1GOTB

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
339
Chain Sequence
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (gtp-binding/transducer)
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
source organism Bos taurus
total genus 106
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gotB00
2B5LA 4O9DA 4QL1A 5B4WA 5IT9g 2IWKA 4BUJC 5CXBB 4ZOVA 2O9KA 5FKTA 4JSXC 4PBZA 3RMZD 2OVRB 3JPXA 1GG2B 3I7OA 4IA9A 4CY5A 4G56B 5CXCB 5HQGA 2YNPA 3IIWA 4D6VA 4GM3A 3J80g 1YFQA 2YNOA 2AQ5A 3AH8B 1Q47A 5TF2A 2YB8B 1XKSA 2P9KC 2PM9B 3EI1A 4A0AB 4FA9D 3JB9L 3EI3B 5KDOB 3SJLD 1SQ9A 2OIZA 4U1EI 1PBYB 3OKWA 1N6EA 4GQ1A 4PSXB 3OL2A 3I7KA 1K8KC 4J84A 1U2VC 3RN0D 3FM0A 1OLZA 3L4MD 4CY2A 4PC0A 4ES0A 5FKQA 2H9MA 2EBSA 1JOFA 5I5JA 3PSLA 5IC7A 1GP2B 4CI3A 2H9NA 3SFZA 2AH1A 4J82A 2IUVA 3RFGA 3A0FA 1FWXA 4J86A 4X60B 2CN2A 2MTAH 3B7FA 4E54A 3DXKC 3EWEA 4IMMA 1ERJA 4E5ZA 2PM7B 5FKSA 3UR4A 3SCYA 2GC4A 1N6DA 3IKOA 3MZLA 1GOTB 2BBKH 5FA5B 4ERZA 4ESGA 3EI2A 4GZ8A 4FWWA 4JT6C 3PXWD 4JT5C 5HYNB 2P9UC 5EMJB 4X3EA 5C2VB 2Z2PA 3I8EA 3I7LA 4O3UB 1TYQC 4JSNC 5CXBA 3OL2B 4L1QD 2J56H 3OKYB 3OTTA 1JMZB 4JSPC 3PE7A 2CE8A 5CXCA 3AFCA 3AL9A 4ZN4A 4FA1D 4CI8A 3KRXB 3N0DA 3J81g 5JWZA 3ORVD 4XEIC 5EM2B 4CZXA 5C2WB 3V7DB 2PM9A 4A0AA 4LG9A 4UI9R 3AL8B 2GC7A 3EI3A 3BWSA 1JJUB 4J0WA 1NR0A 3JZNA 3IJ0A 3C75H 5EMLB 4X61B 4GGDA 3UVLA 4CI1A 4AOWA 3SBQA 3SXTD 2OK4A 2OJYA 3JROA 4GMBA 3UVKA 2AGLA 1B9YA 3I7HA 2G9AA 1S4UX 3E0CA 4A11B 2H9PA 3CIKB 3C5MA 4J79A 4J87A 3UVOA 5A2Qg 4BH6A 4FA4D 4GGCA 4ERQA 5FLXg 2UZXB 3SMRA 1XHMA 5FXYA 3K26A 2OK6A 4XYHA 5TDHB 4A2MA 2HJ4A 4A09B 2J55H 2XYIA 3SBRA 2I0TA 1RI6A 4L3HD 1NEXB 3NVQA 3C9CA 1U4CA 2B5MA 4MK0B 1B9XA 2CN3A 2XL3A 3PXTD 2H68A 4OZUA 5EMKB 4FB1D 4AEZA 3HFQA 3OKYA 4XYIA 3P4FA 3SVWD 5TEFA 3JZGA 2B5NA 3GFCA 4O45A 2G99A 3BG1A 4J0XA 4A0BB 4PNKB 3V9FA 2P9LC 2P9PC 4FAND 4I79A 3MKQA 5GXHA 5EM2A 5EAPA 5EMMB 2AGYA 3RRMC 4D0KA 3ZWLB 2CNXA 3AL8A 1L0QA 1VYHC 1MG3A 3PXSD 2H13A 3GREA 4PBYA 2H3XA 3K27A 3I7PA 5AFU3 5I5MA 4GGAA 4OWRA 2XL2A 2HKRA 3F3GA 4ZOXA 4U7AA 3MXXA 4A11A 2AGXA 2AGWA 2HKMA 4CI2A 4JD2C 3SBPA 5EALA 3DSMA 2AH0A 4J73A 2QC5A 4K3ID 5GMKn 2CO0A 3EU7A 1R5MA 2AGZA 1TBGA 3NVNA 5IJ7E 4A09A 2B4EA 4R7AB 4ZOYA 2Q7QA 5K1CC 5GSAA 3MMYA 4KFMB 1JMXB 3N0EA 4O1QD 3RLMD 3PSCB 1QNIA 3IIYA 5AJAA 5IGOA 4L9OA 4LGNA 1A0RB 2H47A 2CO0C 2H6QA 3OKTA 3IJ1A 3OW8A 3EMHA 4YVDA 3SHFA 4A7JA 3JAMg 4N14A 2IUPA 3DWLC 2P9NC 2HJBA 3CFSB 5IJ8E 4EWRA 4A0BA 3W15A 5IGQA 5EARA 3RN1D 4A08B 3I8CA 2I0SA 3C99A 4O3TB 4QQEA 1OMWB 3ULEC 3PVWB 3I2NA 3U4YA 4CC9A 5EAMA 3EI4B 3UVNA 2I3TA 1SQJA 4A2LA 2HYEA 5CYKB 4ERYA 2PM6B 4GM8A 4PSWB 3MKSB 4J77A 1XIPA 2IWFA 4GM9A 2H6NA 3NVXA 2UZYB 5HE3B 4Y5RD 2W18A 4QRJA 4K3JB 2IUQA 4J78A 3FGBA 5K19A 2YMUA 4HDJA 5TEEA 4J8BA 3BG0A 5FQDA 5SXMA 3RSEC 1GXRA 2OVQB 1PGUA 5FKRA 3V5WB 1K32A 2YNNA 2P9SC 3DXMC 3UKRC 4J81A 4ZOZA 5AMSA 4QT8A 3UKUC 3SN6B 3CFVA 2IURA 4Z8LA 4Y7RA 2H9LA 2Z2NA 2I3SA 2HESX 4PXWA 5HE1B 4TZ4A 2H6KA 4JXMA 3RFHA 2YBAA 3MZKA 4H5JA 3IJCA 3EI1B 3I89A 5I5IA 1N6FA 2J57G 2BCJB 5H14A 4A08A 3F3FA 2H14A 3EG6A 2I0RA 3VA6A 1PI6A 4CZVA 5H17A 1P22A 3DM0A 3VGZA 4FA5D 4NSXA 1MDAH 2CE9A 3F3PA 4H5IA 3JZHA 3JRPA 4JSVC 5HE2B 1PEVA 3EI4A 1SHYB 5HE0B 5GXIA 4X63B 3I7NA 5CYKA 2HXCA 4CY1A 1MG2A 2XU7A 5C9ZB 2QXVA 3KRWB 4GQBB 4BL0A 5THAA 4FAVD 4J8GA 4L3GD 3SLED 4CY3A 4E54B 2TRCB 4LG8A 3SWSD 2Z2OA 2IAAA 4FHLA 4E5ZB 2GNQA 3FRXA 4CZYA 2P9IC 3UVMA 3ODTA 4GQ2P 3EI2B 2PBIB 3L4OD 3PVUB 3VH0A 2OVPB 5H1MA
