4GMBA

Crystal structure of human wd repeat domain 5 with compound mm-402
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
307
structure length
307
Chain Sequence
PTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
publication title Discovery of a Highly Potent, Cell-Permeable Macrocyclic Peptidomimetic (MM-589) Targeting the WD Repeat Domain 5 Protein (WDR5)-Mixed Lineage Leukemia (MLL) Protein-Protein Interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gmbA00
5EMMB 2AGYA 4J81A 2H68A 3I8EA 3KRXB 2YNPA 4GMBA 5GXIA 2YNNA 4IA9A 4R7AB 4L3GD 4PBYA 3AFCA 3OL2B 5TDHB 4ZOVA 4A08B 5AFU3 3I7KA 3VH0A 5HQGA 3I7NA 4PBZA 1SQJA 5TF2A 2YMUA 4GM8A 2P9IC 4L9OA 2HJBA 3I7LA 2H9MA 1JOFA 1MG3A 4O3TB 4FAND 2AGZA 4CY5A 3JROA 3OKYB 1NR0A 1FWXA 3MKQA 5IJ8E 2I0RA 3SJLD 5JWZA 5HE1B 3EWEA 4FA5D 1YFQA 5HE0B 2I0SA 2XU7A 5FA5B 5GMKn 4I79A 4O1QD 4CI8A 4BL0A 3SCYA 5CYKA 4JT5C 2OK4A 3EU7A 3RRMC 4Z8LA 3A0FA 5EM2A 2HJ4A 1P22A 4O45A 3AL8A 3K27A 4AOWA 5GSAA 3EI1A 1S4UX 3C5MA 2IWKA 5THAA 3C99A 4GGAA 3PXTD 4ZN4A 3GFCA 4MK0B 4CZYA 5EM2B 4FHLA 2AQ5A 2MTAH 4A2LA 4E5ZB 3JZHA 5EARA 4QQEA 4L1QD 5IGOA 2P9KC 4XEIC 3UVOA 1R5MA 5I5IA 1GOTB 5C9ZB 2YBAA 3RLMD 3BG1A 1GG2B 3PSCB 4ERYA 2OVPB 3J80g 4E54B 2Z2OA 3SMRA 4J79A 2OVQB 4H5JA 2AH1A 3DXMC 1GXRA 3JZNA 3MMYA 4J8BA 4A7JA 3GREA 4LG9A 3CFSB 3V9FA 4J87A 3MZKA 1U2VC 4D0KA 1U4CA 4OZUA 3C9CA 5H17A 2XL3A 2B4EA 2OIZA 4GQ2P 2H14A 5SXMA 2G9AA 3SLED 3RMZD 5CXCB 3I7PA 4XYIA 4J86A 3DM0A 3I7HA 4Y7RA 3C75H 2H3XA 4A09B 4FB1D 4K3ID 2G99A 2H9NA 5FLXg 3PVWB 3CFVA 2IAAA 2XYIA 2B5LA 4GQ1A 4UI9R 4Y5RD 3PXSD 3VGZA 3DWLC 3MZLA 4CI1A 2H13A 3NVNA 3W15A 4X61B 5C2WB 3SN6B 4D6VA 3UVLA 2H9LA 3F3GA 2Q7QA 4CZXA 5IGQA 4QT8A 1GP2B 2CNXA 4CZVA 4A2MA 2B5MA 5I5JA 3V7DB 4J82A 3IJ0A 3UVKA 3DXKC 3EI2A 5FKTA 3I2NA 2I3SA 2CE9A 3SBQA 4KFMB 2IURA 5IJ7E 4QL1A 2J57G 3UKUC 3EI3A 4FA1D 4FA9D 2CO0C 3AH8B 3PXWD 4FWWA 1ERJA 3P4FA 2IUVA 3K26A 3FRXA 4CY1A 3ODTA 4A0AA 4GM3A 4LGNA 3EI3B 3IJ1A 4ERZA 3KRWB 2OVRB 5FKRA 4A11A 5FKQA 4IMMA 2PM9A 3SWSD 4NSXA 3ORVD 4JSNC 1OLZA 3CIKB 3IJCA 1B9XA 3BG0A 5CYKB 4J8GA 4L3HD 5B4WA 2BCJB 3UR4A 3N0EA 3AL8B 1NEXB 3I8CA 3EI1B 4O9DA 3OW8A 2AGWA 2OK6A 5H1MA 2P9LC 4G56B 2YNOA 5I5MA 3SHFA 3AL9A 2AGLA 1TBGA 4PC0A 2GC7A 3DSMA 3SFZA 4U7AA 3UVMA 4CC9A 2EBSA 3JB9L 4N14A 1VYHC 1SHYB 3IIWA 4A0BA 3OKWA 5K1CC 2IUPA 1K32A 3L4MD 4ZOZA 2HKRA 2H47A 1PBYB 3J81g 2PM7B 3L4OD 4J84A 2IUQA 2PM6B 1QNIA 1XIPA 2H9PA 4TZ4A 2Z2PA 3SBPA 4O3UB 3OTTA 5EAMA 3N0DA 3JRPA 3F3FA 2PBIB 3RSEC 5IC7A 3JPXA 5EMKB 4ERQA 2CE8A 3I7OA 5EMJB 5AJAA 4X3EA 4XYHA 5H14A 4CI2A 4PSWB 1MG2A 2O9KA 3SBRA 1A0RB 3UKRC 2P9SC 3EG6A 1N6DA 2W18A 4X60B 3HFQA 5HE2B 2XL2A 3EMHA 4A08A 3F3PA 4JXMA 1SQ9A 4JT6C 1PI6A 1Q47A 1K8KC 4BUJC 1OMWB 5KDOB 4J0XA 4U1EI 4GZ8A 4J0WA 4ZOXA 1PGUA 4K3JB 3BWSA 1TYQC 2AGXA 4PXWA 4JD2C 3OKYA 5HE3B 3PVUB 2P9UC 4LG8A 2B5NA 4J78A 3EI2B 3JZGA 4PSXB 3NVXA 1N6EA 4FAVD 5HYNB 2QC5A 3UVNA 3U4YA 3VA6A 4JSXC 4AEZA 5EAPA 2HYEA 2OJYA 1N6FA 4OWRA 1XKSA 3RFGA 4JSVC 5CXBA 3IKOA 2GNQA 4J77A 5FKSA 4A0AB 3MXXA 3FGBA 4A11B 4YVDA 4JSPC 2J55H 1JMZB 2PM9B 2H6QA 2I3TA 3SXTD 5CXBB 4GGCA 5TEFA 2IWFA 4GGDA 1RI6A 4GQBB 4E5ZA 5IT9g 1XHMA 5AMSA 2BBKH 4X63B 3SVWD 2HXCA 3B7FA 4E54A 5EALA 3RFHA 2AH0A 1JMXB 2CO0A 4ESGA 3MKSB 4EWRA 2CN2A 5C2VB 2CN3A 4A0BB 2I0TA 2H6NA 3ZWLB 2HESX 5A2Qg 3IIYA 2GC4A 1PEVA 2UZXB 5K19A 2QXVA 4H5IA 3EI4A 4CY3A 3I89A 5FQDA 3ULEC 4BH6A 3OKTA 2UZYB 3NVQA 3E0CA 2H6KA 3PE7A 2YB8B 1B9YA 4CY2A 4J73A 1MDAH 5EMLB 3EI4B 4QRJA 5CXCA 3FM0A 1L0QA 2TRCB 3PSLA 2P9PC 2HKMA 4CI3A 5FXYA 3JAMg 4A09A 4ZOYA 4ES0A 3RN1D 5GXHA 2Z2NA 5TEEA 4FA4D 4HDJA 3V5WB 1JJUB 4PNKB 3RN0D 2P9NC 3OL2A 2J56H 4GM9A
