3ZDYA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdyA00
3V4PA 3IJEA 5HDBA 5FFGA 2VDLA 3FCSA 2VDNA 4Z7OA 2VDOA 4MMXA 4WK2A 5E6RA 3V4VA 3ZDYA 3ZE2A 3VI4A 2VDKA 3ZDXA 5E6SA 1M1XA 1U8CA 2VC2A 2VDPA 3K72A 5E6UA 5FFOA 3ZDZA 3NIFA 4UM9A 3K6SA 2VDMA 1JV2A 2VDQA 1L5GA 3ZE0A 4MMYA 4WK4A 4NENA 3K71A 4UM8A 4WK0A 4WJKA 4MMZA 3VI3A 3NIGA 3ZE1A 1TYEA 3FCUA 3NIDA 4G1EA 4G1MA 4IRZA 4O02A 3T3MA 4Z7QA 3T3PA 4Z7NA 2VDRA
chains in the Genus database with same CATH superfamily
3V4PA 3BWSA 3IUQA 4IMMA 2VDLA 3PVUB 2VDNA 4D9SA 4X60B 4DNVA 1SQJA 5I5MA 4WK2A 5M5VA 4CY3A 2XYIA 1JTDB 5GSAA 3A0FA 4QAMA 5IGOA 1GXRA 4EWRA 4JXMA 5E6UA 3SVWD 1YFQA 4GMBA 3B7FA 4UM9A 1N6EA 3PXTD 2CO0C 4NC4A 1U4CA 5FKSA 3SXTD 4AEZA 4UM8A 5EAPA 5FKTA 4A2MA 4J81A 5M5SA 2XDWA 3EU7A 2WQ8A 4OWRA 2PM9A 3EI3A 4CI8A 4J86A 3I8EA 4CI2A 4Y7RA 1E5TA 4FA1D 1H2ZA 2VDOA 3I7OA 3UVLA 2I3SA 2O9KA 2HJ4A 3NVNA 3U4YA 1YR2A 2J57G 2P9KC 3OF7A 4A09B 3HFQA 3UVMA 2H6QA 3K6SA 2CE8A 2BKLA 4RE6A 5M5TA 2YNOA 3MKQA 1K3IA 1K32A 4J84A 3ZWLB 3IULA 4A0BA 3AH8B 3EG6A 3MZLA 3RLMD 1QNIA 5EAMA 1GOTB 3DXMC 4JT5C 4O02A 5K19A 4Z7QA 1A12A 4Z7NA 5HE3B 2VDRA 3PSLA 2Q7QA 1N6DA 2G9AA 3IJ0A 4LG8A 2I0TA 2H9NA 3MKSB 4PBYA 2UZYB 2PM9B 3EI3B 3SHFA 2HU7A 3DXKC 2G99A 1VZ3A 3UVOA 1L0QA 2EICA 4CC9A 3O4IA 3KRXB 4I79A 2HXCA 2MTAH 1MG2A 4PBZA 1PGUA 4G1MA 3EI4A 4ESGA 5IJ8E 2IWKA 4GQ1A 4L1MA 3SCYA 3JB9L 4A0BB 5FFGA 3C5MA 4Z7OA 2H3XA 5EM2A 2PM6B 3VI4A 3DWLC 1VYHC 4O45A 2YB8B 2IUVA 3IUMA 3K72A 4NAAA 1NR0A 1E8NA 1B9YA 3W15A 2H14A 5HE2B 5C2WB 3SLED 3RRMC 3MXXA 4AMYA 4OZUA 2BBKH 4J82A 3OL2B 1H2XA 3F3FA 2CN2A 2OK4A 4E5ZB 1GG2B 2J56H 2IWFA 3KCIA 2HKMA 3OW8A 4BP9A 4YVDA 3KRWB 2Z2NA 1NEXB 3JZHA 3CIKB 3K27A 1E8MA 1K8KC 2QC5A 3EI4B 4BUJC 3BG1A 3ZDZA 3F3PA 1I2MB 3L4MD 3K26A 4GGAA 1JMZB 2IUQA 4XYHA 3E0CA 2CNXA 3GC3B 4ZOYA 3K71A 3UR4A 1U2VC 3IIYA 3EI2A 3I8CA 4BCDA 1VE6A 4U1EI 2TRCB 3IVMA 5C2VB 4G1EA 2OJYA 4ERYA 5EMMB 2AQ5A 4UI9R 4A0AA 2IAAA 2YNNA 4A09A 3DDUA 2B5MA 2H9PA 2J55H 4H5IA 2YBAA 3EMHA 4GGCA 4KFMB 3DSMA 3AL8A 4A11A 5KDOB 4ZOVA 2IURA 3I7LA 4GM9A 3ZE0A 4K3ID 4JSXC 1GOGA 4WK0A 2H6NA 1P22A 2HESX 