1GOTB

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
339
Chain Sequence
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (gtp-binding/transducer)
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
total genus 106
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gotB00
3EI1A 4FA1D 3OKWA 4ERZA 2AGZA 3PXWD 3EI3A 5TEEA 4J0WA 3RRMC 1ERJA 5SXMA 3OL2B 1FWXA 4G56B 3IJ1A 5THAA 2IURA 3I2NA 4J87A 4JD2C 5K19A 3VGZA 3N0EA 5EM2A 2PM6B 2OVPB 4A09B 2AGXA 2P9UC 3CFVA 1K8KC 1A0RB 4IMMA 4K3JB 4GQBB 3VA6A 2XU7A 3BWSA 4Y5RD 2HYEA 3SVWD 4GM3A 4JSPC 2AQ5A 4J81A 3I7HA 4AEZA 4KFMB 1NR0A 3PXTD 3BG1A 3ULEC 4E5ZB 3BG0A 1JJUB 3EG6A 1B9XA 1TBGA 4ERQA 3JPXA 3JZGA 4PSXB 5I5MA 2I0SA 2Z2PA 4PC0A 4A11B 4XEIC 5KDOB 4O9DA 5TF2A 4BUJC 5AMSA 4ZOZA 4X3EA 5H17A 5EMMB 3MXXA 4H5IA 5IJ8E 2IAAA 2H6QA 1XIPA 5HE2B 5EALA 3SMRA 3NVNA 2CN2A 5CYKA 3OKYB 5CYKB 3IIWA 3JROA 4E54A 2H9PA 4CI3A 2H6NA 4CY1A 3FRXA 3OW8A 4ZOYA 4A09A 2XL2A 3SFZA 4BH6A 3MKSB 3I7PA 3MZLA 1RI6A 5CXCB 3ORVD 3UVKA 1SHYB 4CY5A 1JOFA 4D6VA 2CO0C 1JMXB 4FWWA 2EBSA 3PSLA 4A08B 4GGAA 4L3HD 5CXBB 2MTAH 2PBIB 4GQ1A 3AFCA 3P4FA 4X63B 3K26A 4ES0A 4LG8A 4FA4D 3J81g 4ERYA 2O9KA 2H9LA 3PXSD 5B4WA 1U4CA 2B5MA 3L4MD 5EMKB 3OKTA 3J80g 3AL8B 4I79A 4UI9R 4H5JA 3C9CA 3DXMC 2I0RA 2J56H 3EMHA 2UZXB 4PBYA 3ODTA 4QRJA 3RN0D 4A2MA 3B7FA 2YNNA 1PI6A 3RFHA 3GREA 5FKQA 5K1CC 5CXBA 3UVNA 2QC5A 2IWKA 3MZKA 5HE0B 4FAND 3OKYA 5GXHA 3MMYA 2P9LC 3IIYA 4IA9A 4J82A 4J77A 4XYHA 5CXCA 4CZYA 3AL9A 1N6DA 5HQGA 2HXCA 2J55H 1GP2B 4Z8LA 4L9OA 5HE3B 3IJ0A 4CI8A 4QL1A 3C99A 3SHFA 2UZYB 1YFQA 1GXRA 3FM0A 4J86A 4NSXA 5EAPA 5GXIA 3JZNA 4L1QD 2AH1A 4A7JA 5EM2B 3PSCB 2H47A 3PE7A 2P9SC 1MDAH 2CN3A 3HFQA 4A2LA 3A0FA 2HKMA 3SBPA 2B5NA 2OVRB 4A0BB 4CZXA 5EARA 4JT6C 2HKRA 2AGLA 5EAMA 2GC4A 3I7NA 5I5IA 1Q47A 2B4EA 5FKSA 2H14A 2PM7B 3I89A 3NVXA 3OL2A 4D0KA 3JB9L 2H9NA 4U1EI 4CI2A 3RSEC 3SJLD 3SLED 2H6KA 1N6EA 4J8BA 2P9IC 4FAVD 4EWRA 2P9KC 4J84A 5FA5B 4X60B 3JRPA 2OJYA 2AH0A 3AH8B 1K32A 1MG3A 5H1MA 5IJ7E 2YB8B 5GSAA 3SBQA 4XYIA 5FQDA 3EI2B 4PBZA 4E54B 4J79A 3SN6B 4A0AB 3L4OD 2AGYA 3SWSD 2YNOA 1MG2A 4ZOVA 3UR4A 4GZ8A 2P9PC 5IGQA 1OLZA 3KRXB 2B5LA 4FB1D 3EI4A 2BBKH 4J78A 5AFU3 3I7OA 4J0XA 2HESX 2GNQA 4FA9D 3UKRC 2H13A 3SCYA 4JSXC 3GFCA 2H3XA 5C9ZB 2TRCB 2YMUA 5I5JA 5FKRA 3I8CA 4ZOXA 3RFGA 4GM9A 4J8GA 1B9YA 4YVDA 1NEXB 3PVWB 4QQEA 5FKTA 5FXYA 3W15A 3CFSB 3IJCA 3FGBA 2CO0A 3RLMD 3OTTA 3UVLA 2OIZA 2W18A 1N6FA 3UVMA 5JWZA 2I0TA 4O3TB 3ZWLB 1QNIA 3F3PA 5EMLB 2YNPA 3DSMA 4J73A 4CI1A 4GGCA 3U4YA 2H9MA 3EI1B 3PVUB 4MK0B 1JMZB 3CIKB 4ESGA 2QXVA 4GGDA 4Y7RA 5HE1B 3UKUC 4TZ4A 4A0AA 2IUVA 4O45A 3V9FA 2IUQA 1SQ9A 2OVQB 2IUPA 3JAMg 3V5WB 5IGOA 3DXKC 3IKOA 2HJ4A 4CZVA 2BCJB 4CY3A 2G99A 4O1QD 4L3GD 2J57G 3N0DA 5FLXg 3DM0A 4QT8A 3E0CA 3EWEA 3F3FA 4CY2A 3C5MA 4FA5D 4PXWA 4PNKB 5EMJB 4R7AB 4JSVC 3AL8A 4ZN4A 3K27A 3EI2A 1L0QA 4O3UB 2PM9A 2PM9B 4K3ID 1P22A 5HYNB 4GM8A 4N14A 3V7DB 4CC9A 3MKQA 1PGUA 4A08A 2I3SA 3JZHA 2XYIA 2Z2NA 3EI4B 3C75H 2P9NC 5AJAA 3VH0A 3F3GA 4GQ2P 1XHMA 1XKSA 3EI3B 5IC7A 2G9AA 2Q7QA 3SXTD 3RN1D 3UVOA 3I7KA 1S4UX 2OK6A 5TDHB 4JSNC 4X61B 1R5MA 1SQJA 4BL0A 2GC7A 4OWRA 1TYQC 2CE8A 2H68A 1U2VC 4OZUA 4U7AA 2I3TA 2OK4A 2HJBA 1OMWB 2CNXA 3EU7A 1PEVA 5C2WB 5A2Qg 3SBRA 4A0BA 3DWLC 4HDJA 5TEFA 4FHLA 5GMKn 4JXMA 1GOTB 2CE9A 3NVQA 3RMZD 2IWFA 4E5ZA 2YBAA 5IT9g 2AGWA 1VYHC 1PBYB 3I8EA 5C2VB 1GG2B 2XL3A 4AOWA 4GMBA 4LG9A 5H14A 4A11A 4LGNA 4JT5C 3I7LA 2Z2OA 3KRWB 4PSWB
