2OK4A

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct oxidized with ferricyanide
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ok4A01
1PI6A 1TYQC 4CI8A 4A09B 4XYIA 2P9UC 3RSEC 4OWRA 5IGQA 2TRCB 2OVQB 3JZGA 4ZOZA 4FA1D 2AGXA 3SBQA 5GXIA 3MXXA 3EU7A 2BCJB 1TBGA 3RFHA 3I8CA 4PSXB 3EI1A 2MTAH 2PM6B 3NVXA 3I7PA 1N6DA 4U7AA 4J82A 1NEXB 3JPXA 3EI1B 3IJCA 3OW8A 3P4FA 4EWRA 3FM0A 3SCYA 2J56H 2I3TA 4AOWA 5IT9g 1XHMA 4X63B 3ODTA 1JMZB 4GM9A 1L0QA 2PBIB 5HYNB 5K19A 3IJ1A 5KDOB 1R5MA 4CY3A 3I7OA 2XYIA 3VGZA 2PM9A 1N6EA 4ERQA 3V5WB 2B5LA 3UVKA 2PM9B 2PM7B 4E5ZB 2P9PC 1NR0A 2AQ5A 1OLZA 3BG0A 2Z2PA 3PXTD 3SHFA 1GG2B 4JSXC 4A11A 2Z2OA 4GGAA 4IA9A 3DSMA 5AMSA 1GP2B 4A11B 2OVPB 3CIKB 3NVNA 2H3XA 4GGDA 4MK0B 3RFGA 4PBZA 3I7KA 1PGUA 3C99A 5IJ7E 3OKWA 1JJUB 4ERYA 3FGBA 4ZOVA 1FWXA 1U2VC 3DWLC 4BUJC 2H9NA 1S4UX 4IMMA 3I7LA 3K26A 1XKSA 5FLXg 3RMZD 3U4YA 5H14A 2GNQA 3KRWB 3MZLA 5TF2A 3UKUC 4CY5A 3SXTD 2B4EA 4X60B 3IKOA 4FWWA 5B4WA 3CFSB 4J8BA 4J0WA 4FA4D 5SXMA 4N14A 3N0DA 3JRPA 2AGYA 1MDAH 5FKSA 1B9XA 3HFQA 4ZOYA 3L4OD 5JWZA 3IIYA 3SJLD 4FB1D 5AFU3 1VYHC 4PSWB 5IGOA 2CNXA 4ZN4A 1SQJA 3SBRA 2GC4A 3C75H 1YFQA 2HKMA 2H14A 4O45A 3VH0A 3OKYA 3EI3B 3L4MD 3BG1A 2EBSA 4Y5RD 4GGCA 1N6FA 5GMKn 3OKYB 3OL2A 4ZOXA 5FXYA 2HJ4A 3SWSD 4GQ2P 5H17A 5HE3B 4A7JA 3EMHA 5EALA 4XYHA 2IURA 2AGWA 1GOTB 3OL2B 5HE1B 3EI2A 3IIWA 2HESX 2P9IC 4J78A 3RLMD 3EI2B 2XL2A 5TEFA 3C9CA 3SBPA 2HXCA 4JSPC 3UVOA 3V9FA 1Q47A 4A0BA 4CZYA 2YBAA 2P9SC 5THAA 4CI2A 2H9LA 2CN2A 1A0RB 3I7NA 3J80g 1RI6A 3N0EA 2CO0C 3MMYA 3PXWD 3AL8A 2OK6A 3KRXB 4CY2A 3MZKA 4LG8A 1P22A 4J0XA 5EARA 2QXVA 4JT6C 3AL8B 3I7HA 3VA6A 4HDJA 1GXRA 4AEZA 2AH1A 5C2WB 3DXMC 4A2MA 2OJYA 2IWFA 4PBYA 2I0RA 4I79A 4KFMB 2I3SA 3PXSD 4CC9A 2H6KA 5CYKA 4K3JB 2H9PA 4O9DA 1MG2A 4JSNC 2GC7A 2AGZA 4GZ8A 5CYKB 4J79A 4FAND 3DXKC 3UVNA 4BH6A 4A08A 3GFCA 5CXBA 3SMRA 3RN0D 5I5JA 2J57G 2H13A 4L3GD 2J55H 3GREA 4A08B 4FA9D 5CXBB 3ULEC 4GM3A 2QC5A 2XL3A 4J73A 2H6NA 2YB8B 3JZNA 4L1QD 4UI9R 5IC7A 4J87A 2B5MA 2IAAA 3SN6B 2OVRB 3UKRC 3ORVD 4CI3A 3JZHA 3PVUB 5AJAA 3PE7A 3EI4A 2I0SA 2CO0A 2P9NC 1K32A 4G56B 2IUQA 4ES0A 4A0AA 3AH8B 1SHYB 5C9ZB 1JOFA 5TEEA 2H47A 2AGLA 4FHLA 4YVDA 4A0AB 2Q7QA 3IJ0A 4LGNA 4ERZA 3PSLA 4GM8A 4H5IA 1JMXB 2CE9A 5H1MA 1K8KC 2B5NA 5GXHA 2OIZA 2P9KC 2H6QA 3AL9A 2UZYB 3BWSA 5TDHB 5I5MA 2OK4A 4PC0A 4Z8LA 5EMLB 4A2LA 3W15A 4XEIC 5K1CC 4GQBB 1MG3A 4JXMA 5FKRA 2H9MA 3V7DB 4CZXA 5EMKB 3I2NA 4JSVC 3UR4A 5HE2B 3NVQA 1PEVA 3PVWB 2O9KA 4BL0A 3UVMA 1QNIA 2CE8A 2XU7A 4A0BB 2IWKA 4J84A 3SLED 4X3EA 2G9AA 4ESGA 5HQGA 5FKTA 2CN3A 3EG6A 2BBKH 4J81A 4K3ID 3F3FA 3I89A 2HYEA 3RRMC 3F3PA 5FQDA 4TZ4A 4PXWA 5I5IA 4R7AB 3RN1D 1XIPA 5HE0B 4D6VA 4J86A 4L9OA 4QQEA 2W18A 2YNPA 3MKQA 4QT8A 5EMJB 4E5ZA 5EAPA 2YMUA 4QL1A 2HJBA 5GSAA 1B9YA 2G99A 3CFVA 4J8GA 3EWEA 5CXCA 4QRJA 2UZXB 3OKTA 3ZWLB 3FRXA 4JT5C 3JROA 5CXCB 2HKRA 4GMBA 3F3GA 4JD2C 3B7FA 3E0CA 4LG9A 4GQ1A 4FA5D 4CI1A 2I0TA 3J81g 2YNOA 4FAVD 4D0KA 4CY1A 3MKSB 3K27A 3PSCB 1SQ9A 5EM2A 4H5JA 4E54A 4O1QD 2AH0A 3C5MA 3AFCA 5A2Qg 4PNKB 3SFZA 3OTTA 5EM2B 4E54B 4L3HD 5C2VB 3JAMg 1OMWB 4CZVA 5EAMA 5EMMB 2IUVA 5FA5B 5IJ8E 3EI4B 4OZUA 4X61B 4O3UB 4Y7RA 4U1EI 3UVLA 4O3TB 2Z2NA 3I8EA 3SVWD 1ERJA 2IUPA 3EI3A 3A0FA 3JB9L 4A09A 2P9LC 1PBYB 4J77A 1U4CA 5FKQA 4NSXA 2YNNA 3DM0A 2H68A