chains in the Genus database with same CATH superfamily
5EMMB 2AGYA 4J81A 2H68A 1VZ2A 3I8EA 2YNPA 3KRXB 4GMBA 5GXIA 2YNNA 4IA9A 4R7AB 5FFOA 4L3GD 4PBYA 3AFCA 3OL2B 1BPOA 5TDHB 2XDWA 4ZOVA 4RE5A 4A08B 5AFU3 3I7KA 3VH0A 5HQGA 2EIEA 3I7NA 4PBZA 1SQJA 5TF2A 2YMUA 1E8MA 4GM8A 2P9IC 4L9OA 2HJBA 3I7LA 4MMYA 2H9MA 1JOFA 1MG3A 4O3TB 2QZPA 4AMYA 4FAND 2AGZA 4CY5A 3JROA 3OKYB 4WK4A 1NR0A 1FWXA 1UOOA 3MKQA 3K6SA 5IJ8E 2I0RA 3QI0A 3SJLD 5JWZA 5HE1B 3EWEA 4FA5D 3QHYB 1YFQA 5HE0B 2I0SA 2XU7A 5FA5B 5GMKn 3V4VA 4I79A 4O1QD 4CI8A 4BL0A 3SCYA 5CYKA 4BP8A 4JT5C 2OK4A 3EU7A 3RRMC 4Z8LA 3A0FA 3NIDA 5EM2A 2HJ4A 1P22A 4O45A 3AL8A 3O4IA 3K27A 4AOWA 5GSAA 3EI1A 1S4UX 2EICA 3C5MA 3OF7A 2IWKA 5THAA 3C99A 4GGAA 3PXTD 4ZN4A 3GFCA 4MK0B 3IUNA 4CZYA 3IJEA 5EM2B 4FHLA 5HDBA 4AMZA 3IULA 2VDMA 1C9LA 2AQ5A 1E8NA 2MTAH 5M5RA 4A2LA 4Z7OA 3NIGA 4E5ZB 3ZE2A 3IUMA 3JZHA 5EARA 4QQEA 4L1QD 5IGOA 2P9KC 3O4JA 5M61A 4XEIC 3UVOA 1R5MA 1H2WA 5I5IA 1GOTB 5C9ZB 2YBAA 3EQ7A 2VDOA 1L5GA 3RLMD 3BG1A 1GG2B 4DNWA 5M5UA 3PSCB 4ERYA 2OVPB 3J80g 4E54B 4O2WA 2Z2OA 3SMRA 3KCIA 4J79A 4WJKA 2OVQB 1YR2A 4H5JA 2AH1A 4DNVA 2XZGA 3DXMC 1H2YA 4QAMA 1GXRA 3JZNA 3MMYA 4J8BA 2EIDA 4JHNA 4A7JA 3VI4A 4BCBA 3GREA 4LG9A 4NENA 1TYEA 3CFSB 3V9FA 4J87A 3MZKA 1U2VC 4D0KA 3K72A 1U4CA 4OZUA 3C9CA 5H17A 2XL3A 2B4EA 2OIZA 4GQ2P 2H14A 5SXMA 2G9AA 4NBMA 1QFMA 4D9SA 3MUOA 3FCSA 3SLED 3RMZD 4G1MA 5CXCB 3I7PA 4XYIA 4J86A 3DM0A 3I7HA 4Y7RA 3C75H 1JV2A 2H3XA 4A09B 4FB1D 4K3ID 2G99A 2H9NA 5FLXg 3PVWB 3CFVA 2IAAA 3MVDK 2EIBA 2XYIA 2B5LA 4GQ1A 4UI9R 4Y5RD 3PXSD 3VGZA 3DWLC 3MZLA 4CI1A 2H13A 3NVNA 3W15A 4X61B 5C2WB 3SN6B 4D6VA 3UVLA 2H9LA 3F3GA 1GOFA 2Q7QA 4CZXA 5IGQA 4QT8A 1GP2B 2CNXA 4CZVA 4A2MA 2B5MA 5I5JA 3V7DB 4J82A 4IRZA 1UOQA 3IJ0A 4AN0A 5E6RA 3UVKA 3DXKC 1UOPA 4Z7NA 4G55A 3EI2A 5FKTA 3K71A 3I2NA 2I3SA 2CE9A 3SBQA 4KFMB 2IURA 5IJ7E 4QL1A 2J57G 3UKUC 3EI3A 4FA1D 4FA9D 2CO0C 3AH8B 3PXWD 5M5TA 4FWWA 1ERJA 3P4FA 2IUVA 3K26A 3FRXA 4CY1A 3ODTA 4A0AA 4GM3A 4LGNA 3EI3B 3IJ1A 4ERZA 5C92A 3KRWB 4DNUA 2OVRB 1VE7A 5FKRA 1K3IA 4A11A 5FKQA 4IMMA 3ZE1A 2PM9A 3SWSD 4NSXA 3ORVD 4JSNC 1OLZA 3CIKB 3ZDXA 3IJCA 1B9XA 3BG0A 2WQ8A 5CYKB 4J8GA 2VDLA 4L3HD 5B4WA 2BCJB 3UR4A 2VDPA 3N0EA 3AL8B 1NEXB 3I8CA 3EI1B 5M5VA 4O9DA 3OW8A 2AGWA 1M1XA 2OK6A 1GOGA 5H1MA 2P9LC 3IUJA 3ZDZA 4G56B 2HU5A 2YNOA 5I5MA 2VC2A 3SHFA 3AL9A 2AGLA 1TBGA 4PC0A 2GC7A 3DSMA 3SFZA 3GD1I 4U7AA 3UVMA 4WK0A 2EBSA 4CC9A 3JB9L 4N14A 2BKLA 1VYHC 1SHYB 3IIWA 4A0BA 3OKWA 5K1CC 5E6UA 2IUPA 1K32A 3L4MD 4ZOZA 2HKRA 3IURA 1H2ZA 2H47A 2QR5A 1PBYB 3J81g 2PM7B 3L4OD 4L1MA 4J84A 2IUQA 2PM6B 1QNIA 1XIPA 1GOHA 2H9PA 4TZ4A 2Z2PA 5FFGA 3SBPA 4O3UB 3OTTA 4NC4A 5EAMA 1E5TA 3N0DA 4AN1A 3JRPA 1O6FA 3F3FA 2PBIB 2XE4A 3RSEC 5IC7A 3JPXA 5EMKB 4ERQA 5C86A 3FCUA 2CE8A 3I7OA 5EMJB 5AJAA 3O4GA 4X3EA 1VE6A 4XYHA 5H14A 4CI2A 4PSWB 4UM8A 1MG2A 2O9KA 3SBRA 3IVMA 1A0RB 2HU8A 3UKRC 2P9SC 3EG6A 1N6DA 2W18A 4X60B 3HFQA 5HE2B 2XL2A 3EMHA 4A08A 3F3PA 4JXMA 1SQ9A 1PI6A 4JT6C 1Q47A 4O02A 1K8KC 1UTCA 1JTDB 4BUJC 1OMWB 5KDOB 4J0XA 4U1EI 4GZ8A 2VDRA 4J0WA 4ZOXA 1PGUA 4K3JB 3EQ9A 1O6GA 3BWSA 