chains in the Genus database with same CATH superfamily
3NIDA 3EI1A 4FA1D 3OKWA 4ERZA 2AGZA 3PXWD 3EI3A 5TEEA 4J0WA 3RRMC 1TYEA 1ERJA 5SXMA 3OL2B 1FWXA 4G56B 3IJ1A 5THAA 2IURA 3I2NA 4G1EA 4J87A 4O2WA 4JD2C 5K19A 3VGZA 1VZ2A 3N0EA 5EM2A 2HU7A 2PM6B 2OVPB 4UM9A 4A09B 2AGXA 2P9UC 3O4JA 3CFVA 1K8KC 3O4IA 1GOHA 4Z7QA 1A0RB 4NC4A 4IMMA 4K3JB 4GQBB 3IJEA 3VA6A 2XU7A 3BWSA 4Y5RD 3QHYB 2HYEA 3SVWD 4GM3A 4JSPC 2AQ5A 3ZDZA 4J81A 3I7HA 4AEZA 4KFMB 1NR0A 3PXTD 4MMZA 2QZPA 3BG1A 3ULEC 4E5ZB 3BG0A 1JJUB 1L5GA 3ZE2A 3EG6A 1B9XA 1TBGA 4NAAA 4ERQA 3JPXA 3JZGA 4PSXB 5I5MA 2I0SA 2Z2PA 5E6UA 4PC0A 4A11B 4XEIC 5KDOB 4O9DA 5TF2A 4BUJC 1QFSA 1VE7A 5AMSA 4ZOZA 4X3EA 5H17A 5EMMB 3MXXA 4H5IA 5IJ8E 2XE4A 2IAAA 3ZE0A 2H6QA 1XIPA 5HE2B 3ZDYA 4RE6A 5EALA 3SMRA 3NVNA 2CN2A 5CYKA 3OKYB 5CYKB 3IIWA 3IURA 3JROA 1JTDB 2H9PA 4E54A 4CI3A 2H6NA 4CY1A 3FRXA 3OW8A 4ZOYA 4A09A 2XL2A 3SFZA 4BH6A 3NIGA 3MKSB 3I7PA 3MZLA 4BCCA 1RI6A 1VZ3A 5CXCB 3ORVD 3UVKA 3IVMA 1SHYB 4CY5A 1JOFA 2XDWA 4BCBA 4D6VA 2CO0C 3O4GA 1JMXB 3EQ8A 4FWWA 2EBSA 1K3IA 1U8CA 3PSLA 4A08B 2VZ1A 4GGAA 1O6GA 4L3HD 5CXBB 2MTAH 2PBIB 4GQ1A 3IUQA 3AFCA 3P4FA 4X63B 5M61A 3K26A 4ES0A 4LG8A 3IULA 4FA4D 3J81g 4ERYA 2O9KA 4MMYA 2H9LA 5E6RA 3PXSD 5B4WA 5C86A 2VDQA 1U4CA 2B5MA 3L4MD 5M5VA 1E8MA 2HU5A 5EMKB 2VZ3A 3OKTA 3J80g 3AL8B 4I79A 4UI9R 4MMXA 4H5JA 4BCDA 3C9CA 3DXMC 2I0RA 2J56H 3EMHA 3T3PA 2UZXB 4PBYA 3ODTA 2VDOA 4JHNA 4QRJA 3RN0D 4A2MA 3B7FA 2YNNA 3VI3A 1PI6A 2VDPA 2VDRA 3RFHA 3GREA 5FKQA 1C9LA 5CXBA 5K1CC 3UVNA 2QC5A 2IWKA 3DDUA 3MZKA 5HE0B 4FAND 3OKYA 5GXHA 3V4VA 3MMYA 2P9LC 3EQ9A 3IIYA 3NIFA 1H2YA 4IA9A 4J82A 4J77A 4XYHA 2EICA 5CXCA 4CZYA 3AL9A 1UOPA 1UOOA 1N6DA 5HQGA 2HXCA 2J55H 1GP2B 2VDKA 4Z8LA 4L9OA 5HE3B 3IJ0A 4CI8A 4QL1A 1GOFA 3C99A 3EQ7A 2VDMA 3SHFA 2UZYB 1YFQA 1GXRA 4WK0A 4G55A 3FM0A 4J86A 4NSXA 5EAPA 5GXIA 3JZNA 4WK4A 1H2WA 4L1QD 2AH1A 4A7JA 5EM2B 3PSCB 2H47A 3PE7A 2P9SC 1MDAH 2BKLA 2CN3A 3HFQA 4A2LA 4AMZA 3A0FA 3OF7A 2HKMA 3SBPA 2B5NA 4O02A 4DNUA 2OVRB 4A0BB 4CZXA 3IUJA 4JHPC 3K72A 5EARA 4JT6C 1H2XA 1UTCA 3MUOA 2HKRA 2AGLA 5EAMA 2GC4A 3I7NA 5I5IA 1Q47A 2B4EA 5FKSA 2H14A 2PM7B 3I89A 3NVXA 3OL2A 4D0KA 3JB9L 2H9NA 4U1EI 4CI2A 4DNWA 2WQ8A 3RSEC 3SJLD 4NBMA 3SLED 2H6KA 1N6EA 4J8BA 2P9IC 4FAVD 5C92A 4EWRA 2P9KC 2VDLA 3GD1I 4J84A 5FA5B 4X60B 3JRPA 4Z7NA 3FCUA 2OJYA 2AH0A 3AH8B 1K32A 4AN1A 1MG3A 5H1MA 5IJ7E 2YB8B 5GSAA 3O4HA 3SBQA 1I2MB 3FCSA 4L1MA 4XYIA 5FQDA 3EI2B 3K6SA 4PBZA 4E54B 4J79A 3SN6B 4A0AB 1QFMA 3L4OD 1VE6A 2AGYA 3SWSD 2YNOA 1MG2A 4ZOVA 3UR4A 4GZ8A 2P9PC 5IGQA 1OLZA 3KRXB 2B5LA 4FB1D 3EI4A 2BBKH 4J78A 5AFU3 3I7OA 4J0XA 2HESX 2GNQA 5FFGA 4FA9D 3UKRC 2JKXA 2H13A 3SCYA 4JSXC 3GFCA 2H3XA 5C9ZB 2TRCB 2YMUA 5I5JA 5FKRA 3I8CA 4ZOXA 1O6FA 3RFGA 4GM9A 4J8GA 1B9YA 4YVDA 1NEXB 3PVWB 4QQEA 5FKTA 4D9SA 5M5RA 5FXYA 3W15A 3CFSB 3IJCA 4WK2A 3FGBA 2CO0A 3RLMD 3OTTA 3UVLA 2OIZA 2W18A 1N6FA 3UVMA 5JWZA 2VC2A 2I0TA 4O3TB 3ZWLB 1QNIA 1E5TA 4WJKA 3F3PA 5EMLB 2YNPA 3DSMA 3KCIA 4J73A 4DNVA 4CI1A 4GGCA 3U4YA 4AX4A 2H9MA 2QR5A 3EI1B 3PVUB 4MK0B 5HDBA 1JMZB 3CIKB 4ESGA 2QXVA 4GGDA 4Y7RA 5HE1B 3MVDK 3UKUC 4TZ4A 4A0AA 2IUVA 4O45A 3V9FA 2IUQA 1SQ9A 2OVQB 4BP8A 2IUPA 3JAMg 3GC3B 3V5WB 5IGOA 3DXKC 3IKOA 3MUNA 2HJ4A 4CZVA 2BCJB 4CY3A 3IUMA 4UM8A 