chains in the Genus database with same CATH superfamily
4G1EA 4O02A 1T2XA 1PI6A 1TYQC 4CI8A 4A09B 4XYIA 2P9UC 3RSEC 1VE7A 4OWRA 5IGQA 2TRCB 2OVQB 3JZGA 4ZOZA 4FA1D 2AGXA 3SBQA 3IUJA 5GXIA 3MXXA 3EU7A 4Z7OA 2BCJB 1TBGA 1UOQA 3RFHA 3I8CA 2VDMA 4BCBA 4PSXB 3EI1A 2MTAH 2PM6B 1M1XA 3NVXA 2WQ8A 3I7PA 1N6DA 4U7AA 4J82A 1NEXB 4MMZA 3JPXA 3EI1B 3IJCA 3OW8A 3P4FA 2EIEA 4EWRA 3FM0A 3SCYA 2J56H 2I3TA 4AOWA 5IT9g 1XHMA 4X63B 3ODTA 1JMZB 4GM9A 1L0QA 2PBIB 2EIDA 5HYNB 3IJ1A 5K19A 5KDOB 1R5MA 2VC2A 4NC4A 1UOOA 4CY3A 3I7OA 2XYIA 3O4JA 4NAAA 2PM9A 3VGZA 3KCIA 3O4HA 1N6EA 4ERQA 3V5WB 2B5LA 3FCUA 1C9LA 3UVKA 2PM9B 2PM7B 4E5ZB 2P9PC 1NR0A 2AQ5A 1OLZA 3BG0A 3IURA 2Z2PA 3PXTD 4AX4A 3SHFA 1GG2B 1H2YA 4JSXC 4A11A 2Z2OA 3ZE2A 4AN1A 4GGAA 3MVDK 4G55A 4IA9A 3DSMA 5AMSA 4O2WA 1GP2B 4A11B 3VI4A 2OVPB 3CIKB 2VDRA 3NVNA 2H3XA 4GGDA 4MK0B 3RFGA 4PBZA 1U8CA 3I7KA 1PGUA 3C99A 5IJ7E 3OKWA 5C92A 1JJUB 1QFMA 4ERYA 4MMXA 3FGBA 4ZOVA 1FWXA 2XE4A 1U2VC 3DWLC 3MUOA 4BUJC 2H9NA 1S4UX 3NIFA 4IMMA 3I7LA 3K26A 1XKSA 5FLXg 3RMZD 3U4YA 5H14A 2GNQA 1C9IA 3KRWB 3MZLA 5TF2A 3UKUC 4CY5A 3SXTD 2B4EA 4X60B 3IKOA 4FWWA 5B4WA 3CFSB 1I2MB 4J8BA 5M5SA 4J0WA 3DDUA 4FA4D 5SXMA 4N14A 3OF7A 2HU5A 3N0DA 2QR5A 1VZ3A 3JRPA 1QFSA 2AGYA 1GOGA 1MDAH 5M61A 2VDKA 5FKSA 1B9XA 3HFQA 1A12A 3L4OD 4ZOYA 5JWZA 1TYEA 3GC3B 3IIYA 3O4IA 3SJLD 4FB1D 5AFU3 1VYHC 4PSWB 5IGOA 2CNXA 4ZN4A 1SQJA 3SBRA 3EQ7A 2GC4A 3C75H 1YFQA 1H2WA 2H14A 2HKMA 4JHPC 4O45A 3VH0A 3OKYA 2VDNA 3EI3B 1K3IA 3L4MD 3MUNA 3BG1A 2EBSA 4Y5RD 4GGCA 1N6FA 5GMKn 3OKYB 3OL2A 4ZOXA 5FXYA 2HJ4A 1O6FA 3SWSD 4GQ2P 5H17A 5HE3B 4A7JA 3EMHA 5EALA 4XYHA 2IURA 2AGWA 1GOTB 3OL2B 5HE1B 3EI2A 4RE6A 2HU8A 3IIWA 2HESX 4G1MA 2P9IC 3QI0A 4J78A 3RLMD 3EI2B 4QAMA 3NIGA 2XL2A 5TEFA 3C9CA 4UM9A 5FFOA 3SBPA 4WK2A 3ZE0A 2HXCA 4JSPC 3UVOA 3V9FA 1Q47A 4A0BA 4CZYA 1GOFA 2YBAA 2P9SC 5THAA 4CI2A 2H9LA 2HU7A 2CN2A 1A0RB 3I7NA 3J80g 1RI6A 3N0EA 4Z7QA 2CO0C 3MMYA 4RE5A 3IJEA 3NIDA 3PXWD 3AL8A 2OK6A 3KRXB 4CY2A 3IULA 3MZKA 4LG8A 2VZ1A 4L1MA 1P22A 3QHYB 4J0XA 5EARA 3EQ8A 2QXVA 4JT6C 3AL8B 3EQ9A 3I7HA 3VA6A 4HDJA 3O4GA 1GXRA 3ZDXA 4AEZA 2AH1A 4D9SA 3DXMC 4JHNA 3T3PA 4A2MA 5C2WB 2OJYA 2IWFA 4PBYA 2I0RA 4I79A 4KFMB 2I3SA 5M5TA 3PXSD 4CC9A 2H6KA 5CYKA 3VI3A 4K3JB 2H9PA 2VDQA 4O9DA 1MG2A 3ZDZA 4JSNC 3ZE1A 2GC7A 4WJKA 2AGZA 4GZ8A 1BPOA 5CYKB 1UOPA 4J79A 4FAND 3DXKC 1E8MA 3UVNA 4BH6A 4A08A 3GFCA 5CXBA 1VE6A 3SMRA 4NBMA 3ZDYA 3RN0D 5I5JA 2J57G 2H13A 3V4VA 4L3GD 2J55H 3GREA 4A08B 4FA9D 5CXBB 4Z7NA 3ULEC 4GM3A 2QC5A 2XL3A 4J73A 2H6NA 2YB8B 3JZNA 3IUMA 4L1QD 4UI9R 4J87A 1GOHA 1O6GA 2B5MA 2IAAA 5IC7A 5M5RA 5HDBA 3SN6B 2OVRB 2QZPA 3UKRC 3ORVD 4CI3A 3FCSA 3K72A 3JZHA 3PVUB 5C86A 5AJAA 3PE7A 3EI4A 2I0SA 2CO0A 4WK0A 2P9NC 1K32A 1VZ2A 4G56B 2IUQA 4ES0A 4A0AA 3AH8B 1SHYB 5C9ZB 1JOFA 5E6RA 5TEEA 2H47A 2AGLA 4AMYA 4FHLA 4YVDA 4A0AB 2Q7QA 3IJ0A 4LGNA 4ERZA 3PSLA 4DNWA 4GM8A 4H5IA 1JMXB 2CE9A 5H1MA 1K8KC 2B5NA 5GXHA 4BCDA 2OIZA 2P9KC 2H6QA 3AL9A 2UZYB 3BWSA 5TDHB 5I5MA 2OK4A 4PC0A 4Z8LA 5EMLB 4A2LA 3GD1I 3W15A 4XEIC 5K1CC 4GQBB 1MG3A 4JXMA 2VZ3A 4UM8A 4AN0A 3T3MA 4DNVA 5FKRA 2H9MA 3V7DB 4CZXA 5EMKB 1E5TA 3I2NA 4JSVC 3UR4A 5HE2B 3NVQA 1PEVA 3PVWB 2O9KA 4BL0A 3UVMA 3V4PA 1QNIA 2CE8A 2XU7A 4NENA 4A0BB 2IWKA 4J84A 3SLED 4X3EA 2G9AA 1UTCA 4ESGA 1YR2A 5FKTA 2CN3A 3EG6A 5HQGA 1E8NA 2BBKH 4DNUA 5FFGA 5E6SA 4J81A 2VDLA 4K3ID 