1GOTB

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
339
Chain Sequence
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (gtp-binding/transducer)
total genus 106
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gotB00
1Q47A 4X63B 3VA6A 3UVLA 4O3UB 3JZNA 2CO0A 3NVNA 3ULEC 5C2VB 2IURA 1XHMA 4FHLA 3RFGA 1YFQA 4GQBB 3BG1A 4PC0A 1OLZA 5HQGA 3N0EA 1QNIA 2QC5A 2OK6A 2CE9A 2HJ4A 1P22A 5CXBA 2YNPA 2H6NA 2HKRA 2P9UC 2B5MA 2J55H 5I5IA 3ODTA 2HESX 4CY5A 4XYIA 1JOFA 4ESGA 2PBIB 4Y5RD 2P9IC 1PGUA 3AH8B 2GNQA 5EMJB 3EI2B 2I0TA 5EMLB 3P4FA 4A2LA 4FA4D 4CY3A 4CZVA 3UVNA 2Z2PA 3RMZD 2H47A 5CYKB 2OVPB 3K27A 3EI1A 2I0SA 3AFCA 5H17A 2J57G 1N6DA 3EWEA 3OKTA 3IJ0A 4ES0A 4FA5D 5A2Qg 2OVQB 4JXMA 3AL9A 3NVQA 3UVKA 4FB1D 4ZOXA 5THAA 4UI9R 4K3ID 2OK4A 2G99A 2IUPA 2XYIA 4IA9A 4U7AA 4FA1D 3C9CA 4JSVC 1SQ9A 2CN3A 3V5WB 5FLXg 3JRPA 3A0FA 3JROA 5HYNB 1PEVA 3SBRA 3JZHA 1GOTB 2AGXA 4D0KA 3CFVA 3I7PA 3N0DA 4JT6C 3GREA 2MTAH 3DSMA 2AGLA 4J8BA 5FA5B 3SBQA 4IMMA 3NVXA 1JMZB 1VYHC 2AGYA 2H3XA 4PXWA 4KFMB 3PVWB 5B4WA 5GXHA 4XEIC 3RSEC 3UKRC 1L0QA 3UVMA 5FKRA 2H13A 4QL1A 3OL2A 1MG2A 5TF2A 2IUQA 4A11B 2B4EA 3EI4B 1XIPA 3U4YA 3V9FA 1N6FA 4GMBA 4K3JB 3HFQA 4OZUA 4A7JA 1GXRA 4CZXA 2YNOA 3CFSB 5AFU3 2H6QA 4QQEA 2Z2NA 3MMYA 3OTTA 4CI8A 5IGQA 4E54B 3L4MD 4A08B 5C9ZB 2IWKA 3ORVD 3EI3B 1PBYB 3J80g 3C5MA 4N14A 4XYHA 5EAMA 3IIWA 4A2MA 2H9NA 2PM7B 4J77A 4A09B 3OKYB 4BL0A 4MK0B 2P9PC 3IIYA 3DWLC 4PSXB 4Y7RA 3JB9L 2YNNA 4J81A 4EWRA 3RN0D 3I7HA 1JJUB 4ERYA 1NEXB 3I7LA 3OW8A 4PSWB 3I7NA 4LG8A 3DM0A 2Z2OA 4GGDA 3DXMC 3E0CA 4CI3A 2B5NA 3AL8B 2G9AA 4FWWA 4J86A 3J81g 3I7KA 4CY2A 5IT9g 3EMHA 1K8KC 4ZOVA 2PM9B 2CN2A 4ZN4A 2AH0A 4L1QD 3SCYA 5H1MA 4A0BA 4JT5C 3IJ1A 3FGBA 1OMWB 4FAND 2GC7A 2IWFA 1TYQC 3I8CA 3UR4A 4L3GD 1R5MA 3EI4A 5EAPA 4H5JA 1U2VC 5IJ7E 4R7AB 4H5IA 5EM2A 5CXCA 4G56B 2I0RA 3VH0A 5AMSA 3OKWA 4FA9D 5TEEA 4E54A 3VGZA 1JMXB 1SHYB 1SQJA 2AGWA 3EU7A 3PSCB 3DXKC 2P9SC 2PM6B 3MKSB 4CY1A 2I3SA 1RI6A 3L4OD 4QT8A 4A0AB 2XL3A 5KDOB 4X60B 2AQ5A 3OKYA 3SVWD 4GM8A 4GM3A 4I79A 2EBSA 4J79A 3B7FA 1S4UX 3KRXB 2P9KC 4O3TB 4GGCA 4LGNA 3IJCA 4CC9A 1XKSA 2H9LA 5IGOA 4J82A 3EI2A 4Z8LA 4GQ2P 4J0WA 5K1CC 2OVRB 1B9YA 5FKSA 1MDAH 1U4CA 3MKQA 4NSXA 3PXWD 2I3TA 5CYKA 5H14A 2IUVA 3F3GA 3V7DB 2HKMA 2BCJB 2HXCA 4HDJA 2O9KA 4PNKB 4X3EA 4JD2C 3FM0A 3JAMg 2HJBA 2B5LA 4TZ4A 3MZKA 3PSLA 3PXTD 4BH6A 2P9LC 4J84A 2HYEA 4FAVD 4PBYA 3RRMC 1ERJA 2H9PA 4AEZA 5C2WB 4ZOZA 2H68A 4GGAA 1NR0A 5AJAA 2OIZA 5HE1B 3RFHA 3GFCA 1N6EA 3F3PA 5HE2B 