chains in the Genus database with same CATH superfamily
2B5LA 4O9DA 4QL1A 5B4WA 5IT9g 2IWKA 4BUJC 3O4HA 5CXBB 4ZOVA 2O9KA 5FKTA 3OF7A 4JSXC 4PBZA 3RMZD 2OVRB 2VDLA 2HU5A 1QFMA 3JPXA 1GG2B 3I7OA 4IA9A 4CY5A 3ZDYA 4G56B 5CXCB 5HQGA 4DNWA 2YNPA 3IIWA 4D6VA 2VDOA 4GM3A 3J80g 1YFQA 4O2WA 2YNOA 2AQ5A 5FFGA 3AH8B 1Q47A 5TF2A 2YB8B 1XKSA 2P9KC 2PM9B 3EI1A 4A0AB 4FA9D 3JB9L 3EI3B 5KDOB 3IUMA 3SJLD 1SQ9A 2OIZA 4U1EI 1PBYB 3OKWA 1N6EA 3O4JA 4GQ1A 4PSXB 5M5UA 3OL2A 3I7KA 1K8KC 4J84A 3IUJA 3MUOA 3EQ7A 3ZE1A 1U2VC 3RN0D 3FM0A 1OLZA 3L4MD 4CY2A 4PC0A 1YR2A 4ES0A 5FKQA 2H9MA 3IUQA 2EBSA 1JOFA 5I5JA 3PSLA 5IC7A 1GP2B 4CI3A 2H9NA 4RE6A 3SFZA 2AH1A 4J82A 2IUVA 1UOPA 3A0FA 1FWXA 1C9IA 4J86A 4X60B 2CN2A 2MTAH 3RFGA 4Z7OA 3B7FA 4E54A 3DXKC 3EWEA 4IMMA 2VDNA 3ZE0A 1ERJA 4E5ZA 2PM7B 5M5TA 5FKSA 3UR4A 3SCYA 2GC4A 1N6DA 3IKOA 3MZLA 1GOTB 2BBKH 5FA5B 4ERZA 3T3MA 4ESGA 3EI2A 4GZ8A 4FWWA 4JT6C 3PXWD 4JT5C 5HYNB 2P9UC 5EMJB 2HU8A 4X3EA 4G55A 5C2VB 2Z2PA 3I8EA 3I7LA 3FCUA 4O3UB 1TYQC 4JSNC 5CXBA 3OL2B 4L1QD 2J56H 1TYEA 3OKYB 2EIBA 3OTTA 1JMZB 4JSPC 3PE7A 4AN0A 4UM8A 3DDUA 2CE8A 5CXCA 3AFCA 4O02A 3AL9A 4ZN4A 1QFSA 4BP9A 4FA1D 3KRXB 4CI8A 3N0DA 3V4PA 5JWZA 3J81g 1E8MA 3ORVD 4XEIC 1I2MB 5EM2B 4JHNA 1K3IA 4CZXA 5C2WB 3V7DB 2PM9A 4WJKA 4A0AA 4LG9A 4AX4A 4UI9R 3AL8B 2GC7A 3EI3A 2XDWA 3BWSA 1JJUB 4J0WA 1NR0A 3JZNA 3IJ0A 3C75H 5EMLB 4X61B 4GGDA 3UVLA 1T2XA 2VC2A 4CI1A 3GD1I 4AOWA 3SBQA 3SXTD 2OK4A 2OJYA 3JROA 4Z7NA 4GMBA 3UVKA 2AGLA 1B9YA 3I7HA 1GOGA 4BCCA 2G9AA 1S4UX 3E0CA 4NENA 2VDRA 4A11B 2H9PA 3CIKB 3C5MA 4WK0A 2EICA 4J79A 4J87A 3UVOA 5A2Qg 3K72A 4BH6A 1M1XA 1H2YA 4FA4D 5C86A 4GGCA 4BCDA 4ERQA 5FLXg 2UZXB 3SMRA 1GOFA 1XHMA 3KCIA 5FXYA 2QZPA 3K26A 2OK6A 4XYHA 5TDHB 4A2MA 2HJ4A 4A09B 2J55H 4UM9A 2XYIA 3SBRA 2I0TA 1RI6A 4L3HD 3VI3A 1NEXB 3C9CA 3NVQA 1U4CA 1O6GA 2B5MA 4MK0B 1B9XA 2CN3A 4AMYA 2XL3A 3PXTD 2H68A 4OZUA 5EMKB 4FB1D 4AEZA 3IULA 2EIDA 3HFQA 3OKYA 5FFOA 1E5TA 4XYIA 4AN1A 3P4FA 3SVWD 5TEFA 3JZGA 2B5NA 3GFCA 4O45A 2VDKA 2G99A 3BG1A 2VDMA 4J0XA 3K6SA 4A0BB 4PNKB 3V9FA 2P9LC 2P9PC 4FAND 4I79A 3MKQA 5GXHA 5M61A 5EM2A 5EAPA 5EMMB 2AGYA 3RRMC 4D0KA 3ZWLB 1JV2A 2CNXA 3AL8A 1L0QA 4JHPC 1VYHC 2VZ3A 1MG3A 3PXSD 2H13A 3GREA 4PBYA 2H3XA 3K27A 1A12A 3I7PA 5AFU3 5I5MA 4GGAA 4OWRA 2WQ8A 2HKRA 2XL2A 3F3GA 3V4VA 4ZOXA 4U7AA 1BPOA 1UTCA 4MMXA 2XZGA 3MXXA 4A11A 2AGXA 2AGWA 3NIDA 2HKMA 4CI2A 1O6FA 3O4GA 4JD2C 3SBPA 5EALA 5E6UA 1VE7A 3DSMA 2AH0A 4J73A 2QC5A 4K3ID 5GMKn 2CO0A 3EU7A 1R5MA 2AGZA 1TBGA 1UOQA 3NVNA 5IJ7E 4A09A 2B4EA 4R7AB 4ZOYA 2Q7QA 5K1CC 5GSAA 3MMYA 4KFMB 1JMXB 3N0EA 4O1QD 3IJEA 3RLMD 3PSCB 1QNIA 4RE5A 3IIYA 3K71A 5AJAA 4NC4A 3T3PA 5IGOA 4L9OA 4LGNA 1A0RB 2H47A 2CO0C 2H6QA 3OKTA 3IJ1A 3OW8A 3EMHA 4YVDA 3SHFA 4A7JA 3JAMg 4N14A 2IUPA 3DWLC 2P9NC 2HJBA 3FCSA 3CFSB 5IJ8E 1VZ2A 3IUNA 4EWRA 4A0BA 3W15A 5IGQA 5EARA 3RN1D 3EQ9A 4A08B 3I8CA 2I0SA 3C99A 4O3TB 4QQEA 2BKLA 1OMWB 3ULEC 4DNUA 4G1EA 4QAMA 4NBMA 3GC3B 3PVWB 3I2NA 3U4YA 4CC9A 5EAMA 3EI4B 3UVNA 2I3TA 1SQJA 4A2LA 2HYEA 5CYKB 4ERYA 2PM6B 4NAAA 4GM8A 4PSWB 3MKSB 4J77A 1XIPA 2IWFA 4GM9A 5C92A 2H6NA 3ZDXA 3NVXA 2UZYB 5HE3B 3IURA 2W18A 4QRJA 4K3JB 4Y5RD 2IUQA 3NIFA 4J78A 3FGBA 2VDPA 5K19A 2YMUA 4HDJA 5TEEA 4J8BA 3BG0A 1C9LA 