3F3FA 3I89A 2HYEA 3RRMC 3F3PA 5FQDA 4TZ4A 4PXWA 5I5IA 4R7AB 3RN1D 1XIPA 5HE0B 4D6VA 4J86A 4L9OA 4MMYA 4QQEA 2W18A 2YNPA 3MKQA 4QT8A 5EMJB 4E5ZA 5EAPA 2YMUA 4QL1A 2HJBA 5M5VA 5GSAA 5M5UA 1B9YA 2G99A 3CFVA 1L5GA 4J8GA 3EWEA 5CXCA 4QRJA 2UZXB 3OKTA 3ZWLB 3FRXA 4JT5C 3JROA 5CXCB 2HKRA 4GMBA 3F3GA 2XDWA 4JD2C 3B7FA 3E0CA 4AMZA 4LG9A 4GQ1A 4FA5D 4CI1A 3K6SA 2I0TA 3J81g 2YNOA 4FAVD 4D0KA 2EIBA 4CY1A 3MKSB 2XZGA 3K27A 4BP9A 3PSCB 1SQ9A 5EM2A 4H5JA 1JTDB 4E54A 1H2XA 2AH0A 3IUNA 4O1QD 3C5MA 4BCCA 3AFCA 5A2Qg 4PNKB 3SFZA 2JKXA 3OTTA 5EM2B 4E54B 2EICA 4L3HD 5C2VB 3IVMA 3JAMg 1OMWB 4CZVA 5EAMA 1H2ZA 2BKLA 4IRZA 5EMMB 1JV2A 4WK4A 2IUVA 5FA5B 5IJ8E 3EI4B 3IUQA 4OZUA 3K71A 4X61B 4O3UB 5E6UA 4Y7RA 4U1EI 3UVLA 2VDPA 4O3TB 2Z2NA 2VDOA 3I8EA 3SVWD 1ERJA 2IUPA 3EI3A 3A0FA 3JB9L 4A09A 2P9LC 1PBYB 4J77A 1U4CA 5FKQA 4BP8A 4NSXA 2YNNA 3DM0A 2H68A
chains in the Genus database with same CATH topology
1PI6A 1TYQC 4CI8A 4A09B 4XYIA 2P9UC 3RSEC 4OWRA 5IGQA 2TRCB 2OVQB 3JZGA 4ZOZA 4FA1D 2AGXA 3SBQA 5GXIA 3MXXA 3EU7A 2BCJB 1TBGA 3RFHA 3I8CA 4PSXB 3EI1A 2MTAH 2PM6B 3NVXA 3I7PA 1N6DA 4U7AA 4J82A 1NEXB 3JPXA 3EI1B 3IJCA 3OW8A 3P4FA 4EWRA 3FM0A 3SCYA 2J56H 2I3TA 4AOWA 5IT9g 1XHMA 4X63B 3ODTA 1JMZB 4GM9A 1L0QA 2PBIB 5HYNB 5K19A 3IJ1A 5KDOB 1R5MA 4CY3A 3I7OA 2XYIA 3VGZA 2PM9A 1N6EA 4ERQA 3V5WB 2B5LA 3UVKA 2PM9B 2PM7B 4E5ZB 2P9PC 1NR0A 2AQ5A 1OLZA 3BG0A 2Z2PA 3PXTD 3SHFA 1GG2B 4JSXC 4A11A 2Z2OA 4GGAA 4IA9A 3DSMA 5AMSA 1GP2B 4A11B 2OVPB 3CIKB 3NVNA 2H3XA 4GGDA 4MK0B 3RFGA 4PBZA 3I7KA 1PGUA 3C99A 5IJ7E 3OKWA 1JJUB 4ERYA 3FGBA 4ZOVA 1FWXA 1U2VC 3DWLC 4BUJC 2H9NA 1S4UX 4IMMA 3I7LA 3K26A 1XKSA 5FLXg 3RMZD 3U4YA 5H14A 2GNQA 3KRWB 3MZLA 5TF2A 3UKUC 4CY5A 3SXTD 2B4EA 4X60B 3IKOA 4FWWA 5B4WA 3CFSB 4J8BA 4J0WA 4FA4D 5SXMA 4N14A 3N0DA 3JRPA 2AGYA 1MDAH 5FKSA 1B9XA 3HFQA 4ZOYA 3L4OD 5JWZA 3IIYA 3SJLD 4FB1D 5AFU3 1VYHC 4PSWB 5IGOA 2CNXA 4ZN4A 1SQJA 3SBRA 2GC4A 3C75H 1YFQA 2HKMA 2H14A 4O45A 3VH0A 3OKYA 3EI3B 3L4MD 3BG1A 2EBSA 4Y5RD 4GGCA 1N6FA 5GMKn 3OKYB 3OL2A 4ZOXA 5FXYA 2HJ4A 3SWSD 4GQ2P 5H17A 5HE3B 4A7JA 3EMHA 5EALA 4XYHA 2IURA 2AGWA 1GOTB 3OL2B 5HE1B 3EI2A 3IIWA 2HESX 2P9IC 4J78A 3RLMD 3EI2B 2XL2A 5TEFA 3C9CA 3SBPA 2HXCA 4JSPC 3UVOA 3V9FA 1Q47A 4A0BA 4CZYA 2YBAA 2P9SC 5THAA 4CI2A 2H9LA 2CN2A 1A0RB 3I7NA 3J80g 1RI6A 3N0EA 2CO0C 3MMYA 3PXWD 3AL8A 2OK6A 3KRXB 4CY2A 3MZKA 4LG8A 1P22A 4J0XA 5EARA 2QXVA 4JT6C 3AL8B 3I7HA 3VA6A 4HDJA 1GXRA 4AEZA 2AH1A 5C2WB 3DXMC 4A2MA 2OJYA 2IWFA 4PBYA 2I0RA 4I79A 4KFMB 2I3SA 3PXSD 4CC9A 2H6KA 5CYKA 4K3JB 2H9PA 4O9DA 1MG2A 4JSNC 2GC7A 2AGZA 4GZ8A 5CYKB 4J79A 4FAND 3DXKC 3UVNA 4BH6A 4A08A 3GFCA 5CXBA 3SMRA 3RN0D 5I5JA 2J57G 2H13A 4L3GD 2J55H 3GREA 4A08B 4FA9D 5CXBB 3ULEC 4GM3A 2QC5A 2XL3A 4J73A 2H6NA 2YB8B 3JZNA 4L1QD 4UI9R 5IC7A 4J87A 2B5MA 2IAAA 3SN6B 2OVRB 3UKRC 3ORVD 4CI3A 3JZHA 3PVUB 5AJAA 3PE7A 3EI4A 2I0SA 2CO0A 2P9NC 1K32A 4G56B 2IUQA 4ES0A 4A0AA 3AH8B 1SHYB 5C9ZB 1JOFA 5TEEA 2H47A 2AGLA 4FHLA 4YVDA 4A0AB 2Q7QA 3IJ0A 4LGNA 4ERZA 3PSLA 4GM8A 4H5IA 1JMXB 2CE9A 5H1MA 1K8KC 2B5NA 5GXHA 2OIZA 2P9KC 2H6QA 3AL9A 2UZYB 3BWSA 5TDHB 5I5MA 2OK4A 4PC0A 4Z8LA 5EMLB 4A2LA 3W15A 4XEIC 5K1CC 4GQBB 1MG3A 4JXMA 5FKRA 2H9MA 3V7DB 4CZXA 5EMKB 3I2NA 4JSVC 3UR4A 5HE2B 3NVQA 1PEVA 3PVWB 2O9KA 4BL0A 3UVMA 1QNIA 2CE8A 2XU7A 4A0BB 2IWKA 4J84A 3SLED 4X3EA 2G9AA 4ESGA 