5FQDA 5SXMA 2CE8A 2W18A 4LG9A 4A0AA 3K26A 2IAAA 3JPXA 3F3FA 3EG6A 5EMMB 4JSPC 3SHFA 2CO0C 5JWZA 3SBPA 4D6VA 2YB8B 4O9DA 2UZXB 4J73A 4E5ZB 3RLMD 3MXXA 5FXYA 3SMRA 3OL2B 2GC4A 3JZGA 3RN1D 4JSXC 4J8GA 4ZOYA 3C75H 2H14A 5FKTA 2AGZA 4PBZA 4J0XA 5EMKB 4A11A 2XL2A 5GXIA 1FWXA 1PI6A 4X61B 2H6KA 2H9MA 2Q7QA 4GM9A 3SN6B 4QRJA 5EARA 3KRWB 4JSNC 4O1QD 5EALA 5TEFA 5HE3B 3SJLD 3SWSD 2AH1A 5IJ8E 4A08A 2YMUA 3SLED 4L3HD 3UKUC 3C99A 5GSAA 2J56H 3BG0A 3EI3A 5CXBB 4GZ8A 4BUJC 2CNXA 5TDHB 1A0RB 4CI1A 2TRCB 2XU7A 4A09A 3PE7A 5FKQA 4OWRA 4ERQA 3BWSA 3PVUB 3ZWLB 3I89A 3SFZA 3CIKB 3W15A 1GP2B 3PXSD 4CZYA 2P9NC 2UZYB 4ERZA 3UVOA 5GMKn 1GG2B 3AL8A 1MG3A 3EI1B 4L9OA 4CI2A 5K19A 2OJYA 2YBAA 3IKOA 3MZLA 4U1EI 4AOWA 2PM9A 3I8EA 4GQ1A 4A0BB 1TBGA 5IC7A 1B9XA 1K32A 5HE0B 4E5ZA 5I5MA 3FRXA 3I7OA 4YVDA 5I5JA 4J87A 2BBKH 4O45A 3SXTD 5EM2B 5CXCB 3I2NA 2QXVA 4J78A
chains in the Genus database with same CATH superfamily
4QAMA 1Q47A 3NIDA 4X63B 3VA6A 3UVLA 4O3UB 3JZNA 2CO0A 3NVNA 5M5RA 3ULEC 5C2VB 2IURA 1XHMA 4FHLA 2WQ8A 3RFGA 1YFQA 4GQBB 3BG1A 4PC0A 1OLZA 5HQGA 3N0EA 3K6SA 1QNIA 2QC5A 2OK6A 4AX4A 2CE9A 2HJ4A 2VDMA 1P22A 5CXBA 2YNPA 2H6NA 1H2ZA 2HKRA 1H2YA 2P9UC 2B5MA 2J55H 4AMYA 5I5IA 4JHNA 3ODTA 2HESX 4CY5A 4XYIA 1JOFA 4ESGA 2PBIB 4Y5RD 2P9IC 1PGUA 3AH8B 2GNQA 5EMJB 3EI2B 2I0TA 5EMLB 3IUJA 3P4FA 1O6GA 4A2LA 4FA4D 3FCSA 4CY3A 4DNWA 4CZVA 3UVNA 2Z2PA 3RMZD 2H47A 5CYKB 2OVPB 3K27A 3EI1A 2I0SA 3AFCA 5H17A 2J57G 5E6SA 3ZE0A 4L1MA 4WK4A 1N6DA 3EWEA 3OKTA 3IJ0A 4ES0A 4FA5D 4G1EA 5A2Qg 2OVQB 4JXMA 3AL9A 3NVQA 3MUOA 3UVKA 4FB1D 4ZOXA 5THAA 4UI9R 4K3ID 2OK4A 3IJEA 2G99A 2IUPA 1GOHA 2XYIA 4IA9A 4U7AA 4FA1D 4Z7QA 1UOOA 3C9CA 4JSVC 2VZ3A 1SQ9A 2CN3A 3V5WB 5FLXg 3JRPA 4AN1A 2EIBA 3A0FA 3JROA 2VDOA 2QR5A 5HYNB 1PEVA 3SBRA 3JZHA 1GOTB 2AGXA 3K72A 4D0KA 3CFVA 3I7PA 4G55A 3N0DA 4JT6C 3GREA 2MTAH 3DSMA 2AGLA 4J8BA 5FA5B 3SBQA 4IMMA 3NVXA 1JMZB 2AGYA 1VYHC 2XZGA 2H3XA 4PXWA 4KFMB 3O4GA 3PVWB 5B4WA 5GXHA 4XEIC 3T3MA 3RSEC 3UKRC 1GOGA 1L0QA 3UVMA 5FKRA 2H13A 4QL1A 4Z7NA 3OL2A 1MG2A 1UOPA 5TF2A 3VI4A 2IUQA 2HU8A 2B4EA 3EI4B 4A11B 1XIPA 3U4YA 3V9FA 1N6FA 1QFMA 4GMBA 4K3JB 3HFQA 4OZUA 4A7JA 1GXRA 4CZXA 2YNOA 3CFSB 5AFU3 2H6QA 4QQEA 2Z2NA 3V4PA 3MMYA 3OTTA 4CI8A 5IGQA 3EQ9A 4E54B 3L4MD 5FFGA 2VC2A 4A08B 5C9ZB 2IWKA 3ORVD 2VDLA 3EQ7A 3EI3B 1PBYB 3J80g 3C5MA 5C92A 4BP9A 3IUQA 5M5TA 4N14A 4XYHA 5EAMA 3IIWA 4A2MA 2H9NA 2PM7B 4J77A 4A09B 3OKYB 4BL0A 4MK0B 2P9PC 3IIYA 3DWLC 4PSXB 4Y7RA 3JB9L 2YNNA 4J81A 4EWRA 3RN0D 3GD1I 