3QHYB 3ZE2A 5FQDA 5SXMA 3RSEC 3ZDZA 3VI4A 2EIEA 1GXRA 5HDBA 5E6SA 4BCBA 3IVMA 2OVQB 1PGUA 5FKRA 3V5WB 5M5VA 4WK2A 4D9SA 5E6RA 1K32A 1JTDB 2YNNA 2P9SC 3DXMC 1UOOA 2QR5A 4J81A 3UKRC 4ZOZA 5AMSA 3NIGA 4QT8A 3UKUC 4AMZA 3SN6B 3CFVA 1H2WA 2IURA 4Z8LA 4Y7RA 2VDQA 2H9LA 2Z2NA 2I3SA 2HESX 1GOHA 4PXWA 5HE1B 3O4IA 4TZ4A 2H6KA 4WK4A 4JXMA 3RFHA 2YBAA 4L1MA 3MZKA 4H5JA 3IJCA 4MMZA 3EI1B 3I89A 3MUNA 1N6FA 2J57G 5I5IA 2BCJB 2HU7A 5H14A 4A08A 3F3FA 2H14A 3EG6A 3EQ8A 1H2ZA 2I0RA 3VA6A 1PI6A 4CZVA 4G1MA 5H17A 1P22A 3DM0A 3VGZA 4FA5D 4NSXA 1MDAH 2CE9A 3F3PA 4H5IA 3JZHA 3QI0A 1L5GA 3JRPA 4JSVC 5HE2B 1PEVA 3EI4A 1SHYB 5HE0B 5GXIA 4X63B 4BP8A 3I7NA 4DNVA 5CYKA 2HXCA 4CY1A 1MG2A 2XU7A 5C9ZB 2QXVA 5M5RA 3KRWB 4GQBB 4BL0A 5THAA 1H2XA 4FAVD 4J8GA 4L3GD 4IRZA 3SLED 4CY3A 4E54B 1U8CA 2TRCB 4LG8A 3SWSD 2VZ1A 2Z2OA 1E8NA 2IAAA 4FHLA 4E5ZB 2JKXA 4Z7QA 2GNQA 3FRXA 4CZYA 5M5SA 1VE6A 1VZ3A 2XE4A 4MMYA 3MVDK 2P9IC 3UVMA 3ODTA 4GQ2P 3EI2B 2PBIB 3L4OD 3PVUB 3VH0A 2OVPB 5H1MA
chains in the Genus database with same CATH topology
2B5LA 4O9DA 4QL1A 5B4WA 5IT9g 2IWKA 4BUJC 5CXBB 4ZOVA 2O9KA 5FKTA 4JSXC 4PBZA 3RMZD 2OVRB 3JPXA 1GG2B 3I7OA 4IA9A 4CY5A 4G56B 5CXCB 5HQGA 2YNPA 3IIWA 4D6VA 4GM3A 3J80g 1YFQA 2YNOA 2AQ5A 3AH8B 1Q47A 5TF2A 2YB8B 1XKSA 2P9KC 2PM9B 3EI1A 4A0AB 4FA9D 3JB9L 3EI3B 5KDOB 3SJLD 1SQ9A 2OIZA 4U1EI 1PBYB 3OKWA 1N6EA 4GQ1A 4PSXB 3OL2A 3I7KA 1K8KC 4J84A 1U2VC 3RN0D 3FM0A 1OLZA 3L4MD 4CY2A 4PC0A 4ES0A 5FKQA 2H9MA 2EBSA 1JOFA 5I5JA 3PSLA 5IC7A 1GP2B 4CI3A 2H9NA 3SFZA 2AH1A 4J82A 2IUVA 3RFGA 3A0FA 1FWXA 4J86A 4X60B 2CN2A 2MTAH 3B7FA 4E54A 3DXKC 3EWEA 4IMMA 1ERJA 4E5ZA 2PM7B 5FKSA 3UR4A 3SCYA 2GC4A 1N6DA 3IKOA 3MZLA 1GOTB 2BBKH 5FA5B 4ERZA 4ESGA 3EI2A 4GZ8A 4FWWA 4JT6C 3PXWD 4JT5C 5HYNB 2P9UC 5EMJB 4X3EA 5C2VB 2Z2PA 3I8EA 3I7LA 4O3UB 1TYQC 4JSNC 5CXBA 3OL2B 4L1QD 2J56H 3OKYB 3OTTA 1JMZB 4JSPC 3PE7A 2CE8A 5CXCA 3AFCA 3AL9A 4ZN4A 4FA1D 4CI8A 3KRXB 3N0DA 3J81g 5JWZA 3ORVD 4XEIC 5EM2B 4CZXA 5C2WB 3V7DB 2PM9A 4A0AA 4LG9A 4UI9R 3AL8B 2GC7A 3EI3A 3BWSA 1JJUB 4J0WA 1NR0A 3JZNA 3IJ0A 3C75H 5EMLB 4X61B 4GGDA 3UVLA 4CI1A 4AOWA 3SBQA 3SXTD 2OK4A 2OJYA 3JROA 4GMBA 3UVKA 2AGLA 1B9YA 3I7HA 2G9AA 1S4UX 3E0CA 4A11B 2H9PA 3CIKB 3C5MA 4J79A 4J87A 3UVOA 5A2Qg 4BH6A 4FA4D 4GGCA 4ERQA 5FLXg 2UZXB 3SMRA 1XHMA 5FXYA 3K26A 2OK6A 4XYHA 5TDHB 4A2MA 2HJ4A 4A09B 2J55H 2XYIA 3SBRA 2I0TA 1RI6A 4L3HD 1NEXB 3NVQA 3C9CA 1U4CA 2B5MA 4MK0B 1B9XA 2CN3A 2XL3A 3PXTD 2H68A 4OZUA 5EMKB 4FB1D 4AEZA 3HFQA 3OKYA 4XYIA 3P4FA 3SVWD 5TEFA 3JZGA 2B5NA 3GFCA 4O45A 2G99A 3BG1A 4J0XA 4A0BB 4PNKB 3V9FA 2P9LC 2P9PC 4FAND 4I79A 3MKQA 5GXHA 5EM2A 5EAPA 5EMMB 2AGYA 3RRMC 4D0KA 3ZWLB 2CNXA 3AL8A 1L0QA 1VYHC 1MG3A 3PXSD 2H13A 3GREA 4PBYA 2H3XA 3K27A 3I7PA 5AFU3 5I5MA 4GGAA 4OWRA 2XL2A 2HKRA 3F3GA 4ZOXA 4U7AA 3MXXA 4A11A 2AGXA 2AGWA 2HKMA 4CI2A 4JD2C 3SBPA 5EALA 3DSMA 2AH0A 4J73A 2QC5A 4K3ID 5GMKn 2CO0A 3EU7A 1R5MA 2AGZA 1TBGA 3NVNA 5IJ7E 4A09A 2B4EA 4R7AB 4ZOYA 2Q7QA 5K1CC 5GSAA 3MMYA 4KFMB 1JMXB 3N0EA 4O1QD 3RLMD 3PSCB 1QNIA 3IIYA 5AJAA 5IGOA 4L9OA 4LGNA 1A0RB 2H47A 2CO0C 2H6QA 3OKTA 3IJ1A 3OW8A 3EMHA 4YVDA 3SHFA 4A7JA 3JAMg 4N14A 2IUPA 3DWLC 2P9NC 2HJBA 3CFSB 5IJ8E 4EWRA 4A0BA 3W15A 5IGQA 5EARA 3RN1D 4A08B 3I8CA 2I0SA 3C99A 4O3TB 4QQEA 1OMWB 3ULEC 3PVWB 3I2NA 3U4YA 4CC9A 5EAMA 3EI4B 3UVNA 2I3TA 1SQJA 4A2LA 2HYEA 5CYKB 4ERYA 2PM6B 