5HQGA 5FKTA 2CN3A 3EG6A 2BBKH 4J81A 4K3ID 3F3FA 3I89A 2HYEA 3RRMC 3F3PA 5FQDA 4TZ4A 4PXWA 5I5IA 4R7AB 3RN1D 1XIPA 5HE0B 4D6VA 4J86A 4L9OA 4QQEA 2W18A 2YNPA 3MKQA 4QT8A 5EMJB 4E5ZA 5EAPA 2YMUA 4QL1A 2HJBA 5GSAA 1B9YA 2G99A 3CFVA 4J8GA 3EWEA 5CXCA 4QRJA 2UZXB 3OKTA 3ZWLB 3FRXA 4JT5C 3JROA 5CXCB 2HKRA 4GMBA 3F3GA 4JD2C 3B7FA 3E0CA 4LG9A 4GQ1A 4FA5D 4CI1A 2I0TA 3J81g 2YNOA 4FAVD 4D0KA 4CY1A 3MKSB 3K27A 3PSCB 1SQ9A 5EM2A 4H5JA 4E54A 4O1QD 2AH0A 3C5MA 3AFCA 5A2Qg 4PNKB 3SFZA 3OTTA 5EM2B 4E54B 4L3HD 5C2VB 3JAMg 1OMWB 4CZVA 5EAMA 5EMMB 2IUVA 5FA5B 5IJ8E 3EI4B 4OZUA 4X61B 4O3UB 4Y7RA 4U1EI 3UVLA 4O3TB 2Z2NA 3I8EA 3SVWD 1ERJA 2IUPA 3EI3A 3A0FA 3JB9L 4A09A 2P9LC 1PBYB 4J77A 1U4CA 5FKQA 4NSXA 2YNNA 3DM0A 2H68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI6 A;  1TYQ C;  4CI8 A;  4A09 B;  4XYI A;  2P9U C;  3RSE C;  4OWR A;  5IGQ A;  2TRC B;  2OVQ B;  3JZG A;  4ZOZ A;  4FA1 D;  2AGX A;  3SBQ A;  5GXI A;  3MXX A;  3EU7 A;  2BCJ B;  1TBG A;  3RFH A;  3I8C A;  4PSX B;  3EI1 A;  2MTA H;  2PM6 B;  3NVX A;  3I7P A;  1N6D A;  4U7A A;  4J82 A;  1NEX B;  3JPX A;  3EI1 B;  3IJC A;  3OW8 A;  3P4F A;  4EWR A;  3FM0 A;  3SCY A;  2J56 H;  2I3T A;  4AOW A;  5IT9 g;  1XHM A;  4X63 B;  3ODT A;  1JMZ B;  4GM9 A;  1L0Q A;  2PBI B;  5HYN B;  5K19 A;  3IJ1 A;  5KDO B;  1R5M A;  4CY3 A;  3I7O A;  2XYI A;  3VGZ A;  2PM9 A;  1N6E A;  4ERQ A;  3V5W B;  2B5L A;  3UVK A;  2PM9 B;  2PM7 B;  4E5Z B;  2P9P C;  1NR0 A;  2AQ5 A;  1OLZ A;  3BG0 A;  2Z2P A;  3PXT D;  3SHF A;  1GG2 B;  4JSX C;  4A11 A;  2Z2O A;  4GGA A;  4IA9 A;  3DSM A;  5AMS A;  1GP2 B;  4A11 B;  2OVP B;  3CIK B;  3NVN A;  2H3X A;  4GGD A;  4MK0 B;  3RFG A;  4PBZ A;  3I7K A;  1PGU A;  3C99 A;  5IJ7 E;  3OKW A;  1JJU B;  4ERY A;  3FGB A;  4ZOV A;  1FWX A;  1U2V C;  3DWL C;  4BUJ C;  2H9N A;  1S4U X;  4IMM A;  3I7L A;  3K26 A;  1XKS A;  5FLX g;  3RMZ D;  3U4Y A;  5H14 A;  2GNQ A;  3KRW B;  3MZL A;  5TF2 A;  3UKU C;  4CY5 A;  3SXT D;  2B4E A;  4X60 B;  3IKO A;  4FWW A;  5B4W A;  3CFS B;  4J8B A;  4J0W A;  4FA4 D;  5SXM A;  4N14 A;  3N0D A;  3JRP A;  2AGY A;  1MDA H;  5FKS A;  1B9X A;  3HFQ A;  4ZOY A;  3L4O D;  5JWZ A;  3IIY A;  3SJL D;  4FB1 D;  5AFU 3;  1VYH C;  4PSW B;  5IGO A;  2CNX A;  4ZN4 A;  1SQJ A;  3SBR A;  2GC4 A;  3C75 H;  1YFQ A;  2HKM A;  2H14 A;  4O45 A;  3VH0 A;  3OKY A;  3EI3 B;  3L4M D;  3BG1 A;  2EBS A;  4Y5R D;  4GGC A;  1N6F A;  5GMK n;  3OKY B;  3OL2 A;  4ZOX A;  5FXY A;  2HJ4 A;  3SWS D;  4GQ2 P;  5H17 A;  5HE3 B;  4A7J A;  3EMH A;  5EAL A;  4XYH A;  2IUR A;  2AGW A;  1GOT B;  3OL2 B;  5HE1 B;  3EI2 A;  3IIW A;  2HES X;  2P9I C;  4J78 A;  3RLM D;  3EI2 B;  2XL2 A;  5TEF A;  3C9C A;  3SBP A;  2HXC A;  4JSP C;  3UVO A;  3V9F A;  1Q47 A;  4A0B A;  4CZY A;  2YBA A;  2P9S C;  5THA A;  4CI2 A;  2H9L A;  2CN2 A;  1A0R B;  3I7N A;  3J80 g;  1RI6 A;  3N0E A;  2CO0 C;  3MMY A;  3PXW D;  3AL8 A;  2OK6 A;  3KRX B;  4CY2 A;  3MZK A;  4LG8 A;  1P22 A;  4J0X A;  5EAR A;  2QXV A;  4JT6 C;  3AL8 B;  3I7H A;  3VA6 A;  4HDJ A;  1GXR A;  4AEZ A;  2AH1 A;  5C2W B;  3DXM C;  4A2M A;  2OJY A;  2IWF A;  4PBY A;  2I0R A;  4I79 A;  4KFM B;  2I3S A;  3PXS D;  4CC9 A;  2H6K A;  5CYK A;  4K3J B;  2H9P A;  4O9D A;  1MG2 A;  4JSN C;  2GC7 A;  2AGZ A;  4GZ8 A;  5CYK B;  4J79 A;  4FAN D;  3DXK C;  3UVN A;  4BH6 