3I7HA 1JJUB 1VE7A 4ERYA 1NEXB 3I7LA 3OW8A 3VI3A 4PSWB 3I7NA 4LG8A 3DM0A 4NAAA 2Z2OA 3DXMC 4GGDA 3ZDYA 3E0CA 4CI3A 4JHPC 2B5NA 3AL8B 3IUMA 2G9AA 1C9IA 4FWWA 4J86A 3J81g 3I7KA 2VDRA 4CY2A 1YR2A 3EMHA 5IT9g 2HU5A 5C86A 1K8KC 4ZOVA 1VE6A 2PM9B 2CN2A 4ZN4A 2AH0A 4L1QD 4MMZA 3SCYA 5H1MA 4A0BA 1E5TA 4O02A 4JT5C 3IJ1A 3ZE2A 3FGBA 1L5GA 1M1XA 1OMWB 3EQ8A 4FAND 2GC7A 2IWFA 2EICA 1TYQC 3I8CA 3UR4A 4L3GD 1R5MA 2EIEA 3EI4A 5EAPA 4H5JA 3T3PA 1U2VC 4O2WA 3ZE1A 5IJ7E 4R7AB 4H5IA 5EM2A 5CXCA 4G56B 2I0RA 3VH0A 5E6RA 5AMSA 3V4VA 3OKWA 3O4JA 4FA9D 4Z7OA 5TEEA 4E54A 3OF7A 3VGZA 1JMXB 1SHYB 1SQJA 2AGWA 3EU7A 3PSCB 3DXKC 2P9SC 2PM6B 3MKSB 4CY1A 2I3SA 1RI6A 3L4OD 4QT8A 4AN0A 4A0AB 2XL3A 5KDOB 4X60B 4DNUA 2AQ5A 3OKYA 3SVWD 4GM8A 4GM3A 3NIFA 4I79A 4BCCA 2EBSA 4J79A 1A12A 3B7FA 1S4UX 3KRXB 2P9KC 4O3TB 4GGCA 4LGNA 2VDPA 3IJCA 4CC9A 1XKSA 2H9LA 5IGOA 3DDUA 4J82A 3EI2A 3K71A 4Z8LA 1H2WA 4GQ2P 4J0WA 5K1CC 2OVRB 1B9YA 5FKSA 1MDAH 1U4CA 3MKQA 4NSXA 3PXWD 3ZDXA 2I3TA 5CYKA 1JTDB 5H14A 4BP8A 1UTCA 3IULA 2IUVA 3F3GA 3V7DB 2HKMA 2BCJB 2HXCA 4HDJA 2O9KA 4PNKB 2XDWA 4X3EA 4JD2C 3FM0A 4BCDA 3JAMg 1C9LA 2HJBA 2B5LA 4TZ4A 3MZKA 4NENA 3PSLA 3PXTD 4BH6A 3IUNA 2P9LC 4J84A 2HYEA 4FAVD 4PBYA 3RRMC 1ERJA 2H9PA 4NBMA 1QFSA 4AEZA 1TYEA 5C2WB 4ZOZA 2H68A 4GGAA 1I2MB 3QI0A 1NR0A 5AJAA 2OIZA 5HE1B 4D9SA 3RFHA 5M5VA 3GFCA 1N6EA 3F3PA 5HE2B 4MMYA 2VDQA 5FQDA 5HDBA 5SXMA 2CE8A 1GOFA 2W18A 5M5SA 2HU7A 4LG9A 4A0AA 3MVDK 3K26A 2IAAA 3JPXA 3F3FA 3EG6A 4RE6A 5EMMB 4JSPC 3SHFA 2CO0C 5JWZA 3SBPA 1T2XA 4D6VA 2YB8B 4O9DA 2UZXB 4J73A 4AMZA 4IRZA 4E5ZB 5M61A 3RLMD 1E8NA 3MXXA 5FXYA 3SMRA 3OL2B 3ZDZA 2JKXA 2GC4A 3JZGA 3O4IA 4JSXC 4J8GA 3RN1D 4ZOYA 3C75H 2BKLA 2H14A 3NIGA 5E6UA 5FKTA 2AGZA 4PBZA 4J0XA 5EMKB 4A11A 1E8MA 2XL2A 5GXIA 2XE4A 1FWXA 1PI6A 4X61B 2H6KA 2H9MA 2Q7QA 2QZPA 4GM9A 3SN6B 4QRJA 5EARA 3KRWB 4WK2A 4JSNC 4BCBA 4O1QD 5EALA 5TEFA 5HE3B 3SJLD 3SWSD 2AH1A 5IJ8E 4A08A 2YMUA 3SLED 4L3HD 3UKUC 4DNVA 3C99A 5GSAA 2J56H 3BG0A 3EI3A 5CXBB 3KCIA 4GZ8A 2VZ1A 4BUJC 2CNXA 5TDHB 1A0RB 4UM8A 4CI1A 2TRCB 2XU7A 4A09A 1BPOA 3PE7A 5FKQA 3O4HA 4NC4A 4OWRA 4UM9A 1JV2A 4G1MA 4ERQA 5M5UA 3BWSA 3MUNA 5FFOA 3PVUB 2VDNA 3ZWLB 3I89A 3SFZA 3CIKB 3W15A 1GP2B 3PXSD 1VZ3A 4CZYA 2P9NC 2UZYB 4ERZA 3UVOA 1U8CA 3IURA 5GMKn 1GG2B 3AL8A 1MG3A 3EI1B 4L9OA 4CI2A 3FCUA 2OJYA 5K19A 2YBAA 3IKOA 3MZLA 4U1EI 4AOWA 2PM9A 3I8EA 4GQ1A 1K3IA 2EIDA 4A0BB 1H2XA 4WJKA 1O6FA 1TBGA 5IC7A 1B9XA 1K32A 4WK0A 5HE0B 4E5ZA 2VDKA 5I5MA 3FRXA 3I7OA 4RE5A 4YVDA 1VZ2A 5I5JA 4J87A 1UOQA 2BBKH 4O45A 3QHYB 3SXTD 5EM2B 5CXCB 3GC3B 3I2NA 2QXVA 3IVMA 4MMXA 4J78A
