3ZDYA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 101
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdyA00
2VDQA 2VDLA 3NIFA 4MMYA 5FFGA 2VDNA 3ZE1A 3ZDYA 4Z7OA 3ZE2A 2VDRA 4Z7NA 3VI3A 2VC2A 3T3PA 1L5GA 3K6SA 5E6RA 4MMZA 5HDBA 3VI4A 4G1EA 3IJEA 4NENA 2VDOA 4WK4A 4IRZA 5FFOA 1TYEA 3NIDA 4WK0A 2VDPA 4UM9A 3V4VA 4G1MA 4Z7QA 3NIGA 3FCSA 4WJKA 3ZDXA 3ZDZA 5E6UA 3K71A 2VDKA 1JV2A 4O02A 4UM8A 3K72A 4WK2A 1M1XA 3V4PA 3T3MA 2VDMA 1U8CA 3ZE0A 5E6SA 3FCUA 4MMXA
chains in the Genus database with same CATH superfamily
3I2NA 2CE8A 2QXVA 1FWXA 4MMYA 2Z2OA 1UOPA 2G9AA 3ZE1A 4FAND 2H6QA 2H9NA 3OL2B 4J79A 4D6VA 4JHNA 1E5TA 2P9IC 2J56H 3OL2A 2VZ3A 5K19A 3JRPA 3P4FA 2BBKH 4ES0A 2VDPA 3N0EA 3ZDXA 5IC7A 2EBSA 3IJ1A 1YR2A 5EAPA 5C2VB 3IUMA 2OJYA 2H6KA 3FRXA 2IUPA 3SCYA 3SBPA 4J77A 4BCBA 5C9ZB 3N0DA 2XYIA 3EQ8A 4ESGA 3MKQA 5SXMA 5IGOA 4X63B 3O4HA 3AFCA 3DXKC 4YVDA 3UVOA 5AJAA 4MMZA 4QAMA 3IJEA 1GOFA 5FFOA 1VZ3A 3C9CA 5H1MA 5THAA 4CI8A 3EI1B 3BG1A 2JKXA 4J78A 4DNVA 3OTTA 4GGAA 4CY5A 3IKOA 3B7FA 4CY2A 3I7HA 2CN3A 4FA1D 5GXIA 3RFHA 5HE0B 4PBYA 1MDAH 3KRXB 2AGLA 2OIZA 4LG8A 2EIBA 1I2MB 2P9NC 4U7AA 4BCDA 1ERJA 4MMXA 2VDLA 1SHYB 3JZHA 4OZUA 1K8KC 3AL9A 4GM8A 1H2XA 1JMZB 3I7PA 5M5UA 2H3XA 1OLZA 1TYEA 4Y7RA 1RI6A 5FKSA 4D0KA 4A09A 1PI6A 2AGXA 3I7OA 5AMSA 3DM0A 4IA9A 3PSCB 5EMJB 5H14A 3OKYB 4J0XA 2VZ1A 2HKMA 2EIEA 3V5WB 5B4WA 1JV2A 3RN1D 2CN2A 3MZLA 5M5SA 1PEVA 4H5IA 3PE7A 4WK2A 5EM2B 4GGDA 4CI1A 3RFGA 2AGWA 4L3HD 2AGYA 4NSXA 1VE7A 1U4CA 3EQ9A 5TDHB 4GGCA 4L3GD 4PSWB 4BP9A 4G1EA 2B5LA 5HYNB 1OMWB 3OKWA 5IGQA 5HE3B 4O3TB 5KDOB 3SN6B 4GQ2P 2XU7A 4FA5D 1T2XA 5FQDA 3QI0A 4L9OA 1JMXB 4UM8A 2QZPA 3K72A 3T3MA 3O4JA 4GM9A 3J81g 1O6GA 4K3JB 2AH1A 3NIFA 4ZOZA 5FFGA 5CXCB 4J81A 4Z7NA 2I0TA 4ERZA 2Q7QA 5A2Qg 1SQ9A 3GC3B 5TEEA 5M5RA 3GD1I 3IIWA 1GG2B 2QC5A 4WJKA 5IJ8E 5C2WB 2AH0A 3K71A 4AN1A 4N14A 4QT8A 4XEIC 5EM2A 4GQBB 1QNIA 4ERYA 3EWEA 3EI1A 3AH8B 4FA9D 4A0AA 4GMBA 3IJ0A 1JJUB 2OVQB 3EU7A 4AN0A 2VDRA 2BKLA 1QFMA 4X60B 2IAAA 5FLXg 4X61B 1XKSA 2HESX 4D9SA 2CNXA 2QR5A 5M61A 2EICA 4G56B 1NEXB 4ZOYA 3EG6A 1K32A 3V7DB 5I5MA 