4GMBA

Crystal structure of human wd repeat domain 5 with compound mm-402
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
307
structure length
307
Chain Sequence
PTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Discovery of a Highly Potent, Cell-Permeable Macrocyclic Peptidomimetic (MM-589) Targeting the WD Repeat Domain 5 Protein (WDR5)-Mixed Lineage Leukemia (MLL) Protein-Protein Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 95
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gmbA00
3SFZA 3EI3A 3N0DA 5CXCB 3K26A 3EI2A 2AGXA 5H14A 4A0AA 3GFCA 3EWEA 4J86A 5FKQA 3F3PA 3AH8B 2W18A 3NVXA 4O1QD 1GOTB 4GGDA 3MZKA 2G99A 3NVNA 5HE2B 2H13A 3IJ0A 2O9KA 3FGBA 2H6QA 3NVQA 4QQEA 4ES0A 3PVUB 2I0RA 2P9LC 3K27A 3SBRA 1JMXB 3F3FA 3CFSB 3RFGA 3OKWA 3UKUC 5SXMA 4GGCA 2PBIB 2H3XA 3IIYA 5EM2A 4FA5D 2B5MA 2CO0A 4GM9A 2GNQA 1SQ9A 3C75H 3GREA 2IUPA 2AH0A 4PBYA 5FKTA 3AL8B 3DXMC 2CO0C 3PSCB 5KDOB 2Z2NA 2I0TA 4LG8A 1K32A 4UI9R 5FKSA 4A09B 2UZYB 2HXCA 4ZOYA 5GSAA 4E54A 3SXTD 1SHYB 2GC4A 4OWRA 3I7OA 4J77A 5H1MA 3W15A 3IIWA 2IAAA 2OK6A 4PSXB 5CYKB 4A2LA 3EI1B 5CXBA 4CI3A 1ERJA 3EU7A 4A08B 4A0BB 4XYHA 3N0EA 3RLMD 2PM9A 2J56H 2OVRB 4CY3A 5IJ7E 4A7JA 4ESGA 5EAPA 5I5IA 4FHLA 2YNNA 1MG3A 4PNKB 4JSXC 3SMRA 5IJ8E 4X63B 3EI3B 3IJ1A 2XU7A 4X3EA 5HE3B 3EI4A 3EI2B 4J0XA 2OVPB 4A0AB 3JB9L 4PBZA 5GMKn 4H5JA 4PSWB 1YFQA 4K3JB 3I2NA 4XEIC 3OKYA 3JRPA 4A11A 3I7HA 3UKRC 1XKSA 4MK0B 4JXMA 3PXSD 4H5IA 2H9NA 3IKOA 5B4WA 2B4EA 3CIKB 4PXWA 4R7AB 1JMZB 3SBQA 3VH0A 3RN1D 2GC7A 3RSEC 3PE7A 4J78A 3L4MD 4D0KA 4BUJC 3PVWB 4D6VA 3JROA 5IGQA 4FAND 3A0FA 2HKRA 3BG0A 5EM2B 3C9CA 3MKSB 1SQJA 3HFQA 5HYNB 3DM0A 2OK4A 2OIZA 4ERZA 5C2VB 4OZUA 3CFVA 5IGOA 3SJLD 3PXTD 4JD2C 2CN3A 5FA5B 2CE9A 4E54B 3BG1A 4CY2A 3KRWB 4ZN4A 4BH6A 4CZXA 2XL3A 2I0SA 3DWLC 3AL9A 4U1EI 2AGYA 5CXBB 4JT6C 4CZYA 3SVWD 2IUVA 4JSPC 5EALA 2PM9B 2IWFA 5EMJB 3AFCA 4K3ID 2TRCB 4J81A 2H6NA 4CC9A 1RI6A 3DSMA 1TYQC 1L0QA 4KFMB 3JZHA 3ORVD 1MDAH 4GQ1A 3JZNA 3I7PA 2OJYA 4ERQA 5THAA 3EI4B 1N6EA 4CY1A 4Y7RA 4J82A 4CY5A 2YNPA 3OKYB 2YNOA 3FRXA 4O3UB 4ERYA 4HDJA 2P9IC 2QXVA 4A11B 2H9MA 2Z2OA 3OL2A 4ZOXA 3C99A 1OLZA 3ODTA 4JSVC 3SLED 3SCYA 3I8CA 4LGNA 3I8EA 5AMSA 2UZXB 5AJAA 2Z2PA 4QT8A 4L3HD 3SBPA 5FQDA 3RN0D 4JSNC 5GXIA 3EG6A 4GGAA 4X61B 4J79A 1K8KC 3F3GA 1NR0A 4FA1D 4CI2A 2OVQB 4IA9A 2AH1A 4GQBB 2PM6B 3SN6B 2P9NC 1JOFA 5TDHB 3V7DB 1N6FA 5EMLB 3MZLA 3ULEC 2YB8B 4G56B 5I5JA 2HYEA 4TZ4A 4ZOZA 2H47A 1B9YA 2HJBA 5IT9g 3E0CA 4I79A 4CZVA 3MMYA 1MG2A 4L3GD 2EBSA 2XYIA 2CNXA 1JJUB 3BWSA 5TEEA 3VGZA 4FWWA 3JAMg 3C5MA 1PEVA 3OTTA 5H17A 2I3TA 3U4YA 5EAMA 3RMZD 5C2WB 1A0RB 4Y5RD 2BBKH 1PI6A 2BCJB 2MTAH 4GQ2P 3JZGA 4J84A 3J81g 4L1QD 1GG2B 2AGLA 1GXRA 4FAVD 2AGZA 1U4CA 4O3TB 5FLXg 2J57G 4FB1D 2P9KC 4J0WA 2HKMA 2QC5A 5EARA 3UR4A 3V9FA 5K19A 4QL1A 3OL2B 4XYIA 1XHMA 4EWRA 3I7NA 5EMMB 2P9UC 2H68A 2AGWA 2H9LA 5FKRA 3I7KA 1TBGA 4J8BA 4A2MA 4L9OA 3JPXA 4CI8A 4CI1A 1FWXA 3UVLA 2B5NA 2B5LA 1U2VC 4GM8A 3P4FA 5CXCA 2HESX 4FA9D 1XIPA 5GXHA 3OKTA 4J87A 2YBAA 4GM3A 4Z8LA 2XL2A 4BL0A 2H9PA 4E5ZB 4ZOVA 3UVNA 5HE1B 4O9DA 3RFHA 1GP2B 2IURA 4FA4D 2J55H 5EMKB 1OMWB 3FM0A 5TF2A 3I89A 2H14A 4LG9A 4N14A 5TEFA 2CN2A 1S4UX 4J8GA 3DXKC 3L4OD 5FXYA 3V5WB 4U7AA 3SHFA 2HJ4A 4X60B 1R5MA 3J80g 1PGUA 2IUQA 4GMBA 2P9SC 5C9ZB 1NEXB 1QNIA 3KRXB 5HE0B 4J73A 3UVMA 3B7FA 4E5ZA 1P22A 3AL8A 4O45A 1Q47A 5JWZA 5IC7A 4A09A 4AEZA 4YVDA 3MXXA 2Q7QA 2H6KA 2P9PC 3UVOA 2IWKA 3IJCA 4GZ8A 4NSXA 3VA6A 3MKQA 2AQ5A 5K1CC 3RRMC 5CYKA 3EI1A 4IMMA 2PM7B 4JT5C 4A08A 4QRJA 4A0BA 3OW8A 1PBYB 5HQGA 1N6DA 4PC0A 2CE8A 2YMUA 2I3SA 3PSLA 3ZWLB 1VYHC 5I5MA 3SWSD 2G9AA 1B9XA 4AOWA 3EMHA 3UVKA 5A2Qg 3PXWD 5AFU3 3I7LA