4GM8A 4PSWB 3MKSB 4J77A 1XIPA 2IWFA 4GM9A 2H6NA 3NVXA 2UZYB 5HE3B 4Y5RD 2W18A 4QRJA 4K3JB 2IUQA 4J78A 3FGBA 5K19A 2YMUA 4HDJA 5TEEA 4J8BA 3BG0A 5FQDA 5SXMA 3RSEC 1GXRA 2OVQB 1PGUA 5FKRA 3V5WB 1K32A 2YNNA 2P9SC 3DXMC 3UKRC 4J81A 4ZOZA 5AMSA 4QT8A 3UKUC 3SN6B 3CFVA 2IURA 4Z8LA 4Y7RA 2H9LA 2Z2NA 2I3SA 2HESX 4PXWA 5HE1B 4TZ4A 2H6KA 4JXMA 3RFHA 2YBAA 3MZKA 4H5JA 3IJCA 3EI1B 3I89A 5I5IA 1N6FA 2J57G 2BCJB 5H14A 4A08A 3F3FA 2H14A 3EG6A 2I0RA 3VA6A 1PI6A 4CZVA 5H17A 1P22A 3DM0A 3VGZA 4FA5D 4NSXA 1MDAH 2CE9A 3F3PA 4H5IA 3JZHA 3JRPA 4JSVC 5HE2B 1PEVA 3EI4A 1SHYB 5HE0B 5GXIA 4X63B 3I7NA 5CYKA 2HXCA 4CY1A 1MG2A 2XU7A 5C9ZB 2QXVA 3KRWB 4GQBB 4BL0A 5THAA 4FAVD 4J8GA 4L3GD 3SLED 4CY3A 4E54B 2TRCB 4LG8A 3SWSD 2Z2OA 2IAAA 4FHLA 4E5ZB 2GNQA 3FRXA 4CZYA 2P9IC 3UVMA 3ODTA 4GQ2P 3EI2B 2PBIB 3L4OD 3PVUB 3VH0A 2OVPB 5H1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5L A;  4O9D A;  4QL1 A;  5B4W A;  5IT9 g;  2IWK A;  4BUJ C;  5CXB B;  4ZOV A;  2O9K A;  5FKT A;  4JSX C;  4PBZ A;  3RMZ D;  2OVR B;  3JPX A;  1GG2 B;  3I7O A;  4IA9 A;  4CY5 A;  4G56 B;  5CXC B;  5HQG A;  2YNP A;  3IIW A;  4D6V A;  4GM3 A;  3J80 g;  1YFQ A;  2YNO A;  2AQ5 A;  3AH8 B;  1Q47 A;  5TF2 A;  2YB8 B;  1XKS A;  2P9K C;  2PM9 B;  3EI1 A;  4A0A B;  4FA9 D;  3JB9 L;  3EI3 B;  5KDO B;  3SJL D;  1SQ9 A;  2OIZ A;  4U1E I;  1PBY B;  3OKW A;  1N6E A;  4GQ1 A;  4PSX B;  3OL2 A;  3I7K A;  1K8K C;  4J84 A;  1U2V C;  3RN0 D;  3FM0 A;  1OLZ A;  3L4M D;  4CY2 A;  4PC0 A;  4ES0 A;  5FKQ A;  2H9M A;  2EBS A;  1JOF A;  5I5J A;  3PSL A;  5IC7 A;  1GP2 B;  4CI3 A;  2H9N A;  3SFZ A;  2AH1 A;  4J82 A;  2IUV A;  3RFG A;  3A0F A;  1FWX A;  4J86 A;  4X60 B;  2CN2 A;  2MTA H;  3B7F A;  4E54 A;  3DXK C;  3EWE A;  4IMM A;  1ERJ A;  4E5Z A;  2PM7 B;  5FKS A;  3UR4 A;  3SCY A;  2GC4 A;  1N6D A;  3IKO A;  3MZL A;  1GOT B;  2BBK H;  5FA5 B;  4ERZ A;  4ESG A;  3EI2 A;  4GZ8 A;  4FWW A;  4JT6 C;  3PXW D;  4JT5 C;  5HYN B;  2P9U C;  5EMJ B;  4X3E A;  5C2V B;  2Z2P A;  3I8E A;  3I7L A;  4O3U B;  1TYQ C;  4JSN C;  5CXB A;  3OL2 B;  4L1Q D;  2J56 H;  3OKY B;  3OTT A;  1JMZ B;  4JSP C;  3PE7 A;  2CE8 A;  5CXC A;  3AFC A;  3AL9 A;  4ZN4 A;  4FA1 D;  4CI8 A;  3KRX B;  3N0D A;  3J81 g;  5JWZ A;  3ORV D;  4XEI C;  5EM2 B;  4CZX A;  5C2W B;  3V7D B;  2PM9 A;  4A0A A;  4LG9 A;  4UI9 R;  3AL8 B;  2GC7 A;  3EI3 A;  3BWS A;  1JJU B;  4J0W A;  1NR0 A;  3JZN A;  3IJ0 A;  3C75 H;  5EML B;  4X61 B;  4GGD A;  3UVL A;  4CI1 A;  4AOW A;  3SBQ A;  3SXT D;  2OK4 A;  2OJY A;  3JRO A;  4GMB A;  3UVK A;  2AGL A;  1B9Y A;  3I7H A;  2G9A A;  1S4U X;  3E0C A;  4A11 B;  2H9P A;  3CIK B;  3C5M A;  4J79 A;  4J87 A;  3UVO A;  5A2Q g;  4BH6 A;  4FA4 D;  4GGC A;  4ERQ A;  5FLX g;  2UZX B;  3SMR A;  1XHM A;  5FXY A;  3K26 A;  2OK6 A;  4XYH A;  5TDH B;  4A2M A;  2HJ4 A;  4A09 B;  2J55 H;  2XYI A;  3SBR A;  2I0T A;  1RI6 A;  4L3H D;  1NEX B;  3NVQ A;  3C9C A;  1U4C A;  2B5M A;  4MK0 B;  1B9X A;  2CN3 A;  2XL3 A;  3PXT D;  2H68 A;  4OZU A;  5EMK B;  4FB1 D;  4AEZ A;  3HFQ A;  3OKY A;  4XYI A;  3P4F A;  3SVW D;  5TEF A;  3JZG A;  2B5N A;  3GFC A;  4O45 A;  2G99 A;  3BG1 A;  4J0X A;  4A0B B;  4PNK B;  3V9F A;  2P9L C;  2P9P C;  4FAN D;  4I79 A;  3MKQ A;  5GXH A;  5EM2 A;  5EAP A;  5EMM B;  2AGY A;  3RRM C;  4D0K A;  3ZWL B;  2CNX A;  3AL8 A;  1L0Q A;  1VYH C;  1MG3 