3ZDYA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 101
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdyA00
5E6UA 4WK4A 4WK0A 4Z7QA 1M1XA 4G1MA 4WJKA 2VDLA 3K71A 4O02A 4MMYA 3V4VA 3NIDA 2VDNA 2VC2A 1L5GA 3VI4A 1JV2A 3T3MA 5FFGA 1U8CA 3FCUA 4NENA 3NIGA 4UM9A 3IJEA 3V4PA 2VDMA 4Z7NA 3ZE1A 3NIFA 4WK2A 2VDQA 3ZDXA 3ZDZA 4Z7OA 3ZE2A 5FFOA 2VDOA 4IRZA 3K6SA 1TYEA 3VI3A 3ZE0A 2VDRA 4MMZA 5E6RA 3T3PA 2VDPA 4UM8A 3ZDYA 4MMXA 3FCSA 2VDKA 5HDBA 3K72A 5E6SA 4G1EA
chains in the Genus database with same CATH superfamily
3UVKA 1JMZB 5GSAA 5GXIA 4JT5C 4A11B 1A12A 5IJ7E 3I89A 5SXMA 3N0EA 3FCUA 2HU8A 2HU7A 4GM9A 3ODTA 3EI2A 2QXVA 2G99A 3C75H 3O4GA 4H5JA 4YVDA 3V5WB 4O1QD 4AMZA 4A0BB 4GM3A 3JAMg 4J84A 4A0AB 4CY5A 1P22A 3RRMC 4O2WA 2YNOA 2J56H 2I0RA 2OK4A 4E5ZB 2AGXA 2Z2NA 5AFU3 4O02A 4J86A 5IC7A 3SN6B 5FKRA 3VI4A 3DXKC 1OLZA 2BCJB 1RI6A 4J0XA 3PXTD 3O4JA 4E54B 5GMKn 2PM9B 3MUOA 2Z2OA 1R5MA 4NC4A 3EI1A 2GC4A 3RLMD 3SLED 2CN3A 4L3HD 1UOOA 2XU7A 2JKXA 3C9CA 3IURA 5EARA 3K6SA 3F3GA 3T3PA 5E6RA 1GOTB 4ERQA 3OKYB 1UOPA 3A0FA 4KFMB 3MZLA 4U1EI 1H2WA 4JXMA 4WK4A 2J55H 4LGNA 4RE6A 1SQJA 3VGZA 4ZN4A 1K32A 2AQ5A 4BCBA 1E8NA 2HKRA 5THAA 2O9KA 1U8CA 3DXMC 4AMYA 1GOHA 1QFMA 5EMMB 3C5MA 4A09B 3ZE1A 3EQ9A 5TF2A 5IGQA 4XEIC 2I0SA 2VZ3A 4CC9A 3N0DA 2IUVA 2EIDA 5FKTA 2XE4A 3FCSA 5GXHA 1TBGA 1YR2A 3PSCB 4ESGA 5AMSA 2CO0A 3CFSB 1B9XA 1T2XA 2CO0C 4AX4A 3SCYA 3V4VA 4FAND 3IIWA 3OKTA 3RFHA 3I7LA 3PXWD 2AGZA 2AGLA 4CY3A 4X3EA 2VDMA 2EICA 5CXCA 2VDQA 4UI9R 2OVQB 5H1MA 3ZDXA 4FA9D 2XYIA 1VZ3A 3O4HA 4ZOXA 3DDUA 2H13A 1VE7A 4R7AB 4UM8A 2PM6B 1E8MA 3UR4A 4J8GA 5FKSA 4NSXA 3OW8A 4AEZA 1UTCA 1L0QA 3DSMA 3VH0A 4FA1D 2OVRB 3OTTA 3PE7A 4D0KA 2VC2A 3RFGA 4GGDA 4JSVC 5IJ8E 2Z2PA 3AL8A 5EAMA 3EI4B 2QC5A 4JSXC 5TEFA 1OMWB 4A2LA 4A11A 3UVLA 1TYQC 4PNKB 4BH6A 2H68A 3UKUC 4X63B 2IAAA 2YB8B 3I8CA 4G55A 1TYEA 2XL3A 3EU7A 2VDRA 4ERZA 5HQGA 4N14A 2VDKA 4L9OA 4PBYA 3IUMA 3SWSD 4DNUA 1PBYB 4A0BA 2YMUA 4MMYA 4A0AA 1JJUB 5I5JA 2BKLA 4HDJA 4NENA 2G9AA 2HXCA 3DM0A 4UM9A 5I5MA 4AN1A 4E5ZA 3ORVD 2XDWA 5H17A 1U2VC 4MK0B 4NBMA 5A2Qg 2AGYA 1MG3A 3JZHA 