1VE7A 2P9UC 5FKRA 4CI3A 3EI1A 3I7KA 5I5JA 3IUJA 4TZ4A 5H17A 2P9SC 3EQ7A 3FCSA 3NVXA 3SBQA 3J80g 3EI2B 3JPXA 5FQDA 5GMKn 1MG3A 5E6SA 2AGLA 5CXCA 4DNUA 3J81g 3MUNA 4PNKB 2QZPA 4A0AB 1XHMA 1FWXA 2Z2OA 2H13A 4NBMA 4GZ8A 2HKRA 3NVQA 3PE7A 4WJKA 2AGXA 2B4EA 4NSXA 4D6VA 1OLZA 1TYQC 3AL8B 3QI0A 4GQ2P 3VGZA 4A11B 5C92A 3C99A 3O4HA 3JROA 5IT9g 3CFSB 3OKYA 2H9MA 2H47A 3FM0A 1TBGA 4XEIC 4FA9D 5M61A 2YNPA 2OIZA 4GGDA 3UVKA 2XZGA 3V5WB 3VH0A 1M1XA 2AGYA 2GC7A 4JHPC 4A7JA 3OL2A 1PEVA 4CZVA 2GC4A 2H6KA 3EI1B 5TDHB 4E5ZA 4BCCA 4MMYA 1OMWB 4ZOXA 5M5RA 5EARA 3JZGA 4J0WA 5CXCB 5CXBA 2EIDA 4BCBA 3PSCB 4L1QD 3T3PA 2AH0A 1Q47A 3I7HA 2BCJB 2XL3A 5FXYA 4FWWA 1C9IA 2HJBA 4MMXA 3V4VA 3EQ8A 3OKWA 3UKUC 1JMXB 1T2XA 1B9XA 4QRJA 2H68A 3MMYA 4U7AA 3OKYB 4O9DA 1H2WA 1SQ9A 2CN3A 4A08B 3F3GA 4O1QD 5H1MA 3RFGA 3C9CA 4O3TB 4IRZA 3ULEC 5C9ZB 1BPOA 3QHYB 4JSVC 3SBRA 1PBYB 4J79A 1VZ2A 2EIEA 4FAND 3N0EA 5CXBB 2XL2A 1SHYB 2CO0A 4J8BA 3SJLD 4CY2A 2XE4A 1H2YA 4H5JA 3OTTA 4PSWB 2H9LA 2VZ1A 2Z2PA 4DNWA 5GXIA 4R7AB 5EMLB 3P4FA 1S4UX 3CFVA 3MZKA 3DM0A 2OVPB 5HDBA 3FGBA 3ORVD 5HQGA 4GM3A 2P9LC 3VA6A 2P9PC 1A0RB 1RI6A 3GREA 3MUOA 4G56B 4J87A 2VC2A 4J73A 2I0SA 4BL0A 4J8GA 2EBSA 3AFCA 4L3HD 1XKSA 4QL1A 4O3UB 4WK4A 5TF2A 1JJUB 3SMRA 2GNQA 5TEFA 5AJAA 4AOWA 1UOQA 4D0KA 1GOHA 3PXWD 3AL9A 4ERQA 4JSPC 4AMZA 1UOOA 3IKOA 5JWZA 4N14A 1GOFA 4JT6C 5IGQA 3PVWB 3OKTA 2VDMA 3RMZD 2AH1A 5CYKA 2OVQB 3I89A 4J77A 1UTCA 4IA9A 3RN0D 3ODTA 3ZE1A 2XU7A 3FCUA 3O4GA 3SFZA 4O2WA 4LG9A 3N0DA 5EMKB 2VZ3A 4MK0B 1C9LA 4XYIA 4CZXA 3I7PA 3FRXA 2JKXA 5FLXg 1O6FA 4BP8A 5AMSA 2OVRB 1R5MA 3EQ9A 3ZE2A 5K1CC 5EALA 5SXMA 2VDKA 4QQEA 3ZDXA 4A08A 4FB1D 1U8CA 2VDPA 2P9NC 3PXSD 3IIWA 3C75H 2I3TA 4CZYA 3IJ1A 4AN1A 2P9IC 2AGZA 4X63B 3SN6B 1O6GA 3O4JA 4J78A 4NENA 4PC0A 4PXWA 5FA5B 3VI3A 4CY5A 2UZXB 2YMUA 2HU8A 3L4OD 3NIDA 4QT8A 4CI1A 1JOFA 4K3JB 5HE0B 5M5UA 3IUNA 2PBIB 3IJEA 4Y5RD 5CYKB 1XIPA 2W18A 4E54A 3IURA 3I7NA 1PI6A 2EIBA 4FAVD 5EMJB 4GM8A 5E6RA 1GP2B 4J0XA 5FKQA 5I5IA 2QXVA 5FFOA 5IC7A 2PM7B 1N6FA 2VDQA 2OK6A 2B5LA 4FA5D 2B5NA 2I0RA 4LGNA 4JHNA 1UOPA 4AX4A 3IJCA 