01
4GGDA 5EM2B 1GG2B 2W18A 3I7LA 4AOWA 3SBPA 4GGCA 3RFHA 2Z2NA 3EI2B 1XKSA 4PNKB 2PM7B 2H6KA 4JSXC 5FXYA 2IUQA 2EBSA 1YFQA 3V9FA 3SHFA 3OKTA 2J55H 2AGLA 2YNNA 4J77A 4LG9A 4JSVC 5GSAA 5I5JA 5THAA 5HYNB 4U1EI 3F3PA 5K1CC 2HJ4A 1NEXB 1QNIA 4CI2A 4H5JA 3VH0A 3RN0D 4FA4D 5TEEA 1GP2B 2O9KA 3MXXA 2BCJB 4IA9A 4JT6C 4JD2C 4PSXB 2G9AA 4J84A 2H9PA 5EARA 4A2MA 3ORVD 2OVQB 4IMMA 2CN3A 4BL0A 2MTAH 2XYIA 4X61B 3RN1D 3RSEC 2OK4A 4FB1D 4FWWA 4J81A 3C5MA 4CI8A 4Y7RA 3DXKC 4J86A 2AH1A 3AL8A 4LGNA 3IIWA 4JT5C 3EI4A 3PXTD 2OIZA 4CI3A 4FA9D 3BG0A 3SCYA 1P22A 3MKSB 3I2NA 5AJAA 2P9UC 3I7NA 3I7PA 3RRMC 5EAMA 2B5MA 3VGZA 4A0AB 3PVUB 4U7AA 5GXIA 4D0KA 4CY5A 3C75H 3EI3B 4PSWB 2IWKA 4A0AA 4A09B 2J57G 3ODTA 4OZUA 2IUVA 2G99A 4L3GD 3IIYA 1JJUB 3IJ1A 3EI3A 4HDJA 3VA6A 4A09A 1JMZB 2IUPA 2Z2PA 3UR4A 4GQBB 4CC9A 3OL2B 1SQJA 4J73A 3GREA 4QT8A 4X3EA 2GNQA 4QRJA 3DSMA 1Q47A 3SXTD 2H14A 3SLED 3GFCA 3IJ0A 2P9IC 5HE1B 3L4OD 3SBQA 2PM9B 4J87A 2H9NA 2OK6A 5JWZA 3OKWA 2CNXA 5FKSA 1OLZA 3MMYA 2GC4A 2PM9A 2BBKH 2HXCA 4H5IA 2OVPB 5EM2A 5TF2A 2H6QA 2H9MA 4J8BA 4ZOXA 4PXWA 3RFGA 4GM9A 3EI2A 1PEVA 5AFU3 4GMBA 4KFMB 4FA1D 5IC7A 4GQ2P 3AFCA 2I3SA 3N0EA 3RMZD 4PBYA 5EALA 3SVWD 4CY3A 4O1QD 4D6VA 4E5ZB 4JSPC 5H1MA 4J82A 3SWSD 4Z8LA 3CIKB 3I7KA 4ZN4A 2B5LA 5TDHB 3SJLD 4E5ZA 5EAPA 2AGXA 4N14A 3HFQA 5KDOB 5K19A 2AGWA 3UVNA 4E54B 2P9LC 1N6EA 4A11B 3U4YA 1N6FA 4YVDA 5GMKn 2IAAA 1K8KC 2H6NA 4E54A 2AH0A 4CZYA 4UI9R 2YNOA 4GGAA 5FKQA 2TRCB 4A7JA 3CFSB 5FKRA 2OVRB 5H14A 2P9NC 4CZXA 5GXHA 2B5NA 4L1QD 2IWFA 4O45A 3ZWLB 4ESGA 4O3UB 4K3JB 4FAVD 3CFVA 1U2VC 2CO0C 3FRXA 3JROA 4ES0A 3E0CA 4O9DA 5IT9g 4CZVA 4ERZA 4XYHA 5EMJB 5FA5B 3SMRA 5EMMB 3FGBA 3UVKA 2AGZA 1GOTB 2PM6B 3I7OA 2H13A 2QC5A 2CE9A 3OKYB 1RI6A 1U4CA 5CXBB 1XIPA 3SN6B 3JRPA 4FA5D 4A2LA 3DM0A 4J79A 3EG6A 3OKYA 5AMSA 5A2Qg 5C2VB 3N0DA 5EMKB 2HYEA 1A0RB 3BG1A 3JB9L 3V7DB 1B9YA 2B4EA 3ULEC 5I5MA 3J81g 3I7HA 4CY2A 2HJBA 3A0FA 5I5IA 4ZOZA 2AQ5A 3I8EA 3EMHA 1VYHC 3OL2A 3W15A 3PXWD 2CO0A 2CE8A 4J8GA 4JXMA 3F3FA 5IJ8E 3UVLA 3SBRA 2PBIB 3PE7A 5C9ZB 3I89A 4OWRA 3PXSD 2YBAA 3NVXA 3BWSA 1N6DA 2I3TA 5FLXg 3EI1B 3EWEA 5IJ7E 4GZ8A 3EU7A 1PBYB 5C2WB 3EI1A 2AGYA 4Y5RD 2YNPA 5B4WA 3K27A 4I79A 3PSLA 4R7AB 4NSXA 5CYKB 5HE2B 1SQ9A 4X63B 5EMLB 3MKQA 1TYQC 3NVNA 2XU7A 1NR0A 3AL9A 3MZLA 5CYKA 3B7FA 4ZOYA 2Q7QA 4FHLA 3JAMg 3IKOA 1JOFA 1JMXB 4L9OA 3JZHA 4QQEA 5IGOA 3V5WB 4JSNC 4ERQA 4TZ4A 3UKRC 2UZYB 1PGUA 1L0QA 4O3TB 2UZXB 4J78A 4A11A 1MG3A 2J56H 5IGQA 3J80g 2QXVA 3JZGA 4J0XA 1XHMA 3AH8B 1S4UX 4EWRA 1MG2A 5FQDA 3SFZA 2XL3A 1K32A 4CY1A 1R5MA 1MDAH 3KRXB 3AL8B 4BUJC 2HESX 3I8CA 4FAND 4A0BB 2I0SA 4MK0B 5SXMA 3C99A 3DXMC 3OW8A 3EI4B 2OJYA 3F3GA 3PVWB 3JPXA 3PSCB 2H68A 4J0WA 4A0BA 5TEFA 5CXCB 3DWLC 3RLMD 4ERYA 3C9CA 5H17A 3OTTA 4GQ1A 3UKUC 4PBZA 5CXBA 2H47A 2H3XA 5FKTA 2H9LA 2P9PC 4A08B 5CXCA 2XL2A 4LG8A 1OMWB 3NVQA 1B9XA 2GC7A 3JZNA 4A08A 1SHYB 4L3HD 2Z2OA 2YMUA 3L4MD 2HKMA 4GM8A 3KRWB 2I0RA 2YB8B 5HE0B 2HKRA 1PI6A 1FWXA 3MZKA 1ERJA 5HQGA 3UVOA 1TBGA 1GXRA 3FM0A 3UVMA 4ZOVA 4X60B 3P4FA 4CI1A 4QL1A 4G56B 4XYIA 4AEZA 4GM3A 4PC0A 2P9KC 4BH6A 2IURA 2I0TA 3K26A 3IJCA 4XEIC 2P9SC 2CN2A 4K3ID 5HE3B
chains in the Genus database with same CATH superfamily