chains in the Genus database with same CATH topology
1Q47A 4X63B 3VA6A 3UVLA 4O3UB 3JZNA 2CO0A 3NVNA 3ULEC 5C2VB 2IURA 1XHMA 4FHLA 3RFGA 1YFQA 4GQBB 3BG1A 4PC0A 1OLZA 5HQGA 3N0EA 1QNIA 2QC5A 2OK6A 2CE9A 2HJ4A 1P22A 5CXBA 2YNPA 2H6NA 2HKRA 2P9UC 2B5MA 2J55H 5I5IA 3ODTA 2HESX 4CY5A 4XYIA 1JOFA 4ESGA 2PBIB 4Y5RD 2P9IC 1PGUA 3AH8B 2GNQA 5EMJB 3EI2B 2I0TA 5EMLB 3P4FA 4A2LA 4FA4D 4CY3A 4CZVA 3UVNA 2Z2PA 3RMZD 2H47A 5CYKB 2OVPB 3K27A 3EI1A 2I0SA 3AFCA 5H17A 2J57G 1N6DA 3EWEA 3OKTA 3IJ0A 4ES0A 4FA5D 5A2Qg 2OVQB 4JXMA 3AL9A 3NVQA 3UVKA 4FB1D 4ZOXA 5THAA 4UI9R 4K3ID 2OK4A 2G99A 2IUPA 2XYIA 4IA9A 4U7AA 4FA1D 3C9CA 4JSVC 1SQ9A 2CN3A 3V5WB 5FLXg 3JRPA 3A0FA 3JROA 5HYNB 1PEVA 3SBRA 3JZHA 1GOTB 2AGXA 4D0KA 3CFVA 3I7PA 3N0DA 4JT6C 3GREA 2MTAH 3DSMA 2AGLA 4J8BA 5FA5B 3SBQA 4IMMA 3NVXA 1JMZB 1VYHC 2AGYA 2H3XA 4PXWA 4KFMB 3PVWB 5B4WA 5GXHA 4XEIC 3RSEC 3UKRC 1L0QA 3UVMA 5FKRA 2H13A 4QL1A 3OL2A 1MG2A 5TF2A 2IUQA 4A11B 2B4EA 3EI4B 1XIPA 3U4YA 3V9FA 1N6FA 4GMBA 4K3JB 3HFQA 4OZUA 4A7JA 1GXRA 4CZXA 2YNOA 3CFSB 5AFU3 2H6QA 4QQEA 2Z2NA 3MMYA 3OTTA 4CI8A 5IGQA 4E54B 3L4MD 4A08B 5C9ZB 2IWKA 3ORVD 3EI3B 1PBYB 3J80g 3C5MA 4N14A 4XYHA 5EAMA 3IIWA 4A2MA 2H9NA 2PM7B 4J77A 4A09B 3OKYB 4BL0A 4MK0B 2P9PC 3IIYA 3DWLC 4PSXB 4Y7RA 3JB9L 2YNNA 4J81A 4EWRA 3RN0D 3I7HA 1JJUB 4ERYA 1NEXB 3I7LA 3OW8A 4PSWB 3I7NA 4LG8A 3DM0A 2Z2OA 4GGDA 3DXMC 3E0CA 4CI3A 2B5NA 3AL8B 2G9AA 4FWWA 4J86A 3J81g 3I7KA 4CY2A 5IT9g 3EMHA 1K8KC 4ZOVA 2PM9B 2CN2A 4ZN4A 2AH0A 4L1QD 3SCYA 5H1MA 4A0BA 4JT5C 3IJ1A 3FGBA 1OMWB 4FAND 2GC7A 2IWFA 1TYQC 3I8CA 3UR4A 4L3GD 1R5MA 3EI4A 5EAPA 4H5JA 1U2VC 5IJ7E 4R7AB 4H5IA 5EM2A 5CXCA 4G56B 2I0RA 3VH0A 5AMSA 3OKWA 4FA9D 5TEEA 4E54A 3VGZA 1JMXB 1SHYB 1SQJA 2AGWA 3EU7A 3PSCB 3DXKC 2P9SC 2PM6B 3MKSB 4CY1A 2I3SA 1RI6A 3L4OD 4QT8A 4A0AB 2XL3A 5KDOB 4X60B 2AQ5A 3OKYA 3SVWD 4GM8A 4GM3A 4I79A 2EBSA 4J79A 3B7FA 1S4UX 3KRXB 2P9KC 4O3TB 4GGCA 4LGNA 3IJCA 4CC9A 1XKSA 2H9LA 5IGOA 4J82A 3EI2A 4Z8LA 4GQ2P 4J0WA 5K1CC 2OVRB 1B9YA 5FKSA 1MDAH 1U4CA 3MKQA 4NSXA 3PXWD 2I3TA 5CYKA 5H14A 2IUVA 3F3GA 3V7DB 2HKMA 2BCJB 2HXCA 4HDJA 2O9KA 4PNKB 4X3EA 4JD2C 3FM0A 3JAMg 2HJBA 2B5LA 4TZ4A 3MZKA 3PSLA 3PXTD 4BH6A 2P9LC 4J84A 2HYEA 4FAVD 4PBYA 3RRMC 1ERJA 2H9PA 4AEZA 5C2WB 4ZOZA 2H68A 4GGAA 1NR0A 5AJAA 2OIZA 5HE1B 3RFHA 3GFCA 1N6EA 3F3PA 5HE2B 5FQDA 5SXMA 2CE8A 2W18A 4LG9A 4A0AA 3K26A 2IAAA 3JPXA 3F3FA 3EG6A 5EMMB 4JSPC 3SHFA 2CO0C 5JWZA 