chains in the Genus database with same CATH superfamily
3OF7A 3SFZA 3EI3A 3N0DA 5CXCB 1C9LA 3K26A 1E8MA 3EI2A 2AGXA 5H14A 4A0AA 3GFCA 3EWEA 2XE4A 4J86A 5FKQA 3F3PA 4DNVA 3AH8B 2W18A 3NVXA 4O1QD 1GOTB 2QZPA 2VDMA 4GGDA 4BCDA 3MZKA 2G99A 3NVNA 5HE2B 2H13A 1O6FA 3IJ0A 2O9KA 3FGBA 4WK4A 2H6QA 3NVQA 4QQEA 4ES0A 3PVUB 1U8CA 2I0RA 2P9LC 3K27A 3MUOA 4WJKA 3SBRA 1JMXB 3F3FA 3CFSB 3RFGA 3IUMA 3OKWA 3UKUC 5SXMA 4GGCA 1H2WA 2PBIB 2H3XA 1VE6A 3IIYA 5EM2A 2B5MA 2CO0A 4GM9A 2GNQA 4FA5D 5M5UA 1SQ9A 5FFGA 3C75H 3GREA 2IUPA 2AH0A 4PBYA 5FKTA 3AL8B 3DXMC 2CO0C 3PSCB 5KDOB 2Z2NA 2I0TA 4LG8A 1K32A 4UI9R 5FKSA 4A09B 2UZYB 2HXCA 3IUQA 4ZOYA 5GSAA 4E54A 3SXTD 1SHYB 2GC4A 3IURA 3I7OA 4OWRA 4J77A 5H1MA 3W15A 5E6UA 3IIWA 2IAAA 2OK6A 4PSXB 3O4HA 5CYKB 4A2LA 3EI1B 5CXBA 4CI3A 4BCCA 1ERJA 3EU7A 4AX4A 5C86A 4A08B 4A0BB 4XYHA 3N0EA 3RLMD 2PM9A 2J56H 2VC2A 2OVRB 1VE7A 4CY3A 4JHPC 5IJ7E 4A7JA 4ESGA 5EAPA 2HU7A 5I5IA 4FHLA 2YNNA 1MG3A 4PNKB 5HDBA 4JSXC 3SMRA 5IJ8E 5M61A 4X63B 3EI3B 3IJ1A 2HU8A 2XU7A 4X3EA 5HE3B 3EI4A 3NIDA 3EI2B 1K3IA 4J0XA 2OVPB 4A0AB 3JB9L 4PBZA 5GMKn 1H2ZA 3ZDYA 4H5JA 4PSWB 1YFQA 4K3JB 3I2NA 4XEIC 3OKYA 2VZ3A 3QHYB 3JRPA 4A11A 3I7HA 3UKRC 1XKSA 2EICA 4MK0B 3IUJA 3NIGA 3PXSD 4H5IA 4JXMA 2H9NA 3IKOA 5B4WA 2B4EA 4NC4A 3CIKB 4PXWA 4R7AB 1JMZB 3SBQA 3VH0A 3RN1D 2GC7A 3RSEC 2VZ1A 3PE7A 4G55A 4J78A 3L4MD 4D0KA 4AN0A 4BUJC 3PVWB 3ZE0A 4D6VA 3JROA 5IGQA 4FAND 3A0FA 4DNUA 2HKRA 3BG0A 5EM2B 3C9CA 3MKSB 3K6SA 1SQJA 3HFQA 5HYNB 3DM0A 2OK4A 2OIZA 4ERZA 3T3PA 1E8NA 5C2VB 4OZUA 3CFVA 1GOHA 5IGOA 3SJLD 3PXTD 4JD2C 2CN3A 5FA5B 3VI4A 2CE9A 1UOQA 1UTCA 4E54B 3BG1A 4CY2A 3KRWB 4ZN4A 4BH6A 4CZXA 4MMZA 2XL3A 2I0SA 4L1MA 3DWLC 3AL9A 4U1EI 2AGYA 5CXBB 3O4GA 4JT6C 4WK2A 4CZYA 3SVWD 2IUVA 4JSPC 5EALA 2PM9B 2IWFA 5EMJB 3AFCA 4K3ID 2TRCB 4J81A 2H6NA 3IVMA 3ZE1A 4CC9A 1RI6A 3DSMA 1TYQC 1L0QA 4KFMB 3JZHA 3ORVD 1MDAH 4GQ1A 4BCBA 3JZNA 3I7PA 2OJYA 4ERQA 5THAA 3GC3B 3EI4B 4UM9A 1N6EA 4CY1A 4Y7RA 4J82A 4CY5A 2YNPA 3OKYB 2YNOA 3FRXA 4O3UB 4ERYA 4HDJA 2P9IC 2QXVA 4A11B 2H9MA 2Z2OA 3OL2A 1E5TA 4ZOXA 2EIBA 3C99A 1OLZA 1JTDB 5FFOA 3ODTA 4JSVC 3SLED 3SCYA 2BKLA 3I8CA 3QI0A 4LGNA 2EIDA 3I8EA 5AMSA 2UZXB 5AJAA 2Z2PA 4QT8A 4L3HD 3SBPA 5FQDA 3RN0D 4G1MA 4JSNC 5GXIA 3EG6A 4AMYA 4GGAA 4X61B 1VZ3A 4J79A 1K8KC 3NIFA 3F3GA 1NR0A 4FA1D 4CI2A 2OVQB 4IA9A 2JKXA 2AH1A 4GQBB 4RE6A 1H2XA 3MVDK 2PM6B 3SN6B 1C9IA 2P9NC 1JOFA 1VZ2A 5TDHB 3V7DB 3GD1I 1N6FA 5EMLB 3MZLA 3ULEC 2YB8B 4G56B 4AN1A 3EQ8A 1L5GA 5I5JA 2HYEA 3K71A 4TZ4A 4ZOZA 2H47A 1B9YA 2HJBA 5IT9g 3E0CA 4I79A 4CZVA 4UM8A 3MMYA 1MG2A 4G1EA 4L3GD 2EBSA 3T3MA 5M5VA 1GOGA 2XYIA 2CNXA 1JJUB 3BWSA 4MMYA 3K72A 5TEEA 3VGZA 5M5TA 4FWWA 3JAMg 3C5MA 1PEVA 3OTTA 5H17A 2I3TA 5M5SA 3U4YA 5EAMA 2HU5A 3RMZD 5C92A 1QFSA 5C2WB 1A0RB 2VDOA 4Y5RD 2BBKH 1PI6A 2BCJB 2MTAH 4GQ2P 3JZGA 1BPOA 4J84A 5E6SA 3J81g 4L1QD 1GG2B 1T2XA 2AGLA 3ZE2A 1GXRA 2XZGA 3FCUA 4FAVD 4O02A 1H2YA 2AGZA 1A12A 1U4CA 4O3TB 5FLXg 2J57G 2VDQA 4NBMA 2P9KC 4FB1D 4J0WA 2HKMA 2VDNA 2QC5A 5EARA 3UR4A 1GOFA 3V9FA 3O4JA 4IRZA 5K19A 4QL1A 3OL2B 4DNWA 4XYIA 