1TYQC 2AGXA 4PXWA 3VI3A 4JD2C 3DDUA 3OKYA 5HE3B 3PVUB 2P9UC 1A12A 4LG8A 2B5NA 4J78A 3EI2B 3JZGA 4PSXB 3ZE0A 3NVXA 1N6EA 4G1EA 4FAVD 5HYNB 2QC5A 4Z7QA 3UVNA 3U4YA 3VA6A 4BCCA 4JSXC 4AEZA 5EAPA 2HYEA 2OJYA 1N6FA 4OWRA 1XKSA 3RFGA 4JSVC 5CXBA 3IKOA 2GNQA 4J77A 5FKSA 4A0AB 3T3PA 3MXXA 3FGBA 4A11B 4YVDA 4JSPC 2J55H 1JMZB 2PM9B 2H6QA 2I3TA 3SXTD 3ZDYA 4AX4A 5CXBB 4GGCA 3IUQA 5TEFA 2IWFA 4GGDA 1RI6A 1C9IA 4GQBB 4E5ZA 2JKXA 5IT9g 3NIFA 2VZ1A 1XHMA 5AMSA 1H2XA 2BBKH 4MMZA 4X63B 3SVWD 3EQ8A 2HXCA 4WK2A 3B7FA 4E54A 5EALA 4UM9A 3RFHA 2HU7A 2VDQA 1I2MB 2AH0A 1JMXB 3GC3B 2CO0A 4ESGA 3MKSB 4EWRA 1U8CA 2CN2A 3V4PA 2CN3A 5C2VB 4A0BB 2I0TA 4BP9A 2H6NA 3ZWLB 5M5SA 2HESX 2VDKA 5E6SA 5A2Qg 3IIYA 4BCDA 2GC4A 1PEVA 2UZXB 5K19A 2QXVA 4RE6A 3O4HA 1T2XA 1VZ3A 3EI4A 4H5IA 4JHPC 3I89A 5FQDA 4CY3A 1QFSA 3ULEC 4BH6A 3OKTA 2UZYB 3NVQA 2VDNA 3E0CA 2H6KA 3PE7A 2YB8B 1B9YA 3T3MA 4CY2A 4J73A 1MDAH 5EMLB 3EI4B 4QRJA 5CXCA 3FM0A 1L0QA 2TRCB 3PSLA 4NAAA 4MMXA 2P9PC 2HKMA 2VZ3A 4CI3A 5FXYA 3JAMg 4A09A 4ZOYA 4ES0A 3RN1D 5GXHA 2Z2NA 5TEEA 4FA4D 4HDJA 3V5WB 1JJUB 4PNKB 3RN0D 2P9NC 3MUNA 3OL2A 2J56H 4GM9A
chains in the Genus database with same CATH topology
5EMMB 2AGYA 4J81A 2H68A 3I8EA 3KRXB 2YNPA 4GMBA 5GXIA 2YNNA 4IA9A 4R7AB 4L3GD 4PBYA 3AFCA 3OL2B 5TDHB 4ZOVA 4A08B 5AFU3 3I7KA 3VH0A 5HQGA 3I7NA 4PBZA 1SQJA 5TF2A 2YMUA 4GM8A 2P9IC 4L9OA 2HJBA 3I7LA 2H9MA 1JOFA 1MG3A 4O3TB 4FAND 2AGZA 4CY5A 3JROA 3OKYB 1NR0A 1FWXA 3MKQA 5IJ8E 2I0RA 3SJLD 5JWZA 5HE1B 3EWEA 4FA5D 1YFQA 5HE0B 2I0SA 2XU7A 5FA5B 5GMKn 4I79A 4O1QD 4CI8A 4BL0A 3SCYA 5CYKA 4JT5C 2OK4A 3EU7A 3RRMC 4Z8LA 3A0FA 5EM2A 2HJ4A 1P22A 4O45A 3AL8A 3K27A 4AOWA 5GSAA 3EI1A 1S4UX 3C5MA 2IWKA 5THAA 3C99A 4GGAA 3PXTD 4ZN4A 3GFCA 4MK0B 4CZYA 5EM2B 4FHLA 2AQ5A 2MTAH 4A2LA 4E5ZB 3JZHA 5EARA 4QQEA 4L1QD 5IGOA 2P9KC 4XEIC 3UVOA 1R5MA 5I5IA 1GOTB 5C9ZB 2YBAA 3RLMD 3BG1A 1GG2B 3PSCB 4ERYA 2OVPB 3J80g 4E54B 2Z2OA 3SMRA 4J79A 2OVQB 4H5JA 2AH1A 3DXMC 1GXRA 3JZNA 3MMYA 4J8BA 4A7JA 3GREA 4LG9A 3CFSB 3V9FA 4J87A 3MZKA 1U2VC 4D0KA 1U4CA 4OZUA 3C9CA 5H17A 2XL3A 2B4EA 2OIZA 4GQ2P 2H14A 5SXMA 2G9AA 3SLED 3RMZD 5CXCB 3I7PA 4XYIA 4J86A 3DM0A 3I7HA 4Y7RA 3C75H 2H3XA 4A09B 4FB1D 4K3ID 2G99A 2H9NA 5FLXg 3PVWB 3CFVA 2IAAA 2XYIA 2B5LA 4GQ1A 4UI9R 4Y5RD 3PXSD 3VGZA 3DWLC 3MZLA 4CI1A 2H13A 3NVNA 3W15A 4X61B 5C2WB 3SN6B 4D6VA 3UVLA 2H9LA 3F3GA 2Q7QA 4CZXA 5IGQA 4QT8A 1GP2B 2CNXA 4CZVA 4A2MA 2B5MA 5I5JA 3V7DB 4J82A 3IJ0A 3UVKA 3DXKC 3EI2A 5FKTA 3I2NA 2I3SA 2CE9A 3SBQA 4KFMB 2IURA 5IJ7E 4QL1A 2J57G 3UKUC 3EI3A 4FA1D 4FA9D 2CO0C 3AH8B 3PXWD 4FWWA 1ERJA 3P4FA 2IUVA 3K26A 3FRXA 4CY1A 3ODTA 4A0AA 4GM3A 4LGNA 3EI3B 3IJ1A 4ERZA 3KRWB 2OVRB 5FKRA 4A11A 5FKQA 4IMMA 2PM9A 3SWSD 4NSXA 3ORVD 4JSNC 1OLZA 3CIKB 3IJCA 1B9XA 3BG0A 5CYKB 4J8GA 4L3HD 5B4WA 2BCJB 3UR4A 3N0EA 3AL8B 1NEXB 3I8CA 3EI1B 4O9DA 3OW8A 2AGWA 2OK6A 5H1MA 2P9LC 4G56B 2YNOA 5I5MA 3SHFA 3AL9A 2AGLA 1TBGA 4PC0A 2GC7A 3DSMA 3SFZA 4U7AA 3UVMA 4CC9A 2EBSA 3JB9L 4N14A 1VYHC 1SHYB 3IIWA 4A0BA 3OKWA 5K1CC 2IUPA 1K32A 3L4MD 4ZOZA 2HKRA 2H47A 1PBYB 3J81g 2PM7B 3L4OD 4J84A 2IUQA 2PM6B 1QNIA 1XIPA 2H9PA 4TZ4A 2Z2PA 3SBPA 4O3UB 3OTTA 5EAMA 3N0DA 3JRPA 3F3FA 2PBIB 3RSEC 5IC7A 3JPXA 5EMKB 4ERQA 2CE8A 3I7OA 5EMJB 5AJAA 4X3EA 4XYHA 5H14A 4CI2A 4PSWB 1MG2A 2O9KA 3SBRA 1A0RB 3UKRC 2P9SC 3EG6A 1N6DA 2W18A 4X60B 3HFQA 5HE2B 2XL2A 3EMHA 4A08A 3F3PA 4JXMA 