3SBPA 4D6VA 2YB8B 4O9DA 2UZXB 4J73A 4E5ZB 3RLMD 3MXXA 5FXYA 3SMRA 3OL2B 2GC4A 3JZGA 3RN1D 4JSXC 4J8GA 4ZOYA 3C75H 2H14A 5FKTA 2AGZA 4PBZA 4J0XA 5EMKB 4A11A 2XL2A 5GXIA 1FWXA 1PI6A 4X61B 2H6KA 2H9MA 2Q7QA 4GM9A 3SN6B 4QRJA 5EARA 3KRWB 4JSNC 4O1QD 5EALA 5TEFA 5HE3B 3SJLD 3SWSD 2AH1A 5IJ8E 4A08A 2YMUA 3SLED 4L3HD 3UKUC 3C99A 5GSAA 2J56H 3BG0A 3EI3A 5CXBB 4GZ8A 4BUJC 2CNXA 5TDHB 1A0RB 4CI1A 2TRCB 2XU7A 4A09A 3PE7A 5FKQA 4OWRA 4ERQA 3BWSA 3PVUB 3ZWLB 3I89A 3SFZA 3CIKB 3W15A 1GP2B 3PXSD 4CZYA 2P9NC 2UZYB 4ERZA 3UVOA 5GMKn 1GG2B 3AL8A 1MG3A 3EI1B 4L9OA 4CI2A 5K19A 2OJYA 2YBAA 3IKOA 3MZLA 4U1EI 4AOWA 2PM9A 3I8EA 4GQ1A 4A0BB 1TBGA 5IC7A 1B9XA 1K32A 5HE0B 4E5ZA 5I5MA 3FRXA 3I7OA 4YVDA 5I5JA 4J87A 2BBKH 4O45A 3SXTD 5EM2B 5CXCB 3I2NA 2QXVA 4J78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q47 A;  4X63 B;  3VA6 A;  3UVL A;  4O3U B;  3JZN A;  2CO0 A;  3NVN A;  3ULE C;  5C2V B;  2IUR A;  1XHM A;  4FHL A;  3RFG A;  1YFQ A;  4GQB B;  3BG1 A;  4PC0 A;  1OLZ A;  5HQG A;  3N0E A;  1QNI A;  2QC5 A;  2OK6 A;  2CE9 A;  2HJ4 A;  1P22 A;  5CXB A;  2YNP A;  2H6N A;  2HKR A;  2P9U C;  2B5M A;  2J55 H;  5I5I A;  3ODT A;  2HES X;  4CY5 A;  4XYI A;  1JOF A;  4ESG A;  2PBI B;  4Y5R D;  2P9I C;  1PGU A;  3AH8 B;  2GNQ A;  5EMJ B;  3EI2 B;  2I0T A;  5EML B;  3P4F A;  4A2L A;  4FA4 D;  4CY3 A;  4CZV A;  3UVN A;  2Z2P A;  3RMZ D;  2H47 A;  5CYK B;  2OVP B;  3K27 A;  3EI1 A;  2I0S A;  3AFC A;  5H17 A;  2J57 G;  1N6D A;  3EWE A;  3OKT A;  3IJ0 A;  4ES0 A;  4FA5 D;  5A2Q g;  2OVQ B;  4JXM A;  3AL9 A;  3NVQ A;  3UVK A;  4FB1 D;  4ZOX A;  5THA A;  4UI9 R;  4K3I D;  2OK4 A;  2G99 A;  2IUP A;  2XYI A;  4IA9 A;  4U7A A;  4FA1 D;  3C9C A;  4JSV C;  1SQ9 A;  2CN3 A;  3V5W B;  5FLX g;  3JRP A;  3A0F A;  3JRO A;  5HYN B;  1PEV A;  3SBR A;  3JZH A;  1GOT B;  2AGX A;  4D0K A;  3CFV A;  3I7P A;  3N0D A;  4JT6 C;  3GRE A;  2MTA H;  3DSM A;  2AGL A;  4J8B A;  5FA5 B;  3SBQ A;  4IMM A;  3NVX A;  1JMZ B;  1VYH C;  2AGY A;  2H3X A;  4PXW A;  4KFM B;  3PVW B;  5B4W A;  5GXH A;  4XEI C;  3RSE C;  3UKR C;  1L0Q A;  3UVM A;  5FKR A;  2H13 A;  4QL1 A;  3OL2 A;  1MG2 A;  5TF2 A;  2IUQ A;  4A11 B;  2B4E A;  3EI4 B;  1XIP A;  3U4Y A;  3V9F A;  1N6F A;  4GMB A;  4K3J B;  3HFQ A;  4OZU A;  4A7J A;  1GXR A;  4CZX A;  2YNO A;  3CFS B;  5AFU 3;  2H6Q A;  4QQE A;  2Z2N A;  3MMY A;  3OTT A;  4CI8 A;  5IGQ A;  4E54 B;  3L4M D;  4A08 B;  5C9Z B;  2IWK A;  3ORV D;  3EI3 B;  1PBY B;  3J80 g;  3C5M A;  4N14 A;  4XYH A;  5EAM