2VDOA 2IUQA 4CI8A 1SHYB 3PVUB 4E54A 2PM9A 2EIEA 4I79A 3OKWA 4DNVA 2PM7B 3SMRA 4WJKA 5EMJB 4G56B 3OKYA 4PC0A 5CYKB 3JZNA 5HE3B 4Z7NA 3C99A 2XL2A 3AFCA 2WQ8A 4IRZA 4CZXA 4GQ2P 4GQBB 4GZ8A 4CZVA 2CNXA 2P9UC 1N6FA 4A09A 3EWEA 5FLXg 2P9SC 2CN2A 2OIZA 3E0CA 3JPXA 4Z7QA 3IKOA 4QAMA 5K19A 4JSPC 3GFCA 3QI0A 4O3TB 4FA4D 5HE2B 1MG2A 3OL2A 1N6EA 2IWFA 2IUPA 3NIGA 3J80g 3MKQA 5C92A 3IJ1A 5HYNB 4FWWA 1Q47A 2OK6A 4JT6C 4QL1A 1GP2B 3IIYA 3RN0D 2H3XA 2H9NA 1PGUA 1XHMA 3AL9A 1NEXB 3ZDYA 3PSLA 5FA5B 2UZYB 4ZOZA 3JZGA 2HJ4A 4O45A 4AN0A 4ZOYA 1M1XA 3L4MD 3CIKB 3NIDA 2VDNA 1L5GA 4U7AA 3EG6A 5EAPA 5KDOB 3MMYA 3SXTD 1FWXA 4ZOVA 1PEVA 4CI2A 2UZXB 3BWSA 3OF7A 1JTDB 3JB9L 3U4YA 4BUJC 1C9IA 3I2NA 3SFZA 3EI4A 3EI3B 4BL0A 2BBKH 3V4PA 3ULEC 3UVNA 5E6SA 3MXXA 4CI3A 5H14A 1VE6A 4Z8LA 2AH0A 5C9ZB 3IUNA 3KRWB 4J87A 5JWZA 4O3UB 4XYIA 3MUNA 3FGBA 3HFQA 1BPOA 2HESX 5M5VA 5TEEA 5FXYA 3SVWD 4WK2A 3SJLD 4XYHA 1JOFA 4LG8A 1QFSA 3KRXB 4GGCA 3QHYB 3RMZD 2VDLA 1E5TA 2OVPB 4FAVD 3I7OA 4QRJA 5M61A 1XKSA 4OZUA 4FA5D 2YNPA 5M5TA 4LG9A 1O6FA 2AH1A 5CXBB 4QT8A 3MZKA 4CY1A 2PBIB 1K3IA 2I3TA 4BCCA 5FFGA 2H9MA 3DWLC 4X61B 2H9LA 3EQ7A 3I7PA 1YFQA 3F3FA 4Z7OA 4PSXB 3AH8B 4J82A 5EM2B 2IURA 4IMMA 5HE0B 4J79A 4K3ID 3BG0A 2B5MA 4QQEA 4CY2A 2W18A 2VZ1A 3GD1I 4O9DA 5CYKA 3ZE0A 4CI1A 2J57G 3EMHA 2HYEA 2I0TA 1XIPA 1C9LA 3MKSB 5C86A 1VYHC 3K27A 4PXWA 4OWRA 5FKQA 4A08B 4AOWA 5EMLB 3VA6A 3F3PA 1UOQA 1O6GA 4A7JA 3IJEA 3IUQA 4CZYA 5EALA 5FFOA 2HJBA 5M5UA 2HKMA 4J77A 4PSWB 5IGOA 2TRCB 1VZ2A 4MMXA 4JHNA 4D9SA 4IA9A 5HE1B 4WK0A 3W15A 5C2VB 4EWRA 2H6KA 3IUJA 4ERYA 3EI2B 2QZPA 4BP9A 4JHPC 3I7KA 3FRXA 2QR5A 1GG2B 1S4UX 3GC3B 4JSNC 4J0WA 1QNIA 3J81g 2CE8A 4D6VA 1GOGA 5TDHB 3JRPA 1NR0A 4PBZA 4A2MA 2H9PA 5K1CC 1ERJA 2B4EA 4Y7RA 4MMZA 1H2YA 2YBAA 4GQ1A 3ZWLB 3L4OD 5HDBA 1A0RB 2Q7QA 3SBPA 2H14A 4J78A 4FHLA 3EI1B 3I7NA 3NVXA 4GMBA 2H6NA 2GNQA 3FM0A 3SBRA 2GC7A 1N6DA 3EI3A 2P9IC 4Y5RD 2P9PC 1H2ZA 1JV2A 3RN1D 4FB1D 5C2WB 5IT9g 3SBQA 2YNNA 1PI6A 3I7HA 4RE5A 3ZE2A 2P9LC 3PVWB 5B4WA 3IJ0A 2H6QA 4BCDA 3UVMA 3OL2B 4NAAA 3SHFA 3IVMA 3K72A 4GM8A 1MDAH 4ES0A 3I8EA 4G1MA 3CFVA 