1M1XA 1XHMA 4EWRA 3I7NA 5EMMB 2P9UC 2H68A 2AGWA 2H9LA 5FKRA 3I7KA 1TBGA 4J8BA 4A2MA 4L9OA 3JPXA 4CI8A 4CI1A 2WQ8A 3ZDXA 4RE5A 1FWXA 3UVLA 2B5NA 2B5LA 1U2VC 1YR2A 3EQ7A 4GM8A 4QAMA 4O2WA 4MMXA 3P4FA 2QR5A 5CXCA 2HESX 5E6RA 4FA9D 3EQ9A 4BP8A 1XIPA 5GXHA 4WK0A 3OKTA 4J87A 2YBAA 1O6GA 4Z7OA 1I2MB 4GM3A 3FCSA 4Z8LA 4BP9A 2XL2A 4BL0A 2H9PA 4E5ZB 4ZOVA 3UVNA 5HE1B 3O4IA 4O9DA 3RFHA 2VDPA 2VDLA 1QFMA 1GP2B 2IURA 4FA4D 2J55H 5EMKB 1OMWB 3FM0A 5TF2A 3I89A 2EIEA 2H14A 4LG9A 4N14A 5TEFA 2CN2A 1S4UX 4J8GA 3V4VA 3DXKC 3L4OD 5FXYA 3ZDZA 3V5WB 4U7AA 1JV2A 3SHFA 2HJ4A 4X60B 1R5MA 4D9SA 3J80g 1PGUA 3DDUA 2IUQA 4GMBA 5M5RA 2P9SC 1UOOA 5C9ZB 1NEXB 3KCIA 1QNIA 3KRXB 3V4PA 5HE0B 4J73A 3UVMA 3VI3A 3B7FA 4E5ZA 1P22A 3AL8A 4O45A 1TYEA 1Q47A 3IULA 5JWZA 5IC7A 4A09A 4AEZA 4YVDA 3MXXA 2Q7QA 4AMZA 3IUNA 2H6KA 1UOPA 2P9PC 3UVOA 2IWKA 2VDRA 3IJCA 4Z7NA 4GZ8A 4NSXA 3VA6A 2XDWA 3MKQA 4NAAA 2AQ5A 5K1CC 3MUNA 3RRMC 5CYKA 3EI1A 2VDKA 4IMMA 2PM7B 4JHNA 4JT5C 4A08A 4QRJA 4A0BA 3OW8A 1PBYB 5HQGA 1N6DA 4PC0A 2CE8A 2YMUA 2I3SA 3PSLA 3ZWLB 1VYHC 5I5MA 3SWSD 2G9AA 1B9XA 4AOWA 3IJEA 3EMHA 3UVKA 5A2Qg 3PXWD 5AFU3 4Z7QA 4NENA 3I7LA
chains in the Genus database with same CATH topology
3SFZA 3EI3A 3N0DA 5CXCB 3K26A 3EI2A 2AGXA 5H14A 4A0AA 3GFCA 3EWEA 4J86A 5FKQA 3F3PA 3AH8B 2W18A 3NVXA 4O1QD 1GOTB 4GGDA 3MZKA 2G99A 3NVNA 5HE2B 2H13A 3IJ0A 2O9KA 3FGBA 2H6QA 3NVQA 4QQEA 4ES0A 3PVUB 2I0RA 2P9LC 3K27A 3SBRA 1JMXB 3F3FA 3CFSB 3RFGA 3OKWA 3UKUC 5SXMA 4GGCA 2PBIB 2H3XA 3IIYA 5EM2A 4FA5D 2B5MA 2CO0A 4GM9A 2GNQA 1SQ9A 3C75H 3GREA 2IUPA 2AH0A 4PBYA 5FKTA 3AL8B 3DXMC 2CO0C 3PSCB 5KDOB 2Z2NA 2I0TA 4LG8A 1K32A 4UI9R 5FKSA 4A09B 2UZYB 2HXCA 4ZOYA 5GSAA 4E54A 3SXTD 1SHYB 2GC4A 4OWRA 3I7OA 4J77A 5H1MA 3W15A 3IIWA 2IAAA 2OK6A 4PSXB 5CYKB 4A2LA 3EI1B 5CXBA 4CI3A 1ERJA 3EU7A 4A08B 4A0BB 4XYHA 3N0EA 3RLMD 2PM9A 2J56H 2OVRB 4CY3A 5IJ7E 4A7JA 4ESGA 5EAPA 5I5IA 4FHLA 2YNNA 1MG3A 4PNKB 4JSXC 3SMRA 5IJ8E 4X63B 3EI3B 3IJ1A 2XU7A 4X3EA 5HE3B 3EI4A 3EI2B 4J0XA 2OVPB 4A0AB 3JB9L 4PBZA 5GMKn 4H5JA 4PSWB 1YFQA 4K3JB 3I2NA 4XEIC 3OKYA 3JRPA 4A11A 3I7HA 3UKRC 1XKSA 4MK0B 4JXMA 3PXSD 4H5IA 2H9NA 3IKOA 5B4WA 2B4EA 3CIKB 4PXWA 4R7AB 1JMZB 3SBQA 3VH0A 3RN1D 2GC7A 3RSEC 3PE7A 4J78A 3L4MD 4D0KA 4BUJC 3PVWB 4D6VA 3JROA 5IGQA 4FAND 3A0FA 2HKRA 3BG0A 5EM2B 3C9CA 3MKSB 1SQJA 3HFQA 5HYNB 3DM0A 2OK4A 2OIZA 4ERZA 5C2VB 4OZUA 3CFVA 5IGOA 3SJLD 3PXTD 4JD2C 2CN3A 5FA5B 2CE9A 4E54B 3BG1A 4CY2A 3KRWB 4ZN4A 4BH6A 4CZXA 2XL3A 2I0SA 3DWLC 3AL9A 4U1EI 2AGYA 5CXBB 4JT6C 4CZYA 3SVWD 2IUVA 4JSPC 5EALA 2PM9B 2IWFA 5EMJB 3AFCA 4K3ID 2TRCB 4J81A 2H6NA 4CC9A 1RI6A 3DSMA 1TYQC 1L0QA 4KFMB 3JZHA 3ORVD 1MDAH 4GQ1A 3JZNA 3I7PA 2OJYA 4ERQA 5THAA 3EI4B 1N6EA 4CY1A 4Y7RA 4J82A 4CY5A 2YNPA 3OKYB 2YNOA 3FRXA 4O3UB 4ERYA 4HDJA 2P9IC 2QXVA 4A11B 2H9MA 2Z2OA 3OL2A 4ZOXA 3C99A 1OLZA 3ODTA 4JSVC 3SLED 3SCYA 3I8CA 4LGNA 3I8EA 5AMSA 2UZXB 5AJAA 2Z2PA 4QT8A 4L3HD 3SBPA 5FQDA 3RN0D 4JSNC 5GXIA 3EG6A 4GGAA 4X61B 4J79A 1K8KC 3F3GA 1NR0A 4FA1D 4CI2A 2OVQB 4IA9A 2AH1A 4GQBB 2PM6B 3SN6B 2P9NC 1JOFA 5TDHB 3V7DB 1N6FA 5EMLB 3MZLA 3ULEC 2YB8B 4G56B 5I5JA 2HYEA 4TZ4A 4ZOZA 2H47A 1B9YA 2HJBA 5IT9g 3E0CA 4I79A 4CZVA 3MMYA 1MG2A 4L3GD 2EBSA 2XYIA 2CNXA 1JJUB 3BWSA 5TEEA 3VGZA 4FWWA 3JAMg 3C5MA 1PEVA 3OTTA 5H17A 2I3TA 3U4YA 5EAMA 3RMZD 5C2WB 1A0RB 4Y5RD 2BBKH 1PI6A 2BCJB 2MTAH 4GQ2P 3JZGA 4J84A 3J81g 4L1QD 