A;  3PXS D;  2H13 A;  3GRE A;  4PBY A;  2H3X A;  3K27 A;  3I7P A;  5AFU 3;  5I5M A;  4GGA A;  4OWR A;  2XL2 A;  2HKR A;  3F3G A;  4ZOX A;  4U7A A;  3MXX A;  4A11 A;  2AGX A;  2AGW A;  2HKM A;  4CI2 A;  4JD2 C;  3SBP A;  5EAL A;  3DSM A;  2AH0 A;  4J73 A;  2QC5 A;  4K3I D;  5GMK n;  2CO0 A;  3EU7 A;  1R5M A;  2AGZ A;  1TBG A;  3NVN A;  5IJ7 E;  4A09 A;  2B4E A;  4R7A B;  4ZOY A;  2Q7Q A;  5K1C C;  5GSA A;  3MMY A;  4KFM B;  1JMX B;  3N0E A;  4O1Q D;  3RLM D;  3PSC B;  1QNI A;  3IIY A;  5AJA A;  5IGO A;  4L9O A;  4LGN A;  1A0R B;  2H47 A;  2CO0 C;  2H6Q A;  3OKT A;  3IJ1 A;  3OW8 A;  3EMH A;  4YVD A;  3SHF A;  4A7J A;  3JAM g;  4N14 A;  2IUP A;  3DWL C;  2P9N C;  2HJB A;  3CFS B;  5IJ8 E;  4EWR A;  4A0B A;  3W15 A;  5IGQ A;  5EAR A;  3RN1 D;  4A08 B;  3I8C A;  2I0S A;  3C99 A;  4O3T B;  4QQE A;  1OMW B;  3ULE C;  3PVW B;  3I2N A;  3U4Y A;  4CC9 A;  5EAM A;  3EI4 B;  3UVN A;  2I3T A;  1SQJ A;  4A2L A;  2HYE A;  5CYK B;  4ERY A;  2PM6 B;  4GM8 A;  4PSW B;  3MKS B;  4J77 A;  1XIP A;  2IWF A;  4GM9 A;  2H6N A;  3NVX A;  2UZY B;  5HE3 B;  4Y5R D;  2W18 A;  4QRJ A;  4K3J B;  2IUQ A;  4J78 A;  3FGB A;  5K19 A;  2YMU A;  4HDJ A;  5TEE A;  4J8B A;  3BG0 A;  5FQD A;  5SXM A;  3RSE C;  1GXR A;  2OVQ B;  1PGU A;  5FKR A;  3V5W B;  1K32 A;  2YNN A;  2P9S C;  3DXM C;  3UKR C;  4J81 A;  4ZOZ A;  5AMS A;  4QT8 A;  3UKU C;  3SN6 B;  3CFV A;  2IUR A;  4Z8L A;  4Y7R A;  2H9L A;  2Z2N A;  2I3S A;  2HES X;  4PXW A;  5HE1 B;  4TZ4 A;  2H6K A;  4JXM A;  3RFH A;  2YBA A;  3MZK A;  4H5J A;  3IJC A;  3EI1 B;  3I89 A;  5I5I A;  1N6F A;  2J57 G;  2BCJ B;  5H14 A;  4A08 A;  3F3F A;  2H14 A;  3EG6 A;  2I0R A;  3VA6 A;  1PI6 A;  4CZV A;  5H17 A;  1P22 A;  3DM0 A;  3VGZ A;  4FA5 D;  4NSX A;  1MDA H;  2CE9 A;  3F3P A;  4H5I A;  3JZH A;  3JRP A;  4JSV C;  5HE2 B;  1PEV A;  3EI4 A;  1SHY B;  5HE0 B;  5GXI A;  4X63 B;  3I7N A;  5CYK A;  2HXC A;  4CY1 A;  1MG2 A;  2XU7 A;  5C9Z B;  2QXV A;  3KRW B;  4GQB B;  4BL0 A;  5THA A;  4FAV D;  4J8G A;  4L3G D;  3SLE D;  4CY3 A;  4E54 B;  2TRC B;  4LG8 A;  3SWS D;  2Z2O A;  2IAA A;  4FHL A;  4E5Z B;  2GNQ A;  3FRX A;  4CZY A;  2P9I C;  3UVM A;  3ODT A;  4GQ2 P;  3EI2 B;  2PBI B;  3L4O D;  3PVU B;  3VH0 A;  2OVP B;  5H1M A; 
#chains in the Genus database with same CATH topology
 2B5L A;  4O9D A;  4QL1 A;  5B4W A;  5IT9 g;  2IWK A;  4BUJ C;  3O4H A;  5CXB B;  4ZOV A;  2O9K A;  5FKT A;  3OF7 A;  4JSX C;  4PBZ A;  3RMZ D;  2OVR B;  2VDL A;  2HU5 A;  1QFM A;  3JPX A;  1GG2 B;  3I7O A;  4IA9 A;  4CY5 A;  3ZDY A;  4G56 B;  5CXC B;  5HQG A;  4DNW A;  2YNP A;  3IIW A;  4D6V A;  2VDO A;  4GM3 A;  3J80 g;  1YFQ A;  4O2W A;  2YNO A;  2AQ5 A;  5FFG A;  3AH8 B;  1Q47 A;  5TF2 A;  2YB8 B;  1XKS A;  2P9K C;  2PM9 B;  3EI1 A;  4A0A B;  4FA9 D;  3JB9 L;  3EI3 B;  5KDO B;  3IUM A;  3SJL D;  1SQ9 A;  2OIZ A;  4U1E I;  1PBY B;  3OKW A;  1N6E A;  3O4J A;  4GQ1 A;  4PSX B;  5M5U A;  3OL2 A;  3I7K A;  1K8K C;  4J84 A;  3IUJ A;  3MUO A;  3EQ7 A;  3ZE1 A;  1U2V C;  3RN0 D;  3FM0 A;  1OLZ A;  3L4M D;  4CY2 A;  4PC0 A;  1YR2 A;  4ES0 A;  5FKQ A;  2H9M A;  3IUQ A;  2EBS A;  1JOF A;  5I5J A;  3PSL A;  5IC7 A;  1GP2 B;  4CI3 A;  2H9N A;  4RE6 A;  3SFZ A;  2AH1 A;  4J82 A;  2IUV A;  1UOP A;  3A0F A;  1FWX A;  1C9I A;  4J86 A;  4X60 B;  2CN2 A;  2MTA H;  3RFG A;  4Z7O A;  3B7F A;  4E54 A;  3DXK C;  3EWE A;  4IMM A;  2VDN A;  3ZE0 A;  1ERJ A;  4E5Z A;  2PM7 B;  5M5T A;  5FKS A;  3UR4 A;  3SCY A;  2GC4 A;  1N6D A;  3IKO A;  3MZL A;  1GOT B;  2BBK H;  5FA5 B;  4ERZ A;  3T3M A;  4ESG A;  3EI2 A;  4GZ8 A;  4FWW A;  4JT6 C;  3PXW D;  4JT5 C;  5HYN B;  2P9U C;  5EMJ B;  2HU8 A;  4X3E A;  4G55 A;  5C2V B;  2Z2P A;  3I8E A;  3I7L A;  3FCU A;  4O3U B;  1TYQ C;  4JSN C;  5CXB A;  3OL2 B;  4L1Q D;  2J56 H;  1TYE A;  3OKY B;  2EIB A;  3OTT A;  1JMZ B;  4JSP C;  3PE7 A;  4AN0 A;  4UM8 A;  3DDU A;  2CE8 A;  5CXC A;  3AFC A;  4O02 A;  3AL9 A;  4ZN4 A;  1QFS A;  4BP9 A;  4FA1 D;  3KRX B;  4CI8 A;  3N0D A;  3V4P A;  5JWZ A;  3J81 g;  1E8M A;  3ORV D;  4XEI C;  1I2M B;  5EM2 B;  4JHN A;  1K3I A;  4CZX A;  5C2W B;  3V7D B;  2PM9 A;  4WJK A;  4A0A A;  4LG9 A;  4AX4 A;  4UI9 R;  3AL8 B;  2GC7 A;  3EI3 A;  2XDW A;  3BWS A;  1JJU B;  4J0W A;  1NR0 A;  3JZN A;  3IJ0 A;  3C75 H;  5EML B;  4X61 B;  4GGD A;  3UVL A;  1T2X A;  2VC2 A;  4CI1 A;  3GD1 I;  4AOW A;  3SBQ A;  3SXT D;  2OK4 A;  2OJY A;  3JRO A;  4Z7N A;  4GMB A;  3UVK A;  2AGL A;  1B9Y A;  3I7H A;  1GOG A;  4BCC A;  2G9A A;  1S4U X;  3E0C A;  4NEN A;  2VDR A;  4A11 B;  2H9P A;  3CIK B;  3C5M A;  4WK0 A;  2EIC A;  4J79 A;  4J87 A;  3UVO A;  5A2Q g;  3K72 A;  4BH6 A;  1M1X A;  1H2Y A;  4FA4 D;  5C86 A;  4GGC A;  4BCD A;  4ERQ A;  5FLX g;  2UZX B;  3SMR A;  1GOF A;  1XHM A;  3KCI A;  5FXY A;  2QZP A;  3K26 A;  2OK6 A;  4XYH A;  5TDH B;  4A2M A;  2HJ4 A;  4A09 B;  2J55 H;  4UM9 A;  2XYI A;  3SBR A;  2I0T A;  1RI6 A;  4L3H D;  3VI3 A;  1NEX B;  3C9C A;  3NVQ A;  1U4C A;  1O6G A;  2B5M A;  4MK0 B;  1B9X A;  2CN3 A;  4AMY A;  2XL3 A;  3PXT D;  2H68 A;  4OZU A;  5EMK B;  4FB1 D;  4AEZ A;  3IUL A;  2EID A;  3HFQ A;  3OKY A;  5FFO A;  1E5T A;  4XYI A;  4AN1 A;  3P4F A;  3SVW D;  5TEF A;  3JZG A;  2B5N A;  3GFC A;  4O45 A;  2VDK A;  2G99 A;  3BG1 A;  2VDM A;  4J0X A;  3K6S A;  4A0B B;  4PNK B;  3V9F A;  2P9L C;  2P9P C;  4FAN D;  4I79 A;  3MKQ A;  5GXH A;  5M61 A;  5EM2 A;  5EAP A;  5EMM B;  2AGY A;  3RRM C;  4D0K A;  3ZWL B;  1JV2 A;  2CNX A;  3AL8 A;  1L0Q A;  4JHP C;  1VYH C;  2VZ3 A;  1MG3 A;  3PXS D;  2H13 A;  3GRE A;  4PBY A;  2H3X A;  3K27 A;  1A12 A;  3I7P A;  5AFU 3;  5I5M A;  4GGA A;  4OWR A;  2WQ8 A;  2HKR A;  2XL2 A;  3F3G A;  3V4V A;  4ZOX A;  4U7A A;  1BPO A;  1UTC A;  4MMX A;  2XZG A;  3MXX A;  4A11 A;  2AGX A;  2AGW A;  3NID A;  2HKM A;  4CI2 A;  1O6F A;  3O4G A;  4JD2 C;  3SBP A;  5EAL A;  5E6U A;  1VE7 A;  3DSM A;  2AH0 A;  4J73 A;  2QC5 A;  4K3I D;  5GMK n;  2CO0 A;  3EU7 A;  1R5M A;  2AGZ A;  1TBG A;  1UOQ A;  3NVN A;  5IJ7 E;  4A09 A;  2B4E A;  4R7A B;  4ZOY A;  2Q7Q A;  5K1C C;  5GSA A;  3MMY A;  4KFM B;  1JMX B;  3N0E A;  4O1Q D;  3IJE A;  3RLM D;  3PSC B;  1QNI A;  4RE5 A;  3IIY A;  3K71 A;  5AJA A;  4NC4 A;  3T3P A;  5IGO A;  4L9O A;  4LGN A;  1A0R B;  2H47 A;  2CO0 C;  2H6Q A;  3OKT A;  3IJ1 A;  3OW8 A;  3EMH A;  4YVD A;  3SHF A;  4A7J A;  3JAM g;  4N14 A;  2IUP A;  3DWL C;  2P9N C;  2HJB A;  3FCS A;  3CFS B;  5IJ8 E;  1VZ2 A;  3IUN A;  4EWR A;  4A0B A;  3W15 A;  5IGQ A;  5EAR A;  3RN1 D;  3EQ9 A;  4A08 B;  3I8C A;  2I0S A;  3C99 A;  4O3T B;  4QQE A;  2BKL A;  1OMW B;  3ULE C;  4DNU A;  4G1E A;  4QAM A;  4NBM A;  3GC3 B;  3PVW B;  3I2N A;  3U4Y A;  4CC9 A;  5EAM A;  