4FA4D 3RFHA 3SWSD 4X3EA 5TEEA 3GFCA 3UVNA 4ES0A 4JSNC 3BG0A 4ZN4A 3MVDK 5H14A 3ZDYA 3JRPA 3RN1D 2HU5A 4ZOZA 3JZNA 4Z8LA 3UKRC 4HDJA 4FHLA 4E54B 3GD1I 5AFU3 1JV2A 1L5GA 2HYEA 5HE1B 5HYNB 5B4WA 3V9FA 3NIGA 3JAMg 1TYEA 4L3GD 3T3MA 1QFMA 1ERJA 4ERZA 1QFSA 5GXHA 4BH6A 4GQBB 3I2NA 5C86A 2CE9A 4L9OA 2QR5A 4JD2C 3NIFA 4X61B 5EM2B 4CY1A 4RE5A 2IUPA 4MMZA 3RSEC 4AN0A 3SBPA 3EWEA 1MDAH 4A2LA 5A2Qg 4G55A 4PSXB 2AGWA 5IJ7E 3V7DB 5THAA
chains in the Genus database with same CATH topology
3V4PA 3IJEA 5HDBA 5FFGA 2VDLA 3FCSA 2VDNA 4Z7OA 2VDOA 4MMXA 4WK2A 5E6RA 3V4VA 3ZDYA 3ZE2A 3VI4A 2VDKA 3ZDXA 5E6SA 1M1XA 1U8CA 2VC2A 2VDPA 3K72A 5E6UA 5FFOA 3ZDZA 3NIFA 4UM9A 3K6SA 2VDMA 1JV2A 2VDQA 1L5GA 3ZE0A 4MMYA 4WK4A 4NENA 3K71A 4UM8A 4WK0A 4WJKA 4MMZA 3VI3A 3NIGA 3ZE1A 1TYEA 3FCUA 3NIDA 4G1EA 4G1MA 4IRZA 4O02A 3T3MA 4Z7QA 3T3PA 4Z7NA 2VDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4P A;  3IJE A;  5HDB A;  5FFG A;  2VDL A;  3FCS A;  2VDN A;  4Z7O A;  2VDO A;  4MMX A;  4WK2 A;  5E6R A;  3V4V A;  3ZDY A;  3ZE2 A;  3VI4 A;  2VDK A;  3ZDX A;  5E6S A;  1M1X A;  1U8C A;  2VC2 A;  2VDP A;  3K72 A;  5E6U A;  5FFO A;  3ZDZ A;  3NIF A;  4UM9 A;  3K6S A;  2VDM A;  1JV2 A;  2VDQ A;  1L5G A;  3ZE0 A;  4MMY A;  4WK4 A;  4NEN A;  3K71 A;  4UM8 A;  4WK0 A;  4WJK A;  4MMZ A;  3VI3 A;  3NIG A;  3ZE1 A;  1TYE A;  3FCU A;  3NID A;  4G1E A;  4G1M A;  4IRZ A;  4O02 A;  3T3M A;  4Z7Q A;  3T3P A;  4Z7N A;  2VDR A; 
#chains in the Genus database with same CATH topology
 3V4P A;  3BWS A;  3IUQ A;  4IMM A;  2VDL A;  3PVU B;  2VDN A;  4D9S A;  4X60 B;  4DNV A;  1SQJ A;  5I5M A;  4WK2 A;  5M5V A;  4CY3 A;  2XYI A;  1JTD B;  5GSA A;  3A0F A;  4QAM A;  5IGO A;  1GXR A;  4EWR A;  4JXM A;  5E6U A;  3SVW D;  1YFQ A;  4GMB A;  3B7F A;  4UM9 A;  1N6E A;  3PXT D;  2CO0 C;  4NC4 A;  1U4C A;  5FKS A;  3SXT D;  4AEZ A;  4UM8 A;  5EAP A;  5FKT A;  4A2M A;  4J81 A;  5M5S A;  2XDW A;  3EU7 A;  2WQ8 A;  4OWR A;  2PM9 A;  3EI3 A;  4CI8 A;  4J86 A;  3I8E A;  4CI2 A;  4Y7R A;  1E5T A;  4FA1 D;  1H2Z A;  2VDO A;  3I7O A;  3UVL A;  2I3S A;  2O9K A;  2HJ4 A;  3NVN A;  3U4Y A;  1YR2 A;  2J57 G;  2P9K C;  3OF7 A;  4A09 B;  3HFQ A;  3UVM A;  2H6Q A;  3K6S A;  2CE8 A;  2BKL A;  4RE6 A;  5M5T A;  2YNO A;  3MKQ A;  1K3I A;  1K32 A;  4J84 A;  3ZWL B;  3IUL A;  4A0B A;  3AH8 B;  3EG6 A;  3MZL A;  3RLM D;  1QNI A;  5EAM A;  1GOT B;  3DXM C;  4JT5 C;  4O02 A;  5K19 A;  4Z7Q A;  1A12 A;  4Z7N A;  5HE3 B;  2VDR A;  3PSL A;  2Q7Q A;  1N6D A;  2G9A A;  3IJ0 A;  4LG8 A;  2I0T A;  2H9N A;  3MKS B;  4PBY A;  2UZY B;  2PM9 B;  3EI3 B;  3SHF A;  2HU7 A;  3DXK C;  2G99 A;  1VZ3 A;  3UVO A;  1L0Q A;  2EIC A;  4CC9 A;  3O4I A;  3KRX B;  4I79 A;  2HXC A;  2MTA H;  1MG2 A;  4PBZ A;  1PGU A;  4G1M A;  3EI4 A;  4ESG A;  5IJ8 E;  2IWK A;  4GQ1 A;  4L1M A;  3SCY A;  3JB9 L;  4A0B B;  5FFG A;  3C5M A;  4Z7O A;  2H3X A;  5EM2 A;  2PM6 B;  3VI4 A;  3DWL C;  1VYH C;  4O45 A;  2YB8 B;  2IUV A;  3IUM A;  3K72 A;  4NAA A;  1NR0 A;  1E8N A;  1B9Y A;  3W15 A;  2H14 A;  5HE2 B;  5C2W B;  3SLE D;  3RRM C;  3MXX A;  4AMY A;  4OZU A;  2BBK H;  4J82 A;  3OL2 B;  1H2X A;  3F3F A;  2CN2 A;  2OK4 A;  4E5Z B;  1GG2 B;  2J56 H;  2IWF A;  3KCI A;  2HKM A;  3OW8 A;  4BP9 A;  4YVD A;  3KRW B;  2Z2N A;  1NEX B;  3JZH A;  3CIK B;  3K27 A;  1E8M A;  1K8K C;  2QC5 A;  3EI4 B;  4BUJ C;  3BG1 A;  3ZDZ A;  3F3P A;  1I2M B;  3L4M D;  3K26 A;  4GGA A;  1JMZ B;  2IUQ A;  4XYH A;  3E0C A;  2CNX A;  3GC3 B;  4ZOY A;  3K71 A;  3UR4 A;  1U2V C;  3IIY A;  3EI2 A;  3I8C A;  4BCD A;  1VE6 A;  4U1E I;  2TRC B;  3IVM A;  5C2V B;  4G1E A;  2OJY A;  4ERY A;  5EMM B;  2AQ5 A;  4UI9 R;  4A0A A;  2IAA A;  2YNN A;  4A09 A;  3DDU A;  2B5M A;  2H9P A;  2J55 H;  4H5I A;  2YBA A;  3EMH A;  4GGC A;  4KFM B;  3DSM A;  3AL8 A;  4A11 A;  5KDO B;  4ZOV A;  2IUR A;  3I7L A;  4GM9 A;  3ZE0 A;  4K3I D;  4JSX C;  1GOG A;  4WK0 A;  2H6N A;  1P22 A;  2HES X;  1VE7 A;  2P9U C;  5FKR A;  4CI3 A;  3EI1 A;  3I7K A;  5I5J A;  3IUJ A;  4TZ4 A;  5H17 A;  2P9S C;  3EQ7 A;  3FCS A;  3NVX A;  3SBQ A;  3J80 g;  3EI2 B;  3JPX A;  5FQD A;  5GMK n;  1MG3 A;  5E6S A;  2AGL A;  5CXC A;  4DNU A;  3J81 g;  3MUN A;  4PNK B;  