1GG2B 2AGLA 1GXRA 4FAVD 2AGZA 1U4CA 4O3TB 5FLXg 2J57G 4FB1D 2P9KC 4J0WA 2HKMA 2QC5A 5EARA 3UR4A 3V9FA 5K19A 4QL1A 3OL2B 4XYIA 1XHMA 4EWRA 3I7NA 5EMMB 2P9UC 2H68A 2AGWA 2H9LA 5FKRA 3I7KA 1TBGA 4J8BA 4A2MA 4L9OA 3JPXA 4CI8A 4CI1A 1FWXA 3UVLA 2B5NA 2B5LA 1U2VC 4GM8A 3P4FA 5CXCA 2HESX 4FA9D 1XIPA 5GXHA 3OKTA 4J87A 2YBAA 4GM3A 4Z8LA 2XL2A 4BL0A 2H9PA 4E5ZB 4ZOVA 3UVNA 5HE1B 4O9DA 3RFHA 1GP2B 2IURA 4FA4D 2J55H 5EMKB 1OMWB 3FM0A 5TF2A 3I89A 2H14A 4LG9A 4N14A 5TEFA 2CN2A 1S4UX 4J8GA 3DXKC 3L4OD 5FXYA 3V5WB 4U7AA 3SHFA 2HJ4A 4X60B 1R5MA 3J80g 1PGUA 2IUQA 4GMBA 2P9SC 5C9ZB 1NEXB 1QNIA 3KRXB 5HE0B 4J73A 3UVMA 3B7FA 4E5ZA 1P22A 3AL8A 4O45A 1Q47A 5JWZA 5IC7A 4A09A 4AEZA 4YVDA 3MXXA 2Q7QA 2H6KA 2P9PC 3UVOA 2IWKA 3IJCA 4GZ8A 4NSXA 3VA6A 3MKQA 2AQ5A 5K1CC 3RRMC 5CYKA 3EI1A 4IMMA 2PM7B 4JT5C 4A08A 4QRJA 4A0BA 3OW8A 1PBYB 5HQGA 1N6DA 4PC0A 2CE8A 2YMUA 2I3SA 3PSLA 3ZWLB 1VYHC 5I5MA 3SWSD 2G9AA 1B9XA 4AOWA 3EMHA 3UVKA 5A2Qg 3PXWD 5AFU3 3I7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFZ A;  3EI3 A;  3N0D A;  5CXC B;  3K26 A;  3EI2 A;  2AGX A;  5H14 A;  4A0A A;  3GFC A;  3EWE A;  4J86 A;  5FKQ A;  3F3P A;  3AH8 B;  2W18 A;  3NVX A;  4O1Q D;  1GOT B;  4GGD A;  3MZK A;  2G99 A;  3NVN A;  5HE2 B;  2H13 A;  3IJ0 A;  2O9K A;  3FGB A;  2H6Q A;  3NVQ A;  4QQE A;  4ES0 A;  3PVU B;  2I0R A;  2P9L C;  3K27 A;  3SBR A;  1JMX B;  3F3F A;  3CFS B;  3RFG A;  3OKW A;  3UKU C;  5SXM A;  4GGC A;  2PBI B;  2H3X A;  3IIY A;  5EM2 A;  4FA5 D;  2B5M A;  2CO0 A;  4GM9 A;  2GNQ A;  1SQ9 A;  3C75 H;  3GRE A;  2IUP A;  2AH0 A;  4PBY A;  5FKT A;  3AL8 B;  3DXM C;  2CO0 C;  3PSC B;  5KDO B;  2Z2N A;  2I0T A;  4LG8 A;  1K32 A;  4UI9 R;  5FKS A;  4A09 B;  2UZY B;  2HXC A;  4ZOY A;  5GSA A;  4E54 A;  3SXT D;  1SHY B;  2GC4 A;  4OWR A;  3I7O A;  4J77 A;  5H1M A;  3W15 A;  3IIW A;  2IAA A;  2OK6 A;  4PSX B;  5CYK B;  4A2L A;  3EI1 B;  5CXB A;  4CI3 A;  1ERJ A;  3EU7 A;  4A08 B;  4A0B B;  4XYH A;  3N0E A;  3RLM D;  2PM9 A;  2J56 H;  2OVR B;  4CY3 A;  5IJ7 E;  4A7J A;  4ESG A;  5EAP A;  5I5I A;  4FHL A;  2YNN A;  1MG3 A;  4PNK B;  4JSX C;  3SMR A;  5IJ8 E;  4X63 B;  3EI3 B;  3IJ1 A;  2XU7 A;  4X3E A;  5HE3 B;  3EI4 A;  3EI2 B;  4J0X A;  2OVP B;  4A0A B;  3JB9 L;  4PBZ A;  5GMK n;  4H5J A;  4PSW B;  1YFQ A;  4K3J B;  3I2N A;  4XEI C;  3OKY A;  3JRP A;  4A11 A;  3I7H A;  3UKR C;  1XKS A;  4MK0 B;  4JXM A;  3PXS D;  4H5I A;  2H9N A;  3IKO A;  5B4W A;  2B4E A;  3CIK B;  4PXW A;  4R7A B;  1JMZ B;  3SBQ A;  3VH0 A;  3RN1 D;  2GC7 A;  3RSE C;  3PE7 A;  4J78 A;  3L4M D;  4D0K A;  4BUJ C;  3PVW B;  4D6V A;  3JRO A;  5IGQ A;  4FAN D;  3A0F A;  2HKR A;  3BG0 A;  5EM2 B;  3C9C A;  3MKS B;  1SQJ A;  3HFQ A;  5HYN B;  3DM0 A;  2OK4 A;  2OIZ A;  4ERZ A;  5C2V B;  4OZU A;  3CFV A;  5IGO A;  3SJL D;  3PXT D;  4JD2 C;  2CN3 A;  5FA5 B;  2CE9 A;  4E54 B;  3BG1 A;  4CY2 A;  3KRW B;  4ZN4 A;  4BH6 A;  4CZX A;  2XL3 A;  2I0S A;  3DWL C;  3AL9 A;  4U1E I;  2AGY A;  5CXB B;  4JT6 C;  4CZY A;  3SVW D;  2IUV A;  4JSP C;  5EAL A;  2PM9 B;  2IWF A;  5EMJ B;  3AFC A;  4K3I D;  2TRC B;  4J81 A;  2H6N A;  4CC9 A;  1RI6 A;  3DSM A;  1TYQ C;  1L0Q A;  4KFM B;  3JZH A;  3ORV D;  1MDA H;  4GQ1 A;  3JZN A;  3I7P A;  2OJY A;  4ERQ A;  5THA A;  3EI4 B;  1N6E A;  4CY1 A;  4Y7R A;  4J82 A;  4CY5 A;  2YNP A;  3OKY B;  2YNO A;  3FRX A;  4O3U B;  4ERY A;  4HDJ A;  2P9I C;  2QXV A;  4A11 B;  2H9M A;  2Z2O A;  3OL2 A;  4ZOX A;  3C99 A;  1OLZ A;  3ODT A;  4JSV C;  3SLE D;  3SCY A;  3I8C A;  4LGN A;  3I8E A;  5AMS A;  2UZX B;  5AJA A;  2Z2P A;  4QT8 A;  4L3H D;  3SBP A;  5FQD A;  3RN0 D;  4JSN C;  5GXI A;  3EG6 A;  4GGA A;  4X61 B;  4J79 A;  1K8K C;  3F3G A;  1NR0 A;  4FA1 D;  4CI2 A;  2OVQ B;  4IA9 A;  2AH1 A;  4GQB B;  2PM6 B;  3SN6 B;  2P9N C;  1JOF A;  5TDH B;  3V7D B;  1N6F A;  5EML B;  3MZL A;  3ULE C;  2YB8 B;  4G56 B;  5I5J A;  2HYE A;  4TZ4 A;  4ZOZ A;  2H47 A;  1B9Y A;  2HJB A;  5IT9 g;  3E0C A;  4I79 A;  4CZV A;  3MMY A;  1MG2 A;  4L3G D;  2EBS A;  2XYI A;  2CNX A;  1JJU B;  3BWS A;  5TEE A;  3VGZ A;  4FWW A;  3JAM g;  3C5M A;  1PEV A;  3OTT A;  5H17 A;  2I3T A;  3U4Y A;  5EAM A;  3RMZ D;  5C2W B;  1A0R B;  4Y5R D;  2BBK H;  1PI6 A;  2BCJ B;  2MTA H;  4GQ2 P;  3JZG A;  4J84 A;  3J81 g;  4L1Q D;  1GG2 B;  2AGL A;  1GXR A;  4FAV D;  2AGZ A;  1U4C A;  4O3T B;  5FLX g;  2J57 G;  4FB1 D;  2P9K C;  4J0W A;  2HKM A;  2QC5 A;  5EAR A;  3UR4 A;  3V9F A;  5K19 A;  4QL1 A;  3OL2 B;  4XYI A;  1XHM A;  4EWR A;  3I7N A;  5EMM B;  2P9U C;  2H68 A;  2AGW A;  2H9L A;  5FKR A;  3I7K A;  1TBG A;  4J8B A;  4A2M A;  4L9O A;  3JPX A;  4CI8 A;  4CI1 A;  1FWX A;  3UVL A;  2B5N A;  2B5L A;  1U2V C;  4GM8 A;  3P4F A;  5CXC A;  2HES X;  4FA9 D;  1XIP A;  5GXH A;  3OKT A;  4J87 A;  2YBA A;  4GM3 A;  4Z8L A;  2XL2 A;  4BL0 A;  2H9P A;  4E5Z B;  4ZOV A;  3UVN A;  5HE1 B;  4O9D A;  3RFH A;  1GP2 B;  2IUR A;  4FA4 D;  2J55 H;  5EMK B;  1OMW B;  3FM0 A;  5TF2 A;  3I89 A;  2H14 A;  4LG9 A;  4N14 A;  5TEF A;  2CN2 A;  1S4U X;  4J8G A;  3DXK C;  3L4O D;  5FXY A;  3V5W B;  4U7A A;  3SHF A;  2HJ4 A;  4X60 B;  1R5M A;  3J80 g;  1PGU A;  2IUQ A;  4GMB A;  2P9S C;  5C9Z B;  1NEX B;  1QNI A;  3KRX B;  5HE0 B;  4J73 A;  3UVM A;  3B7F A;  4E5Z A;  1P22 A;  3AL8 A;  4O45 A;  1Q47 A;  5JWZ A;  5IC7 A;  4A09 A;  4AEZ A;  4YVD A;  3MXX A;  2Q7Q A;  2H6K A;  2P9P C;  3UVO A;  2IWK A;  3IJC A;  4GZ8 A;  4NSX A;  3VA6 A;  3MKQ A;  2AQ5 A;  5K1C C;  3RRM C;  5CYK A;  3EI1 A;  4IMM A;  2PM7 B;  4JT5 C;  4A08 A;  4QRJ A;  4A0B A;  3OW8 A;  1PBY B;  5HQG A;  1N6D A;  4PC0 A;  2CE8 A;  2YMU A;  2I3S A;  3PSL A;  3ZWL B;  1VYH C;  5I5M A;  3SWS D;  2G9A A;  1B9X A;  4AOW A;  3EMH A;  3UVK A;  5A2Q g;  3PXW D;  5AFU 3;  3I7L A; 
#chains in the Genus database with same CATH topology
 3OF7 A;  3SFZ A;  3EI3 A;  3N0D A;  5CXC B;  1C9L A;  3K26 A;  1E8M A;  3EI2 A;  2AGX A;  5H14 A;  4A0A A;  3GFC A;  3EWE A;  2XE4 A;  4J86 A;  5FKQ A;  3F3P A;  4DNV A;  3AH8 B;  2W18 A;  3NVX A;  4O1Q D;  1GOT B;  2QZP A;  2VDM A;  4GGD A;  4BCD A;  3MZK A;  2G99 A;  3NVN A;  5HE2 B;  2H13 A;  1O6F A;  3IJ0 A;  2O9K A;  3FGB A;  4WK4 A;  2H6Q A;  3NVQ A;  4QQE A;  4ES0 A;  3PVU B;  1U8C A;  2I0R A;  2P9L C;  3K27 A;  3MUO A;  4WJK A;  3SBR A;  1JMX B;  3F3F A;  3CFS B;  3RFG A;  3IUM A;  3OKW A;  3UKU C;  5SXM A;  4GGC A;  1H2W A;  2PBI B;  2H3X A;  1VE6 A;  3IIY A;  5EM2 A;  2B5M A;  2CO0 A;  4GM9 A;  2GNQ A;  4FA5 D;  5M5U A;  1SQ9 A;  5FFG A;  3C75 H;  3GRE A;  2IUP A;  2AH0 A;  4PBY A;  5FKT A;  3AL8 B;  3DXM C;  2CO0 C;  3PSC B;  5KDO B;  2Z2N A;  2I0T A;  4LG8 A;  1K32 A;  4UI9 R;  5FKS A;  4A09 B;  2UZY B;  2HXC A;  3IUQ A;  4ZOY A;  5GSA A;  4E54 A;  3SXT D;  1SHY B;  2GC4 A;  3IUR A;  