A;  4A08 A;  3GFC A;  5CXB A;  3SMR A;  3RN0 D;  5I5J A;  2J57 G;  2H13 A;  4L3G D;  2J55 H;  3GRE A;  4A08 B;  4FA9 D;  5CXB B;  3ULE C;  4GM3 A;  2QC5 A;  2XL3 A;  4J73 A;  2H6N A;  2YB8 B;  3JZN A;  4L1Q D;  4UI9 R;  5IC7 A;  4J87 A;  2B5M A;  2IAA A;  3SN6 B;  2OVR B;  3UKR C;  3ORV D;  4CI3 A;  3JZH A;  3PVU B;  5AJA A;  3PE7 A;  3EI4 A;  2I0S A;  2CO0 A;  2P9N C;  1K32 A;  4G56 B;  2IUQ A;  4ES0 A;  4A0A A;  3AH8 B;  1SHY B;  5C9Z B;  1JOF A;  5TEE A;  2H47 A;  2AGL A;  4FHL A;  4YVD A;  4A0A B;  2Q7Q A;  3IJ0 A;  4LGN A;  4ERZ A;  3PSL A;  4GM8 A;  4H5I A;  1JMX B;  2CE9 A;  5H1M A;  1K8K C;  2B5N A;  5GXH A;  2OIZ A;  2P9K C;  2H6Q A;  3AL9 A;  2UZY B;  3BWS A;  5TDH B;  5I5M A;  2OK4 A;  4PC0 A;  4Z8L A;  5EML B;  4A2L A;  3W15 A;  4XEI C;  5K1C C;  4GQB B;  1MG3 A;  4JXM A;  5FKR A;  2H9M A;  3V7D B;  4CZX A;  5EMK B;  3I2N A;  4JSV C;  3UR4 A;  5HE2 B;  3NVQ A;  1PEV A;  3PVW B;  2O9K A;  4BL0 A;  3UVM A;  1QNI A;  2CE8 A;  2XU7 A;  4A0B B;  2IWK A;  4J84 A;  3SLE D;  4X3E A;  2G9A A;  4ESG A;  5HQG A;  5FKT A;  2CN3 A;  3EG6 A;  2BBK H;  4J81 A;  4K3I D;  3F3F A;  3I89 A;  2HYE A;  3RRM C;  3F3P A;  5FQD A;  4TZ4 A;  4PXW A;  5I5I A;  4R7A B;  3RN1 D;  1XIP A;  5HE0 B;  4D6V A;  4J86 A;  4L9O A;  4QQE A;  2W18 A;  2YNP A;  3MKQ A;  4QT8 A;  5EMJ B;  4E5Z A;  5EAP A;  2YMU A;  4QL1 A;  2HJB A;  5GSA A;  1B9Y A;  2G99 A;  3CFV A;  4J8G A;  3EWE A;  5CXC A;  4QRJ A;  2UZX B;  3OKT A;  3ZWL B;  3FRX A;  4JT5 C;  3JRO A;  5CXC B;  2HKR A;  4GMB A;  3F3G A;  4JD2 C;  3B7F A;  3E0C A;  4LG9 A;  4GQ1 A;  4FA5 D;  4CI1 A;  2I0T A;  3J81 g;  2YNO A;  4FAV D;  4D0K A;  4CY1 A;  3MKS B;  3K27 A;  3PSC B;  1SQ9 A;  5EM2 A;  4H5J A;  4E54 A;  4O1Q D;  2AH0 A;  3C5M A;  3AFC A;  5A2Q g;  4PNK B;  3SFZ A;  3OTT A;  5EM2 B;  4E54 B;  4L3H D;  5C2V B;  3JAM g;  1OMW B;  4CZV A;  5EAM A;  5EMM B;  2IUV A;  5FA5 B;  5IJ8 E;  3EI4 B;  4OZU A;  4X61 B;  4O3U B;  4Y7R A;  4U1E I;  3UVL A;  4O3T B;  2Z2N A;  3I8E A;  3SVW D;  1ERJ A;  2IUP A;  3EI3 A;  3A0F A;  3JB9 L;  4A09 A;  2P9L C;  1PBY B;  4J77 A;  1U4C A;  5FKQ A;  4NSX A;  2YNN A;  3DM0 A;  2H68 A; 
#chains in the Genus database with same CATH topology
 4G1E A;  4O02 A;  1T2X A;  1PI6 A;  1TYQ C;  4CI8 A;  4A09 B;  4XYI A;  2P9U C;  3RSE C;  1VE7 A;  4OWR A;  5IGQ A;  2TRC B;  2OVQ B;  3JZG A;  4ZOZ A;  4FA1 D;  2AGX A;  3SBQ A;  3IUJ A;  5GXI A;  3MXX A;  3EU7 A;  4Z7O A;  2BCJ B;  1TBG A;  1UOQ A;  3RFH A;  3I8C A;  2VDM A;  4BCB A;  4PSX B;  3EI1 A;  2MTA H;  2PM6 B;  1M1X A;  3NVX A;  2WQ8 A;  3I7P A;  1N6D A;  4U7A A;  4J82 A;  1NEX B;  4MMZ A;  3JPX A;  3EI1 B;  3IJC A;  3OW8 A;  3P4F A;  2EIE A;  4EWR A;  3FM0 A;  3SCY A;  2J56 H;  2I3T A;  4AOW A;  5IT9 g;  1XHM A;  4X63 B;  3ODT A;  1JMZ B;  4GM9 A;  1L0Q A;  2PBI B;  2EID A;  5HYN B;  3IJ1 A;  5K19 A;  5KDO B;  1R5M A;  2VC2 A;  4NC4 A;  1UOO A;  4CY3 A;  3I7O A;  2XYI A;  3O4J A;  4NAA A;  2PM9 A;  3VGZ A;  3KCI A;  3O4H A;  1N6E A;  4ERQ A;  3V5W B;  2B5L A;  3FCU A;  1C9L A;  3UVK A;  2PM9 B;  2PM7 B;  4E5Z B;  2P9P C;  1NR0 A;  2AQ5 A;  1OLZ A;  3BG0 A;  3IUR A;  2Z2P A;  3PXT D;  4AX4 A;  3SHF A;  1GG2 B;  1H2Y A;  4JSX C;  4A11 A;  2Z2O A;  3ZE2 A;  4AN1 A;  4GGA A;  3MVD K;  4G55 A;  4IA9 A;  3DSM A;  5AMS A;  