1B9YA 5EMKB 3UVOA 1H2XA 2B5NA 3JROA 4J8BA 2H47A 3BG1A 3T3MA 5M5RA 5AJAA 5M5SA 2EIBA 3UKRC 3V9FA 1I2MB 3V7DB 3PXSD 5FQDA 3RSEC 1GOFA 3GREA 5CXBA 2XZGA 4L1QD 2OJYA 3O4IA 3EQ8A 1U4CA 4H5IA 2MTAH 3K71A 3NVNA 3IULA 4G1EA 5E6UA 4L3GD 1SQ9A 2P9NC 5EM2A 2AGWA 5CXCB 4DNWA 2B5LA 3MVDK 2EBSA 2HU5A 3P4FA 1GXRA 4GGAA 1JMXB 3NVQA 5I5IA 3B7FA 3NIFA 4TZ4A 3K26A 2CE9A 2IWKA 2I3SA 4X60B 3ZDZA 4A08A 4J73A 4J81A 4K3JB 1K8KC 3VI3A 2P9KC 4JD2C 3IJCA 3KCIA 2VDPA 4BP8A 4L1MA 3AL8B
chains in the Genus database with same CATH topology
5E6UA 4WK4A 4WK0A 4Z7QA 1M1XA 4G1MA 4WJKA 2VDLA 3K71A 4O02A 4MMYA 3V4VA 3NIDA 2VDNA 2VC2A 1L5GA 3VI4A 1JV2A 3T3MA 5FFGA 1U8CA 3FCUA 4NENA 3NIGA 4UM9A 3IJEA 3V4PA 2VDMA 4Z7NA 3ZE1A 3NIFA 4WK2A 2VDQA 3ZDXA 3ZDZA 4Z7OA 3ZE2A 5FFOA 2VDOA 4IRZA 3K6SA 1TYEA 3VI3A 3ZE0A 2VDRA 4MMZA 5E6RA 3T3PA 2VDPA 4UM8A 3ZDYA 4MMXA 3FCSA 2VDKA 5HDBA 3K72A 5E6SA 4G1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6U A;  4WK4 A;  4WK0 A;  4Z7Q A;  1M1X A;  4G1M A;  4WJK A;  2VDL A;  3K71 A;  4O02 A;  4MMY A;  3V4V A;  3NID A;  2VDN A;  2VC2 A;  1L5G A;  3VI4 A;  1JV2 A;  3T3M A;  5FFG A;  1U8C A;  3FCU A;  4NEN A;  3NIG A;  4UM9 A;  3IJE A;  3V4P A;  2VDM A;  4Z7N A;  3ZE1 A;  3NIF A;  4WK2 A;  2VDQ A;  3ZDX A;  3ZDZ A;  4Z7O A;  3ZE2 A;  5FFO A;  2VDO A;  4IRZ A;  3K6S A;  1TYE A;  3VI3 A;  3ZE0 A;  2VDR A;  4MMZ A;  5E6R A;  3T3P A;  2VDP A;  4UM8 A;  3ZDY A;  4MMX A;  3FCS A;  2VDK A;  5HDB A;  3K72 A;  5E6S A;  4G1E A; 
#chains in the Genus database with same CATH topology
 3UVK A;  1JMZ B;  5GSA A;  5GXI A;  4JT5 C;  4A11 B;  1A12 A;  5IJ7 E;  3I89 A;  5SXM A;  3N0E A;  3FCU A;  2HU8 A;  2HU7 A;  4GM9 A;  3ODT A;  3EI2 A;  2QXV A;  2G99 A;  3C75 H;  3O4G A;  4H5J A;  4YVD A;  3V5W B;  4O1Q D;  4AMZ A;  4A0B B;  4GM3 A;  3JAM g;  4J84 A;  4A0A B;  4CY5 A;  1P22 A;  3RRM C;  4O2W A;  2YNO A;  2J56 H;  2I0R A;  2OK4 A;  4E5Z B;  2AGX A;  2Z2N A;  5AFU 3;  4O02 A;  4J86 A;  5IC7 A;  3SN6 B;  5FKR A;  3VI4 A;  3DXK C;  1OLZ A;  2BCJ B;  1RI6 A;  4J0X A;  3PXT D;  3O4J A;  4E54 B;  5GMK n;  2PM9 B;  