3I7O A;  4OWR A;  4J77 A;  5H1M A;  3W15 A;  5E6U A;  3IIW A;  2IAA A;  2OK6 A;  4PSX B;  3O4H A;  5CYK B;  4A2L A;  3EI1 B;  5CXB A;  4CI3 A;  4BCC A;  1ERJ A;  3EU7 A;  4AX4 A;  5C86 A;  4A08 B;  4A0B B;  4XYH A;  3N0E A;  3RLM D;  2PM9 A;  2J56 H;  2VC2 A;  2OVR B;  1VE7 A;  4CY3 A;  4JHP C;  5IJ7 E;  4A7J A;  4ESG A;  5EAP A;  2HU7 A;  5I5I A;  4FHL A;  2YNN A;  1MG3 A;  4PNK B;  5HDB A;  4JSX C;  3SMR A;  5IJ8 E;  5M61 A;  4X63 B;  3EI3 B;  3IJ1 A;  2HU8 A;  2XU7 A;  4X3E A;  5HE3 B;  3EI4 A;  3NID A;  3EI2 B;  1K3I A;  4J0X A;  2OVP B;  4A0A B;  3JB9 L;  4PBZ A;  5GMK n;  1H2Z A;  3ZDY A;  4H5J A;  4PSW B;  1YFQ A;  4K3J B;  3I2N A;  4XEI C;  3OKY A;  2VZ3 A;  3QHY B;  3JRP A;  4A11 A;  3I7H A;  3UKR C;  1XKS A;  2EIC A;  4MK0 B;  3IUJ A;  3NIG A;  3PXS D;  4H5I A;  4JXM A;  2H9N A;  3IKO A;  5B4W A;  2B4E A;  4NC4 A;  3CIK B;  4PXW A;  4R7A B;  1JMZ B;  3SBQ A;  3VH0 A;  3RN1 D;  2GC7 A;  3RSE C;  2VZ1 A;  3PE7 A;  4G55 A;  4J78 A;  3L4M D;  4D0K A;  4AN0 A;  4BUJ C;  3PVW B;  3ZE0 A;  4D6V A;  3JRO A;  5IGQ A;  4FAN D;  3A0F A;  4DNU A;  2HKR A;  3BG0 A;  5EM2 B;  3C9C A;  3MKS B;  3K6S A;  1SQJ A;  3HFQ A;  5HYN B;  3DM0 A;  2OK4 A;  2OIZ A;  4ERZ A;  3T3P A;  1E8N A;  5C2V B;  4OZU A;  3CFV A;  1GOH A;  5IGO A;  3SJL D;  3PXT D;  4JD2 C;  2CN3 A;  5FA5 B;  3VI4 A;  2CE9 A;  1UOQ A;  1UTC A;  4E54 B;  3BG1 A;  4CY2 A;  3KRW B;  4ZN4 A;  4BH6 A;  4CZX A;  4MMZ A;  2XL3 A;  2I0S A;  4L1M A;  3DWL C;  3AL9 A;  4U1E I;  2AGY A;  5CXB B;  3O4G A;  4JT6 C;  4WK2 A;  4CZY A;  3SVW D;  2IUV A;  4JSP C;  5EAL A;  2PM9 B;  2IWF A;  5EMJ B;  3AFC A;  4K3I D;  2TRC B;  4J81 A;  2H6N A;  3IVM A;  3ZE1 A;  4CC9 A;  1RI6 A;  3DSM A;  1TYQ C;  1L0Q A;  4KFM B;  3JZH A;  3ORV D;  1MDA H;  4GQ1 A;  4BCB A;  3JZN A;  3I7P A;  2OJY A;  4ERQ A;  5THA A;  3GC3 B;  3EI4 B;  4UM9 A;  1N6E A;  4CY1 A;  4Y7R A;  4J82 A;  4CY5 A;  2YNP A;  3OKY B;  2YNO A;  3FRX A;  4O3U B;  4ERY A;  4HDJ A;  2P9I C;  2QXV A;  4A11 B;  2H9M A;  2Z2O A;  3OL2 A;  1E5T A;  4ZOX A;  2EIB A;  3C99 A;  1OLZ A;  1JTD B;  5FFO A;  3ODT A;  4JSV C;  3SLE D;  3SCY A;  2BKL A;  3I8C A;  3QI0 A;  4LGN A;  2EID A;  3I8E A;  5AMS A;  2UZX B;  5AJA A;  2Z2P A;  4QT8 A;  4L3H D;  3SBP A;  5FQD A;  3RN0 D;  4G1M A;  4JSN C;  5GXI A;  3EG6 A;  4AMY A;  4GGA A;  4X61 B;  1VZ3 A;  4J79 A;  1K8K C;  3NIF A;  3F3G A;  1NR0 A;  4FA1 D;  4CI2 A;  2OVQ B;  4IA9 A;  2JKX A;  2AH1 A;  4GQB B;  4RE6 A;  1H2X A;  3MVD K;  2PM6 B;  3SN6 B;  1C9I A;  2P9N C;  1JOF A;  1VZ2 A;  5TDH B;  3V7D B;  3GD1 I;  1N6F A;  5EML B;  3MZL A;  3ULE C;  2YB8 B;  4G56 B;  4AN1 A;  3EQ8 A;  1L5G A;  5I5J A;  2HYE A;  3K71 A;  4TZ4 A;  4ZOZ A;  2H47 A;  1B9Y A;  2HJB A;  5IT9 g;  3E0C A;  4I79 A;  4CZV A;  4UM8 A;  3MMY A;  1MG2 A;  4G1E A;  4L3G D;  2EBS A;  3T3M A;  5M5V A;  1GOG A;  2XYI A;  2CNX A;  1JJU B;  3BWS A;  4MMY A;  3K72 A;  5TEE A;  3VGZ A;  5M5T A;  4FWW A;  3JAM g;  3C5M A;  1PEV A;  3OTT A;  5H17 A;  2I3T A;  5M5S A;  3U4Y A;  5EAM A;  2HU5 A;  3RMZ D;  5C92 A;  1QFS A;  5C2W B;  1A0R B;  2VDO A;  4Y5R D;  2BBK H;  1PI6 A;  2BCJ B;  2MTA H;  4GQ2 P;  3JZG A;  1BPO A;  4J84 A;  5E6S A;  3J81 g;  4L1Q D;  1GG2 B;  1T2X A;  2AGL A;  3ZE2 A;  1GXR A;  2XZG A;  3FCU A;  4FAV D;  4O02 A;  1H2Y A;  2AGZ A;  1A12 A;  1U4C A;  4O3T B;  5FLX