3EI4 B;  3UVN A;  2I3T A;  1SQJ A;  4A2L A;  2HYE A;  5CYK B;  4ERY A;  2PM6 B;  4NAA A;  4GM8 A;  4PSW B;  3MKS B;  4J77 A;  1XIP A;  2IWF A;  4GM9 A;  5C92 A;  2H6N A;  3ZDX A;  3NVX A;  2UZY B;  5HE3 B;  3IUR A;  2W18 A;  4QRJ A;  4K3J B;  4Y5R D;  2IUQ A;  3NIF A;  4J78 A;  3FGB A;  2VDP A;  5K19 A;  2YMU A;  4HDJ A;  5TEE A;  4J8B A;  3BG0 A;  1C9L A;  3QHY B;  3ZE2 A;  5FQD A;  5SXM A;  3RSE C;  3ZDZ A;  3VI4 A;  2EIE A;  1GXR A;  5HDB A;  5E6S A;  4BCB A;  3IVM A;  2OVQ B;  1PGU A;  5FKR A;  3V5W B;  5M5V A;  4WK2 A;  4D9S A;  5E6R A;  1K32 A;  1JTD B;  2YNN A;  2P9S C;  3DXM C;  1UOO A;  2QR5 A;  4J81 A;  3UKR C;  4ZOZ A;  5AMS A;  3NIG A;  4QT8 A;  3UKU C;  4AMZ A;  3SN6 B;  3CFV A;  1H2W A;  2IUR A;  4Z8L A;  4Y7R A;  2VDQ A;  2H9L A;  2Z2N A;  2I3S A;  2HES X;  1GOH A;  4PXW A;  5HE1 B;  3O4I A;  4TZ4 A;  2H6K A;  4WK4 A;  4JXM A;  3RFH A;  2YBA A;  4L1M A;  3MZK A;  4H5J A;  3IJC A;  4MMZ A;  3EI1 B;  3I89 A;  3MUN A;  1N6F A;  2J57 G;  5I5I A;  2BCJ B;  2HU7 A;  5H14 A;  4A08 A;  3F3F A;  2H14 A;  3EG6 A;  3EQ8 A;  1H2Z A;  2I0R A;  3VA6 A;  1PI6 A;  4CZV A;  4G1M A;  5H17 A;  1P22 A;  3DM0 A;  3VGZ A;  4FA5 D;  4NSX A;  1MDA H;  2CE9 A;  3F3P A;  4H5I A;  3JZH A;  3QI0 A;  1L5G A;  3JRP A;  4JSV C;  5HE2 B;  1PEV A;  3EI4 A;  1SHY B;  5HE0 B;  5GXI A;  4X63 B;  4BP8 A;  3I7N A;  4DNV A;  5CYK A;  2HXC A;  4CY1 A;  1MG2 A;  2XU7 A;  5C9Z B;  2QXV A;  5M5R A;  3KRW B;  4GQB B;  4BL0 A;  5THA A;  1H2X A;  4FAV D;  4J8G A;  4L3G D;  4IRZ A;  3SLE D;  4CY3 A;  4E54 B;  1U8C A;  2TRC B;  4LG8 A;  3SWS D;  2VZ1 A;  2Z2O A;  1E8N A;  2IAA A;  4FHL A;  4E5Z B;  2JKX A;  4Z7Q A;  2GNQ A;  3FRX A;  4CZY A;  5M5S A;  1VE6 A;  1VZ3 A;  2XE4 A;  4MMY A;  3MVD K;  2P9I C;  3UVM A;  3ODT A;  4GQ2 P;  3EI2 B;  2PBI B;  3L4O D;  3PVU B;  3VH0 A;  2OVP B;  5H1M A; 
#chains in the Genus database with same CATH homology
 2B5L A;  4O9D A;  4QL1 A;  5B4W A;  5IT9 g;  2IWK A;  4BUJ C;  5CXB B;  4ZOV A;  2O9K A;  5FKT A;  4JSX C;  4PBZ A;  3RMZ D;  2OVR B;  3JPX A;  1GG2 B;  3I7O A;  4IA9 A;  4CY5 A;  4G56 B;  5CXC B;  5HQG A;  2YNP A;  3IIW A;  4D6V A;  4GM3 A;  3J80 g;  1YFQ A;  2YNO A;  2AQ5 A;  3AH8 B;  1Q47 A;  5TF2 A;  2YB8 B;  1XKS A;  2P9K C;  2PM9 B;  3EI1 A;  4A0A B;  4FA9 D;  3JB9 L;  3EI3 B;  5KDO B;  3SJL D;  1SQ9 A;  2OIZ A;  4U1E I;  1PBY B;  3OKW A;  1N6E A;  4GQ1 A;  4PSX B;  3OL2 A;  3I7K A;  1K8K C;  4J84 A;  1U2V C;  3RN0 D;  3FM0 A;  1OLZ A;  3L4M D;  4CY2 A;  4PC0 A;  4ES0 A;  5FKQ A;  2H9M A;  2EBS A;  1JOF A;  5I5J A;  3PSL A;  5IC7 A;  1GP2 B;  4CI3 A;  2H9N A;  3SFZ A;  2AH1 A;  4J82 A;  2IUV A;  3RFG A;  3A0F A;  1FWX A;  4J86 A;  4X60 B;  2CN2 A;  2MTA H;  3B7F A;  4E54 A;  3DXK C;  3EWE A;  4IMM A;  1ERJ A;  4E5Z A;  2PM7 B;  5FKS A;  3UR4 A;  3SCY A;  2GC4 A;  1N6D A;  3IKO A;  3MZL A;  1GOT B;  2BBK H;  5FA5 B;  4ERZ A;  4ESG A;  3EI2 A;  4GZ8 A;  4FWW A;  4JT6 C;  3PXW D;  4JT5 C;  5HYN B;  2P9U C;  5EMJ B;  4X3E A;  5C2V B;  2Z2P A;  3I8E A;  3I7L A;  4O3U B;  1TYQ C;  4JSN C;  5CXB A;  3OL2 B;  4L1Q D;  2J56 H;  3OKY B;  3OTT A;  1JMZ B;  4JSP C;  3PE7 A;  2CE8 A;  5CXC A;  3AFC A;  3AL9 A;  4ZN4 A;  4FA1 D;  4CI8 A;  3KRX B;  3N0D A;  3J81 g;  5JWZ A;  3ORV D;  4XEI C;  5EM2 B;  4CZX A;  5C2W B;  3V7D B;  2PM9 A;  4A0A