2QZP A;  4A0A B;  1XHM A;  1FWX A;  2Z2O A;  2H13 A;  4NBM A;  4GZ8 A;  2HKR A;  3NVQ A;  3PE7 A;  4WJK A;  2AGX A;  2B4E A;  4NSX A;  4D6V A;  1OLZ A;  1TYQ C;  3AL8 B;  3QI0 A;  4GQ2 P;  3VGZ A;  4A11 B;  5C92 A;  3C99 A;  3O4H A;  3JRO A;  5IT9 g;  3CFS B;  3OKY A;  2H9M A;  2H47 A;  3FM0 A;  1TBG A;  4XEI C;  4FA9 D;  5M61 A;  2YNP A;  2OIZ A;  4GGD A;  3UVK A;  2XZG A;  3V5W B;  3VH0 A;  1M1X A;  2AGY A;  2GC7 A;  4JHP C;  4A7J A;  3OL2 A;  1PEV A;  4CZV A;  2GC4 A;  2H6K A;  3EI1 B;  5TDH B;  4E5Z A;  4BCC A;  4MMY A;  1OMW B;  4ZOX A;  5M5R A;  5EAR A;  3JZG A;  4J0W A;  5CXC B;  5CXB A;  2EID A;  4BCB A;  3PSC B;  4L1Q D;  3T3P A;  2AH0 A;  1Q47 A;  3I7H A;  2BCJ B;  2XL3 A;  5FXY A;  4FWW A;  1C9I A;  2HJB A;  4MMX A;  3V4V A;  3EQ8 A;  3OKW A;  3UKU C;  1JMX B;  1T2X A;  1B9X A;  4QRJ A;  2H68 A;  3MMY A;  4U7A A;  3OKY B;  4O9D A;  1H2W A;  1SQ9 A;  2CN3 A;  4A08 B;  3F3G A;  4O1Q D;  5H1M A;  3RFG A;  3C9C A;  4O3T B;  4IRZ A;  3ULE C;  5C9Z B;  1BPO A;  3QHY B;  4JSV C;  3SBR A;  1PBY B;  4J79 A;  1VZ2 A;  2EIE A;  4FAN D;  3N0E A;  5CXB B;  2XL2 A;  1SHY B;  2CO0 A;  4J8B A;  3SJL D;  4CY2 A;  2XE4 A;  1H2Y A;  4H5J A;  3OTT A;  4PSW B;  2H9L A;  2VZ1 A;  2Z2P A;  4DNW A;  5GXI A;  4R7A B;  5EML B;  3P4F A;  1S4U X;  3CFV A;  3MZK A;  3DM0 A;  2OVP B;  5HDB A;  3FGB A;  3ORV D;  5HQG A;  4GM3 A;  2P9L C;  3VA6 A;  2P9P C;  1A0R B;  1RI6 A;  3GRE A;  3MUO A;  4G56 B;  4J87 A;  2VC2 A;  4J73 A;  2I0S A;  4BL0 A;  4J8G A;  2EBS A;  3AFC A;  4L3H D;  1XKS A;  4QL1 A;  4O3U B;  4WK4 A;  5TF2 A;  1JJU B;  3SMR A;  2GNQ A;  5TEF A;  5AJA A;  4AOW A;  1UOQ A;  4D0K A;  1GOH A;  3PXW D;  3AL9 A;  4ERQ A;  4JSP C;  4AMZ A;  1UOO A;  3IKO A;  5JWZ A;  4N14 A;  1GOF A;  4JT6 C;  5IGQ A;  3PVW B;  3OKT A;  2VDM A;  3RMZ D;  2AH1 A;  5CYK A;  2OVQ B;  3I89 A;  4J77 A;  1UTC A;  4IA9 A;  3RN0 D;  3ODT A;  3ZE1 A;  2XU7 A;  3FCU A;  3O4G A;  3SFZ A;  4O2W A;  4LG9 A;  3N0D A;  5EMK B;  2VZ3 A;  4MK0 B;  1C9L A;  4XYI A;  4CZX A;  3I7P A;  3FRX A;  2JKX A;  5FLX g;  1O6F A;  4BP8 A;  