4GGDA 5EM2B 1GG2B 5M5SA 2W18A 3I7LA 1A12A 4AOWA 3SBPA 4GGCA 3RFHA 2Z2NA 3ZE0A 3EI2B 1XKSA 4PNKB 2PM7B 2H6KA 4JSXC 5FXYA 4G1MA 1UOQA 1VE6A 2IUQA 4AX4A 2EBSA 1YFQA 3V9FA 3SHFA 3OKTA 2J55H 2AGLA 2YNNA 4J77A 2VDPA 4LG9A 4JSVC 5M5TA 5GSAA 5I5JA 5THAA 5HYNB 3KCIA 4U1EI 3F3PA 1VZ2A 5K1CC 1H2ZA 4Z7QA 1H2YA 4RE5A 2HJ4A 1NEXB 1QNIA 4CI2A 4H5JA 3VH0A 3RN0D 4O02A 4FA4D 5TEEA 3IUMA 1GP2B 2O9KA 3MXXA 2BCJB 4IA9A 3IJEA 4JT6C 4JD2C 4PSXB 2G9AA 4J84A 2H9PA 5EARA 3O4JA 4A2MA 4BCCA 1BPOA 3ORVD 2HU5A 2OVQB 4IMMA 1M1XA 2CN3A 4BL0A 2MTAH 2XYIA 4X61B 3RN1D 3RSEC 2OK4A 4FB1D 3GD1I 1UTCA 4FWWA 2XDWA 1I2MB 4J81A 3C5MA 4CI8A 4Y7RA 2QR5A 1TYEA 3DXKC 4J86A 2AH1A 3AL8A 4LGNA 3IIWA 4JT5C 3EI4A 3PXTD 2OIZA 3IVMA 4CI3A 4FA9D 3BG0A 3SCYA 1P22A 4RE6A 3MKSB 3I2NA 5AJAA 2P9UC 3I7NA 4JHNA 3I7PA 3RRMC 5EAMA 2B5MA 4DNVA 3VGZA 4A0AB 3PVUB 4U7AA 5GXIA 4D0KA 4NAAA 4CY5A 3MUNA 3C75H 3EI3B 4PSWB 2IWKA 4A0AA 4A09B 3O4GA 2J57G 3ODTA 4MMYA 4OZUA 2IUVA 2G99A 4L3GD 3IIYA 1JJUB 3IJ1A 3EI3A 3GC3B 3ZDXA 4HDJA 3VA6A 4A09A 1JMZB 3IUNA 4NBMA 4G1EA 2IUPA 2Z2PA 3FCUA 3UR4A 4GQBB 4CC9A 3O4HA 3OL2B 1SQJA 4J73A 3VI3A 3GREA 1E8MA 2HU7A 4QT8A 4X3EA 2EIBA 3VI4A 2GNQA 3V4PA 4QRJA 3DSMA 1Q47A 3SXTD 2H14A 3SLED 3GFCA 3IJ0A 2P9IC 2VDNA 5HE1B 1O6FA 3L4OD 3T3PA 3SBQA 4Z7OA 5C92A 2PM9B 4J87A 2H9NA 1GOHA 2OK6A 2WQ8A 5JWZA 3OKWA 2CNXA 5E6RA 5FKSA 1OLZA 3MMYA 2GC4A 2PM9A 2BBKH 2HXCA 4H5IA 2OVPB 3K71A 5EM2A 5TF2A 2H6QA 2HU8A 2H9MA 4J8BA 4Z7NA 4ZOXA 4PXWA 4QAMA 3RFGA 5E6SA 4GM9A 3EI2A 1PEVA 5AFU3 4GMBA 4KFMB 4BP8A 5IC7A 4FA1D 4GQ2P 4MMXA 5C86A 1QFMA 3AFCA 2VZ1A 2I3SA 2EICA 4WJKA 3N0EA 3RMZD 4PBYA 5EALA 3SVWD 1VE7A 4CY3A 3IULA 4O1QD 3EQ9A 4D6VA 4E5ZB 4WK4A 4JSPC 1GOGA 4D9SA 4NENA 4J82A 5H1MA 3SWSD 4Z8LA 3CIKB 3I7KA 4ZN4A 2B5LA 5TDHB 2EIEA 1VZ3A 3SJLD 2EIDA 1U8CA 5EAPA 4E5ZA 2AGXA 3NIDA 3HFQA 4N14A 5KDOB 5K19A 2AGWA 3UVNA 4E54B 2P9LC 1N6EA 3EQ8A 1JV2A 4A11B 3U4YA 1N6FA 4YVDA 5GMKn 2IAAA 2XZGA 1K8KC 2H6NA 4E54A 2AH0A 4CZYA 4UI9R 2YNOA 4GGAA 5FKQA 2TRCB 4A7JA 3CFSB 5FKRA 2OVRB 5H14A 2P9NC 4CZXA 5M5RA 5GXHA 2B5NA 4L1QD 2IWFA 3DDUA 4O45A 3ZWLB 4ESGA 4O3UB 4K3JB 4FAVD 3CFVA 2VDMA 1U2VC 2CO0C 3FRXA 3JROA 4ES0A 3E0CA 4O9DA 5IT9g 4CZVA 4ERZA 4XYHA 5EMJB 5FA5B 3SMRA 5EMMB 3FGBA 3UVKA 5M5VA 2AGZA 1GOTB 4IRZA 2PM6B 3I7OA 2H13A 2QC5A 2CE9A 3OKYB 1RI6A 1U4CA 5CXBB 1C9LA 1XIPA 3SN6B 4AN0A 3JRPA 4FA5D 4A2LA 3DM0A 4J79A 3EG6A 2QZPA 3OKYA 5AMSA 5A2Qg 5C2VB 3N0DA 5EMKB 2HYEA 1L5GA 1A0RB 3BG1A 3JB9L 3V7DB 1B9YA 2B4EA 3K72A 3ULEC 5I5MA 3T3MA 3J81g 3I7HA 4CY2A 2HJBA 3A0FA 5I5IA 4ZOZA 2AQ5A 3I8EA 3EMHA 1UOOA 1VYHC 3OL2A 4WK2A 3W15A 3PXWD 2CO0A 2CE8A 4J8GA 4JXMA 3F3FA 5IJ8E 3UVLA 3SBRA 2PBIB 3K6SA 2JKXA 3PE7A 5C9ZB 2VZ3A 4BP9A 2BKLA 3I89A 4OWRA 3OF7A 3PXSD 2YBAA 3NVXA 4DNUA 3BWSA 1N6DA 2I3TA 5FLXg 3EI1B 3MUOA 3EWEA 5IJ7E 4GZ8A 4MMZA 3EU7A 3V4VA 1PBYB 4O2WA 3ZDYA 5C2WB 3EI1A 2AGYA 4Y5RD 3MVDK 1E8NA 4UM9A 2YNPA 5B4WA 3K27A 4I79A 3PSLA 4R7AB 4NSXA 5CYKB 5HE2B 1SQ9A 4WK0A 4X63B 5EMLB 3MKQA 1TYQC 3NVNA 2XU7A 1NR0A 3AL9A 3MZLA 5CYKA 3B7FA 1K3IA 4UM8A 3IUJA 2Q7QA 4ZOYA 4FHLA 3JAMg 3IKOA 1H2WA 1JOFA 1JMXB 4L9OA 3JZHA 4QQEA 4NC4A 4AN1A 5IGOA 3V5WB 4JSNC 4ERQA 4TZ4A 2VDQA 3UKRC 2UZYB 1PGUA 1L0QA 4O3TB 2UZXB 4J78A 4A11A 1T2XA 2VC2A 1MG3A 1QFSA 1JTDB 2J56H 5IGQA 3J80g 2QXVA 3JZGA 5M5UA 4J0XA 4BCDA 1XHMA 2XE4A 1E5TA 4L1MA 1C9IA 3AH8B 4G55A 4AMYA 1S4UX 4EWRA 1MG2A 5FQDA 3SFZA 2XL3A 1K32A 4DNWA 4CY1A 1R5MA 2VDRA 1MDAH 