3I7KA 3GREA 2HJ4A 3C99A 5EAMA 3AL8A 1GP2B 4FB1D 4GZ8A 4A08B 4E54A 3JPXA 3SWSD 3FCUA 5FKRA 4Z7OA 4NBMA 3SBQA 3C75H 4XYHA 1SQJA 3L4OD 3ZDYA 4CC9A 4XYIA 2YNNA 1L5GA 4WK4A 2UZYB 3NVNA 4A2MA 1S4UX 3UKRC 4AOWA 2GC7A 3SXTD 3IULA 4DNWA 2I0RA 4J84A 5GMKn 3I7LA 3BG0A 2TRCB 4R7AB 1NR0A 4OWRA 1L0QA 3RN0D 1GOGA 2XE4A 3EI3B 3MZKA 1TBGA 4ZOXA 4I79A 3PXWD 5EARA 3MVDK 4QQEA 5I5IA 5HE1B 3QHYB 3KCIA 1VZ2A 1QFSA 4O9DA 4IRZA 2H6NA 2HU8A 1MG2A 4JSNC 3DDUA 3IJCA 4FHLA 5HE2B 3L4MD 3U4YA 3JAMg 4A7JA 5EALA 1VYHC 2OK4A 4O3UB 4CZVA 4J8BA 4CZXA 2IUVA 4DNUA 3V4PA 2P9UC 4L1QD 3ZE0A 5GXHA 4O45A 4PSXB 5AFU3 3F3PA 1UOQA 4JT5C 3RMZD 3ZE2A 3FGBA 4JHPC 3F3GA 2BCJB 2HKRA 3ODTA 4LGNA 3SJLD 2Z2NA 4KFMB 3GFCA 1JOFA 4E54B 2J55H 3V4VA 2H9LA 3NIGA 3OKTA 4ZN4A 5IT9g 4NAAA 5K1CC 1BPOA 4NC4A 5EMKB 2PM6B 3RSEC 3MUOA 4X3EA 3EQ7A 2H68A 3J80g 3PXTD 2G99A 5TEFA 2WQ8A 4RE5A 4GQ1A 4JSPC 3PVUB 3MUNA 1K3IA 3I8CA 4AEZA 3SLED 5GSAA 3C5MA 4E5ZB 5EMMB 3ZWLB 3OF7A 4CI3A 4A0AB 4AMZA 4AX4A 1N6DA 4TZ4A 5EMLB 4Z8LA 2CO0C 3FCSA 4PC0A 3BWSA 2PM9B 1JTDB 4ZOVA 3EI2A 1UOOA 4QL1A 4GM3A 4J82A 3E0CA 4CY3A 4H5JA 3A0FA 3O4GA 2AGZA 4IMMA 2VDNA 2I3SA 4A0BA 4BCCA 4CI2A 3JZNA 1A12A 4RE6A 3SFZA 1H2ZA 3PVWB 1MG3A 4AMYA 3MXXA 3NIDA 3NVXA 5FA5B 3O4IA 1E8NA 2HU7A 3SHFA 4J8GA 5E6UA 3DSMA 4BL0A 3EI2B 4FWWA 1YFQA 4L1MA 3CIKB 1VE6A 3W15A 3SBRA 3RRMC 4HDJA 1A0RB 5IJ7E 3UVMA 3FM0A 2PM7B 4J86A 1B9YA 2OVRB 3VI3A 4CZYA 4A09B 5E6RA 4PXWA 3VA6A 4WK0A 4A2LA 4JSVC 2B5NA 2B4EA 2HU5A 3IUQA 4Z7QA 3KRWB 1GOTB 3IUJA 2GNQA 3HFQA 1O6FA 4JD2C 3VH0A 5CXBB 5FXYA 4EWRA 1M1XA 3I7NA 2VDMA 5CXBA 4ERQA 2XL2A 4Y5RD 1H2YA 5M5TA 4J87A 3PXSD 4FAVD 1N6FA 5FKQA 5JWZA 4E5ZA 4PBZA 4G1MA 4J73A 3EI3A 5CYKB 1R5MA 4FA4D 2YNOA 2VDKA 3NVQA 3UKUC 5C92A 2OVPB 4BH6A 4A0BB 3IUNA 2YBAA 1PBYB 2J57G 1U2VC 4PNKB 5CXCA 5HQGA 1Q47A 4A11A 3VGZA 2XZGA 1XIPA 2P9LC 2UZXB 4U1EI 4QRJA 2O9KA 3T3PA 2I3TA 4BUJC 2P9SC 1C9LA 2Z2PA 2VDOA 3IVMA 2IURA 5FKTA 2IWFA 3OW8A 4O1QD 4JXMA 3EMHA 4UM9A 3DXMC 2EIDA 4A11B 1B9XA 3PSLA 2I0SA 2H9PA 5C86A 3SVWD 2IWKA 3F3FA 4O02A 3IIYA 3UR4A 1GOHA 2XL3A 2HJBA 3DWLC 2VDQA 2H13A 3RLMD 1N6EA 2VC2A 3K6SA 