1YR2A 2G99A 4O1QD 3T3MA 4L3GD 2J57G 3N0DA 5FLXg 3DM0A 4QT8A 3E0CA 3EWEA 3F3FA 4CY2A 3C5MA 4FA5D 4PXWA 5M5TA 4PNKB 5EMJB 4R7AB 4JSVC 4IRZA 3AL8A 4ZN4A 3K27A 3EI2A 1L0QA 4O3UB 5E6SA 2PM9A 5M5UA 2PM9B 4K3ID 1P22A 3V4PA 5HYNB 4G1MA 4GM8A 4N14A 3IUNA 1H2ZA 3V7DB 4AN0A 4QAMA 4CC9A 3MKQA 4Z7OA 1PGUA 2EIBA 4A08A 2I3SA 3JZHA 2XYIA 2Z2NA 3EI4B 3C75H 4BP9A 2P9NC 5AJAA 3VH0A 3F3GA 4GQ2P 1XHMA 1E8NA 1XKSA 3EI3B 5IC7A 2G9AA 2Q7QA 3SXTD 3RN1D 3UVOA 1GOGA 3I7KA 1S4UX 2OK6A 5TDHB 4JSNC 4X61B 4AMYA 1R5MA 1A12A 2XZGA 5FFOA 1SQJA 4BL0A 2GC7A 4RE5A 4OWRA 1JV2A 1TYQC 5M5SA 2HU8A 2CE8A 2H68A 1U2VC 4OZUA 4U7AA 2I3TA 2OK4A 2HJBA 2EIDA 1OMWB 2CNXA 3EU7A 1PEVA 5C2WB 5A2Qg 3SBRA 4A0BA 3DWLC 4HDJA 5TEFA 4FHLA 5GMKn 3ZE1A 4NENA 4JXMA 3K71A 1C9IA 1GOTB 2CE9A 3NVQA 3RMZD 1T2XA 3VI4A 2IWFA 1UOQA 3ZDXA 2YBAA 5IT9g 4E5ZA 3QI0A 2VDNA 1BPOA 1M1XA 2AGWA 1VYHC 1PBYB 3I8EA 5C2VB 1GG2B 2XL3A 4AOWA 4GMBA 4LG9A 5H14A 4A11A 4LGNA 4JT5C 3I7LA 2Z2OA 2EIEA 3KRWB 4PSWB
chains in the Genus database with same CATH topology
3EI1A 4FA1D 3OKWA 4ERZA 2AGZA 3PXWD 3EI3A 5TEEA 4J0WA 3RRMC 1ERJA 5SXMA 3OL2B 1FWXA 4G56B 3IJ1A 5THAA 2IURA 3I2NA 4J87A 4JD2C 5K19A 3VGZA 3N0EA 5EM2A 2PM6B 2OVPB 4A09B 2AGXA 2P9UC 3CFVA 1K8KC 1A0RB 4IMMA 4K3JB 4GQBB 3VA6A 2XU7A 3BWSA 4Y5RD 2HYEA 3SVWD 4GM3A 4JSPC 2AQ5A 4J81A 3I7HA 4AEZA 4KFMB 1NR0A 3PXTD 3BG1A 3ULEC 4E5ZB 3BG0A 1JJUB 3EG6A 1B9XA 1TBGA 4ERQA 3JPXA 3JZGA 4PSXB 5I5MA 2I0SA 2Z2PA 4PC0A 4A11B 4XEIC 5KDOB 4O9DA 5TF2A 4BUJC 5AMSA 4ZOZA 4X3EA 5H17A 5EMMB 3MXXA 4H5IA 5IJ8E 2IAAA 2H6QA 1XIPA 5HE2B 5EALA 3SMRA 3NVNA 2CN2A 5CYKA 3OKYB 5CYKB 3IIWA 3JROA 4E54A 2H9PA 4CI3A 2H6NA 4CY1A 3FRXA 3OW8A 4ZOYA 4A09A 2XL2A 3SFZA 4BH6A 3MKSB 3I7PA 3MZLA 1RI6A 5CXCB 3ORVD 3UVKA 1SHYB 4CY5A 1JOFA 4D6VA 2CO0C 1JMXB 4FWWA 2EBSA 3PSLA 4A08B 4GGAA 4L3HD 5CXBB 2MTAH 2PBIB 4GQ1A 3AFCA 3P4FA 4X63B 3K26A 4ES0A 4LG8A 4FA4D 3J81g 4ERYA 2O9KA 2H9LA 3PXSD 5B4WA 1U4CA 2B5MA 3L4MD 5EMKB 3OKTA 3J80g 3AL8B 4I79A 4UI9R 4H5JA 3C9CA 3DXMC 2I0RA 2J56H 3EMHA 2UZXB 4PBYA 3ODTA 4QRJA 3RN0D 4A2MA 3B7FA 2YNNA 1PI6A 3RFHA 3GREA 5FKQA 5K1CC 5CXBA 3UVNA 2QC5A 2IWKA 3MZKA 5HE0B 4FAND 3OKYA 5GXHA 3MMYA 2P9LC 3IIYA 4IA9A 4J82A 4J77A 4XYHA 5CXCA 4CZYA 3AL9A 1N6DA 5HQGA 2HXCA 2J55H 1GP2B 4Z8LA 4L9OA 5HE3B 3IJ0A 4CI8A 4QL1A 3C99A 3SHFA 2UZYB 1YFQA 1GXRA 3FM0A 4J86A 4NSXA 5EAPA 5GXIA 3JZNA 4L1QD 2AH1A 4A7JA 5EM2B 3PSCB 2H47A 3PE7A 2P9SC 1MDAH 2CN3A 3HFQA 4A2LA 3A0FA 2HKMA 3SBPA 2B5NA 2OVRB 4A0BB 4CZXA 5EARA 4JT6C 2HKRA 2AGLA 5EAMA 2GC4A 3I7NA 5I5IA 1Q47A 2B4EA 5FKSA 2H14A 2PM7B 3I89A 3NVXA 3OL2A 4D0KA 3JB9L 2H9NA 4U1EI 4CI2A 3RSEC 3SJLD 3SLED 2H6KA 1N6EA 4J8BA 2P9IC 4FAVD 4EWRA 2P9KC 4J84A 5FA5B 4X60B 3JRPA 2OJYA 2AH0A 3AH8B 1K32A 1MG3A 5H1MA 5IJ7E 2YB8B 5GSAA 3SBQA 4XYIA 5FQDA 3EI2B 4PBZA 4E54B 4J79A 3SN6B 4A0AB 3L4OD 2AGYA 3SWSD 2YNOA 1MG2A 4ZOVA 3UR4A 4GZ8A 2P9PC 5IGQA 1OLZA 3KRXB 2B5LA 4FB1D 3EI4A 2BBKH 4J78A 5AFU3 3I7OA 4J0XA 2HESX 2GNQA 4FA9D 3UKRC 2H13A 3SCYA 4JSXC 3GFCA 2H3XA 5C9ZB 2TRCB 2YMUA 5I5JA 5FKRA 3I8CA 4ZOXA 3RFGA 4GM9A 4J8GA 1B9YA 4YVDA 1NEXB 3PVWB 4QQEA 5FKTA 5FXYA 3W15A 3CFSB 3IJCA 3FGBA 2CO0A 3RLMD 3OTTA 3UVLA 2OIZA 2W18A 1N6FA 3UVMA 5JWZA 2I0TA 4O3TB 3ZWLB 1QNIA 3F3PA 5EMLB 2YNPA 3DSMA 4J73A 4CI1A 4GGCA 3U4YA 2H9MA 3EI1B 3PVUB 4MK0B 1JMZB 3CIKB 4ESGA 2QXVA 4GGDA 4Y7RA 5HE1B 3UKUC 4TZ4A 4A0AA 2IUVA 