3KRXB 4JHPC 3AL8B 4BUJC 2HESX 5HDBA 2VDLA 3I8CA 4FAND 4A0BB 2I0SA 3EQ7A 4MK0B 3C99A 3DXMC 5SXMA 3ZDZA 3OW8A 3EI4B 2OJYA 3F3GA 3PVWB 3JPXA 4BCBA 3PSCB 2H68A 4J0WA 4A0BA 5TEFA 1H2XA 3QHYB 5CXCB 3DWLC 3RLMD 4ERYA 3C9CA 5H17A 3OTTA 4GQ1A 3UKUC 4PBZA 5CXBA 2H47A 2H3XA 5FKTA 1GOFA 2H9LA 2P9PC 4A08B 5CXCA 2XL2A 4LG8A 1OMWB 3NIGA 3NVQA 1UOPA 1B9XA 2GC7A 3JZNA 4A08A 1SHYB 5M61A 2VDOA 4L3HD 2Z2OA 2YMUA 3L4MD 1YR2A 2HKMA 4GM8A 3IURA 3KRWB 5E6UA 1O6GA 2I0RA 2YB8B 5HE0B 2HKRA 1PI6A 1FWXA 3MZKA 1ERJA 5HQGA 3ZE1A 3UVOA 1TBGA 1GXRA 3NIFA 5FFGA 3FM0A 3UVMA 4ZOVA 4X60B 3FCSA 5FFOA 3P4FA 4CI1A 4QL1A 4G56B 4XYIA 4AEZA 4GM3A 3IUQA 4AMZA 4PC0A 2P9KC 2VDKA 4BH6A 3ZE2A 2IURA 2I0TA 3K26A 3O4IA 3IJCA 4XEIC 2P9SC 3QI0A 2CN2A 4K3ID 5HE3B
chains in the Genus database with same CATH topology
4GGDA 5EM2B 1GG2B 2W18A 3I7LA 4AOWA 3SBPA 4GGCA 3RFHA 2Z2NA 3EI2B 1XKSA 4PNKB 2PM7B 2H6KA 4JSXC 5FXYA 2IUQA 2EBSA 1YFQA 3V9FA 3SHFA 3OKTA 2J55H 2AGLA 2YNNA 4J77A 4LG9A 4JSVC 5GSAA 5I5JA 5THAA 5HYNB 4U1EI 3F3PA 5K1CC 2HJ4A 1NEXB 1QNIA 4CI2A 4H5JA 3VH0A 3RN0D 4FA4D 5TEEA 1GP2B 2O9KA 3MXXA 2BCJB 4IA9A 4JT6C 4JD2C 4PSXB 2G9AA 4J84A 2H9PA 5EARA 4A2MA 3ORVD 2OVQB 4IMMA 2CN3A 4BL0A 2MTAH 2XYIA 4X61B 3RN1D 3RSEC 2OK4A 4FB1D 4FWWA 4J81A 3C5MA 4CI8A 4Y7RA 3DXKC 4J86A 2AH1A 3AL8A 4LGNA 3IIWA 4JT5C 3EI4A 3PXTD 2OIZA 4CI3A 4FA9D 3BG0A 3SCYA 1P22A 3MKSB 3I2NA 5AJAA 2P9UC 3I7NA 3I7PA 3RRMC 5EAMA 2B5MA 3VGZA 4A0AB 3PVUB 4U7AA 5GXIA 4D0KA 4CY5A 3C75H 3EI3B 4PSWB 2IWKA 4A0AA 4A09B 2J57G 3ODTA 4OZUA 2IUVA 2G99A 4L3GD 3IIYA 1JJUB 3IJ1A 3EI3A 4HDJA 3VA6A 4A09A 1JMZB 2IUPA 2Z2PA 3UR4A 4GQBB 4CC9A 3OL2B 1SQJA 4J73A 3GREA 4QT8A 4X3EA 2GNQA 4QRJA 3DSMA 1Q47A 3SXTD 2H14A 3SLED 3GFCA 3IJ0A 2P9IC 5HE1B 3L4OD 3SBQA 2PM9B 4J87A 2H9NA 2OK6A 5JWZA 3OKWA 2CNXA 5FKSA 1OLZA 3MMYA 2GC4A 2PM9A 2BBKH 2HXCA 4H5IA 2OVPB 5EM2A 5TF2A 2H6QA 2H9MA 4J8BA 4ZOXA 4PXWA 3RFGA 4GM9A 3EI2A 1PEVA 5AFU3 4GMBA 4KFMB 4FA1D 5IC7A 4GQ2P 3AFCA 2I3SA 3N0EA 3RMZD 4PBYA 5EALA 3SVWD 4CY3A 4O1QD 4D6VA 4E5ZB 4JSPC 5H1MA 4J82A 3SWSD 4Z8LA 3CIKB 3I7KA 4ZN4A 2B5LA 5TDHB 3SJLD 4E5ZA 5EAPA 2AGXA 4N14A 3HFQA 5KDOB 5K19A 2AGWA 3UVNA 4E54B 2P9LC 1N6EA 4A11B 3U4YA 1N6FA 4YVDA 5GMKn 2IAAA 1K8KC 2H6NA 4E54A 2AH0A 4CZYA 4UI9R 2YNOA 4GGAA 5FKQA 2TRCB 4A7JA 3CFSB 5FKRA 2OVRB 5H14A 2P9NC 4CZXA 5GXHA 2B5NA 4L1QD 2IWFA 4O45A 3ZWLB 4ESGA 4O3UB 4K3JB 4FAVD 3CFVA 1U2VC 2CO0C 3FRXA 3JROA 4ES0A 3E0CA 4O9DA 5IT9g 4CZVA 4ERZA 4XYHA 5EMJB 5FA5B 3SMRA 5EMMB 3FGBA 3UVKA 2AGZA 1GOTB 2PM6B 3I7OA 2H13A 2QC5A 2CE9A 3OKYB 1RI6A 1U4CA 5CXBB 1XIPA 3SN6B 3JRPA 4FA5D 4A2LA 3DM0A 4J79A 3EG6A 3OKYA 5AMSA 5A2Qg 5C2VB 3N0DA 5EMKB 2HYEA 1A0RB 3BG1A 3JB9L 3V7DB 1B9YA 2B4EA 3ULEC 5I5MA 3J81g 3I7HA 4CY2A 2HJBA 3A0FA 5I5IA 4ZOZA 2AQ5A 3I8EA 3EMHA 1VYHC 3OL2A 3W15A 3PXWD 2CO0A 2CE8A 4J8GA 4JXMA 3F3FA 5IJ8E 3UVLA 3SBRA 2PBIB 3PE7A 5C9ZB 3I89A 4OWRA 3PXSD 2YBAA 3NVXA 3BWSA 1N6DA 2I3TA 5FLXg 3EI1B 3EWEA 5IJ7E 4GZ8A 3EU7A 1PBYB 5C2WB 3EI1A 2AGYA 4Y5RD 2YNPA 5B4WA 3K27A 4I79A 3PSLA 4R7AB 4NSXA 5CYKB 5HE2B 1SQ9A 4X63B 5EMLB 3MKQA 1TYQC 3NVNA 2XU7A 1NR0A 3AL9A 3MZLA 5CYKA 3B7FA 4ZOYA 2Q7QA 4FHLA 3JAMg 3IKOA 1JOFA 1JMXB 4L9OA 3JZHA 4QQEA 5IGOA 3V5WB 4JSNC 4ERQA 4TZ4A 3UKRC 2UZYB 1PGUA 1L0QA 4O3TB 2UZXB 4J78A 4A11A 1MG3A 2J56H 5IGQA 3J80g 2QXVA 3JZGA 4J0XA 1XHMA 