4O2W A;  1GP2 B;  4A11 B;  3VI4 A;  2OVP B;  3CIK B;  2VDR A;  3NVN A;  2H3X A;  4GGD A;  4MK0 B;  3RFG A;  4PBZ A;  1U8C A;  3I7K A;  1PGU A;  3C99 A;  5IJ7 E;  3OKW A;  5C92 A;  1JJU B;  1QFM A;  4ERY A;  4MMX A;  3FGB A;  4ZOV A;  1FWX A;  2XE4 A;  1U2V C;  3DWL C;  3MUO A;  4BUJ C;  2H9N A;  1S4U X;  3NIF A;  4IMM A;  3I7L A;  3K26 A;  1XKS A;  5FLX g;  3RMZ D;  3U4Y A;  5H14 A;  2GNQ A;  1C9I A;  3KRW B;  3MZL A;  5TF2 A;  3UKU C;  4CY5 A;  3SXT D;  2B4E A;  4X60 B;  3IKO A;  4FWW A;  5B4W A;  3CFS B;  1I2M B;  4J8B A;  5M5S A;  4J0W A;  3DDU A;  4FA4 D;  5SXM A;  4N14 A;  3OF7 A;  2HU5 A;  3N0D A;  2QR5 A;  1VZ3 A;  3JRP A;  1QFS A;  2AGY A;  1GOG A;  1MDA H;  5M61 A;  2VDK A;  5FKS A;  1B9X A;  3HFQ A;  1A12 A;  3L4O D;  4ZOY A;  5JWZ A;  1TYE A;  3GC3 B;  3IIY A;  3O4I A;  3SJL D;  4FB1 D;  5AFU 3;  1VYH C;  4PSW B;  5IGO A;  2CNX A;  4ZN4 A;  1SQJ A;  3SBR A;  3EQ7 A;  2GC4 A;  3C75 H;  1YFQ A;  1H2W A;  2H14 A;  2HKM A;  4JHP C;  4O45 A;  3VH0 A;  3OKY A;  2VDN A;  3EI3 B;  1K3I A;  3L4M D;  3MUN A;  3BG1 A;  2EBS A;  4Y5R D;  4GGC A;  1N6F A;  5GMK n;  3OKY B;  3OL2 A;  4ZOX A;  5FXY A;  2HJ4 A;  1O6F A;  3SWS D;  4GQ2 P;  5H17 A;  5HE3 B;  4A7J A;  3EMH A;  5EAL A;  4XYH A;  2IUR A;  2AGW A;  1GOT B;  3OL2 B;  5HE1 B;  3EI2 A;  4RE6 A;  2HU8 A;  3IIW A;  2HES X;  4G1M A;  2P9I C;  3QI0 A;  4J78 A;  3RLM D;  3EI2 B;  4QAM A;  3NIG A;  2XL2 A;  5TEF A;  3C9C A;  4UM9 A;  5FFO A;  3SBP A;  4WK2 A;  3ZE0 A;  2HXC A;  4JSP C;  3UVO A;  3V9F A;  1Q47 A;  4A0B A;  4CZY A;  1GOF A;  2YBA A;  2P9S C;  5THA A;  4CI2 A;  2H9L A;  2HU7 A;  2CN2 A;  1A0R B;  3I7N A;  3J80 g;  1RI6 A;  3N0E A;  4Z7Q A;  2CO0 C;  3MMY A;  4RE5 A;  3IJE A;  3NID A;  3PXW D;  3AL8 A;  2OK6 A;  3KRX B;  4CY2 A;  3IUL A;  3MZK A;  4LG8 A;  2VZ1 A;  4L1M A;  1P22 A;  3QHY B;  4J0X A;  5EAR A;  3EQ8 A;  2QXV A;  4JT6 C;  3AL8 B;  3EQ9 A;  3I7H A;  3VA6 A;  4HDJ A;  3O4G A;  1GXR A;  3ZDX A;  4AEZ A;  2AH1 A;  4D9S A;  3DXM C;  4JHN A;  3T3P A;  4A2M A;  5C2W B;  2OJY A;  2IWF A;  4PBY A;  2I0R A;  4I79 A;  4KFM B;  2I3S A;  5M5T A;  3PXS D;  4CC9 A;  2H6K A;  5CYK A;  3VI3 A;  4K3J B;  2H9P A;  2VDQ A;  4O9D A;  1MG2 A;  3ZDZ A;  4JSN C;  3ZE1 A;  2GC7 A;  4WJK A;  2AGZ A;  4GZ8 A;  1BPO A;  5CYK B;  1UOP A;  4J79 A;  4FAN D;  3DXK C;  1E8M A;  3UVN A;  4BH6 A;  4A08 A;  3GFC A;  5CXB A;  1VE6 A;  3SMR A;  4NBM A;  3ZDY A;  3RN0 D;  5I5J A;  2J57 G;  2H13 A;  3V4V A;  4L3G D;  2J55 H;  3GRE A;  4A08 B;  4FA9 D;  5CXB B;  4Z7N A;  3ULE C;  4GM3 A;  2QC5 A;  2XL3 A;  4J73 A;  2H6N A;  2YB8 B;  3JZN A;  3IUM A;  4L1Q D;  4UI9 R;  4J87 A;  1GOH A;  1O6G A;  2B5M A;  2IAA A;  5IC7 A;  5M5R A;  5HDB A;  3SN6 B;  2OVR B;  2QZP A;  3UKR C;  3ORV D;  4CI3 A;  3FCS A;  3K72 A;  3JZH A;  3PVU B;  5C86 A;  5AJA A;  3PE7 A;  3EI4 A;  2I0S A;  2CO0 A;  4WK0 A;  2P9N C;  1K32 A;  1VZ2 A;  4G56 B;  2IUQ A;  4ES0 A;  4A0A A;  3AH8 B;  1SHY B;  5C9Z B;  1JOF A;  5E6R A;  5TEE A;  2H47 A;  2AGL A;  4AMY A;  4FHL A;  4YVD A;  4A0A B;  2Q7Q A;  3IJ0 A;  4LGN A;  4ERZ A;  3PSL A;  4DNW A;  4GM8 A;  4H5I A;  1JMX B;  2CE9 A;  5H1M A;  1K8K C;  2B5N A;  5GXH A;  4BCD A;  2OIZ A;  2P9K C;  2H6Q A;  3AL9 A;  2UZY B;  3BWS A;  5TDH B;  5I5M A;  2OK4 A;  4PC0 A;  4Z8L A;  5EML