1SQ9A 4JT6C 1PI6A 1Q47A 1K8KC 4BUJC 1OMWB 5KDOB 4J0XA 4U1EI 4GZ8A 4J0WA 4ZOXA 1PGUA 4K3JB 3BWSA 1TYQC 2AGXA 4PXWA 4JD2C 3OKYA 5HE3B 3PVUB 2P9UC 4LG8A 2B5NA 4J78A 3EI2B 3JZGA 4PSXB 3NVXA 1N6EA 4FAVD 5HYNB 2QC5A 3UVNA 3U4YA 3VA6A 4JSXC 4AEZA 5EAPA 2HYEA 2OJYA 1N6FA 4OWRA 1XKSA 3RFGA 4JSVC 5CXBA 3IKOA 2GNQA 4J77A 5FKSA 4A0AB 3MXXA 3FGBA 4A11B 4YVDA 4JSPC 2J55H 1JMZB 2PM9B 2H6QA 2I3TA 3SXTD 5CXBB 4GGCA 5TEFA 2IWFA 4GGDA 1RI6A 4GQBB 4E5ZA 5IT9g 1XHMA 5AMSA 2BBKH 4X63B 3SVWD 2HXCA 3B7FA 4E54A 5EALA 3RFHA 2AH0A 1JMXB 2CO0A 4ESGA 3MKSB 4EWRA 2CN2A 5C2VB 2CN3A 4A0BB 2I0TA 2H6NA 3ZWLB 2HESX 5A2Qg 3IIYA 2GC4A 1PEVA 2UZXB 5K19A 2QXVA 4H5IA 3EI4A 4CY3A 3I89A 5FQDA 3ULEC 4BH6A 3OKTA 2UZYB 3NVQA 3E0CA 2H6KA 3PE7A 2YB8B 1B9YA 4CY2A 4J73A 1MDAH 5EMLB 3EI4B 4QRJA 5CXCA 3FM0A 1L0QA 2TRCB 3PSLA 2P9PC 2HKMA 4CI3A 5FXYA 3JAMg 4A09A 4ZOYA 4ES0A 3RN1D 5GXHA 2Z2NA 5TEEA 4FA4D 4HDJA 3V5WB 1JJUB 4PNKB 3RN0D 2P9NC 3OL2A 2J56H 4GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EMM B;  2AGY A;  4J81 A;  2H68 A;  3I8E A;  3KRX B;  2YNP A;  4GMB A;  5GXI A;  2YNN A;  4IA9 A;  4R7A B;  4L3G D;  4PBY A;  3AFC A;  3OL2 B;  5TDH B;  4ZOV A;  4A08 B;  5AFU 3;  3I7K A;  3VH0 A;  5HQG A;  3I7N A;  4PBZ A;  1SQJ A;  5TF2 A;  2YMU A;  4GM8 A;  2P9I C;  4L9O A;  2HJB A;  3I7L A;  2H9M A;  1JOF A;  1MG3 A;  4O3T B;  4FAN D;  2AGZ A;  4CY5 A;  3JRO A;  3OKY B;  1NR0 A;  1FWX A;  3MKQ A;  5IJ8 E;  2I0R A;  3SJL D;  5JWZ A;  5HE1 B;  3EWE A;  4FA5 D;  1YFQ A;  5HE0 B;  2I0S A;  2XU7 A;  5FA5 B;  5GMK n;  4I79 A;  4O1Q D;  4CI8 A;  4BL0 A;  3SCY A;  5CYK A;  4JT5 C;  2OK4 A;  3EU7 A;  3RRM C;  4Z8L A;  3A0F A;  5EM2 A;  2HJ4 A;  1P22 A;  4O45 A;  3AL8 A;  3K27 A;  4AOW A;  5GSA A;  3EI1 A;  1S4U X;  3C5M A;  2IWK A;  5THA A;  3C99 A;  4GGA A;  3PXT D;  4ZN4 A;  3GFC A;  4MK0 B;  4CZY A;  5EM2 B;  4FHL A;  2AQ5 A;  2MTA H;  4A2L A;  4E5Z B;  3JZH A;  5EAR A;  4QQE A;  4L1Q D;  5IGO A;  2P9K C;  4XEI C;  3UVO A;  1R5M A;  5I5I A;  1GOT B;  5C9Z B;  2YBA A;  3RLM D;  3BG1 A;  1GG2 B;  3PSC B;  4ERY A;  2OVP B;  3J80 g;  4E54 B;  2Z2O A;  3SMR A;  4J79 A;  2OVQ B;  4H5J A;  2AH1 A;  3DXM C;  1GXR A;  3JZN A;  3MMY A;  4J8B A;  4A7J A;  3GRE A;  4LG9 A;  3CFS B;  3V9F A;  4J87 A;  3MZK A;  1U2V C;  4D0K A;  1U4C A;  4OZU A;  3C9C A;  5H17 A;  2XL3 A;  2B4E A;  2OIZ A;  4GQ2 P;  2H14 A;  5SXM A;  2G9A A;  3SLE D;  3RMZ D;  5CXC B;  3I7P A;  4XYI A;  4J86 A;  3DM0 A;  3I7H A;  4Y7R A;  3C75 H;  2H3X A;  4A09 B;  4FB1 D;  4K3I D;  2G99 A;  2H9N A;  5FLX g;  3PVW B;  3CFV A;  2IAA A;  2XYI A;  2B5L A;  4GQ1 A;  4UI9 R;  4Y5R D;  3PXS D;  3VGZ A;  3DWL C;  3MZL A;  4CI1 A;  2H13 A;  3NVN A;  3W15 A;  4X61 B;  5C2W B;  3SN6 B;  4D6V A;  3UVL A;  2H9L A;  3F3G A;  2Q7Q A;  4CZX A;  5IGQ A;  4QT8 A;  1GP2 B;  2CNX A;  4CZV A;  4A2M A;  2B5M A;  5I5J A;  3V7D B;  4J82 A;  3IJ0 A;  3UVK A;  3DXK C;  3EI2 A;  5FKT A;  3I2N A;  2I3S A;  2CE9 A;  3SBQ A;  4KFM B;  2IUR A;  5IJ7 E;  4QL1 A;  2J57 G;  3UKU C;  3EI3 A;  4FA1 D;  4FA9 D;  2CO0 C;  3AH8 B;  3PXW D;  4FWW A;  1ERJ A;  3P4F A;  2IUV A;  3K26 A;  3FRX A;  4CY1 A;  3ODT A;  4A0A A;  4GM3 A;  4LGN A;  3EI3 B;  3IJ1 A;  4ERZ A;  3KRW B;  2OVR B;  5FKR A;  4A11 A;  5FKQ A;  4IMM A;  2PM9 A;  3SWS D;  4NSX A;  3ORV D;  4JSN C;  1OLZ A;  3CIK B;  3IJC A;  1B9X A;  3BG0 A;  