3AH8B 1S4UX 4EWRA 1MG2A 5FQDA 3SFZA 2XL3A 1K32A 4CY1A 1R5MA 1MDAH 3KRXB 3AL8B 4BUJC 2HESX 3I8CA 4FAND 4A0BB 2I0SA 4MK0B 5SXMA 3C99A 3DXMC 3OW8A 3EI4B 2OJYA 3F3GA 3PVWB 3JPXA 3PSCB 2H68A 4J0WA 4A0BA 5TEFA 5CXCB 3DWLC 3RLMD 4ERYA 3C9CA 5H17A 3OTTA 4GQ1A 3UKUC 4PBZA 5CXBA 2H47A 2H3XA 5FKTA 2H9LA 2P9PC 4A08B 5CXCA 2XL2A 4LG8A 1OMWB 3NVQA 1B9XA 2GC7A 3JZNA 4A08A 1SHYB 4L3HD 2Z2OA 2YMUA 3L4MD 2HKMA 4GM8A 3KRWB 2I0RA 2YB8B 5HE0B 2HKRA 1PI6A 1FWXA 3MZKA 1ERJA 5HQGA 3UVOA 1TBGA 1GXRA 3FM0A 3UVMA 4ZOVA 4X60B 3P4FA 4CI1A 4QL1A 4G56B 4XYIA 4AEZA 4GM3A 4PC0A 2P9KC 4BH6A 2IURA 2I0TA 3K26A 3IJCA 4XEIC 2P9SC 2CN2A 4K3ID 5HE3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGD A;  5EM2 B;  1GG2 B;  2W18 A;  3I7L A;  4AOW A;  3SBP A;  4GGC A;  3RFH A;  2Z2N A;  3EI2 B;  1XKS A;  4PNK B;  2PM7 B;  2H6K A;  4JSX C;  5FXY A;  2IUQ A;  2EBS A;  1YFQ A;  3V9F A;  3SHF A;  3OKT A;  2J55 H;  2AGL A;  2YNN A;  4J77 A;  4LG9 A;  4JSV C;  5GSA A;  5I5J A;  5THA A;  5HYN B;  4U1E I;  3F3P A;  5K1C C;  2HJ4 A;  1NEX B;  1QNI A;  4CI2 A;  4H5J A;  3VH0 A;  3RN0 D;  4FA4 D;  5TEE A;  1GP2 B;  2O9K A;  3MXX A;  2BCJ B;  4IA9 A;  4JT6 C;  4JD2 C;  4PSX B;  2G9A A;  4J84 A;  2H9P A;  5EAR A;  4A2M A;  3ORV D;  2OVQ B;  4IMM A;  2CN3 A;  4BL0 A;  2MTA H;  2XYI A;  4X61 B;  3RN1 D;  3RSE C;  2OK4 A;  4FB1 D;  4FWW A;  4J81 A;  3C5M A;  4CI8 A;  4Y7R A;  3DXK C;  4J86 A;  2AH1 A;  3AL8 A;  4LGN A;  3IIW A;  4JT5 C;  3EI4 A;  3PXT D;  2OIZ A;  4CI3 A;  4FA9 D;  3BG0 A;  3SCY A;  1P22 A;  3MKS B;  3I2N A;  5AJA A;  2P9U C;  3I7N A;  3I7P A;  3RRM C;  5EAM A;  2B5M A;  3VGZ A;  4A0A B;  3PVU B;  4U7A A;  5GXI A;  4D0K A;  4CY5 A;  3C75 H;  3EI3 B;  4PSW B;  2IWK A;  4A0A A;  4A09 B;  2J57 G;  3ODT A;  4OZU A;  2IUV A;  2G99 A;  4L3G D;  3IIY A;  1JJU B;  3IJ1 A;  3EI3 A;  4HDJ A;  3VA6 A;  4A09 A;  1JMZ B;  2IUP A;  2Z2P A;  3UR4 A;  4GQB B;  4CC9 A;  3OL2 B;  1SQJ A;  4J73 A;  3GRE A;  4QT8 A;  4X3E A;  2GNQ A;  4QRJ A;  3DSM A;  1Q47 A;  3SXT D;  2H14 A;  3SLE D;  3GFC A;  3IJ0 A;  2P9I C;  5HE1 B;  3L4O D;  3SBQ A;  2PM9 B;  4J87 A;  2H9N A;  2OK6 A;  5JWZ A;  3OKW A;  2CNX A;  5FKS A;  1OLZ A;  3MMY A;  2GC4 A;  2PM9 A;  2BBK H;  2HXC A;  4H5I A;  2OVP B;  5EM2 A;  5TF2 A;  2H6Q A;  2H9M A;  4J8B A;  4ZOX A;  4PXW A;  3RFG A;  4GM9 A;  3EI2 A;  1PEV A;  5AFU 3;  4GMB A;  4KFM B;  4FA1 D;  5IC7 A;  4GQ2 P;  3AFC A;  2I3S A;  3N0E A;  3RMZ D;  4PBY A;  5EAL A;  3SVW D;  4CY3 A;  4O1Q D;  4D6V A;  4E5Z B;  4JSP C;  5H1M A;  4J82 A;  3SWS D;  4Z8L A;  3CIK B;  3I7K A;  4ZN4 A;  2B5L A;  5TDH B;  3SJL D;  4E5Z A;  5EAP A;  2AGX A;  4N14 A;  3HFQ A;  5KDO B;  5K19 A;  2AGW A;  3UVN A;  4E54 B;  2P9L C;  1N6E A;  4A11 B;  3U4Y A;  1N6F A;  4YVD A;  5GMK n;  2IAA A;  1K8K C;  2H6N A;  4E54 A;  2AH0 A;  4CZY A;  4UI9 R;  2YNO A;  4GGA A;  5FKQ A;  2TRC B;  4A7J A;  3CFS B;  5FKR A;  2OVR B;  5H14 A;  2P9N C;  4CZX A;  5GXH A;  2B5N A;  4L1Q D;  2IWF A;  4O45 A;  3ZWL B;  4ESG A;  4O3U B;  4K3J B;  4FAV D;  3CFV A;  1U2V C;  2CO0 C;  3FRX A;  3JRO A;  4ES0 A;  3E0C A;  4O9D A;  5IT9 g;  4CZV A;  4ERZ A;  4XYH A;  5EMJ B;  5FA5 B;  3SMR A;  5EMM B;  3FGB A;  3UVK A;  2AGZ A;  1GOT B;  2PM6 B;  3I7O A;  2H13 A;  2QC5 A;  2CE9 A;  3OKY B;  1RI6 A;  1U4C