A;  4LG9 A;  4UI9 R;  3AL8 B;  2GC7 A;  3EI3 A;  3BWS A;  1JJU B;  4J0W A;  1NR0 A;  3JZN A;  3IJ0 A;  3C75 H;  5EML B;  4X61 B;  4GGD A;  3UVL A;  4CI1 A;  4AOW A;  3SBQ A;  3SXT D;  2OK4 A;  2OJY A;  3JRO A;  4GMB A;  3UVK A;  2AGL A;  1B9Y A;  3I7H A;  2G9A A;  1S4U X;  3E0C A;  4A11 B;  2H9P A;  3CIK B;  3C5M A;  4J79 A;  4J87 A;  3UVO A;  5A2Q g;  4BH6 A;  4FA4 D;  4GGC A;  4ERQ A;  5FLX g;  2UZX B;  3SMR A;  1XHM A;  5FXY A;  3K26 A;  2OK6 A;  4XYH A;  5TDH B;  4A2M A;  2HJ4 A;  4A09 B;  2J55 H;  2XYI A;  3SBR A;  2I0T A;  1RI6 A;  4L3H D;  1NEX B;  3NVQ A;  3C9C A;  1U4C A;  2B5M A;  4MK0 B;  1B9X A;  2CN3 A;  2XL3 A;  3PXT D;  2H68 A;  4OZU A;  5EMK B;  4FB1 D;  4AEZ A;  3HFQ A;  3OKY A;  4XYI A;  3P4F A;  3SVW D;  5TEF A;  3JZG A;  2B5N A;  3GFC A;  4O45 A;  2G99 A;  3BG1 A;  4J0X A;  4A0B B;  4PNK B;  3V9F A;  2P9L C;  2P9P C;  4FAN D;  4I79 A;  3MKQ A;  5GXH A;  5EM2 A;  5EAP A;  5EMM B;  2AGY A;  3RRM C;  4D0K A;  3ZWL B;  2CNX A;  3AL8 A;  1L0Q A;  1VYH C;  1MG3 A;  3PXS D;  2H13 A;  3GRE A;  4PBY A;  2H3X A;  3K27 A;  3I7P A;  5AFU 3;  5I5M A;  4GGA A;  4OWR A;  2XL2 A;  2HKR A;  3F3G A;  4ZOX A;  4U7A A;  3MXX A;  4A11 A;  2AGX A;  2AGW A;  2HKM A;  4CI2 A;  4JD2 C;  3SBP A;  5EAL A;  3DSM A;  2AH0 A;  4J73 A;  2QC5 A;  4K3I D;  5GMK n;  2CO0 A;  3EU7 A;  1R5M A;  2AGZ A;  1TBG A;  3NVN A;  5IJ7 E;  4A09 A;  2B4E A;  4R7A B;  4ZOY A;  2Q7Q A;  5K1C C;  5GSA A;  3MMY A;  4KFM B;  1JMX B;  3N0E A;  4O1Q D;  3RLM D;  3PSC B;  1QNI A;  3IIY A;  5AJA A;  5IGO A;  4L9O A;  4LGN A;  1A0R B;  2H47 A;  2CO0 C;  2H6Q A;  3OKT A;  3IJ1 A;  3OW8 A;  3EMH A;  4YVD A;  3SHF A;  4A7J A;  3JAM g;  4N14 A;  2IUP A;  3DWL C;  2P9N C;  2HJB A;  3CFS B;  5IJ8 E;  4EWR A;  4A0B A;  3W15 A;  5IGQ A;  5EAR A;  3RN1 D;  4A08 B;  3I8C A;  2I0S A;  3C99 A;  4O3T B;  4QQE A;  1OMW B;  3ULE C;  3PVW B;  3I2N A;  3U4Y A;  4CC9 A;  5EAM A;  3EI4 B;  3UVN A;  2I3T A;  1SQJ A;  4A2L A;  2HYE A;  5CYK B;  4ERY A;  2PM6 B;  4GM8 A;  4PSW B;  3MKS B;  4J77 A;  1XIP A;  2IWF A;  4GM9 A;  2H6N A;  3NVX A;  2UZY B;  5HE3 B;  4Y5R D;  2W18 A;  4QRJ A;  4K3J B;  2IUQ A;  4J78 A;  3FGB A;  5K19 A;  2YMU A;  4HDJ A;  5TEE A;  4J8B A;  3BG0 A;  5FQD A;  5SXM A;  3RSE C;  1GXR A;  2OVQ B;  1PGU A;  5FKR A;  3V5W B;  1K32 A;  2YNN A;  2P9S C;  3DXM C;  3UKR C;  4J81 A;  4ZOZ A;  5AMS A;  4QT8 A;  3UKU C;  3SN6 B;  3CFV A;  2IUR A;  4Z8L A;  4Y7R A;  2H9L A;  2Z2N A;  2I3S A;  2HES X;  4PXW A;  5HE1 B;  4TZ4 A;  2H6K A;  4JXM A;  3RFH A;  2YBA A;  3MZK A;  4H5J A;  3IJC A;  3EI1 B;  3I89 A;  5I5I A;  1N6F A;  2J57 G;  2BCJ B;  5H14 A;  4A08 A;  3F3F A;  2H14 A;  3EG6 A;  2I0R A;  3VA6 A;  1PI6 A;  4CZV A;  5H17 A;  1P22 A;  3DM0 A;  3VGZ A;  4FA5 D;  4NSX A;  1MDA H;  2CE9 A;  3F3P A;  4H5I A;  3JZH A;  3JRP A;  4JSV C;  5HE2 B;  1PEV A;  3EI4 A;  1SHY B;  5HE0 B;  5GXI A;  4X63 B;  3I7N A;  5CYK A;  2HXC A;  4CY1 A;  1MG2 A;  2XU7 A;  5C9Z B;  2QXV A;  3KRW B;  4GQB B;  4BL0 A;  5THA A;  4FAV D;  4J8G A;  4L3G D;  3SLE D;  4CY3 A;  4E54 B;  2TRC B;  4LG8 A;  3SWS D;  2Z2O A;  2IAA A;  4FHL A;  4E5Z B;  2GNQ A;  3FRX A;  4CZY A;  2P9I C;  3UVM A;  3ODT A;  4GQ2 P;  3EI2 B;  2PBI B;  3L4O D;  3PVU B;  3VH0 A;  2OVP B;  5H1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...