A;  3IIW A;  4A2M A;  2H9N A;  2PM7 B;  4J77 A;  4A09 B;  3OKY B;  4BL0 A;  4MK0 B;  2P9P C;  3IIY A;  3DWL C;  4PSX B;  4Y7R A;  3JB9 L;  2YNN A;  4J81 A;  4EWR A;  3RN0 D;  3I7H A;  1JJU B;  4ERY A;  1NEX B;  3I7L A;  3OW8 A;  4PSW B;  3I7N A;  4LG8 A;  3DM0 A;  2Z2O A;  4GGD A;  3DXM C;  3E0C A;  4CI3 A;  2B5N A;  3AL8 B;  2G9A A;  4FWW A;  4J86 A;  3J81 g;  3I7K A;  4CY2 A;  5IT9 g;  3EMH A;  1K8K C;  4ZOV A;  2PM9 B;  2CN2 A;  4ZN4 A;  2AH0 A;  4L1Q D;  3SCY A;  5H1M A;  4A0B A;  4JT5 C;  3IJ1 A;  3FGB A;  1OMW B;  4FAN D;  2GC7 A;  2IWF A;  1TYQ C;  3I8C A;  3UR4 A;  4L3G D;  1R5M A;  3EI4 A;  5EAP A;  4H5J A;  1U2V C;  5IJ7 E;  4R7A B;  4H5I A;  5EM2 A;  5CXC A;  4G56 B;  2I0R A;  3VH0 A;  5AMS A;  3OKW A;  4FA9 D;  5TEE A;  4E54 A;  3VGZ A;  1JMX B;  1SHY B;  1SQJ A;  2AGW A;  3EU7 A;  3PSC B;  3DXK C;  2P9S C;  2PM6 B;  3MKS B;  4CY1 A;  2I3S A;  1RI6 A;  3L4O D;  4QT8 A;  4A0A B;  2XL3 A;  5KDO B;  4X60 B;  2AQ5 A;  3OKY A;  3SVW D;  4GM8 A;  4GM3 A;  4I79 A;  2EBS A;  4J79 A;  3B7F A;  1S4U X;  3KRX B;  2P9K C;  4O3T B;  4GGC A;  4LGN A;  3IJC A;  4CC9 A;  1XKS A;  2H9L A;  5IGO A;  4J82 A;  3EI2 A;  4Z8L A;  4GQ2 P;  4J0W A;  5K1C C;  2OVR B;  1B9Y A;  5FKS A;  1MDA H;  1U4C A;  3MKQ A;  4NSX A;  3PXW D;  2I3T A;  5CYK A;  5H14 A;  2IUV A;  3F3G A;  3V7D B;  2HKM A;  2BCJ B;  2HXC A;  4HDJ A;  2O9K A;  4PNK B;  4X3E A;  4JD2 C;  3FM0 A;  3JAM g;  2HJB A;  2B5L A;  4TZ4 A;  3MZK A;  3PSL A;  3PXT D;  4BH6 A;  2P9L C;  4J84 A;  2HYE A;  4FAV D;  4PBY A;  3RRM C;  1ERJ A;  2H9P A;  4AEZ A;  5C2W B;  4ZOZ A;  2H68 A;  4GGA A;  1NR0 A;  5AJA A;  2OIZ A;  5HE1 B;  3RFH A;  3GFC A;  1N6E A;  3F3P A;  5HE2 B;  5FQD A;  5SXM A;  2CE8 A;  2W18 A;  4LG9 A;  4A0A A;  3K26 A;  2IAA A;  3JPX A;  3F3F A;  3EG6 A;  5EMM B;  4JSP C;  3SHF A;  2CO0 C;  5JWZ A;  3SBP A;  4D6V A;  2YB8 B;  4O9D A;  2UZX B;  4J73 A;  4E5Z B;  3RLM D;  3MXX A;  5FXY A;  3SMR A;  3OL2 B;  2GC4 A;  3JZG A;  3RN1 D;  4JSX C;  4J8G A;  4ZOY A;  3C75 H;  2H14 A;  5FKT A;  2AGZ A;  4PBZ A;  4J0X A;  5EMK B;  4A11 A;  2XL2 A;  5GXI A;  1FWX A;  1PI6 A;  4X61 B;  2H6K A;  2H9M A;  2Q7Q A;  4GM9 A;  3SN6 B;  4QRJ A;  5EAR A;  3KRW B;  4JSN C;  4O1Q D;  5EAL A;  5TEF A;  5HE3 B;  3SJL D;  3SWS D;  2AH1 A;  5IJ8 E;  4A08 A;  2YMU A;  3SLE D;  4L3H D;  3UKU C;  3C99 A;  5GSA A;  2J56 H;  3BG0 A;  3EI3 A;  5CXB B;  4GZ8 A;  4BUJ C;  2CNX A;  5TDH B;  1A0R B;  4CI1 A;  2TRC B;  2XU7 A;  4A09 A;  