A;  5CXB B;  1XIP A;  3SN6 B;  3JRP A;  4FA5 D;  4A2L A;  3DM0 A;  4J79 A;  3EG6 A;  3OKY A;  5AMS A;  5A2Q g;  5C2V B;  3N0D A;  5EMK B;  2HYE A;  1A0R B;  3BG1 A;  3JB9 L;  3V7D B;  1B9Y A;  2B4E A;  3ULE C;  5I5M A;  3J81 g;  3I7H A;  4CY2 A;  2HJB A;  3A0F A;  5I5I A;  4ZOZ A;  2AQ5 A;  3I8E A;  3EMH A;  1VYH C;  3OL2 A;  3W15 A;  3PXW D;  2CO0 A;  2CE8 A;  4J8G A;  4JXM A;  3F3F A;  5IJ8 E;  3UVL A;  3SBR A;  2PBI B;  3PE7 A;  5C9Z B;  3I89 A;  4OWR A;  3PXS D;  2YBA A;  3NVX A;  3BWS A;  1N6D A;  2I3T A;  5FLX g;  3EI1 B;  3EWE A;  5IJ7 E;  4GZ8 A;  3EU7 A;  1PBY B;  5C2W B;  3EI1 A;  2AGY A;  4Y5R D;  2YNP A;  5B4W A;  3K27 A;  4I79 A;  3PSL A;  4R7A B;  4NSX A;  5CYK B;  5HE2 B;  1SQ9 A;  4X63 B;  5EML B;  3MKQ A;  1TYQ C;  3NVN A;  2XU7 A;  1NR0 A;  3AL9 A;  3MZL A;  5CYK A;  3B7F A;  4ZOY A;  2Q7Q A;  4FHL A;  3JAM g;  3IKO A;  1JOF A;  1JMX B;  4L9O A;  3JZH A;  4QQE A;  5IGO A;  3V5W B;  4JSN C;  4ERQ A;  4TZ4 A;  3UKR C;  2UZY B;  1PGU A;  1L0Q A;  4O3T B;  2UZX B;  4J78 A;  4A11 A;  1MG3 A;  2J56 H;  5IGQ A;  3J80 g;  2QXV A;  3JZG A;  4J0X A;  1XHM A;  3AH8 B;  1S4U X;  4EWR A;  1MG2 A;  5FQD A;  3SFZ A;  2XL3 A;  1K32 A;  4CY1 A;  1R5M A;  1MDA H;  3KRX B;  3AL8 B;  4BUJ C;  2HES X;  3I8C A;  4FAN D;  4A0B B;  2I0S A;  4MK0 B;  5SXM A;  3C99 A;  3DXM C;  3OW8 A;  3EI4 B;  2OJY A;  3F3G A;  3PVW B;  3JPX A;  3PSC B;  2H68 A;  4J0W A;  4A0B A;  5TEF A;  5CXC B;  3DWL C;  3RLM D;  4ERY A;  3C9C A;  5H17 A;  3OTT A;  4GQ1 A;  3UKU C;  4PBZ A;  5CXB A;  2H47 A;  2H3X A;  5FKT A;  2H9L A;  2P9P C;  4A08 B;  5CXC A;  2XL2 A;  4LG8 A;  1OMW B;  3NVQ A;  1B9X A;  2GC7 A;  3JZN A;  4A08 A;  1SHY B;  4L3H D;  2Z2O A;  2YMU A;  3L4M D;  2HKM A;  4GM8 A;  3KRW B;  2I0R A;  2YB8 B;  5HE0 B;  2HKR A;  1PI6 A;  1FWX A;  3MZK A;  1ERJ A;  5HQG A;  3UVO A;  1TBG A;  1GXR A;  3FM0 A;  3UVM A;  4ZOV A;  4X60 B;  3P4F A;  4CI1 A;  4QL1 A;  4G56 B;  4XYI A;  4AEZ A;  4GM3 A;  4PC0 A;  2P9K C;  4BH6 A;  2IUR A;  2I0T A;  3K26 A;  3IJC A;  4XEI C;  2P9S C;  2CN2 A;  4K3I D;  5HE3 B; 
#chains in the Genus database with same CATH topology
 4GGD A;  5EM2 B;  1GG2 B;  5M5S A;  2W18 A;  3I7L A;  1A12 A;  4AOW A;  3SBP A;  4GGC A;  3RFH A;  2Z2N A;  3ZE0 A;  3EI2 B;  1XKS A;  4PNK B;  2PM7 B;  2H6K A;  4JSX C;  5FXY A;  4G1M A;  1UOQ A;  1VE6 A;  2IUQ A;  4AX4 A;  2EBS A;  1YFQ A;  3V9F A;  3SHF A;  3OKT A;  2J55 H;  2AGL A;  2YNN A;  4J77 A;  2VDP A;  4LG9 A;  4JSV C;  5M5T A;  5GSA A;  5I5J A;  5THA A;  5HYN B;  3KCI A;  4U1E I;  3F3P A;  1VZ2 A;  5K1C C;  1H2Z A;  4Z7Q A;  1H2Y A;  4RE5 A;  2HJ4 A;  1NEX B;  1QNI A;  4CI2 A;  4H5J A;  3VH0 A;  3RN0 D;  4O02 A;  4FA4 D;  5TEE A;  3IUM A;  1GP2 B;  2O9K A;  3MXX A;  2BCJ B;  4IA9 A;  3IJE A;  4JT6 C;  4JD2 C;  4PSX B;  2G9A A;  4J84 A;  2H9P A;  5EAR A;  3O4J A;  4A2M A;  4BCC A;  1BPO A;  3ORV D;  2HU5 A;  2OVQ B;  4IMM A;  1M1X A;  2CN3 A;  4BL0 A;  2MTA H;  2XYI A;  4X61 B;  3RN1 D;  3RSE C;  2OK4 A;  4FB1 D;  3GD1 I;  1UTC A;  4FWW A;  2XDW A;  1I2M B;  4J81 A;  3C5M A;  4CI8 A;  4Y7R A;  2QR5 A;  1TYE A;  3DXK C;  4J86 A;  2AH1 A;  3AL8 A;  4LGN A;  3IIW A;  4JT5 C;  3EI4 A;  3PXT D;  2OIZ A;  3IVM A;  4CI3 A;  4FA9 D;  3BG0 A;  3SCY A;  1P22 A;  4RE6 A;  3MKS B;  