1UTCA 4NENA 5I5JA 2MTAH 2CO0A 3OKYA 3I8EA 2YMUA 3JB9L 2YNPA 4BP8A 4G55A 5CYKA 2YB8B 3UVNA 2H47A 2XDWA 4JT6C 3SMRA 2PBIB 1P22A 4MK0B 2OK6A 5TF2A 3ORVD 4UI9R 1XHMA 4LG9A 1U8CA 3JROA 3UVKA 2CE9A 5M5VA 1H2WA 4J0WA 1E8MA 2P9PC 3UVLA 3K26A 1C9IA 3I89A 2P9KC 3EI4A 5HDBA 3CFVA 3VI4A 2H9MA 3V9FA 4CY1A 1GXRA 2HXCA 3ULEC 2AQ5A 2GC4A 2IUQA 3IURA 3ZDZA 2PM9A 3MMYA 3MKSB 5H17A 2HYEA 2H14A 4O2WA 3JZGA 3EI4B 2B5MA 2W18A 3AL8B 3K27A 4K3ID 4A08A 1TYQC 1PGUA 5E6SA 4JSXC 3CFSB
chains in the Genus database with same CATH topology
2VDQA 2VDLA 3NIFA 4MMYA 5FFGA 2VDNA 3ZE1A 3ZDYA 4Z7OA 3ZE2A 2VDRA 4Z7NA 3VI3A 2VC2A 3T3PA 1L5GA 3K6SA 5E6RA 4MMZA 5HDBA 3VI4A 4G1EA 3IJEA 4NENA 2VDOA 4WK4A 4IRZA 5FFOA 1TYEA 3NIDA 4WK0A 2VDPA 4UM9A 3V4VA 4G1MA 4Z7QA 3NIGA 3FCSA 4WJKA 3ZDXA 3ZDZA 5E6UA 3K71A 2VDKA 1JV2A 4O02A 4UM8A 3K72A 4WK2A 1M1XA 3V4PA 3T3MA 2VDMA 1U8CA 3ZE0A 5E6SA 3FCUA 4MMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDQ A;  2VDL A;  3NIF A;  4MMY A;  5FFG A;  2VDN A;  3ZE1 A;  3ZDY A;  4Z7O A;  3ZE2 A;  2VDR A;  4Z7N A;  3VI3 A;  2VC2 A;  3T3P A;  1L5G A;  3K6S A;  5E6R A;  4MMZ A;  5HDB A;  3VI4 A;  4G1E A;  3IJE A;  4NEN A;  2VDO A;  4WK4 A;  4IRZ A;  5FFO A;  1TYE A;  3NID A;  4WK0 A;  2VDP A;  4UM9 A;  3V4V A;  4G1M A;  4Z7Q A;  3NIG A;  3FCS A;  4WJK A;  3ZDX A;  3ZDZ A;  5E6U A;  3K71 A;  2VDK A;  1JV2 A;  4O02 A;  4UM8 A;  3K72 A;  4WK2 A;  1M1X A;  3V4P A;  3T3M A;  2VDM A;  1U8C A;  3ZE0 A;  5E6S A;  3FCU A;  4MMX A; 
#chains in the Genus database with same CATH topology
 3I2N A;  2CE8 A;  2QXV A;  1FWX A;  4MMY A;  2Z2O A;  1UOP A;  2G9A A;  3ZE1 A;  4FAN D;  2H6Q A;  2H9N A;  3OL2 B;  4J79 A;  4D6V A;  4JHN A;  1E5T A;  2P9I C;  2J56 H;  3OL2 A;  2VZ3 A;  5K19 A;  3JRP A;  3P4F A;  2BBK H;  4ES0 A;  2VDP A;  3N0E A;  3ZDX A;  5IC7 A;  2EBS A;  3IJ1 A;  1YR2 A;  5EAP A;  5C2V B;  3IUM A;  2OJY A;  2H6K A;  3FRX A;  2IUP A;  3SCY A;  3SBP A;  4J77 A;  4BCB A;  5C9Z B;  3N0D A;  2XYI A;  3EQ8 A;  4ESG A;  3MKQ A;  5SXM A;  5IGO A;  4X63 B;  3O4H A;  3AFC A;  3DXK C;  4YVD A;  3UVO A;  5AJA A;  