g;  2J57 G;  2VDQ A;  4NBM A;  2P9K C;  4FB1 D;  4J0W A;  2HKM A;  2VDN A;  2QC5 A;  5EAR A;  3UR4 A;  1GOF A;  3V9F A;  3O4J A;  4IRZ A;  5K19 A;  4QL1 A;  3OL2 B;  4DNW A;  4XYI A;  1M1X A;  1XHM A;  4EWR A;  3I7N A;  5EMM B;  2P9U C;  2H68 A;  2AGW A;  2H9L A;  5FKR A;  3I7K A;  1TBG A;  4J8B A;  4A2M A;  4L9O A;  3JPX A;  4CI8 A;  4CI1 A;  2WQ8 A;  3ZDX A;  4RE5 A;  1FWX A;  3UVL A;  2B5N A;  2B5L A;  1U2V C;  1YR2 A;  3EQ7 A;  4GM8 A;  4QAM A;  4O2W A;  4MMX A;  3P4F A;  2QR5 A;  5CXC A;  2HES X;  5E6R A;  4FA9 D;  3EQ9 A;  4BP8 A;  1XIP A;  5GXH A;  4WK0 A;  3OKT A;  4J87 A;  2YBA A;  1O6G A;  4Z7O A;  1I2M B;  4GM3 A;  3FCS A;  4Z8L A;  4BP9 A;  2XL2 A;  4BL0 A;  2H9P A;  4E5Z B;  4ZOV A;  3UVN A;  5HE1 B;  3O4I A;  4O9D A;  3RFH A;  2VDP A;  2VDL A;  1QFM A;  1GP2 B;  2IUR A;  4FA4 D;  2J55 H;  5EMK B;  1OMW B;  3FM0 A;  5TF2 A;  3I89 A;  2EIE A;  2H14 A;  4LG9 A;  4N14 A;  5TEF A;  2CN2 A;  1S4U X;  4J8G A;  3V4V A;  3DXK C;  3L4O D;  5FXY A;  3ZDZ A;  3V5W B;  4U7A A;  1JV2 A;  3SHF A;  2HJ4 A;  4X60 B;  1R5M A;  4D9S A;  3J80 g;  1PGU A;  3DDU A;  2IUQ A;  4GMB A;  5M5R A;  2P9S C;  1UOO A;  5C9Z B;  1NEX B;  3KCI A;  1QNI A;  3KRX B;  3V4P A;  5HE0 B;  4J73 A;  3UVM A;  3VI3 A;  3B7F A;  4E5Z A;  1P22 A;  3AL8 A;  4O45 A;  1TYE A;  1Q47 A;  3IUL A;  5JWZ A;  5IC7 A;  4A09 A;  4AEZ A;  4YVD A;  3MXX A;  2Q7Q A;  4AMZ A;  3IUN A;  2H6K A;  1UOP A;  2P9P C;  3UVO A;  2IWK A;  2VDR A;  3IJC A;  4Z7N A;  4GZ8 A;  4NSX A;  3VA6 A;  2XDW A;  3MKQ A;  4NAA A;  2AQ5 A;  5K1C C;  3MUN A;  3RRM C;  5CYK A;  3EI1 A;  2VDK A;  4IMM A;  2PM7 B;  4JHN A;  4JT5 C;  4A08 A;  4QRJ A;  4A0B A;  3OW8 A;  1PBY B;  5HQG A;  1N6D A;  4PC0 A;  2CE8 A;  2YMU A;  2I3S A;  3PSL A;  3ZWL B;  1VYH C;  5I5M A;  3SWS D;  2G9A A;  1B9X A;  4AOW A;  3IJE A;  3EMH A;  3UVK A;  5A2Q g;  3PXW D;  5AFU 3;  4Z7Q A;  4NEN A;  3I7L A; 
#chains in the Genus database with same CATH homology
 3SFZ A;  3EI3 A;  3N0D A;  5CXC B;  3K26 A;  3EI2 A;  2AGX A;  5H14 A;  4A0A A;  3GFC A;  3EWE A;  4J86 A;  5FKQ A;  3F3P A;  3AH8 B;  2W18 A;  3NVX A;  4O1Q D;  1GOT B;  4GGD A;  3MZK A;  2G99 A;  3NVN A;  5HE2 B;  2H13 A;  3IJ0 A;  2O9K A;  3FGB A;  2H6Q A;  3NVQ A;  4QQE A;  4ES0 A;  3PVU B;  2I0R A;  2P9L C;  3K27 A;  3SBR A;  1JMX B;  3F3F A;  3CFS B;  3RFG A;  3OKW A;  3UKU C;  5SXM A;  4GGC A;  2PBI B;  2H3X A;  3IIY A;  5EM2 A;  4FA5 D;  2B5M A;  2CO0 A;  4GM9 A;  2GNQ A;  1SQ9 A;  3C75 H;  3GRE A;  2IUP A;  2AH0 A;  4PBY A;  5FKT A;  3AL8 B;  3DXM C;  2CO0 C;  3PSC B;  5KDO B;  2Z2N A;  2I0T A;  4LG8 A;  1K32 A;  4UI9 R;  5FKS A;  4A09 B;  2UZY B;  2HXC A;  4ZOY A;  5GSA A;  4E54 A;  3SXT D;  1SHY B;  2GC4 A;  4OWR A;  3I7O A;  4J77 A;  5H1M A;  3W15 A;  3IIW A;  2IAA A;  2OK6 A;  4PSX B;  5CYK B;  4A2L A;  3EI1 B;  5CXB A;  4CI3 A;  1ERJ A;  3EU7 A;  4A08 B;  4A0B B;  4XYH A;  3N0E A;  3RLM D;  2PM9 A;  2J56 H;  2OVR B;  4CY3 A;  5IJ7 E;  4A7J A;  4ESG A;  5EAP A;  5I5I A;  4FHL A;  2YNN A;  1MG3 A;  4PNK B;  4JSX C;  3SMR A;  5IJ8 E;  4X63 B;  3EI3 B;  3IJ1 A;  2XU7 A;  4X3E A;  5HE3 B;  3EI4 A;  3EI2 B;  4J0X A;  2OVP B;  4A0A B;  3JB9 L;  4PBZ A;  5GMK n;  4H5J A;  4PSW B;  1YFQ A;  4K3J B;  3I2N A;  4XEI C;  3OKY A;  3JRP A;  4A11 A;  3I7H A;  3UKR C;  1XKS A;  4MK0 B;  4JXM A;  3PXS D;  4H5I A;  