B;  4A2L A;  3GD1 I;  3W15 A;  4XEI C;  5K1C C;  4GQB B;  1MG3 A;  4JXM A;  2VZ3 A;  4UM8 A;  4AN0 A;  3T3M A;  4DNV A;  5FKR A;  2H9M A;  3V7D B;  4CZX A;  5EMK B;  1E5T A;  3I2N A;  4JSV C;  3UR4 A;  5HE2 B;  3NVQ A;  1PEV A;  3PVW B;  2O9K A;  4BL0 A;  3UVM A;  3V4P A;  1QNI A;  2CE8 A;  2XU7 A;  4NEN A;  4A0B B;  2IWK A;  4J84 A;  3SLE D;  4X3E A;  2G9A A;  1UTC A;  4ESG A;  1YR2 A;  5FKT A;  2CN3 A;  3EG6 A;  5HQG A;  1E8N A;  2BBK H;  4DNU A;  5FFG A;  5E6S A;  4J81 A;  2VDL A;  4K3I D;  3F3F A;  3I89 A;  2HYE A;  3RRM C;  3F3P A;  5FQD A;  4TZ4 A;  4PXW A;  5I5I A;  4R7A B;  3RN1 D;  1XIP A;  5HE0 B;  4D6V A;  4J86 A;  4L9O A;  4MMY A;  4QQE A;  2W18 A;  2YNP A;  3MKQ A;  4QT8 A;  5EMJ B;  4E5Z A;  5EAP A;  2YMU A;  4QL1 A;  2HJB A;  5M5V A;  5GSA A;  5M5U A;  1B9Y A;  2G99 A;  3CFV A;  1L5G A;  4J8G A;  3EWE A;  5CXC A;  4QRJ A;  2UZX B;  3OKT A;  3ZWL B;  3FRX A;  4JT5 C;  3JRO A;  5CXC B;  2HKR A;  4GMB A;  3F3G A;  2XDW A;  4JD2 C;  3B7F A;  3E0C A;  4AMZ A;  4LG9 A;  4GQ1 A;  4FA5 D;  4CI1 A;  3K6S A;  2I0T A;  3J81 g;  2YNO A;  4FAV D;  4D0K A;  2EIB A;  4CY1 A;  3MKS B;  2XZG A;  3K27 A;  4BP9 A;  3PSC B;  1SQ9 A;  5EM2 A;  4H5J A;  1JTD B;  4E54 A;  1H2X A;  2AH0 A;  3IUN A;  4O1Q D;  3C5M A;  4BCC A;  3AFC A;  5A2Q g;  4PNK B;  3SFZ A;  2JKX A;  3OTT A;  5EM2 B;  4E54 B;  2EIC A;  4L3H D;  5C2V B;  3IVM A;  3JAM g;  1OMW B;  4CZV A;  5EAM A;  1H2Z A;  2BKL A;  4IRZ A;  5EMM B;  1JV2 A;  4WK4 A;  2IUV A;  5FA5 B;  5IJ8 E;  3EI4 B;  3IUQ A;  4OZU A;  3K71 A;  4X61 B;  4O3U B;  5E6U A;  4Y7R A;  4U1E I;  3UVL A;  2VDP A;  4O3T B;  2Z2N A;  2VDO A;  3I8E A;  3SVW D;  1ERJ A;  2IUP A;  3EI3 A;  3A0F A;  3JB9 L;  4A09 A;  2P9L C;  1PBY B;  4J77 A;  1U4C A;  5FKQ A;  4BP8 A;  4NSX A;  2YNN A;  3DM0 A;  2H68 A; 
#chains in the Genus database with same CATH homology
 1PI6 A;  1TYQ C;  4CI8 A;  4A09 B;  4XYI A;  2P9U C;  3RSE C;  4OWR A;  5IGQ A;  2TRC B;  2OVQ B;  3JZG A;  4ZOZ A;  4FA1 D;  2AGX A;  3SBQ A;  5GXI A;  3MXX A;  3EU7 A;  2BCJ B;  1TBG A;  3RFH A;  3I8C A;  4PSX B;  3EI1 A;  2MTA H;  2PM6 B;  3NVX A;  3I7P A;  1N6D A;  4U7A A;  4J82 A;  1NEX B;  3JPX A;  3EI1 B;  3IJC A;  3OW8 A;  3P4F A;  4EWR A;  3FM0 A;  3SCY A;  2J56 H;  2I3T A;  4AOW A;  5IT9 g;  1XHM A;  4X63 B;  3ODT A;  1JMZ B;  4GM9 A;  1L0Q A;  2PBI B;  5HYN B;  5K19 A;  3IJ1 A;  5KDO B;  1R5M A;  4CY3 A;  3I7O A;  2XYI A;  3VGZ A;  2PM9 A;  1N6E A;  4ERQ A;  3V5W B;  2B5L A;  3UVK A;  2PM9 B;  2PM7 B;  4E5Z B;  2P9P C;  1NR0 A;  2AQ5 A;  1OLZ A;  3BG0 A;  2Z2P A;  3PXT D;  3SHF A;  1GG2 B;  4JSX C;  4A11 A;  2Z2O A;  4GGA A;  4IA9 A;  3DSM A;  5AMS A;  1GP2 B;  4A11 B;  2OVP B;  3CIK B;  3NVN A;  2H3X A;  4GGD A;  4MK0 B;  3RFG A;  4PBZ A;  3I7K A;  1PGU A;  3C99 A;  5IJ7 E;  3OKW A;  1JJU B;  4ERY A;  3FGB A;  4ZOV A;  1FWX A;  1U2V C;  3DWL C;  4BUJ C;  2H9N A;  1S4U X;  4IMM A;  3I7L A;  3K26 A;  1XKS A;  5FLX g;  3RMZ D;  3U4Y A;  5H14 A;  2GNQ A;  3KRW B;  3MZL A;  5TF2 A;  3UKU C;  4CY5 A;  3SXT D;  2B4E A;  4X60 B;  3IKO A;  4FWW A;  5B4W A;  3CFS B;  4J8B A;  4J0W A;  4FA4 D;  5SXM A;  4N14 A;  3N0D A;  3JRP A;  2AGY A;  1MDA H;  5FKS A;  1B9X A;  3HFQ A;  4ZOY A;  3L4O D;  5JWZ A;  3IIY A;  3SJL D;  4FB1 D;  5AFU 3;  1VYH C;  4PSW B;  