4O45A 3V9FA 2IUQA 1SQ9A 2OVQB 2IUPA 3JAMg 3V5WB 5IGOA 3DXKC 3IKOA 2HJ4A 4CZVA 2BCJB 4CY3A 2G99A 4O1QD 4L3GD 2J57G 3N0DA 5FLXg 3DM0A 4QT8A 3E0CA 3EWEA 3F3FA 4CY2A 3C5MA 4FA5D 4PXWA 4PNKB 5EMJB 4R7AB 4JSVC 3AL8A 4ZN4A 3K27A 3EI2A 1L0QA 4O3UB 2PM9A 2PM9B 4K3ID 1P22A 5HYNB 4GM8A 4N14A 3V7DB 4CC9A 3MKQA 1PGUA 4A08A 2I3SA 3JZHA 2XYIA 2Z2NA 3EI4B 3C75H 2P9NC 5AJAA 3VH0A 3F3GA 4GQ2P 1XHMA 1XKSA 3EI3B 5IC7A 2G9AA 2Q7QA 3SXTD 3RN1D 3UVOA 3I7KA 1S4UX 2OK6A 5TDHB 4JSNC 4X61B 1R5MA 1SQJA 4BL0A 2GC7A 4OWRA 1TYQC 2CE8A 2H68A 1U2VC 4OZUA 4U7AA 2I3TA 2OK4A 2HJBA 1OMWB 2CNXA 3EU7A 1PEVA 5C2WB 5A2Qg 3SBRA 4A0BA 3DWLC 4HDJA 5TEFA 4FHLA 5GMKn 4JXMA 1GOTB 2CE9A 3NVQA 3RMZD 2IWFA 4E5ZA 2YBAA 5IT9g 2AGWA 1VYHC 1PBYB 3I8EA 5C2VB 1GG2B 2XL3A 4AOWA 4GMBA 4LG9A 5H14A 4A11A 4LGNA 4JT5C 3I7LA 2Z2OA 3KRWB 4PSWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI1 A;  4FA1 D;  3OKW A;  4ERZ A;  2AGZ A;  3PXW D;  3EI3 A;  5TEE A;  4J0W A;  3RRM C;  1ERJ A;  5SXM A;  3OL2 B;  1FWX A;  4G56 B;  3IJ1 A;  5THA A;  2IUR A;  3I2N A;  4J87 A;  4JD2 C;  5K19 A;  3VGZ A;  3N0E A;  5EM2 A;  2PM6 B;  2OVP B;  4A09 B;  2AGX A;  2P9U C;  3CFV A;  1K8K C;  1A0R B;  4IMM A;  4K3J B;  4GQB B;  3VA6 A;  2XU7 A;  3BWS A;  4Y5R D;  2HYE A;  3SVW D;  4GM3 A;  4JSP C;  2AQ5 A;  4J81 A;  3I7H A;  4AEZ A;  4KFM B;  1NR0 A;  3PXT D;  3BG1 A;  3ULE C;  4E5Z B;  3BG0 A;  1JJU B;  3EG6 A;  1B9X A;  1TBG A;  4ERQ A;  3JPX A;  3JZG A;  4PSX B;  5I5M A;  2I0S A;  2Z2P A;  4PC0 A;  4A11 B;  4XEI C;  5KDO B;  4O9D A;  5TF2 A;  4BUJ C;  5AMS A;  4ZOZ A;  4X3E A;  5H17 A;  5EMM B;  3MXX A;  4H5I A;  5IJ8 E;  2IAA A;  2H6Q A;  1XIP A;  5HE2 B;  5EAL A;  3SMR A;  3NVN A;  2CN2 A;  5CYK A;  3OKY B;  5CYK B;  3IIW A;  3JRO A;  4E54 A;  2H9P A;  4CI3 A;  2H6N A;  4CY1 A;  3FRX A;  3OW8 A;  4ZOY A;  4A09 A;  2XL2 A;  3SFZ A;  4BH6 A;  3MKS B;  3I7P A;  3MZL A;  1RI6 A;  5CXC B;  3ORV D;  3UVK A;  1SHY B;  4CY5 A;  1JOF A;  4D6V A;  2CO0 C;  1JMX B;  4FWW A;  2EBS A;  3PSL A;  4A08 B;  4GGA A;  4L3H D;  5CXB B;  2MTA H;  2PBI B;  4GQ1 A;  3AFC A;  3P4F A;  4X63 B;  3K26 A;  4ES0 A;  4LG8 A;  4FA4 D;  3J81 g;  4ERY A;  2O9K A;  2H9L A;  3PXS D;  5B4W A;  1U4C A;  2B5M A;  3L4M D;  5EMK B;  3OKT A;  3J80 g;  3AL8 B;  4I79 A;  4UI9 R;  4H5J A;  3C9C A;  3DXM C;  2I0R A;  2J56 H;  3EMH A;  2UZX B;  4PBY A;  3ODT A;  4QRJ A;  3RN0 D;  4A2M A;  3B7F A;  2YNN A;  1PI6 A;  3RFH A;  3GRE A;  5FKQ A;  5K1C C;  5CXB A;  3UVN A;  2QC5 A;  2IWK A;  3MZK A;  5HE0 B;  4FAN D;  3OKY A;  5GXH A;  3MMY A;  2P9L C;  3IIY A;  4IA9 A;  4J82 A;  4J77 A;  4XYH A;  5CXC A;  4CZY A;  3AL9 A;  1N6D A;  5HQG A;  2HXC A;  2J55 H;  1GP2 B;  4Z8L A;  4L9O A;  5HE3 B;  3IJ0 A;  4CI8 A;  4QL1 A;  3C99 A;  3SHF A;  2UZY B;  1YFQ A;  1GXR A;  3FM0 A;  4J86 A;  4NSX A;  5EAP A;  5GXI A;  3JZN A;  4L1Q D;  2AH1 A;  4A7J A;  5EM2 B;  3PSC B;  2H47 A;  3PE7 A;  2P9S C;  1MDA H;  2CN3 A;  3HFQ A;  4A2L A;  3A0F A;  2HKM A;  3SBP A;  2B5N A;  2OVR B;  4A0B B;  4CZX A;  5EAR A;  4JT6 C;  2HKR A;  2AGL A;  5EAM A;  2GC4 A;  3I7N A;  5I5I A;  1Q47 A;  2B4E A;  5FKS A;  2H14 A;  2PM7 B;  3I89 A;  3NVX A;  3OL2 A;  4D0K A;  3JB9 L;  2H9N A;  4U1E I;  4CI2 A;  3RSE C;  3SJL D;  3SLE D;  2H6K A;  1N6E A;  4J8B A;  2P9I C;  4FAV D;  4EWR A;  2P9K C;  4J84 A;  