2H9N A;  3IKO A;  5B4W A;  2B4E A;  3CIK B;  4PXW A;  4R7A B;  1JMZ B;  3SBQ A;  3VH0 A;  3RN1 D;  2GC7 A;  3RSE C;  3PE7 A;  4J78 A;  3L4M D;  4D0K A;  4BUJ C;  3PVW B;  4D6V A;  3JRO A;  5IGQ A;  4FAN D;  3A0F A;  2HKR A;  3BG0 A;  5EM2 B;  3C9C A;  3MKS B;  1SQJ A;  3HFQ A;  5HYN B;  3DM0 A;  2OK4 A;  2OIZ A;  4ERZ A;  5C2V B;  4OZU A;  3CFV A;  5IGO A;  3SJL D;  3PXT D;  4JD2 C;  2CN3 A;  5FA5 B;  2CE9 A;  4E54 B;  3BG1 A;  4CY2 A;  3KRW B;  4ZN4 A;  4BH6 A;  4CZX A;  2XL3 A;  2I0S A;  3DWL C;  3AL9 A;  4U1E I;  2AGY A;  5CXB B;  4JT6 C;  4CZY A;  3SVW D;  2IUV A;  4JSP C;  5EAL A;  2PM9 B;  2IWF A;  5EMJ B;  3AFC A;  4K3I D;  2TRC B;  4J81 A;  2H6N A;  4CC9 A;  1RI6 A;  3DSM A;  1TYQ C;  1L0Q A;  4KFM B;  3JZH A;  3ORV D;  1MDA H;  4GQ1 A;  3JZN A;  3I7P A;  2OJY A;  4ERQ A;  5THA A;  3EI4 B;  1N6E A;  4CY1 A;  4Y7R A;  4J82 A;  4CY5 A;  2YNP A;  3OKY B;  2YNO A;  3FRX A;  4O3U B;  4ERY A;  4HDJ A;  2P9I C;  2QXV A;  4A11 B;  2H9M A;  2Z2O A;  3OL2 A;  4ZOX A;  3C99 A;  1OLZ A;  3ODT A;  4JSV C;  3SLE D;  3SCY A;  3I8C A;  4LGN A;  3I8E A;  5AMS A;  2UZX B;  5AJA A;  2Z2P A;  4QT8 A;  4L3H D;  3SBP A;  5FQD A;  3RN0 D;  4JSN C;  5GXI A;  3EG6 A;  4GGA A;  4X61 B;  4J79 A;  1K8K C;  3F3G A;  1NR0 A;  4FA1 D;  4CI2 A;  2OVQ B;  4IA9 A;  2AH1 A;  4GQB B;  2PM6 B;  3SN6 B;  2P9N C;  1JOF A;  5TDH B;  3V7D B;  1N6F A;  5EML B;  3MZL A;  3ULE C;  2YB8 B;  4G56 B;  5I5J A;  2HYE A;  4TZ4 A;  4ZOZ A;  2H47 A;  1B9Y A;  2HJB A;  5IT9 g;  3E0C A;  4I79 A;  4CZV A;  3MMY A;  1MG2 A;  4L3G D;  2EBS A;  2XYI A;  2CNX A;  1JJU B;  3BWS A;  5TEE A;  3VGZ A;  4FWW A;  3JAM g;  3C5M A;  1PEV A;  3OTT A;  5H17 A;  2I3T A;  3U4Y A;  5EAM A;  3RMZ D;  5C2W B;  1A0R B;  4Y5R D;  2BBK H;  1PI6 A;  2BCJ B;  2MTA H;  4GQ2 P;  3JZG A;  4J84 A;  3J81 g;  4L1Q D;  1GG2 B;  2AGL A;  1GXR A;  4FAV D;  2AGZ A;  1U4C A;  4O3T B;  5FLX g;  2J57 G;  4FB1 D;  2P9K C;  4J0W A;  2HKM A;  2QC5 A;  5EAR A;  3UR4 A;  3V9F A;  5K19 A;  4QL1 A;  3OL2 B;  4XYI A;  1XHM A;  4EWR A;  3I7N A;  5EMM B;  2P9U C;  2H68 A;  2AGW A;  2H9L A;  5FKR A;  3I7K A;  1TBG A;  4J8B A;  4A2M A;  4L9O A;  3JPX A;  4CI8 A;  4CI1 A;  1FWX A;  3UVL A;  2B5N A;  2B5L A;  1U2V C;  4GM8 A;  3P4F A;  5CXC A;  2HES X;  4FA9 D;  1XIP A;  5GXH A;  3OKT A;  4J87 A;  2YBA A;  4GM3 A;  4Z8L A;  2XL2 A;  4BL0 A;  2H9P A;  4E5Z B;  4ZOV A;  3UVN A;  5HE1 B;  4O9D A;  3RFH A;  1GP2 B;  2IUR A;  4FA4 D;  2J55 H;  5EMK B;  1OMW B;  3FM0 A;  5TF2 A;  3I89 A;  2H14 A;  4LG9 A;  4N14 A;  5TEF A;  2CN2 A;  1S4U X;  4J8G A;  3DXK C;  3L4O D;  5FXY A;  3V5W B;  4U7A A;  3SHF A;  2HJ4 A;  4X60 B;  1R5M A;  3J80 g;  1PGU A;  2IUQ A;  4GMB A;  2P9S C;  5C9Z B;  1NEX B;  1QNI A;  3KRX B;  5HE0 B;  4J73 A;  3UVM A;  3B7F A;  4E5Z A;  1P22 A;  3AL8 A;  4O45 A;  1Q47 A;  5JWZ A;  5IC7 A;  4A09 A;  4AEZ A;  4YVD A;  3MXX A;  2Q7Q A;  2H6K A;  2P9P C;  3UVO A;  2IWK A;  3IJC A;  4GZ8 A;  4NSX A;  3VA6 A;  3MKQ A;  2AQ5 A;  5K1C C;  3RRM C;  5CYK A;  3EI1 A;  4IMM A;  2PM7 B;  4JT5 C;  4A08 A;  4QRJ A;  4A0B A;  3OW8 A;  1PBY B;  5HQG A;  1N6D A;  4PC0 A;  2CE8 A;  2YMU A;  2I3S A;  3PSL A;  3ZWL B;  1VYH C;  5I5M A;  3SWS D;  2G9A A;  1B9X A;  4AOW A;  3EMH A;  3UVK A;  5A2Q g;  3PXW D;  5AFU 3;  3I7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...