4MMZ A;  4QAM A;  3IJE A;  1GOF A;  5FFO A;  1VZ3 A;  3C9C A;  5H1M A;  5THA A;  4CI8 A;  3EI1 B;  3BG1 A;  2JKX A;  4J78 A;  4DNV A;  3OTT A;  4GGA A;  4CY5 A;  3IKO A;  3B7F A;  4CY2 A;  3I7H A;  2CN3 A;  4FA1 D;  5GXI A;  3RFH A;  5HE0 B;  4PBY A;  1MDA H;  3KRX B;  2AGL A;  2OIZ A;  4LG8 A;  2EIB A;  1I2M B;  2P9N C;  4U7A A;  4BCD A;  1ERJ A;  4MMX A;  2VDL A;  1SHY B;  3JZH A;  4OZU A;  1K8K C;  3AL9 A;  4GM8 A;  1H2X A;  1JMZ B;  3I7P A;  5M5U A;  2H3X A;  1OLZ A;  1TYE A;  4Y7R A;  1RI6 A;  5FKS A;  4D0K A;  4A09 A;  1PI6 A;  2AGX A;  3I7O A;  5AMS A;  3DM0 A;  4IA9 A;  3PSC B;  5EMJ B;  5H14 A;  3OKY B;  4J0X A;  2VZ1 A;  2HKM A;  2EIE A;  3V5W B;  5B4W A;  1JV2 A;  3RN1 D;  2CN2 A;  3MZL A;  5M5S A;  1PEV A;  4H5I A;  3PE7 A;  4WK2 A;  5EM2 B;  4GGD A;  4CI1 A;  3RFG A;  2AGW A;  4L3H D;  2AGY A;  4NSX A;  1VE7 A;  1U4C A;  3EQ9 A;  5TDH B;  4GGC A;  4L3G D;  4PSW B;  4BP9 A;  4G1E A;  2B5L A;  5HYN B;  1OMW B;  3OKW A;  5IGQ A;  5HE3 B;  4O3T B;  5KDO B;  3SN6 B;  4GQ2 P;  2XU7 A;  4FA5 D;  1T2X A;  5FQD A;  3QI0 A;  4L9O A;  1JMX B;  4UM8 A;  2QZP A;  3K72 A;  3T3M A;  3O4J A;  4GM9 A;  3J81 g;  1O6G A;  4K3J B;  2AH1 A;  3NIF A;  4ZOZ A;  5FFG A;  5CXC B;  4J81 A;  4Z7N A;  2I0T A;  4ERZ A;  2Q7Q A;  5A2Q g;  1SQ9 A;  3GC3 B;  5TEE A;  5M5R A;  3GD1 I;  3IIW A;  1GG2 B;  2QC5 A;  4WJK A;  5IJ8 E;  5C2W B;  2AH0 A;  3K71 A;  4AN1 A;  4N14 A;  4QT8 A;  4XEI C;  5EM2 A;  4GQB B;  1QNI A;  4ERY A;  3EWE A;  3EI1 A;  3AH8 B;  4FA9 D;  4A0A A;  4GMB A;  3IJ0 A;  1JJU B;  2OVQ B;  3EU7 A;  4AN0 A;  2VDR A;  2BKL A;  1QFM A;  4X60 B;  2IAA A;  5FLX g;  4X61 B;  1XKS A;  2HES X;  4D9S A;  2CNX A;  2QR5 A;  5M61 A;  2EIC A;  4G56 B;  1NEX B;  4ZOY A;  3EG6 A;  1K32 A;  3V7D B;  5I5M A;  3I7K A;  3GRE A;  2HJ4 A;  3C99 A;  5EAM A;  3AL8 A;  1GP2 B;  4FB1 D;  4GZ8 A;  4A08 B;  4E54 A;  3JPX A;  3SWS D;  3FCU A;  5FKR A;  4Z7O A;  4NBM A;  3SBQ A;  3C75 H;  4XYH A;  1SQJ A;  3L4O D;  3ZDY A;  4CC9 A;  4XYI A;  2YNN A;  1L5G A;  4WK4 A;  2UZY B;  3NVN A;  4A2M A;  1S4U X;  3UKR C;  4AOW A;  