3PE7 A;  5FKQ A;  4OWR A;  4ERQ A;  3BWS A;  3PVU B;  3ZWL B;  3I89 A;  3SFZ A;  3CIK B;  3W15 A;  1GP2 B;  3PXS D;  4CZY A;  2P9N C;  2UZY B;  4ERZ A;  3UVO A;  5GMK n;  1GG2 B;  3AL8 A;  1MG3 A;  3EI1 B;  4L9O A;  4CI2 A;  5K19 A;  2OJY A;  2YBA A;  3IKO A;  3MZL A;  4U1E I;  4AOW A;  2PM9 A;  3I8E A;  4GQ1 A;  4A0B B;  1TBG A;  5IC7 A;  1B9X A;  1K32 A;  5HE0 B;  4E5Z A;  5I5M A;  3FRX A;  3I7O A;  4YVD A;  5I5J A;  4J87 A;  2BBK H;  4O45 A;  3SXT D;  5EM2 B;  5CXC B;  3I2N A;  2QXV A;  4J78 A; 
#chains in the Genus database with same CATH topology
 4QAM A;  1Q47 A;  3NID A;  4X63 B;  3VA6 A;  3UVL A;  4O3U B;  3JZN A;  2CO0 A;  3NVN A;  5M5R A;  3ULE C;  5C2V B;  2IUR A;  1XHM A;  4FHL A;  2WQ8 A;  3RFG A;  1YFQ A;  4GQB B;  3BG1 A;  4PC0 A;  1OLZ A;  5HQG A;  3N0E A;  3K6S A;  1QNI A;  2QC5 A;  2OK6 A;  4AX4 A;  2CE9 A;  2HJ4 A;  2VDM A;  1P22 A;  5CXB A;  2YNP A;  2H6N A;  1H2Z A;  2HKR A;  1H2Y A;  2P9U C;  2B5M A;  2J55 H;  4AMY A;  5I5I A;  4JHN A;  3ODT A;  2HES X;  4CY5 A;  4XYI A;  1JOF A;  4ESG A;  2PBI B;  4Y5R D;  2P9I C;  1PGU A;  3AH8 B;  2GNQ A;  5EMJ B;  3EI2 B;  2I0T A;  5EML B;  3IUJ A;  3P4F A;  1O6G A;  4A2L A;  4FA4 D;  3FCS A;  4CY3 A;  4DNW A;  4CZV A;  3UVN A;  2Z2P A;  3RMZ D;  2H47 A;  5CYK B;  2OVP B;  3K27 A;  3EI1 A;  2I0S A;  3AFC A;  5H17 A;  2J57 G;  5E6S A;  3ZE0 A;  4L1M A;  4WK4 A;  1N6D A;  3EWE A;  3OKT A;  3IJ0 A;  4ES0 A;  4FA5 D;  4G1E A;  5A2Q g;  2OVQ B;  4JXM A;  3AL9 A;  3NVQ A;  3MUO A;  3UVK A;  4FB1 D;  4ZOX A;  5THA A;  4UI9 R;  4K3I D;  2OK4 A;  3IJE A;  2G99 A;  2IUP A;  1GOH A;  2XYI A;  4IA9 A;  4U7A A;  4FA1 D;  4Z7Q A;  1UOO A;  3C9C A;  4JSV C;  2VZ3 A;  1SQ9 A;  2CN3 A;  3V5W B;  5FLX g;  3JRP A;  4AN1 A;  2EIB A;  3A0F A;  3JRO A;  2VDO A;  2QR5 A;  5HYN B;  1PEV A;  3SBR A;  3JZH A;  1GOT B;  2AGX A;  3K72 A;  4D0K A;  3CFV A;  3I7P A;  4G55 A;  3N0D A;  4JT6 C;  3GRE A;  2MTA H;  3DSM A;  2AGL A;  4J8B A;  5FA5 B;  3SBQ A;  4IMM A;  3NVX A;  1JMZ B;  2AGY A;  1VYH C;  2XZG A;  2H3X A;  4PXW A;  4KFM B;  3O4G A;  3PVW B;  5B4W A;  5GXH A;  4XEI C;  3T3M A;  3RSE C;  3UKR C;  1GOG A;  1L0Q A;  3UVM A;  5FKR A;  2H13 A;  4QL1 A;  4Z7N A;  3OL2 A;  1MG2 A;  1UOP A;  5TF2 A;  3VI4 A;  2IUQ A;  2HU8 A;  2B4E A;  3EI4 B;  4A11 B;  1XIP A;  3U4Y A;  3V9F A;  1N6F A;  1QFM A;  4GMB A;  4K3J B;  3HFQ A;  4OZU A;  4A7J A;  1GXR A;  4CZX A;  2YNO A;  3CFS B;  5AFU 3;  2H6Q A;  4QQE A;  2Z2N A;  3V4P A;  3MMY