3I2N A;  5AJA A;  2P9U C;  3I7N A;  4JHN A;  3I7P A;  3RRM C;  5EAM A;  2B5M A;  4DNV A;  3VGZ A;  4A0A B;  3PVU B;  4U7A A;  5GXI A;  4D0K A;  4NAA A;  4CY5 A;  3MUN A;  3C75 H;  3EI3 B;  4PSW B;  2IWK A;  4A0A A;  4A09 B;  3O4G A;  2J57 G;  3ODT A;  4MMY A;  4OZU A;  2IUV A;  2G99 A;  4L3G D;  3IIY A;  1JJU B;  3IJ1 A;  3EI3 A;  3GC3 B;  3ZDX A;  4HDJ A;  3VA6 A;  4A09 A;  1JMZ B;  3IUN A;  4NBM A;  4G1E A;  2IUP A;  2Z2P A;  3FCU A;  3UR4 A;  4GQB B;  4CC9 A;  3O4H A;  3OL2 B;  1SQJ A;  4J73 A;  3VI3 A;  3GRE A;  1E8M A;  2HU7 A;  4QT8 A;  4X3E A;  2EIB A;  3VI4 A;  2GNQ A;  3V4P A;  4QRJ A;  3DSM A;  1Q47 A;  3SXT D;  2H14 A;  3SLE D;  3GFC A;  3IJ0 A;  2P9I C;  2VDN A;  5HE1 B;  1O6F A;  3L4O D;  3T3P A;  3SBQ A;  4Z7O A;  5C92 A;  2PM9 B;  4J87 A;  2H9N A;  1GOH A;  2OK6 A;  2WQ8 A;  5JWZ A;  3OKW A;  2CNX A;  5E6R A;  5FKS A;  1OLZ A;  3MMY A;  2GC4 A;  2PM9 A;  2BBK H;  2HXC A;  4H5I A;  2OVP B;  3K71 A;  5EM2 A;  5TF2 A;  2H6Q A;  2HU8 A;  2H9M A;  4J8B A;  4Z7N A;  4ZOX A;  4PXW A;  4QAM A;  3RFG A;  5E6S A;  4GM9 A;  3EI2 A;  1PEV A;  5AFU 3;  4GMB A;  4KFM B;  4BP8 A;  5IC7 A;  4FA1 D;  4GQ2 P;  4MMX A;  5C86 A;  1QFM A;  3AFC A;  2VZ1 A;  2I3S A;  2EIC A;  4WJK A;  3N0E A;  3RMZ D;  4PBY A;  5EAL A;  3SVW D;  1VE7 A;  4CY3 A;  3IUL A;  4O1Q D;  3EQ9 A;  4D6V A;  4E5Z B;  4WK4 A;  4JSP C;  1GOG A;  4D9S A;  4NEN A;  4J82 A;  5H1M A;  3SWS D;  4Z8L A;  3CIK B;  3I7K A;  4ZN4 A;  2B5L A;  5TDH B;  2EIE A;  1VZ3 A;  3SJL D;  2EID A;  1U8C A;  5EAP A;  4E5Z A;  2AGX A;  3NID A;  3HFQ A;  4N14 A;  5KDO B;  5K19 A;  2AGW A;  3UVN A;  4E54 B;  2P9L C;  1N6E A;  3EQ8 A;  1JV2 A;  4A11 B;  3U4Y A;  1N6F A;  4YVD A;  5GMK n;  2IAA A;  2XZG A;  1K8K C;  2H6N A;  4E54 A;  2AH0 A;  4CZY A;  4UI9 R;  2YNO A;  4GGA A;  5FKQ A;  2TRC B;  4A7J A;  3CFS B;  5FKR A;  2OVR B;  5H14 A;  2P9N C;  4CZX A;  5M5R A;  5GXH A;  2B5N A;  4L1Q D;  2IWF A;  3DDU A;  4O45 A;  3ZWL B;  4ESG A;  4O3U B;  4K3J B;  4FAV D;  3CFV A;  2VDM A;  1U2V C;  2CO0 C;  3FRX A;  3JRO A;  4ES0 A;  3E0C A;  4O9D A;  5IT9 g;  4CZV A;  4ERZ A;  4XYH A;  5EMJ B;  5FA5 B;  3SMR A;  5EMM B;  3FGB A;  3UVK A;  5M5V A;  2AGZ A;  1GOT B;  4IRZ A;  2PM6 B;  3I7O A;  2H13 A;  2QC5 A;  2CE9 A;  3OKY B;  1RI6 A;  1U4C A;  5CXB B;  1C9L A;  1XIP A;  3SN6 B;  4AN0 A;  3JRP A;  4FA5 D;  4A2L A;  3DM0 A;  4J79 A;  3EG6 A;  2QZP A;  3OKY A;  5AMS A;  5A2Q g;  5C2V B;  3N0D A;  5EMK B;  2HYE A;  1L5G A;  1A0R B;  3BG1 A;  3JB9 L;  3V7D B;  1B9Y A;  2B4E A;  3K72 A;  3ULE C;  5I5M A;  3T3M A;  3J81 g;  3I7H A;  4CY2 A;  2HJB A;  3A0F A;  5I5I A;  4ZOZ A;  2AQ5 A;  3I8E A;  3EMH A;  1UOO A;  1VYH C;  3OL2 A;  4WK2 A;  3W15 A;  3PXW D;  2CO0 A;  2CE8 A;  4J8G A;  4JXM A;  3F3F A;  5IJ8 E;  3UVL A;  3SBR A;  2PBI B;  3K6S A;  2JKX A;  3PE7 A;  5C9Z B;  2VZ3 A;  4BP9 A;  2BKL A;  3I89 A;  4OWR A;  3OF7 A;  3PXS D;  2YBA A;  3NVX A;  4DNU A;  3BWS A;  1N6D A;  2I3T A;  5FLX g;  3EI1 B;  3MUO A;  3EWE A;  5IJ7 E;  4GZ8 A;  4MMZ A;  3EU7 A;  3V4V A;  1PBY B;  4O2W A;  3ZDY A;  5C2W B;  3EI1 A;  2AGY A;  4Y5R D;  3MVD K;  1E8N A;  4UM9 A;  2YNP A;  5B4W A;  3K27 A;  4I79 A;  3PSL A;  4R7A B;  4NSX A;  5CYK B;  5HE2 B;  1SQ9 A;  4WK0 A;  4X63 B;  5EML B;  3MKQ A;  1TYQ C;  3NVN A;  2XU7 A;  1NR0 A;  3AL9 A;  3MZL A;  5CYK A;  3B7F A;  1K3I A;  4UM8 A;  3IUJ A;  2Q7Q A;  4ZOY A;  4FHL A;  3JAM g;  3IKO A;  1H2W A;  1JOF A;  1JMX B;  4L9O A;  3JZH A;  4QQE A;  4NC4 A;  4AN1 A;  5IGO A;  3V5W B;  4JSN C;  4ERQ A;  4TZ4 A;  2VDQ A;  3UKR C;  2UZY B;  1PGU A;  1L0Q A;  4O3T B;  2UZX B;  4J78 A;  4A11 A;  1T2X A;  2VC2 A;  1MG3 A;  1QFS A;  1JTD B;  2J56 H;  5IGQ A;  3J80 g;  2QXV A;  3JZG A;  5M5U A;  4J0X A;  4BCD A;  1XHM A;  2XE4 A;  1E5T A;  4L1M A;  1C9I A;  3AH8 B;  4G55 A;  4AMY A;  1S4U X;  4EWR A;  1MG2 A;  5FQD A;  3SFZ A;  2XL3 A;  1K32 A;  4DNW A;  4CY1 A;  1R5M A;  2VDR A;  1MDA H;  3KRX B;  4JHP C;  3AL8 B;  4BUJ C;  2HES X;  5HDB A;  2VDL A;  3I8C A;  4FAN D;  4A0B B;  2I0S A;  3EQ7 A;  4MK0 B;  3C99 A;  3DXM C;  5SXM A;  3ZDZ A;  3OW8 A;  3EI4 B;  2OJY A;  3F3G A;  3PVW B;  3JPX A;  4BCB A;  3PSC B;  2H68 A;  4J0W A;  4A0B A;  5TEF A;  1H2X A;  3QHY B;  5CXC B;  3DWL C;  3RLM D;  4ERY A;  3C9C A;  5H17 A;  3OTT A;  4GQ1 A;  3UKU C;  4PBZ A;  5CXB A;  2H47 A;  2H3X A;  5FKT A;  1GOF A;  2H9L A;  2P9P C;  4A08 B;  5CXC A;  2XL2 A;  4LG8 A;  1OMW B;  3NIG A;  3NVQ A;  1UOP A;  1B9X A;  2GC7 A;  3JZN A;  4A08 A;  1SHY B;  5M61 A;  2VDO A;  4L3H D;  2Z2O A;  2YMU A;  3L4M D;  1YR2 A;  2HKM A;  4GM8 A;  3IUR A;  3KRW B;  5E6U A;  1O6G A;  2I0R A;  2YB8 B;  5HE0 B;  2HKR A;  1PI6 A;  1FWX A;  3MZK A;  1ERJ A;  5HQG A;  3ZE1 A;  3UVO A;  1TBG A;  1GXR A;  3NIF A;  5FFG A;  3FM0 A;  3UVM A;  4ZOV A;  4X60 B;  3FCS A;  5FFO A;  3P4F A;  4CI1 A;  4QL1 A;  4G56 B;  4XYI A;  4AEZ A;  4GM3 A;  3IUQ A;  4AMZ A;  4PC0 A;  2P9K C;  2VDK A;  4BH6 A;  3ZE2 A;  2IUR A;  2I0T A;  3K26 A;  3O4I A;  3IJC A;  4XEI C;  2P9S C;  3QI0 A;  2CN2 A;  4K3I D;  5HE3 B; 
#chains in the Genus database with same CATH homology
 4GGD A;  5EM2 B;  1GG2 B;  2W18 A;  3I7L A;  4AOW A;  3SBP A;  4GGC A;  3RFH A;  2Z2N A;  3EI2 B;  1XKS A;  4PNK B;  2PM7 B;  2H6K A;  4JSX C;  5FXY A;  2IUQ A;  2EBS A;  1YFQ A;  3V9F A;  3SHF A;  3OKT A;  2J55 H;  2AGL A;  2YNN A;  4J77 A;  4LG9 A;  4JSV C;  5GSA A;  5I5J A;  5THA A;  5HYN B;  4U1E I;  3F3P A;  5K1C C;  2HJ4 A;  1NEX B;  1QNI A;  4CI2 A;  4H5J A;  3VH0 A;  3RN0 D;  4FA4 D;  5TEE A;  1GP2 B;  2O9K A;  3MXX A;  2BCJ B;  4IA9 A;  4JT6 C;  4JD2 C;  4PSX B;  2G9A A;  4J84 A;  2H9P A;  5EAR A;  4A2M A;  3ORV D;  2OVQ B;  4IMM A;  2CN3 A;  4BL0 A;  2MTA H;  2XYI A;  4X61 B;  3RN1 D;  3RSE C;  2OK4 A;  4FB1 D;  4FWW A;  4J81 A;  3C5M A;  4CI8 A;  4Y7R A;  3DXK C;  4J86 A;  2AH1 A;  3AL8 A;  4LGN A;  3IIW A;  4JT5 C;  3EI4 A;  3PXT D;  2OIZ A;  4CI3 A;  4FA9 D;  3BG0 A;  3SCY A;  1P22 A;  3MKS B;  3I2N A;  5AJA A;  2P9U C;  3I7N A;  3I7P A;  3RRM C;  5EAM A;  2B5M A;  3VGZ A;  4A0A B;  3PVU B;  4U7A A;  5GXI A;  4D0K A;  4CY5 A;  3C75 H;  3EI3 B;  4PSW B;  2IWK A;  4A0A A;  4A09 B;  2J57 G;  3ODT A;  4OZU A;  2IUV A;  2G99 A;  4L3G D;  3IIY A;  1JJU B;  3IJ1 A;  3EI3 A;  4HDJ A;  3VA6 A;  4A09 A;  1JMZ B;  2IUP A;  2Z2P A;  3UR4 A;  4GQB B;  4CC9 A;  3OL2 B;  1SQJ A;  4J73 A;  3GRE A;  4QT8 A;  4X3E A;  2GNQ A;  4QRJ A;  3DSM A;  1Q47 A;  3SXT D;  2H14 A;  3SLE D;  3GFC A;  3IJ0 A;  2P9I C;  5HE1 B;  3L4O D;  3SBQ A;  2PM9 B;  4J87 A;  2H9N A;  2OK6 A;  5JWZ A;  