5FA5 B;  4X60 B;  3JRP A;  2OJY A;  2AH0 A;  3AH8 B;  1K32 A;  1MG3 A;  5H1M A;  5IJ7 E;  2YB8 B;  5GSA A;  3SBQ A;  4XYI A;  5FQD A;  3EI2 B;  4PBZ A;  4E54 B;  4J79 A;  3SN6 B;  4A0A B;  3L4O D;  2AGY A;  3SWS D;  2YNO A;  1MG2 A;  4ZOV A;  3UR4 A;  4GZ8 A;  2P9P C;  5IGQ A;  1OLZ A;  3KRX B;  2B5L A;  4FB1 D;  3EI4 A;  2BBK H;  4J78 A;  5AFU 3;  3I7O A;  4J0X A;  2HES X;  2GNQ A;  4FA9 D;  3UKR C;  2H13 A;  3SCY A;  4JSX C;  3GFC A;  2H3X A;  5C9Z B;  2TRC B;  2YMU A;  5I5J A;  5FKR A;  3I8C A;  4ZOX A;  3RFG A;  4GM9 A;  4J8G A;  1B9Y A;  4YVD A;  1NEX B;  3PVW B;  4QQE A;  5FKT A;  5FXY A;  3W15 A;  3CFS B;  3IJC A;  3FGB A;  2CO0 A;  3RLM D;  3OTT A;  3UVL A;  2OIZ A;  2W18 A;  1N6F A;  3UVM A;  5JWZ A;  2I0T A;  4O3T B;  3ZWL B;  1QNI A;  3F3P A;  5EML B;  2YNP A;  3DSM A;  4J73 A;  4CI1 A;  4GGC A;  3U4Y A;  2H9M A;  3EI1 B;  3PVU B;  4MK0 B;  1JMZ B;  3CIK B;  4ESG A;  2QXV A;  4GGD A;  4Y7R A;  5HE1 B;  3UKU C;  4TZ4 A;  4A0A A;  2IUV A;  4O45 A;  3V9F A;  2IUQ A;  1SQ9 A;  2OVQ B;  2IUP A;  3JAM g;  3V5W B;  5IGO A;  3DXK C;  3IKO A;  2HJ4 A;  4CZV A;  2BCJ B;  4CY3 A;  2G99 A;  4O1Q D;  4L3G D;  2J57 G;  3N0D A;  5FLX g;  3DM0 A;  4QT8 A;  3E0C A;  3EWE A;  3F3F A;  4CY2 A;  3C5M A;  4FA5 D;  4PXW A;  4PNK B;  5EMJ B;  4R7A B;  4JSV C;  3AL8 A;  4ZN4 A;  3K27 A;  3EI2 A;  1L0Q A;  4O3U B;  2PM9 A;  2PM9 B;  4K3I D;  1P22 A;  5HYN B;  4GM8 A;  4N14 A;  3V7D B;  4CC9 A;  3MKQ A;  1PGU A;  4A08 A;  2I3S A;  3JZH A;  2XYI A;  2Z2N A;  3EI4 B;  3C75 H;  2P9N C;  5AJA A;  3VH0 A;  3F3G A;  4GQ2 P;  1XHM A;  1XKS A;  3EI3 B;  5IC7 A;  2G9A A;  2Q7Q A;  3SXT D;  3RN1 D;  3UVO A;  3I7K A;  1S4U X;  2OK6 A;  5TDH B;  4JSN C;  4X61 B;  1R5M A;  1SQJ A;  4BL0 A;  2GC7 A;  4OWR A;  1TYQ C;  2CE8 A;  2H68 A;  1U2V C;  4OZU A;  4U7A A;  2I3T A;  2OK4 A;  2HJB A;  1OMW B;  2CNX A;  3EU7 A;  1PEV A;  5C2W B;  5A2Q g;  3SBR A;  4A0B A;  3DWL C;  4HDJ A;  5TEF A;  4FHL A;  5GMK n;  4JXM A;  1GOT B;  2CE9 A;  3NVQ A;  3RMZ D;  2IWF A;  4E5Z A;  2YBA A;  5IT9 g;  2AGW A;  1VYH C;  1PBY B;  3I8E A;  5C2V B;  1GG2 B;  2XL3 A;  4AOW A;  4GMB A;  4LG9 A;  5H14 A;  4A11 A;  4LGN A;  4JT5 C;  3I7L A;  2Z2O A;  3KRW B;  4PSW B; 
#chains in the Genus database with same CATH topology
 3NID A;  3EI1 A;  4FA1 D;  3OKW A;  4ERZ A;  2AGZ A;  3PXW D;  3EI3 A;  5TEE A;  4J0W A;  3RRM C;  1TYE A;  1ERJ A;  5SXM A;  3OL2 B;  1FWX A;  4G56 B;  3IJ1 A;  5THA A;  2IUR A;  3I2N A;  4G1E A;  4J87 A;  4O2W A;  4JD2 C;  5K19 A;  3VGZ A;  1VZ2 A;  3N0E A;  5EM2 A;  2HU7 A;  2PM6 B;  2OVP B;  4UM9 A;  4A09 B;  2AGX A;  2P9U C;  3O4J A;  3CFV A;  1K8K C;  3O4I A;  1GOH A;  4Z7Q A;  1A0R B;  4NC4 A;  4IMM A;  4K3J B;  4GQB B;  3IJE A;  3VA6 A;  2XU7 A;  3BWS A;  4Y5R D;  3QHY B;  2HYE A;  3SVW D;  4GM3 A;  4JSP C;  2AQ5 A;  3ZDZ A;  4J81 A;  3I7H A;  4AEZ A;  4KFM B;  1NR0 A;  3PXT D;  4MMZ A;  2QZP A;  3BG1 A;  3ULE C;  4E5Z B;  3BG0 A;  1JJU B;  1L5G A;  3ZE2 A;  3EG6 A;  1B9X A;  1TBG A;  4NAA A;  4ERQ A;  3JPX A;  3JZG A;  4PSX B;  5I5M A;  2I0S A;  2Z2P A;  5E6U A;  4PC0 A;  4A11 B;  4XEI C;  5KDO B;  4O9D A;  5TF2 A;  4BUJ C;  1QFS A;  1VE7 A;  5AMS A;  4ZOZ A;  4X3E A;  5H17 A;  5EMM B;  3MXX A;  4H5I A;  5IJ8 E;  2XE4 A;  2IAA A;  3ZE0 A;  2H6Q A;  1XIP A;  5HE2 B;  