5CYK B;  4J8G A;  4L3H D;  5B4W A;  2BCJ B;  3UR4 A;  3N0E A;  3AL8 B;  1NEX B;  3I8C A;  3EI1 B;  4O9D A;  3OW8 A;  2AGW A;  2OK6 A;  5H1M A;  2P9L C;  4G56 B;  2YNO A;  5I5M A;  3SHF A;  3AL9 A;  2AGL A;  1TBG A;  4PC0 A;  2GC7 A;  3DSM A;  3SFZ A;  4U7A A;  3UVM A;  4CC9 A;  2EBS A;  3JB9 L;  4N14 A;  1VYH C;  1SHY B;  3IIW A;  4A0B A;  3OKW A;  5K1C C;  2IUP A;  1K32 A;  3L4M D;  4ZOZ A;  2HKR A;  2H47 A;  1PBY B;  3J81 g;  2PM7 B;  3L4O D;  4J84 A;  2IUQ A;  2PM6 B;  1QNI A;  1XIP A;  2H9P A;  4TZ4 A;  2Z2P A;  3SBP A;  4O3U B;  3OTT A;  5EAM A;  3N0D A;  3JRP A;  3F3F A;  2PBI B;  3RSE C;  5IC7 A;  3JPX A;  5EMK B;  4ERQ A;  2CE8 A;  3I7O A;  5EMJ B;  5AJA A;  4X3E A;  4XYH A;  5H14 A;  4CI2 A;  4PSW B;  1MG2 A;  2O9K A;  3SBR A;  1A0R B;  3UKR C;  2P9S C;  3EG6 A;  1N6D A;  2W18 A;  4X60 B;  3HFQ A;  5HE2 B;  2XL2 A;  3EMH A;  4A08 A;  3F3P A;  4JXM A;  1SQ9 A;  4JT6 C;  1PI6 A;  1Q47 A;  1K8K C;  4BUJ C;  1OMW B;  5KDO B;  4J0X A;  4U1E I;  4GZ8 A;  4J0W A;  4ZOX A;  1PGU A;  4K3J B;  3BWS A;  1TYQ C;  2AGX A;  4PXW A;  4JD2 C;  3OKY A;  5HE3 B;  3PVU B;  2P9U C;  4LG8 A;  2B5N A;  4J78 A;  3EI2 B;  3JZG A;  4PSX B;  3NVX A;  1N6E A;  4FAV D;  5HYN B;  2QC5 A;  3UVN A;  3U4Y A;  3VA6 A;  4JSX C;  4AEZ A;  5EAP A;  2HYE A;  2OJY A;  1N6F A;  4OWR A;  1XKS A;  3RFG A;  4JSV C;  5CXB A;  3IKO A;  2GNQ A;  4J77 A;  5FKS A;  4A0A B;  3MXX A;  3FGB A;  4A11 B;  4YVD A;  4JSP C;  2J55 H;  1JMZ B;  2PM9 B;  2H6Q A;  2I3T A;  3SXT D;  5CXB B;  4GGC A;  5TEF A;  2IWF A;  4GGD A;  1RI6 A;  4GQB B;  4E5Z A;  5IT9 g;  1XHM A;  5AMS A;  2BBK H;  4X63 B;  3SVW D;  2HXC A;  3B7F A;  4E54 A;  5EAL A;  3RFH A;  2AH0 A;  1JMX B;  2CO0 A;  4ESG A;  3MKS B;  4EWR A;  2CN2 A;  5C2V B;  2CN3 A;  4A0B B;  2I0T A;  2H6N A;  3ZWL B;  2HES X;  5A2Q g;  3IIY A;  2GC4 A;  1PEV A;  2UZX B;  5K19 A;  2QXV A;  4H5I A;  3EI4 A;  4CY3 A;  3I89 A;  5FQD A;  3ULE C;  4BH6 A;  3OKT A;  2UZY B;  3NVQ A;  3E0C A;  2H6K A;  3PE7 A;  2YB8 B;  1B9Y A;  4CY2 A;  4J73 A;  1MDA H;  5EML B;  3EI4 B;  4QRJ A;  5CXC A;  3FM0 A;  1L0Q A;  2TRC B;  3PSL A;  2P9P C;  2HKM A;  4CI3 A;  5FXY A;  3JAM g;  4A09 A;  4ZOY A;  4ES0 A;  3RN1 D;  5GXH A;  2Z2N A;  5TEE A;  4FA4 D;  4HDJ A;  3V5W B;  1JJU B;  4PNK B;  3RN0 D;  2P9N C;  3OL2 A;  2J56 H;  4GM9 A; 
#chains in the Genus database with same CATH topology
 5EMM B;  2AGY A;  4J81 A;  2H68 A;  1VZ2 A;  3I8E A;  2YNP A;  3KRX B;  4GMB A;  5GXI A;  2YNN A;  4IA9 A;  4R7A B;  5FFO A;  4L3G D;  4PBY A;  3AFC A;  3OL2 B;  1BPO A;  5TDH B;  2XDW A;  4ZOV A;  4RE5 A;  4A08 B;  5AFU 3;  3I7K A;  3VH0 A;  5HQG A;  2EIE A;  3I7N A;  4PBZ A;  1SQJ A;  5TF2 A;  2YMU A;  1E8M A;  4GM8 A;  2P9I C;  4L9O A;  2HJB A;  3I7L A;  4MMY A;  2H9M A;  1JOF A;  1MG3 A;  4O3T B;  2QZP A;  4AMY A;  4FAN D;  2AGZ A;  4CY5 A;  3JRO A;  3OKY B;  4WK4 A;  1NR0 A;  1FWX A;  1UOO A;  3MKQ A;  3K6S A;  5IJ8 E;  2I0R A;  3QI0 A;  3SJL D;  5JWZ A;  5HE1 B;  3EWE A;  4FA5 D;  3QHY B;  1YFQ A;  5HE0 B;  2I0S A;  2XU7 A;  5FA5 B;  5GMK n;  3V4V A;  4I79 A;  4O1Q D;  4CI8 A;  4BL0 A;  3SCY A;  5CYK A;  4BP8 A;  4JT5 C;  2OK4 A;  3EU7 A;  3RRM C;  4Z8L A;  3A0F A;  3NID A;  5EM2 A;  2HJ4 A;  1P22 A;  4O45 A;  3AL8 A;  3O4I A;  3K27 A;  4AOW A;  5GSA A;  3EI1 A;  1S4U X;  2EIC A;  3C5M A;  3OF7 A;  