3OKW A;  2CNX A;  5FKS A;  1OLZ A;  3MMY A;  2GC4 A;  2PM9 A;  2BBK H;  2HXC A;  4H5I A;  2OVP B;  5EM2 A;  5TF2 A;  2H6Q A;  2H9M A;  4J8B A;  4ZOX A;  4PXW A;  3RFG A;  4GM9 A;  3EI2 A;  1PEV A;  5AFU 3;  4GMB A;  4KFM B;  4FA1 D;  5IC7 A;  4GQ2 P;  3AFC A;  2I3S A;  3N0E A;  3RMZ D;  4PBY A;  5EAL A;  3SVW D;  4CY3 A;  4O1Q D;  4D6V A;  4E5Z B;  4JSP C;  5H1M A;  4J82 A;  3SWS D;  4Z8L A;  3CIK B;  3I7K A;  4ZN4 A;  2B5L A;  5TDH B;  3SJL D;  4E5Z A;  5EAP A;  2AGX A;  4N14 A;  3HFQ A;  5KDO B;  5K19 A;  2AGW A;  3UVN A;  4E54 B;  2P9L C;  1N6E A;  4A11 B;  3U4Y A;  1N6F A;  4YVD A;  5GMK n;  2IAA A;  1K8K C;  2H6N A;  4E54 A;  2AH0 A;  4CZY A;  4UI9 R;  2YNO A;  4GGA A;  5FKQ A;  2TRC B;  4A7J A;  3CFS B;  5FKR A;  2OVR B;  5H14 A;  2P9N C;  4CZX A;  5GXH A;  2B5N A;  4L1Q D;  2IWF A;  4O45 A;  3ZWL B;  4ESG A;  4O3U B;  4K3J B;  4FAV D;  3CFV A;  1U2V C;  2CO0 C;  3FRX A;  3JRO A;  4ES0 A;  3E0C A;  4O9D A;  5IT9 g;  4CZV A;  4ERZ A;  4XYH A;  5EMJ B;  5FA5 B;  3SMR A;  5EMM B;  3FGB A;  3UVK A;  2AGZ A;  1GOT B;  2PM6 B;  3I7O A;  2H13 A;  2QC5 A;  2CE9 A;  3OKY B;  1RI6 A;  1U4C A;  5CXB B;  1XIP A;  3SN6 B;  3JRP A;  4FA5 D;  4A2L A;  3DM0 A;  4J79 A;  3EG6 A;  3OKY A;  5AMS A;  5A2Q g;  5C2V B;  3N0D A;  5EMK B;  2HYE A;  1A0R B;  3BG1 A;  3JB9 L;  3V7D B;  1B9Y A;  2B4E A;  3ULE C;  5I5M A;  3J81 g;  3I7H A;  4CY2 A;  2HJB A;  3A0F A;  5I5I A;  4ZOZ A;  2AQ5 A;  3I8E A;  3EMH A;  1VYH C;  3OL2 A;  3W15 A;  3PXW D;  2CO0 A;  2CE8 A;  4J8G A;  4JXM A;  3F3F A;  5IJ8 E;  3UVL A;  3SBR A;  2PBI B;  3PE7 A;  5C9Z B;  3I89 A;  4OWR A;  3PXS D;  2YBA A;  3NVX A;  3BWS A;  1N6D A;  2I3T A;  5FLX g;  3EI1 B;  3EWE A;  5IJ7 E;  4GZ8 A;  3EU7 A;  1PBY B;  5C2W B;  3EI1 A;  2AGY A;  4Y5R D;  2YNP A;  5B4W A;  3K27 A;  4I79 A;  3PSL A;  4R7A B;  4NSX A;  5CYK B;  5HE2 B;  1SQ9 A;  4X63 B;  5EML B;  3MKQ A;  1TYQ C;  3NVN A;  2XU7 A;  1NR0 A;  3AL9 A;  3MZL A;  5CYK A;  3B7F A;  4ZOY A;  2Q7Q A;  4FHL A;  3JAM g;  3IKO A;  1JOF A;  1JMX B;  4L9O A;  3JZH A;  4QQE A;  5IGO A;  3V5W B;  4JSN C;  4ERQ A;  4TZ4 A;  3UKR C;  2UZY B;  1PGU A;  1L0Q A;  4O3T B;  2UZX B;  4J78 A;  4A11 A;  1MG3 A;  2J56 H;  5IGQ A;  3J80 g;  2QXV A;  3JZG A;  4J0X A;  1XHM A;  3AH8 B;  1S4U X;  4EWR A;  1MG2 A;  5FQD A;  3SFZ A;  2XL3 A;  1K32 A;  4CY1 A;  1R5M A;  1MDA H;  3KRX B;  3AL8 B;  4BUJ C;  2HES X;  3I8C A;  4FAN D;  4A0B B;  2I0S A;  4MK0 B;  5SXM A;  3C99 A;  3DXM C;  3OW8 A;  3EI4 B;  2OJY A;  3F3G A;  3PVW B;  3JPX A;  3PSC B;  2H68 A;  4J0W A;  4A0B A;  5TEF A;  5CXC B;  3DWL C;  3RLM D;  4ERY A;  3C9C A;  5H17 A;  3OTT A;  4GQ1 A;  3UKU C;  4PBZ A;  5CXB A;  2H47 A;  2H3X A;  5FKT A;  2H9L A;  2P9P C;  4A08 B;  5CXC A;  2XL2 A;  4LG8 A;  1OMW B;  3NVQ A;  1B9X A;  2GC7 A;  3JZN A;  4A08 A;  1SHY B;  4L3H D;  2Z2O A;  2YMU A;  3L4M D;  2HKM A;  4GM8 A;  3KRW B;  2I0R A;  2YB8 B;  5HE0 B;  2HKR A;  1PI6 A;  1FWX A;  3MZK A;  1ERJ A;  5HQG A;  3UVO A;  1TBG A;  1GXR A;  3FM0 A;  3UVM A;  4ZOV A;  4X60 B;  3P4F A;  4CI1 A;  4QL1 A;  4G56 B;  4XYI A;  4AEZ A;  4GM3 A;  4PC0 A;  2P9K C;  4BH6 A;  2IUR A;  2I0T A;  3K26 A;  3IJC A;  4XEI C;  2P9S C;  2CN2 A;  4K3I D;  5HE3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...