5AMS A;  2OVR B;  1R5M A;  3EQ9 A;  3ZE2 A;  5K1C C;  5EAL A;  5SXM A;  2VDK A;  4QQE A;  3ZDX A;  4A08 A;  4FB1 D;  1U8C A;  2VDP A;  2P9N C;  3PXS D;  3IIW A;  3C75 H;  2I3T A;  4CZY A;  3IJ1 A;  4AN1 A;  2P9I C;  2AGZ A;  4X63 B;  3SN6 B;  1O6G A;  3O4J A;  4J78 A;  4NEN A;  4PC0 A;  4PXW A;  5FA5 B;  3VI3 A;  4CY5 A;  2UZX B;  2YMU A;  2HU8 A;  3L4O D;  3NID A;  4QT8 A;  4CI1 A;  1JOF A;  4K3J B;  5HE0 B;  5M5U A;  3IUN A;  2PBI B;  3IJE A;  4Y5R D;  5CYK B;  1XIP A;  2W18 A;  4E54 A;  3IUR A;  3I7N A;  1PI6 A;  2EIB A;  4FAV D;  5EMJ B;  4GM8 A;  5E6R A;  1GP2 B;  4J0X A;  5FKQ A;  5I5I A;  2QXV A;  5FFO A;  5IC7 A;  2PM7 B;  1N6F A;  2VDQ A;  2OK6 A;  2B5L A;  4FA5 D;  2B5N A;  2I0R A;  4LGN A;  4JHN A;  1UOP A;  4AX4 A;  3IJC A;  4FA4 D;  3RFH A;  3SWS D;  4X3E A;  5TEE A;  3GFC A;  3UVN A;  4ES0 A;  4JSN C;  3BG0 A;  4ZN4 A;  3MVD K;  5H14 A;  3ZDY A;  3JRP A;  3RN1 D;  2HU5 A;  4ZOZ A;  3JZN A;  4Z8L A;  3UKR C;  4HDJ A;  4FHL A;  4E54 B;  3GD1 I;  5AFU 3;  1JV2 A;  1L5G A;  2HYE A;  5HE1 B;  5HYN B;  5B4W A;  3V9F A;  3NIG A;  3JAM g;  1TYE A;  4L3G D;  3T3M A;  1QFM A;  1ERJ A;  4ERZ A;  1QFS A;  5GXH A;  4BH6 A;  4GQB B;  3I2N A;  5C86 A;  2CE9 A;  4L9O A;  2QR5 A;  4JD2 C;  3NIF A;  4X61 B;  5EM2 B;  4CY1 A;  4RE5 A;  2IUP A;  4MMZ A;  3RSE C;  4AN0 A;  3SBP A;  3EWE A;  1MDA H;  4A2L A;  5A2Q g;  4G55 A;  4PSX B;  2AGW A;  5IJ7 E;  3V7D B;  5THA A; 
#chains in the Genus database with same CATH homology
 3V4P A;  3IJE A;  5HDB A;  5FFG A;  2VDL A;  3FCS A;  2VDN A;  4Z7O A;  2VDO A;  4MMX A;  4WK2 A;  5E6R A;  3V4V A;  3ZDY A;  3ZE2 A;  3VI4 A;  2VDK A;  3ZDX A;  5E6S A;  1M1X A;  1U8C A;  2VC2 A;  2VDP A;  3K72 A;  5E6U A;  5FFO A;  3ZDZ A;  3NIF A;  4UM9 A;  3K6S A;  2VDM A;  1JV2 A;  2VDQ A;  1L5G A;  3ZE0 A;  4MMY A;  4WK4 A;  4NEN A;  3K71 A;  4UM8 A;  4WK0 A;  4WJK A;  4MMZ A;  3VI3 A;  3NIG A;  3ZE1 A;  1TYE A;  3FCU A;  3NID A;  4G1E A;  4G1M A;  4IRZ A;  4O02 A;  3T3M A;  4Z7Q A;  3T3P A;  4Z7N A;  2VDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...