3ZDY A;  4RE6 A;  5EAL A;  3SMR A;  3NVN A;  2CN2 A;  5CYK A;  3OKY B;  5CYK B;  3IIW A;  3IUR A;  3JRO A;  1JTD B;  2H9P A;  4E54 A;  4CI3 A;  2H6N A;  4CY1 A;  3FRX A;  3OW8 A;  4ZOY A;  4A09 A;  2XL2 A;  3SFZ A;  4BH6 A;  3NIG A;  3MKS B;  3I7P A;  3MZL A;  4BCC A;  1RI6 A;  1VZ3 A;  5CXC B;  3ORV D;  3UVK A;  3IVM A;  1SHY B;  4CY5 A;  1JOF A;  2XDW A;  4BCB A;  4D6V A;  2CO0 C;  3O4G A;  1JMX B;  3EQ8 A;  4FWW A;  2EBS A;  1K3I A;  1U8C A;  3PSL A;  4A08 B;  2VZ1 A;  4GGA A;  1O6G A;  4L3H D;  5CXB B;  2MTA H;  2PBI B;  4GQ1 A;  3IUQ A;  3AFC A;  3P4F A;  4X63 B;  5M61 A;  3K26 A;  4ES0 A;  4LG8 A;  3IUL A;  4FA4 D;  3J81 g;  4ERY A;  2O9K A;  4MMY A;  2H9L A;  5E6R A;  3PXS D;  5B4W A;  5C86 A;  2VDQ A;  1U4C A;  2B5M A;  3L4M D;  5M5V A;  1E8M A;  2HU5 A;  5EMK B;  2VZ3 A;  3OKT A;  3J80 g;  3AL8 B;  4I79 A;  4UI9 R;  4MMX A;  4H5J A;  4BCD A;  3C9C A;  3DXM C;  2I0R A;  2J56 H;  3EMH A;  3T3P A;  2UZX B;  4PBY A;  3ODT A;  2VDO A;  4JHN A;  4QRJ A;  3RN0 D;  4A2M A;  3B7F A;  2YNN A;  3VI3 A;  1PI6 A;  2VDP A;  2VDR A;  3RFH A;  3GRE A;  5FKQ A;  1C9L A;  5CXB A;  5K1C C;  3UVN A;  2QC5 A;  2IWK A;  3DDU A;  3MZK A;  5HE0 B;  4FAN D;  3OKY A;  5GXH A;  3V4V A;  3MMY A;  2P9L C;  3EQ9 A;  3IIY A;  3NIF A;  1H2Y A;  4IA9 A;  4J82 A;  4J77 A;  4XYH A;  2EIC A;  5CXC A;  4CZY A;  3AL9 A;  1UOP A;  1UOO A;  1N6D A;  5HQG A;  2HXC A;  2J55 H;  1GP2 B;  2VDK A;  4Z8L A;  4L9O A;  5HE3 B;  3IJ0 A;  4CI8 A;  4QL1 A;  1GOF A;  3C99 A;  3EQ7 A;  2VDM A;  3SHF A;  2UZY B;  1YFQ A;  1GXR A;  4WK0 A;  4G55 A;  3FM0 A;  4J86 A;  4NSX A;  5EAP A;  5GXI A;  3JZN A;  4WK4 A;  1H2W A;  4L1Q D;  2AH1 A;  4A7J A;  5EM2 B;  3PSC B;  2H47 A;  3PE7 A;  2P9S C;  1MDA H;  2BKL A;  2CN3 A;  3HFQ A;  4A2L A;  4AMZ A;  3A0F A;  3OF7 A;  2HKM A;  3SBP A;  2B5N A;  4O02 A;  4DNU A;  2OVR B;  4A0B B;  4CZX A;  3IUJ A;  4JHP C;  3K72 A;  5EAR A;  4JT6 C;  1H2X A;  1UTC A;  3MUO A;  2HKR A;  2AGL A;  5EAM A;  2GC4 A;  3I7N A;  5I5I A;  1Q47 A;  2B4E A;  5FKS A;  2H14 A;  2PM7 B;  3I89 A;  3NVX A;  3OL2 A;  4D0K A;  3JB9 L;  2H9N A;  4U1E I;  4CI2 A;  4DNW A;  2WQ8 A;  3RSE C;  3SJL D;  4NBM A;  3SLE D;  2H6K A;  1N6E A;  4J8B A;  2P9I C;  4FAV D;  5C92 A;  4EWR A;  2P9K C;  2VDL A;  3GD1 I;  4J84 A;  5FA5 B;  4X60 B;  3JRP A;  4Z7N A;  3FCU A;  2OJY A;  2AH0 A;  3AH8 B;  1K32 A;  4AN1 A;  1MG3 A;  5H1M A;  5IJ7 E;  2YB8 B;  5GSA A;  3O4H A;  3SBQ A;  1I2M B;  3FCS A;  4L1M A;  4XYI A;  5FQD A;  3EI2 B;  3K6S A;  4PBZ A;  4E54 B;  4J79 A;  3SN6 B;  4A0A B;  1QFM A;  3L4O D;  1VE6 A;  2AGY A;  3SWS D;  2YNO A;  1MG2 A;  4ZOV A;  3UR4 A;  4GZ8 A;  2P9P C;  5IGQ A;  1OLZ A;  3KRX B;  2B5L A;  4FB1 D;  3EI4 A;  2BBK H;  4J78 A;  5AFU 3;  3I7O A;  4J0X A;  2HES X;  2GNQ A;  5FFG A;  4FA9 D;  3UKR C;  2JKX A;  2H13 A;  3SCY A;  4JSX C;  3GFC A;  2H3X A;  5C9Z B;  2TRC B;  2YMU A;  5I5J A;  5FKR A;  3I8C A;  4ZOX A;  1O6F A;  3RFG A;  4GM9 A;  4J8G A;  1B9Y A;  4YVD A;  1NEX B;  3PVW B;  4QQE A;  5FKT A;  4D9S A;  5M5R A;  5FXY A;  3W15 A;  3CFS B;  3IJC A;  4WK2 A;  3FGB A;  2CO0 A;  3RLM D;  3OTT A;  3UVL A;  2OIZ A;  2W18 A;  1N6F A;  3UVM A;  5JWZ A;  2VC2 A;  2I0T A;  4O3T B;  3ZWL B;  1QNI A;  1E5T A;  4WJK A;  3F3P A;  5EML B;  2YNP A;  3DSM A;  3KCI A;  4J73 A;  4DNV