3MUO A;  2Z2O A;  1R5M A;  4NC4 A;  3EI1 A;  2GC4 A;  3RLM D;  3SLE D;  2CN3 A;  4L3H D;  1UOO A;  2XU7 A;  2JKX A;  3C9C A;  3IUR A;  5EAR A;  3K6S A;  3F3G A;  3T3P A;  5E6R A;  1GOT B;  4ERQ A;  3OKY B;  1UOP A;  3A0F A;  4KFM B;  3MZL A;  4U1E I;  1H2W A;  4JXM A;  4WK4 A;  2J55 H;  4LGN A;  4RE6 A;  1SQJ A;  3VGZ A;  4ZN4 A;  1K32 A;  2AQ5 A;  4BCB A;  1E8N A;  2HKR A;  5THA A;  2O9K A;  1U8C A;  3DXM C;  4AMY A;  1GOH A;  1QFM A;  5EMM B;  3C5M A;  4A09 B;  3ZE1 A;  3EQ9 A;  5TF2 A;  5IGQ A;  4XEI C;  2I0S A;  2VZ3 A;  4CC9 A;  3N0D A;  2IUV A;  2EID A;  5FKT A;  2XE4 A;  3FCS A;  5GXH A;  1TBG A;  1YR2 A;  3PSC B;  4ESG A;  5AMS A;  2CO0 A;  3CFS B;  1B9X A;  1T2X A;  2CO0 C;  4AX4 A;  3SCY A;  3V4V A;  4FAN D;  3IIW A;  3OKT A;  3RFH A;  3I7L A;  3PXW D;  2AGZ A;  2AGL A;  4CY3 A;  4X3E A;  2VDM A;  2EIC A;  5CXC A;  2VDQ A;  4UI9 R;  2OVQ B;  5H1M A;  3ZDX A;  4FA9 D;  2XYI A;  1VZ3 A;  3O4H A;  4ZOX A;  3DDU A;  2H13 A;  1VE7 A;  4R7A B;  4UM8 A;  2PM6 B;  1E8M A;  3UR4 A;  4J8G A;  5FKS A;  4NSX A;  3OW8 A;  4AEZ A;  1UTC A;  1L0Q A;  3DSM A;  3VH0 A;  4FA1 D;  2OVR B;  3OTT A;  3PE7 A;  4D0K A;  2VC2 A;  3RFG A;  4GGD A;  4JSV C;  5IJ8 E;  2Z2P A;  3AL8 A;  5EAM A;  3EI4 B;  2QC5 A;  4JSX C;  5TEF A;  1OMW B;  4A2L A;  4A11 A;  3UVL A;  1TYQ C;  4PNK B;  4BH6 A;  2H68 A;  3UKU C;  4X63 B;  2IAA A;  2YB8 B;  3I8C A;  4G55 A;  1TYE A;  2XL3 A;  3EU7 A;  2VDR A;  4ERZ A;  5HQG A;  4N14 A;  2VDK A;  4L9O A;  4PBY A;  3IUM A;  3SWS D;  4DNU A;  1PBY B;  4A0B A;  2YMU A;  4MMY A;  4A0A A;  1JJU B;  5I5J A;  2BKL A;  4HDJ A;  4NEN A;  2G9A A;  2HXC A;  3DM0 A;  4UM9 A;  5I5M A;  4AN1 A;  4E5Z A;  3ORV D;  2XDW A;  5H17 A;  1U2V C;  4MK0 B;  4NBM A;  5A2Q g;  2AGY A;  1MG3 A;  3JZH A;  2VDO A;  2IUQ A;  4CI8 A;  1SHY B;  3PVU B;  4E54 A;  2PM9 A;  2EIE A;  4I79 A;  3OKW A;  4DNV A;  2PM7 B;  3SMR A;  4WJK A;  5EMJ B;  4G56 B;  3OKY A;  4PC0 A;  5CYK B;  3JZN A;  5HE3 B;  4Z7N A;  3C99 A;  2XL2 A;  3AFC A;  2WQ8 A;  4IRZ A;  4CZX A;  4GQ2 P;  4GQB B;  4GZ8 A;  4CZV A;  2CNX A;  2P9U C;  