2IWK A;  5THA A;  3C99 A;  4GGA A;  3PXT D;  4ZN4 A;  3GFC A;  4MK0 B;  3IUN A;  4CZY A;  3IJE A;  5EM2 B;  4FHL A;  5HDB A;  4AMZ A;  3IUL A;  2VDM A;  1C9L A;  2AQ5 A;  1E8N A;  2MTA H;  5M5R A;  4A2L A;  4Z7O A;  3NIG A;  4E5Z B;  3ZE2 A;  3IUM A;  3JZH A;  5EAR A;  4QQE A;  4L1Q D;  5IGO A;  2P9K C;  3O4J A;  5M61 A;  4XEI C;  3UVO A;  1R5M A;  1H2W A;  5I5I A;  1GOT B;  5C9Z B;  2YBA A;  3EQ7 A;  2VDO A;  1L5G A;  3RLM D;  3BG1 A;  1GG2 B;  4DNW A;  5M5U A;  3PSC B;  4ERY A;  2OVP B;  3J80 g;  4E54 B;  4O2W A;  2Z2O A;  3SMR A;  3KCI A;  4J79 A;  4WJK A;  2OVQ B;  1YR2 A;  4H5J A;  2AH1 A;  4DNV A;  2XZG A;  3DXM C;  1H2Y A;  4QAM A;  1GXR A;  3JZN A;  3MMY A;  4J8B A;  2EID A;  4JHN A;  4A7J A;  3VI4 A;  4BCB A;  3GRE A;  4LG9 A;  4NEN A;  1TYE A;  3CFS B;  3V9F A;  4J87 A;  3MZK A;  1U2V C;  4D0K A;  3K72 A;  1U4C A;  4OZU A;  3C9C A;  5H17 A;  2XL3 A;  2B4E A;  2OIZ A;  4GQ2 P;  2H14 A;  5SXM A;  2G9A A;  4NBM A;  1QFM A;  4D9S A;  3MUO A;  3FCS A;  3SLE D;  3RMZ D;  4G1M A;  5CXC B;  3I7P A;  4XYI A;  4J86 A;  3DM0 A;  3I7H A;  4Y7R A;  3C75 H;  1JV2 A;  2H3X A;  4A09 B;  4FB1 D;  4K3I D;  2G99 A;  2H9N A;  5FLX g;  3PVW B;  3CFV A;  2IAA A;  3MVD K;  2EIB A;  2XYI A;  2B5L A;  4GQ1 A;  4UI9 R;  4Y5R D;  3PXS D;  3VGZ A;  3DWL C;  3MZL A;  4CI1 A;  2H13 A;  3NVN A;  3W15 A;  4X61 B;  5C2W B;  3SN6 B;  4D6V A;  3UVL A;  2H9L A;  3F3G A;  1GOF A;  2Q7Q A;  4CZX A;  5IGQ A;  4QT8 A;  1GP2 B;  2CNX A;  4CZV A;  4A2M A;  2B5M A;  5I5J A;  3V7D B;  4J82 A;  4IRZ A;  1UOQ A;  3IJ0 A;  4AN0 A;  5E6R A;  3UVK A;  3DXK C;  1UOP A;  4Z7N A;  4G55 A;  3EI2 A;  5FKT A;  3K71 A;  3I2N A;  2I3S A;  2CE9 A;  3SBQ A;  4KFM B;  2IUR A;  5IJ7 E;  4QL1 A;  2J57 G;  3UKU C;  3EI3 A;  4FA1 D;  4FA9 D;  2CO0 C;  3AH8 B;  3PXW D;  5M5T A;  4FWW A;  1ERJ A;  3P4F A;  2IUV A;  3K26 A;  3FRX A;  4CY1 A;  3ODT A;  4A0A A;  4GM3 A;  4LGN A;  3EI3 B;  3IJ1 A;  4ERZ A;  5C92 A;  3KRW B;  4DNU A;  2OVR B;  1VE7 A;  5FKR A;  1K3I A;  4A11 A;  5FKQ A;  4IMM A;  3ZE1 A;  2PM9 A;  3SWS D;  4NSX A;  3ORV D;  4JSN C;  1OLZ A;  3CIK B;  3ZDX A;  3IJC A;  1B9X A;  3BG0 A;  2WQ8 A;  5CYK B;  4J8G A;  2VDL A;  4L3H D;  5B4W A;  2BCJ B;  3UR4 A;  2VDP A;  3N0E A;  3AL8 B;  1NEX B;  3I8C A;  3EI1 B;  5M5V A;  4O9D A;  3OW8 A;  2AGW A;  1M1X A;  2OK6 A;  1GOG A;  5H1M A;  2P9L C;  3IUJ A;  3ZDZ A;  4G56 B;  2HU5 A;  2YNO A;  5I5M A;  2VC2 A;  3SHF A;  3AL9 A;  2AGL A;  1TBG A;  4PC0 A;  2GC7 A;  3DSM A;  3SFZ A;  3GD1 I;  4U7A A;  3UVM A;  4WK0 A;  2EBS A;  4CC9 A;  3JB9 L;  4N14 A;  2BKL A;  1VYH C;  1SHY B;  3IIW A;  4A0B A;  3OKW A;  5K1C C;  5E6U A;  2IUP A;  1K32 A;  3L4M D;  4ZOZ A;  2HKR A;  3IUR A;  1H2Z A;  2H47 A;  2QR5 A;  1PBY B;  3J81 g;  2PM7 B;  3L4O D;  4L1M A;  4J84 A;  2IUQ A;  2PM6 B;  1QNI A;  1XIP A;  1GOH A;  2H9P A;  4TZ4 A;  2Z2P A;  5FFG A;  3SBP A;  4O3U B;  3OTT A;  4NC4 A;  5EAM A;  1E5T A;  3N0D A;  4AN1 A;  3JRP A;  1O6F A;  3F3F A;  2PBI B;  2XE4 A;  3RSE C;  5IC7 A;  3JPX A;  5EMK B;  4ERQ A;  5C86 A;  3FCU A;  2CE8 A;  3I7O A;  5EMJ B;  5AJA A;  3O4G A;  4X3E A;  1VE6 A;  4XYH A;  5H14 A;  4CI2 A;  4PSW B;  4UM8 A;  1MG2 A;  2O9K A;  3SBR A;  3IVM A;  1A0R B;  2HU8 A;  3UKR C;  2P9S C;  3EG6 A;  1N6D A;  2W18 A;  4X60 B;  3HFQ A;  5HE2 B;  2XL2 A;  3EMH A;  4A08 A;  