2GC7 A;  3SXT D;  3IUL A;  4DNW A;  2I0R A;  4J84 A;  5GMK n;  3I7L A;  3BG0 A;  2TRC B;  4R7A B;  1NR0 A;  4OWR A;  1L0Q A;  3RN0 D;  1GOG A;  2XE4 A;  3EI3 B;  3MZK A;  1TBG A;  4ZOX A;  4I79 A;  3PXW D;  5EAR A;  3MVD K;  4QQE A;  5I5I A;  5HE1 B;  3QHY B;  3KCI A;  1VZ2 A;  1QFS A;  4O9D A;  4IRZ A;  2H6N A;  2HU8 A;  1MG2 A;  4JSN C;  3DDU A;  3IJC A;  4FHL A;  5HE2 B;  3L4M D;  3U4Y A;  3JAM g;  4A7J A;  5EAL A;  1VYH C;  2OK4 A;  4O3U B;  4CZV A;  4J8B A;  4CZX A;  2IUV A;  4DNU A;  3V4P A;  2P9U C;  4L1Q D;  3ZE0 A;  5GXH A;  4O45 A;  4PSX B;  5AFU 3;  3F3P A;  1UOQ A;  4JT5 C;  3RMZ D;  3ZE2 A;  3FGB A;  4JHP C;  3F3G A;  2BCJ B;  2HKR A;  3ODT A;  4LGN A;  3SJL D;  2Z2N A;  4KFM B;  3GFC A;  1JOF A;  4E54 B;  2J55 H;  3V4V A;  2H9L A;  3NIG A;  3OKT A;  4ZN4 A;  5IT9 g;  4NAA A;  5K1C C;  1BPO A;  4NC4 A;  5EMK B;  2PM6 B;  3RSE C;  3MUO A;  4X3E A;  3EQ7 A;  2H68 A;  3J80 g;  3PXT D;  2G99 A;  5TEF A;  2WQ8 A;  4RE5 A;  4GQ1 A;  4JSP C;  3PVU B;  3MUN A;  1K3I A;  3I8C A;  4AEZ A;  3SLE D;  5GSA A;  3C5M A;  4E5Z B;  5EMM B;  3ZWL B;  3OF7 A;  4CI3 A;  4A0A B;  4AMZ A;  4AX4 A;  1N6D A;  4TZ4 A;  5EML B;  4Z8L A;  2CO0 C;  3FCS A;  4PC0 A;  3BWS A;  2PM9 B;  1JTD B;  4ZOV A;  3EI2 A;  1UOO A;  4QL1 A;  4GM3 A;  4J82 A;  3E0C A;  4CY3 A;  4H5J A;  3A0F A;  3O4G A;  2AGZ A;  4IMM A;  2VDN A;  2I3S A;  4A0B A;  4BCC A;  4CI2 A;  3JZN A;  1A12 A;  4RE6 A;  3SFZ A;  1H2Z A;  3PVW B;  1MG3 A;  4AMY A;  3MXX A;  3NID A;  3NVX A;  5FA5 B;  3O4I A;  1E8N A;  2HU7 A;  3SHF A;  4J8G A;  5E6U A;  3DSM A;  4BL0 A;  3EI2 B;  4FWW A;  1YFQ A;  4L1M A;  3CIK B;  1VE6 A;  3W15 A;  3SBR A;  3RRM C;  4HDJ A;  1A0R B;  5IJ7 E;  3UVM A;  3FM0 A;  2PM7 B;  4J86 A;  1B9Y A;  2OVR B;  3VI3 A;  4CZY A;  4A09 B;  5E6R A;  4PXW A;  3VA6 A;  4WK0 A;  4A2L A;  4JSV C;  2B5N A;  2B4E A;  2HU5 A;  3IUQ A;  4Z7Q A;  3KRW B;  1GOT B;  3IUJ A;  2GNQ A;  3HFQ A;  1O6F A;  4JD2 C;  3VH0 A;  5CXB B;  5FXY A;  4EWR A;  1M1X A;  3I7N A;  2VDM A;  5CXB A;  4ERQ A;  2XL2 A;  4Y5R D;  1H2Y A;  5M5T A;  4J87 A;  3PXS D;  