A;  4CI1 A;  4GGC A;  3U4Y A;  4AX4 A;  2H9M A;  2QR5 A;  3EI1 B;  3PVU B;  4MK0 B;  5HDB A;  1JMZ B;  3CIK B;  4ESG A;  2QXV A;  4GGD A;  4Y7R A;  5HE1 B;  3MVD K;  3UKU C;  4TZ4 A;  4A0A A;  2IUV A;  4O45 A;  3V9F A;  2IUQ A;  1SQ9 A;  2OVQ B;  4BP8 A;  2IUP A;  3JAM g;  3GC3 B;  3V5W B;  5IGO A;  3DXK C;  3IKO A;  3MUN A;  2HJ4 A;  4CZV A;  2BCJ B;  4CY3 A;  3IUM A;  4UM8 A;  1YR2 A;  2G99 A;  4O1Q D;  3T3M A;  4L3G D;  2J57 G;  3N0D A;  5FLX g;  3DM0 A;  4QT8 A;  3E0C A;  3EWE A;  3F3F A;  4CY2 A;  3C5M A;  4FA5 D;  4PXW A;  5M5T A;  4PNK B;  5EMJ B;  4R7A B;  4JSV C;  4IRZ A;  3AL8 A;  4ZN4 A;  3K27 A;  3EI2 A;  1L0Q A;  4O3U B;  5E6S A;  2PM9 A;  5M5U A;  2PM9 B;  4K3I D;  1P22 A;  3V4P A;  5HYN B;  4G1M A;  4GM8 A;  4N14 A;  3IUN A;  1H2Z A;  3V7D B;  4AN0 A;  4QAM A;  4CC9 A;  3MKQ A;  4Z7O A;  1PGU A;  2EIB A;  4A08 A;  2I3S A;  3JZH A;  2XYI A;  2Z2N A;  3EI4 B;  3C75 H;  4BP9 A;  2P9N C;  5AJA A;  3VH0 A;  3F3G A;  4GQ2 P;  1XHM A;  1E8N A;  1XKS A;  3EI3 B;  5IC7 A;  2G9A A;  2Q7Q A;  3SXT D;  3RN1 D;  3UVO A;  1GOG A;  3I7K A;  1S4U X;  2OK6 A;  5TDH B;  4JSN C;  4X61 B;  4AMY A;  1R5M A;  1A12 A;  2XZG A;  5FFO A;  1SQJ A;  4BL0 A;  2GC7 A;  4RE5 A;  4OWR A;  1JV2 A;  1TYQ C;  5M5S A;  2HU8 A;  2CE8 A;  2H68 A;  1U2V C;  4OZU A;  4U7A A;  2I3T A;  2OK4 A;  2HJB A;  2EID A;  1OMW B;  2CNX A;  3EU7 A;  1PEV A;  5C2W B;  5A2Q g;  3SBR A;  4A0B A;  3DWL C;  4HDJ A;  5TEF A;  4FHL A;  5GMK n;  3ZE1 A;  4NEN A;  4JXM A;  3K71 A;  1C9I A;  1GOT B;  2CE9 A;  3NVQ A;  3RMZ D;  1T2X A;  3VI4 A;  2IWF A;  1UOQ A;  3ZDX A;  2YBA A;  5IT9 g;  4E5Z A;  3QI0 A;  2VDN A;  1BPO A;  1M1X A;  2AGW A;  1VYH C;  1PBY B;  3I8E A;  5C2V B;  1GG2 B;  2XL3 A;  4AOW A;  4GMB A;  4LG9 A;  5H14 A;  4A11 A;  4LGN A;  4JT5 C;  3I7L A;  2Z2O A;  2EIE A;  3KRW B;  4PSW B; 
#chains in the Genus database with same CATH homology
 3EI1 A;  4FA1 D;  3OKW A;  4ERZ A;  2AGZ A;  3PXW D;  3EI3 A;  5TEE A;  4J0W A;  3RRM C;  1ERJ A;  5SXM A;  3OL2 B;  1FWX A;  4G56 B;  3IJ1 A;  5THA A;  2IUR A;  3I2N A;  4J87 A;  4JD2 C;  5K19 A;  3VGZ A;  3N0E A;  5EM2 A;  2PM6 B;  2OVP B;  4A09 B;  2AGX A;  2P9U C;  3CFV A;  1K8K C;  1A0R B;  4IMM A;  4K3J B;  4GQB B;  3VA6 A;  2XU7 A;  3BWS A;  4Y5R D;  2HYE A;  3SVW D;  4GM3 A;  4JSP C;  2AQ5 A;  4J81 A;  3I7H A;  4AEZ A;  4KFM B;  1NR0 A;  3PXT D;  3BG1 A;  3ULE C;  4E5Z B;  3BG0 A;  1JJU B;  3EG6 A;  1B9X A;  1TBG A;  4ERQ A;  3JPX A;  3JZG A;  4PSX B;  5I5M A;  2I0S A;  2Z2P A;  4PC0 A;  4A11 B;  4XEI C;  5KDO B;  4O9D A;  5TF2 A;  4BUJ C;  5AMS A;  4ZOZ A;  4X3E A;  5H17 A;  5EMM B;  3MXX A;  4H5I A;  5IJ8 E;  2IAA A;  2H6Q A;  1XIP A;  5HE2 B;  5EAL A;  3SMR A;  3NVN A;  2CN2 A;  5CYK A;  3OKY B;  5CYK B;  3IIW A;  3JRO A;  4E54 A;  2H9P A;  4CI3 A;  2H6N A;  4CY1 A;  3FRX A;  3OW8 A;  4ZOY A;  4A09 A;  2XL2 A;  3SFZ A;  4BH6 A;  3MKS B;  3I7P A;  3MZL A;  1RI6 A;  5CXC B;  3ORV D;  3UVK A;  1SHY B;  4CY5 A;  1JOF A;  4D6V A;  2CO0 C;  1JMX B;  4FWW A;  2EBS A;  3PSL A;  4A08 B;  4GGA A;  4L3H D;  5CXB B;  2MTA H;  2PBI B;  4GQ1 A;  3AFC A;  3P4F A;  4X63 B;  3K26 A;  4ES0 A;  4LG8 A;  4FA4 D;  3J81 g;  4ERY A;  2O9K A;  2H9L A;  3PXS D;  5B4W A;  1U4C A;  2B5M A;  3L4M D;  5EMK B;  3OKT A;  3J80 g;  3AL8 B;  4I79 A;  4UI9 R;  