1N6F A;  4A09 A;  3EWE A;  5FLX g;  2P9S C;  2CN2 A;  2OIZ A;  3E0C A;  3JPX A;  4Z7Q A;  3IKO A;  4QAM A;  5K19 A;  4JSP C;  3GFC A;  3QI0 A;  4O3T B;  4FA4 D;  5HE2 B;  1MG2 A;  3OL2 A;  1N6E A;  2IWF A;  2IUP A;  3NIG A;  3J80 g;  3MKQ A;  5C92 A;  3IJ1 A;  5HYN B;  4FWW A;  1Q47 A;  2OK6 A;  4JT6 C;  4QL1 A;  1GP2 B;  3IIY A;  3RN0 D;  2H3X A;  2H9N A;  1PGU A;  1XHM A;  3AL9 A;  1NEX B;  3ZDY A;  3PSL A;  5FA5 B;  2UZY B;  4ZOZ A;  3JZG A;  2HJ4 A;  4O45 A;  4AN0 A;  4ZOY A;  1M1X A;  3L4M D;  3CIK B;  3NID A;  2VDN A;  1L5G A;  4U7A A;  3EG6 A;  5EAP A;  5KDO B;  3MMY A;  3SXT D;  1FWX A;  4ZOV A;  1PEV A;  4CI2 A;  2UZX B;  3BWS A;  3OF7 A;  1JTD B;  3JB9 L;  3U4Y A;  4BUJ C;  1C9I A;  3I2N A;  3SFZ A;  3EI4 A;  3EI3 B;  4BL0 A;  2BBK H;  3V4P A;  3ULE C;  3UVN A;  5E6S A;  3MXX A;  4CI3 A;  5H14 A;  1VE6 A;  4Z8L A;  2AH0 A;  5C9Z B;  3IUN A;  3KRW B;  4J87 A;  5JWZ A;  4O3U B;  4XYI A;  3MUN A;  3FGB A;  3HFQ A;  1BPO A;  2HES X;  5M5V A;  5TEE A;  5FXY A;  3SVW D;  4WK2 A;  3SJL D;  4XYH A;  1JOF A;  4LG8 A;  1QFS A;  3KRX B;  4GGC A;  3QHY B;  3RMZ D;  2VDL A;  1E5T A;  2OVP B;  4FAV D;  3I7O A;  4QRJ A;  5M61 A;  1XKS A;  4OZU A;  4FA5 D;  2YNP A;  5M5T A;  4LG9 A;  1O6F A;  2AH1 A;  5CXB B;  4QT8 A;  3MZK A;  4CY1 A;  2PBI B;  1K3I A;  2I3T A;  4BCC A;  5FFG A;  2H9M A;  3DWL C;  4X61 B;  2H9L A;  3EQ7 A;  3I7P A;  1YFQ A;  3F3F A;  4Z7O A;  4PSX B;  3AH8 B;  4J82 A;  5EM2 B;  2IUR A;  4IMM A;  5HE0 B;  4J79 A;  4K3I D;  3BG0 A;  2B5M A;  4QQE A;  4CY2 A;  2W18 A;  2VZ1 A;  3GD1 I;  4O9D A;  5CYK A;  3ZE0 A;  4CI1 A;  2J57 G;  3EMH A;  2HYE A;  2I0T A;  1XIP A;  1C9L A;  3MKS B;  5C86 A;  1VYH C;  3K27 A;  4PXW A;  4OWR A;  5FKQ A;  4A08 B;  4AOW A;  5EML B;  3VA6 A;  3F3P A;  1UOQ A;  1O6G A;  4A7J A;  3IJE A;  3IUQ A;  4CZY A;  5EAL A;  5FFO A;  2HJB A;  5M5U A;  2HKM A;  4J77 A;  4PSW B;  5IGO A;  2TRC B;  1VZ2 A;  4MMX A;  4JHN A;  4D9S A;  4IA9 A;  5HE1 B;  4WK0 A;  3W15 A;  5C2V B;  4EWR A;  2H6K A;  3IUJ A;  4ERY A;  3EI2 B;  2QZP A;  4BP9 A;  4JHP C;  3I7K A;  3FRX A;  