4FAV D;  1N6F A;  5FKQ A;  5JWZ A;  4E5Z A;  4PBZ A;  4G1M A;  4J73 A;  3EI3 A;  5CYK B;  1R5M A;  4FA4 D;  2YNO A;  2VDK A;  3NVQ A;  3UKU C;  5C92 A;  2OVP B;  4BH6 A;  4A0B B;  3IUN A;  2YBA A;  1PBY B;  2J57 G;  1U2V C;  4PNK B;  5CXC A;  5HQG A;  1Q47 A;  4A11 A;  3VGZ A;  2XZG A;  1XIP A;  2P9L C;  2UZX B;  4U1E I;  4QRJ A;  2O9K A;  3T3P A;  2I3T A;  4BUJ C;  2P9S C;  1C9L A;  2Z2P A;  2VDO A;  3IVM A;  2IUR A;  5FKT A;  2IWF A;  3OW8 A;  4O1Q D;  4JXM A;  3EMH A;  4UM9 A;  3DXM C;  2EID A;  4A11 B;  1B9X A;  3PSL A;  2I0S A;  2H9P A;  5C86 A;  3SVW D;  2IWK A;  3F3F A;  4O02 A;  3IIY A;  3UR4 A;  1GOH A;  2XL3 A;  2HJB A;  3DWL C;  2VDQ A;  2H13 A;  3RLM D;  1N6E A;  2VC2 A;  3K6S A;  1UTC A;  4NEN A;  5I5J A;  2MTA H;  2CO0 A;  3OKY A;  3I8E A;  2YMU A;  3JB9 L;  2YNP A;  4BP8 A;  4G55 A;  5CYK A;  2YB8 B;  3UVN A;  2H47 A;  2XDW A;  4JT6 C;  3SMR A;  2PBI B;  1P22 A;  4MK0 B;  2OK6 A;  5TF2 A;  3ORV D;  4UI9 R;  1XHM A;  4LG9 A;  1U8C A;  3JRO A;  3UVK A;  2CE9 A;  5M5V A;  1H2W A;  4J0W A;  1E8M A;  2P9P C;  3UVL A;  3K26 A;  1C9I A;  3I89 A;  2P9K C;  3EI4 A;  5HDB A;  3CFV A;  3VI4 A;  2H9M A;  3V9F A;  4CY1 A;  1GXR A;  2HXC A;  3ULE C;  2AQ5 A;  2GC4 A;  2IUQ A;  3IUR A;  3ZDZ A;  2PM9 A;  3MMY A;  3MKS B;  5H17 A;  2HYE A;  2H14 A;  4O2W A;  3JZG A;  3EI4 B;  2B5M A;  2W18 A;  3AL8 B;  3K27 A;  4K3I D;  4A08 A;  1TYQ C;  1PGU A;  5E6S A;  4JSX C;  3CFS B; 
#chains in the Genus database with same CATH homology
 2VDQ A;  2VDL A;  3NIF A;  4MMY A;  5FFG A;  2VDN A;  3ZE1 A;  3ZDY A;  4Z7O A;  3ZE2 A;  2VDR A;  4Z7N A;  3VI3 A;  2VC2 A;  3T3P A;  1L5G A;  3K6S A;  5E6R A;  4MMZ A;  5HDB A;  3VI4 A;  4G1E A;  3IJE A;  4NEN A;  2VDO A;  4WK4 A;  4IRZ A;  5FFO A;  1TYE A;  3NID A;  4WK0 A;  2VDP A;  4UM9 A;  3V4V A;  4G1M A;  4Z7Q A;  3NIG A;  3FCS A;  4WJK A;  3ZDX A;  3ZDZ A;  5E6U A;  3K71 A;  2VDK A;  1JV2 A;  4O02 A;  4UM8 A;  3K72 A;  4WK2 A;  1M1X A;  3V4P A;  3T3M A;  2VDM A;  1U8C A;  3ZE0 A;  5E6S A;  3FCU A;  4MMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...