4H5J A;  3C9C A;  3DXM C;  2I0R A;  2J56 H;  3EMH A;  2UZX B;  4PBY A;  3ODT A;  4QRJ A;  3RN0 D;  4A2M A;  3B7F A;  2YNN A;  1PI6 A;  3RFH A;  3GRE A;  5FKQ A;  5K1C C;  5CXB A;  3UVN A;  2QC5 A;  2IWK A;  3MZK A;  5HE0 B;  4FAN D;  3OKY A;  5GXH A;  3MMY A;  2P9L C;  3IIY A;  4IA9 A;  4J82 A;  4J77 A;  4XYH A;  5CXC A;  4CZY A;  3AL9 A;  1N6D A;  5HQG A;  2HXC A;  2J55 H;  1GP2 B;  4Z8L A;  4L9O A;  5HE3 B;  3IJ0 A;  4CI8 A;  4QL1 A;  3C99 A;  3SHF A;  2UZY B;  1YFQ A;  1GXR A;  3FM0 A;  4J86 A;  4NSX A;  5EAP A;  5GXI A;  3JZN A;  4L1Q D;  2AH1 A;  4A7J A;  5EM2 B;  3PSC B;  2H47 A;  3PE7 A;  2P9S C;  1MDA H;  2CN3 A;  3HFQ A;  4A2L A;  3A0F A;  2HKM A;  3SBP A;  2B5N A;  2OVR B;  4A0B B;  4CZX A;  5EAR A;  4JT6 C;  2HKR A;  2AGL A;  5EAM A;  2GC4 A;  3I7N A;  5I5I A;  1Q47 A;  2B4E A;  5FKS A;  2H14 A;  2PM7 B;  3I89 A;  3NVX A;  3OL2 A;  4D0K A;  3JB9 L;  2H9N A;  4U1E I;  4CI2 A;  3RSE C;  3SJL D;  3SLE D;  2H6K A;  1N6E A;  4J8B A;  2P9I C;  4FAV D;  4EWR A;  2P9K C;  4J84 A;  5FA5 B;  4X60 B;  3JRP A;  2OJY A;  2AH0 A;  3AH8 B;  1K32 A;  1MG3 A;  5H1M A;  5IJ7 E;  2YB8 B;  5GSA A;  3SBQ A;  4XYI A;  5FQD A;  3EI2 B;  4PBZ A;  4E54 B;  4J79 A;  3SN6 B;  4A0A B;  3L4O D;  2AGY A;  3SWS D;  2YNO A;  1MG2 A;  4ZOV A;  3UR4 A;  4GZ8 A;  2P9P C;  5IGQ A;  1OLZ A;  3KRX B;  2B5L A;  4FB1 D;  3EI4 A;  2BBK H;  4J78 A;  5AFU 3;  3I7O A;  4J0X A;  2HES X;  2GNQ A;  4FA9 D;  3UKR C;  2H13 A;  3SCY A;  4JSX C;  3GFC A;  2H3X A;  5C9Z B;  2TRC B;  2YMU A;  5I5J A;  5FKR A;  3I8C A;  4ZOX A;  3RFG A;  4GM9 A;  4J8G A;  1B9Y A;  4YVD A;  1NEX B;  3PVW B;  4QQE A;  5FKT A;  5FXY A;  3W15 A;  3CFS B;  3IJC A;  3FGB A;  2CO0 A;  3RLM D;  3OTT A;  3UVL A;  2OIZ A;  2W18 A;  1N6F A;  3UVM A;  5JWZ A;  2I0T A;  4O3T B;  3ZWL B;  1QNI A;  3F3P A;  5EML B;  2YNP A;  3DSM A;  4J73 A;  4CI1 A;  4GGC A;  3U4Y A;  2H9M A;  3EI1 B;  3PVU B;  4MK0 B;  1JMZ B;  3CIK B;  4ESG A;  2QXV A;  4GGD A;  4Y7R A;  5HE1 B;  3UKU C;  4TZ4 A;  4A0A A;  2IUV A;  4O45 A;  3V9F A;  2IUQ A;  1SQ9 A;  2OVQ B;  2IUP A;  3JAM g;  3V5W B;  5IGO A;  3DXK C;  3IKO A;  2HJ4 A;  4CZV A;  2BCJ B;  4CY3 A;  2G99 A;  4O1Q D;  4L3G D;  2J57 G;  3N0D A;  5FLX g;  3DM0 A;  4QT8 A;  3E0C A;  3EWE A;  3F3F A;  4CY2 A;  3C5M A;  4FA5 D;  4PXW A;  4PNK B;  5EMJ B;  4R7A B;  4JSV C;  3AL8 A;  4ZN4 A;  3K27 A;  3EI2 A;  1L0Q A;  4O3U B;  2PM9 A;  2PM9 B;  4K3I D;  1P22 A;  5HYN B;  4GM8 A;  4N14 A;  3V7D B;  4CC9 A;  3MKQ A;  1PGU A;  4A08 A;  2I3S A;  3JZH A;  2XYI A;  2Z2N A;  3EI4 B;  3C75 H;  2P9N C;  5AJA A;  3VH0 A;  3F3G A;  4GQ2 P;  1XHM A;  1XKS A;  3EI3 B;  5IC7 A;  2G9A A;  2Q7Q A;  3SXT D;  3RN1 D;  3UVO A;  3I7K A;  1S4U X;  2OK6 A;  5TDH B;  4JSN C;  4X61 B;  1R5M A;  1SQJ A;  4BL0 A;  2GC7 A;  4OWR A;  1TYQ C;  2CE8 A;  2H68 A;  1U2V C;  4OZU A;  4U7A A;  2I3T A;  2OK4 A;  2HJB A;  1OMW B;  2CNX A;  3EU7 A;  1PEV A;  5C2W B;  5A2Q g;  3SBR A;  4A0B A;  3DWL C;  4HDJ A;  5TEF A;  4FHL A;  5GMK n;  4JXM A;  1GOT B;  2CE9 A;  3NVQ A;  3RMZ D;  2IWF A;  4E5Z A;  2YBA A;  5IT9 g;  2AGW A;  1VYH C;  1PBY B;  3I8E A;  5C2V B;  1GG2 B;  2XL3 A;  4AOW A;  4GMB A;  4LG9 A;  5H14 A;  4A11 A;  4LGN A;  4JT5 C;  3I7L A;  2Z2O A;  3KRW B;  4PSW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...