5IGO A;  2CNX A;  4ZN4 A;  1SQJ A;  3SBR A;  2GC4 A;  3C75 H;  1YFQ A;  2HKM A;  2H14 A;  4O45 A;  3VH0 A;  3OKY A;  3EI3 B;  3L4M D;  3BG1 A;  2EBS A;  4Y5R D;  4GGC A;  1N6F A;  5GMK n;  3OKY B;  3OL2 A;  4ZOX A;  5FXY A;  2HJ4 A;  3SWS D;  4GQ2 P;  5H17 A;  5HE3 B;  4A7J A;  3EMH A;  5EAL A;  4XYH A;  2IUR A;  2AGW A;  1GOT B;  3OL2 B;  5HE1 B;  3EI2 A;  3IIW A;  2HES X;  2P9I C;  4J78 A;  3RLM D;  3EI2 B;  2XL2 A;  5TEF A;  3C9C A;  3SBP A;  2HXC A;  4JSP C;  3UVO A;  3V9F A;  1Q47 A;  4A0B A;  4CZY A;  2YBA A;  2P9S C;  5THA A;  4CI2 A;  2H9L A;  2CN2 A;  1A0R B;  3I7N A;  3J80 g;  1RI6 A;  3N0E A;  2CO0 C;  3MMY A;  3PXW D;  3AL8 A;  2OK6 A;  3KRX B;  4CY2 A;  3MZK A;  4LG8 A;  1P22 A;  4J0X A;  5EAR A;  2QXV A;  4JT6 C;  3AL8 B;  3I7H A;  3VA6 A;  4HDJ A;  1GXR A;  4AEZ A;  2AH1 A;  5C2W B;  3DXM C;  4A2M A;  2OJY A;  2IWF A;  4PBY A;  2I0R A;  4I79 A;  4KFM B;  2I3S A;  3PXS D;  4CC9 A;  2H6K A;  5CYK A;  4K3J B;  2H9P A;  4O9D A;  1MG2 A;  4JSN C;  2GC7 A;  2AGZ A;  4GZ8 A;  5CYK B;  4J79 A;  4FAN D;  3DXK C;  3UVN A;  4BH6 A;  4A08 A;  3GFC A;  5CXB A;  3SMR A;  3RN0 D;  5I5J A;  2J57 G;  2H13 A;  4L3G D;  2J55 H;  3GRE A;  4A08 B;  4FA9 D;  5CXB B;  3ULE C;  4GM3 A;  2QC5 A;  2XL3 A;  4J73 A;  2H6N A;  2YB8 B;  3JZN A;  4L1Q D;  4UI9 R;  5IC7 A;  4J87 A;  2B5M A;  2IAA A;  3SN6 B;  2OVR B;  3UKR C;  3ORV D;  4CI3 A;  3JZH A;  3PVU B;  5AJA A;  3PE7 A;  3EI4 A;  2I0S A;  2CO0 A;  2P9N C;  1K32 A;  4G56 B;  2IUQ A;  4ES0 A;  4A0A A;  3AH8 B;  1SHY B;  5C9Z B;  1JOF A;  5TEE A;  2H47 A;  2AGL A;  4FHL A;  4YVD A;  4A0A B;  2Q7Q A;  3IJ0 A;  4LGN A;  4ERZ A;  3PSL A;  4GM8 A;  4H5I A;  1JMX B;  2CE9 A;  5H1M A;  1K8K C;  2B5N A;  5GXH A;  2OIZ A;  2P9K C;  2H6Q A;  3AL9 A;  2UZY B;  3BWS A;  5TDH B;  5I5M A;  2OK4 A;  4PC0 A;  4Z8L A;  5EML B;  4A2L A;  3W15 A;  4XEI C;  5K1C C;  4GQB B;  1MG3 A;  4JXM A;  5FKR A;  2H9M A;  3V7D B;  4CZX A;  5EMK B;  3I2N A;  4JSV C;  3UR4 A;  5HE2 B;  3NVQ A;  1PEV A;  3PVW B;  2O9K A;  4BL0 A;  3UVM A;  1QNI A;  2CE8 A;  2XU7 A;  4A0B B;  2IWK A;  4J84 A;  3SLE D;  4X3E A;  2G9A A;  4ESG A;  5HQG A;  5FKT A;  2CN3 A;  3EG6 A;  2BBK H;  4J81 A;  4K3I D;  3F3F A;  3I89 A;  2HYE A;  3RRM C;  3F3P A;  5FQD A;  4TZ4 A;  4PXW A;  5I5I A;  4R7A B;  3RN1 D;  1XIP A;  5HE0 B;  4D6V A;  4J86 A;  4L9O A;  4QQE A;  2W18 A;  2YNP A;  3MKQ A;  4QT8 A;  5EMJ B;  4E5Z A;  5EAP A;  2YMU A;  4QL1 A;  2HJB A;  5GSA A;  1B9Y A;  2G99 A;  3CFV A;  4J8G A;  3EWE A;  5CXC A;  4QRJ A;  2UZX B;  3OKT A;  3ZWL B;  3FRX A;  4JT5 C;  3JRO A;  5CXC B;  2HKR A;  4GMB A;  3F3G A;  4JD2 C;  3B7F A;  3E0C A;  4LG9 A;  4GQ1 A;  4FA5 D;  4CI1 A;  2I0T A;  3J81 g;  2YNO A;  4FAV D;  4D0K A;  4CY1 A;  3MKS B;  3K27 A;  3PSC B;  1SQ9 A;  5EM2 A;  4H5J A;  4E54 A;  4O1Q D;  2AH0 A;  3C5M A;  3AFC A;  5A2Q g;  4PNK B;  3SFZ A;  3OTT A;  5EM2 B;  4E54 B;  4L3H D;  5C2V B;  3JAM g;  1OMW B;  4CZV A;  5EAM A;  5EMM B;  2IUV A;  5FA5 B;  5IJ8 E;  3EI4 B;  4OZU A;  4X61 B;  4O3U B;  4Y7R A;  4U1E I;  3UVL A;  4O3T B;  2Z2N A;  3I8E A;  3SVW D;  1ERJ A;  2IUP A;  3EI3 A;  3A0F A;  3JB9 L;  4A09 A;  2P9L C;  1PBY B;  4J77 A;  1U4C A;  5FKQ A;  4NSX A;  2YNN A;  3DM0 A;  2H68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...