3F3P A;  4JXM A;  1SQ9 A;  1PI6 A;  4JT6 C;  1Q47 A;  4O02 A;  1K8K C;  1UTC A;  1JTD B;  4BUJ C;  1OMW B;  5KDO B;  4J0X A;  4U1E I;  4GZ8 A;  2VDR A;  4J0W A;  4ZOX A;  1PGU A;  4K3J B;  3EQ9 A;  1O6G A;  3BWS A;  1TYQ C;  2AGX A;  4PXW A;  3VI3 A;  4JD2 C;  3DDU A;  3OKY A;  5HE3 B;  3PVU B;  2P9U C;  1A12 A;  4LG8 A;  2B5N A;  4J78 A;  3EI2 B;  3JZG A;  4PSX B;  3ZE0 A;  3NVX A;  1N6E A;  4G1E A;  4FAV D;  5HYN B;  2QC5 A;  4Z7Q A;  3UVN A;  3U4Y A;  3VA6 A;  4BCC A;  4JSX C;  4AEZ A;  5EAP A;  2HYE A;  2OJY A;  1N6F A;  4OWR A;  1XKS A;  3RFG A;  4JSV C;  5CXB A;  3IKO A;  2GNQ A;  4J77 A;  5FKS A;  4A0A B;  3T3P A;  3MXX A;  3FGB A;  4A11 B;  4YVD A;  4JSP C;  2J55 H;  1JMZ B;  2PM9 B;  2H6Q A;  2I3T A;  3SXT D;  3ZDY A;  4AX4 A;  5CXB B;  4GGC A;  3IUQ A;  5TEF A;  2IWF A;  4GGD A;  1RI6 A;  1C9I A;  4GQB B;  4E5Z A;  2JKX A;  5IT9 g;  3NIF A;  2VZ1 A;  1XHM A;  5AMS A;  1H2X A;  2BBK H;  4MMZ A;  4X63 B;  3SVW D;  3EQ8 A;  2HXC A;  4WK2 A;  3B7F A;  4E54 A;  5EAL A;  4UM9 A;  3RFH A;  2HU7 A;  2VDQ A;  1I2M B;  2AH0 A;  1JMX B;  3GC3 B;  2CO0 A;  4ESG A;  3MKS B;  4EWR A;  1U8C A;  2CN2 A;  3V4P A;  2CN3 A;  5C2V B;  4A0B B;  2I0T A;  4BP9 A;  2H6N A;  3ZWL B;  5M5S A;  2HES X;  2VDK A;  5E6S A;  5A2Q g;  3IIY A;  4BCD A;  2GC4 A;  1PEV A;  2UZX B;  5K19 A;  2QXV A;  4RE6 A;  3O4H A;  1T2X A;  1VZ3 A;  3EI4 A;  4H5I A;  4JHP C;  3I89 A;  5FQD A;  4CY3 A;  1QFS A;  3ULE C;  4BH6 A;  3OKT A;  2UZY B;  3NVQ A;  2VDN A;  3E0C A;  2H6K A;  3PE7 A;  2YB8 B;  1B9Y A;  3T3M A;  4CY2 A;  4J73 A;  1MDA H;  5EML B;  3EI4 B;  4QRJ A;  5CXC A;  3FM0 A;  1L0Q A;  2TRC B;  3PSL A;  4NAA A;  4MMX A;  2P9P C;  2HKM A;  2VZ3 A;  4CI3 A;  5FXY A;  3JAM g;  4A09 A;  4ZOY A;  4ES0 A;  3RN1 D;  5GXH A;  2Z2N A;  5TEE A;  4FA4 D;  4HDJ A;  3V5W B;  1JJU B;  4PNK B;  3RN0 D;  2P9N C;  3MUN A;  3OL2 A;  2J56 H;  4GM9 A; 
#chains in the Genus database with same CATH homology
 5EMM B;  2AGY A;  4J81 A;  2H68 A;  3I8E A;  3KRX B;  2YNP A;  4GMB A;  5GXI A;  2YNN A;  4IA9 A;  4R7A B;  4L3G D;  4PBY A;  3AFC A;  3OL2 B;  5TDH B;  4ZOV A;  4A08 B;  5AFU 3;  3I7K A;  3VH0 A;  5HQG A;  3I7N A;  4PBZ A;  1SQJ A;  5TF2 A;  2YMU A;  4GM8 A;  2P9I C;  4L9O A;  2HJB A;  3I7L A;  2H9M A;  1JOF A;  1MG3 A;  4O3T B;  4FAN D;  2AGZ A;  4CY5 A;  3JRO A;  3OKY B;  1NR0 A;  1FWX A;  3MKQ A;  5IJ8 E;  2I0R A;  3SJL D;  5JWZ A;  5HE1 B;  3EWE A;  4FA5 D;  1YFQ A;  5HE0 B;  2I0S A;  2XU7 A;  5FA5 B;  5GMK n;  4I79 A;  4O1Q D;  4CI8 A;  4BL0 A;  3SCY A;  5CYK A;  4JT5 C;  2OK4 A;  3EU7 A;  3RRM C;  4Z8L A;  3A0F A;  5EM2 A;  2HJ4 A;  1P22 A;  4O45 A;  3AL8 A;  3K27 A;  4AOW A;  5GSA A;  3EI1 A;  1S4U X;  3C5M A;  2IWK A;  5THA A;  3C99 A;  4GGA A;  3PXT D;  4ZN4 A;  3GFC A;  4MK0 B;  4CZY A;  5EM2 B;  4FHL A;  2AQ5 A;  2MTA H;  4A2L A;  4E5Z B;  3JZH A;  5EAR A;  4QQE A;  4L1Q D;  5IGO A;  2P9K C;  4XEI C;  3UVO A;  1R5M A;  5I5I A;  1GOT B;  5C9Z B;  2YBA A;  3RLM D;  3BG1 A;  1GG2 B;  3PSC B;  4ERY A;  2OVP B;  3J80 g;  4E54 B;  2Z2O A;  3SMR A;  4J79 A;  2OVQ B;  4H5J A;  2AH1 A;  3DXM C;  1GXR A;  3JZN A;  3MMY A;  4J8B A;  4A7J A;  3GRE A;  4LG9 A;  3CFS B;  3V9F A;  4J87 A;  3MZK A;  1U2V C;  4D0K A;  1U4C A;  4OZU A;  3C9C A;  5H17 A;  2XL3 A;  2B4E A;  2OIZ A;  4GQ2 P;  2H14 A;  5SXM A;  2G9A A;  3SLE