2QR5 A;  1GG2 B;  1S4U X;  3GC3 B;  4JSN C;  4J0W A;  1QNI A;  3J81 g;  2CE8 A;  4D6V A;  1GOG A;  5TDH B;  3JRP A;  1NR0 A;  4PBZ A;  4A2M A;  2H9P A;  5K1C C;  1ERJ A;  2B4E A;  4Y7R A;  4MMZ A;  1H2Y A;  2YBA A;  4GQ1 A;  3ZWL B;  3L4O D;  5HDB A;  1A0R B;  2Q7Q A;  3SBP A;  2H14 A;  4J78 A;  4FHL A;  3EI1 B;  3I7N A;  3NVX A;  4GMB A;  2H6N A;  2GNQ A;  3FM0 A;  3SBR A;  2GC7 A;  1N6D A;  3EI3 A;  2P9I C;  4Y5R D;  2P9P C;  1H2Z A;  1JV2 A;  3RN1 D;  4FB1 D;  5C2W B;  5IT9 g;  3SBQ A;  2YNN A;  1PI6 A;  3I7H A;  4RE5 A;  3ZE2 A;  2P9L C;  3PVW B;  5B4W A;  3IJ0 A;  2H6Q A;  4BCD A;  3UVM A;  3OL2 B;  4NAA A;  3SHF A;  3IVM A;  3K72 A;  4GM8 A;  1MDA H;  4ES0 A;  3I8E A;  4G1M A;  3CFV A;  1B9Y A;  5EMK B;  3UVO A;  1H2X A;  2B5N A;  3JRO A;  4J8B A;  2H47 A;  3BG1 A;  3T3M A;  5M5R A;  5AJA A;  5M5S A;  2EIB A;  3UKR C;  3V9F A;  1I2M B;  3V7D B;  3PXS D;  5FQD A;  3RSE C;  1GOF A;  3GRE A;  5CXB A;  2XZG A;  4L1Q D;  2OJY A;  3O4I A;  3EQ8 A;  1U4C A;  4H5I A;  2MTA H;  3K71 A;  3NVN A;  3IUL A;  4G1E A;  5E6U A;  4L3G D;  1SQ9 A;  2P9N C;  5EM2 A;  2AGW A;  5CXC B;  4DNW A;  2B5L A;  3MVD K;  2EBS A;  2HU5 A;  3P4F A;  1GXR A;  4GGA A;  1JMX B;  3NVQ A;  5I5I A;  3B7F A;  3NIF A;  4TZ4 A;  3K26 A;  2CE9 A;  2IWK A;  2I3S A;  4X60 B;  3ZDZ A;  4A08 A;  4J73 A;  4J81 A;  4K3J B;  1K8K C;  3VI3 A;  2P9K C;  4JD2 C;  3IJC A;  3KCI A;  2VDP A;  4BP8 A;  4L1M A;  3AL8 B; 
#chains in the Genus database with same CATH homology
 5E6U A;  4WK4 A;  4WK0 A;  4Z7Q A;  1M1X A;  4G1M A;  4WJK A;  2VDL A;  3K71 A;  4O02 A;  4MMY A;  3V4V A;  3NID A;  2VDN A;  2VC2 A;  1L5G A;  3VI4 A;  1JV2 A;  3T3M A;  5FFG A;  1U8C A;  3FCU A;  4NEN A;  3NIG A;  4UM9 A;  3IJE A;  3V4P A;  2VDM A;  4Z7N A;  3ZE1 A;  3NIF A;  4WK2 A;  2VDQ A;  3ZDX A;  3ZDZ A;  4Z7O A;  3ZE2 A;  5FFO A;  2VDO A;  4IRZ A;  3K6S A;  1TYE A;  3VI3 A;  3ZE0 A;  2VDR A;  4MMZ A;  5E6R A;  3T3P A;  2VDP A;  4UM8 A;  3ZDY A;  4MMX A;  3FCS A;  2VDK A;  5HDB A;  3K72 A;  5E6S A;  4G1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...