D;  3RMZ D;  5CXC B;  3I7P A;  4XYI A;  4J86 A;  3DM0 A;  3I7H A;  4Y7R A;  3C75 H;  2H3X A;  4A09 B;  4FB1 D;  4K3I D;  2G99 A;  2H9N A;  5FLX g;  3PVW B;  3CFV A;  2IAA A;  2XYI A;  2B5L A;  4GQ1 A;  4UI9 R;  4Y5R D;  3PXS D;  3VGZ A;  3DWL C;  3MZL A;  4CI1 A;  2H13 A;  3NVN A;  3W15 A;  4X61 B;  5C2W B;  3SN6 B;  4D6V A;  3UVL A;  2H9L A;  3F3G A;  2Q7Q A;  4CZX A;  5IGQ A;  4QT8 A;  1GP2 B;  2CNX A;  4CZV A;  4A2M A;  2B5M A;  5I5J A;  3V7D B;  4J82 A;  3IJ0 A;  3UVK A;  3DXK C;  3EI2 A;  5FKT A;  3I2N A;  2I3S A;  2CE9 A;  3SBQ A;  4KFM B;  2IUR A;  5IJ7 E;  4QL1 A;  2J57 G;  3UKU C;  3EI3 A;  4FA1 D;  4FA9 D;  2CO0 C;  3AH8 B;  3PXW D;  4FWW A;  1ERJ A;  3P4F A;  2IUV A;  3K26 A;  3FRX A;  4CY1 A;  3ODT A;  4A0A A;  4GM3 A;  4LGN A;  3EI3 B;  3IJ1 A;  4ERZ A;  3KRW B;  2OVR B;  5FKR A;  4A11 A;  5FKQ A;  4IMM A;  2PM9 A;  3SWS D;  4NSX A;  3ORV D;  4JSN C;  1OLZ A;  3CIK B;  3IJC A;  1B9X A;  3BG0 A;  5CYK B;  4J8G A;  4L3H D;  5B4W A;  2BCJ B;  3UR4 A;  3N0E A;  3AL8 B;  1NEX B;  3I8C A;  3EI1 B;  4O9D A;  3OW8 A;  2AGW A;  2OK6 A;  5H1M A;  2P9L C;  4G56 B;  2YNO A;  5I5M A;  3SHF A;  3AL9 A;  2AGL A;  1TBG A;  4PC0 A;  2GC7 A;  3DSM A;  3SFZ A;  4U7A A;  3UVM A;  4CC9 A;  2EBS A;  3JB9 L;  4N14 A;  1VYH C;  1SHY B;  3IIW A;  4A0B A;  3OKW A;  5K1C C;  2IUP A;  1K32 A;  3L4M D;  4ZOZ A;  2HKR A;  2H47 A;  1PBY B;  3J81 g;  2PM7 B;  3L4O D;  4J84 A;  2IUQ A;  2PM6 B;  1QNI A;  1XIP A;  2H9P A;  4TZ4 A;  2Z2P A;  3SBP A;  4O3U B;  3OTT A;  5EAM A;  3N0D A;  3JRP A;  3F3F A;  2PBI B;  3RSE C;  5IC7 A;  3JPX A;  5EMK B;  4ERQ A;  2CE8 A;  3I7O A;  5EMJ B;  5AJA A;  4X3E A;  4XYH A;  5H14 A;  4CI2 A;  4PSW B;  1MG2 A;  2O9K A;  3SBR A;  1A0R B;  3UKR C;  2P9S C;  3EG6 A;  1N6D A;  2W18 A;  4X60 B;  3HFQ A;  5HE2 B;  2XL2 A;  3EMH A;  4A08 A;  3F3P A;  4JXM A;  1SQ9 A;  4JT6 C;  1PI6 A;  1Q47 A;  1K8K C;  4BUJ C;  1OMW B;  5KDO B;  4J0X A;  4U1E I;  4GZ8 A;  4J0W A;  4ZOX A;  1PGU A;  4K3J B;  3BWS A;  1TYQ C;  2AGX A;  4PXW A;  4JD2 C;  3OKY A;  5HE3 B;  3PVU B;  2P9U C;  4LG8 A;  2B5N A;  4J78 A;  3EI2 B;  3JZG A;  4PSX B;  3NVX A;  1N6E A;  4FAV D;  5HYN B;  2QC5 A;  3UVN A;  3U4Y A;  3VA6 A;  4JSX C;  4AEZ A;  5EAP A;  2HYE A;  2OJY A;  1N6F A;  4OWR A;  1XKS A;  3RFG A;  4JSV C;  5CXB A;  3IKO A;  2GNQ A;  4J77 A;  5FKS A;  4A0A B;  3MXX A;  3FGB A;  4A11 B;  4YVD A;  4JSP C;  2J55 H;  1JMZ B;  2PM9 B;  2H6Q A;  2I3T A;  3SXT D;  5CXB B;  4GGC A;  5TEF A;  2IWF A;  4GGD A;  1RI6 A;  4GQB B;  4E5Z A;  5IT9 g;  1XHM A;  5AMS A;  2BBK H;  4X63 B;  3SVW D;  2HXC A;  3B7F A;  4E54 A;  5EAL A;  3RFH A;  2AH0 A;  1JMX B;  2CO0 A;  4ESG A;  3MKS B;  4EWR A;  2CN2 A;  5C2V B;  2CN3 A;  4A0B B;  2I0T A;  2H6N A;  3ZWL B;  2HES X;  5A2Q g;  3IIY A;  2GC4 A;  1PEV A;  2UZX B;  5K19 A;  2QXV A;  4H5I A;  3EI4 A;  4CY3 A;  3I89 A;  5FQD A;  3ULE C;  4BH6 A;  3OKT A;  2UZY B;  3NVQ A;  3E0C A;  2H6K A;  3PE7 A;  2YB8 B;  1B9Y A;  4CY2 A;  4J73 A;  1MDA H;  5EML B;  3EI4 B;  4QRJ A;  5CXC A;  3FM0 A;  1L0Q A;  2TRC B;  3PSL A;  2P9P C;  2HKM A;  4CI3 A;  5FXY A;  3JAM g;  4A09 A;  4ZOY A;  4ES0 A;  3RN1 D;  5GXH A;  2Z2N A;  5TEE A;  4FA4 D;  4HDJ A;  3V5W B;  1JJU B;  4PNK B;  3RN0 D;  2P9N C;  3OL2 A;  2J56 H;  4GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...