A;  3OTT A;  4CI8 A;  5IGQ A;  3EQ9 A;  4E54 B;  3L4M D;  5FFG A;  2VC2 A;  4A08 B;  5C9Z B;  2IWK A;  3ORV D;  2VDL A;  3EQ7 A;  3EI3 B;  1PBY B;  3J80 g;  3C5M A;  5C92 A;  4BP9 A;  3IUQ A;  5M5T A;  4N14 A;  4XYH A;  5EAM A;  3IIW A;  4A2M A;  2H9N A;  2PM7 B;  4J77 A;  4A09 B;  3OKY B;  4BL0 A;  4MK0 B;  2P9P C;  3IIY A;  3DWL C;  4PSX B;  4Y7R A;  3JB9 L;  2YNN A;  4J81 A;  4EWR A;  3RN0 D;  3GD1 I;  3I7H A;  1JJU B;  1VE7 A;  4ERY A;  1NEX B;  3I7L A;  3OW8 A;  3VI3 A;  4PSW B;  3I7N A;  4LG8 A;  3DM0 A;  4NAA A;  2Z2O A;  3DXM C;  4GGD A;  3ZDY A;  3E0C A;  4CI3 A;  4JHP C;  2B5N A;  3AL8 B;  3IUM A;  2G9A A;  1C9I A;  4FWW A;  4J86 A;  3J81 g;  3I7K A;  2VDR A;  4CY2 A;  1YR2 A;  3EMH A;  5IT9 g;  2HU5 A;  5C86 A;  1K8K C;  4ZOV A;  1VE6 A;  2PM9 B;  2CN2 A;  4ZN4 A;  2AH0 A;  4L1Q D;  4MMZ A;  3SCY A;  5H1M A;  4A0B A;  1E5T A;  4O02 A;  4JT5 C;  3IJ1 A;  3ZE2 A;  3FGB A;  1L5G A;  1M1X A;  1OMW B;  3EQ8 A;  4FAN D;  2GC7 A;  2IWF A;  2EIC A;  1TYQ C;  3I8C A;  3UR4 A;  4L3G D;  1R5M A;  2EIE A;  3EI4 A;  5EAP A;  4H5J A;  3T3P A;  1U2V C;  4O2W A;  3ZE1 A;  5IJ7 E;  4R7A B;  4H5I A;  5EM2 A;  5CXC A;  4G56 B;  2I0R A;  3VH0 A;  5E6R A;  5AMS A;  3V4V A;  3OKW A;  3O4J A;  4FA9 D;  4Z7O A;  5TEE A;  4E54 A;  3OF7 A;  3VGZ A;  1JMX B;  1SHY B;  1SQJ A;  2AGW A;  3EU7 A;  3PSC B;  3DXK C;  2P9S C;  2PM6 B;  3MKS B;  4CY1 A;  2I3S A;  1RI6 A;  3L4O D;  4QT8 A;  4AN0 A;  4A0A B;  2XL3 A;  5KDO B;  4X60 B;  4DNU A;  2AQ5 A;  3OKY A;  3SVW D;  4GM8 A;  4GM3 A;  3NIF A;  4I79 A;  4BCC A;  2EBS A;  4J79 A;  1A12 A;  3B7F A;  1S4U X;  3KRX B;  2P9K C;  4O3T B;  4GGC A;  4LGN A;  2VDP A;  3IJC A;  4CC9 A;  1XKS A;  2H9L A;  5IGO A;  3DDU A;  4J82 A;  3EI2 A;  3K71 A;  4Z8L A;  1H2W A;  4GQ2 P;  4J0W A;  5K1C C;  2OVR B;  1B9Y A;  5FKS A;  1MDA H;  1U4C A;  3MKQ A;  4NSX A;  3PXW D;  3ZDX A;  2I3T A;  5CYK A;  1JTD B;  5H14 A;  4BP8 A;  1UTC A;  3IUL A;  2IUV A;  3F3G A;  3V7D B;  2HKM A;  2BCJ B;  2HXC A;  4HDJ A;  2O9K A;  4PNK B;  2XDW A;  4X3E A;  4JD2 C;  3FM0 A;  4BCD A;  3JAM g;  1C9L A;  2HJB A;  2B5L A;  4TZ4 A;  3MZK A;  4NEN A;  3PSL A;  3PXT D;  4BH6 A;  3IUN A;  2P9L C;  4J84 A;  2HYE A;  4FAV D;  4PBY A;  3RRM C;  1ERJ A;  2H9P A;  4NBM A;  1QFS A;  4AEZ A;  1TYE A;  5C2W B;  4ZOZ A;  2H68 A;  4GGA A;  1I2M B;  3QI0 A;  1NR0 A;  5AJA A;  2OIZ A;  5HE1 B;  4D9S A;  3RFH A;  5M5V A;  3GFC A;  1N6E A;  3F3P A;  5HE2 B;  4MMY A;  2VDQ A;  5FQD A;  5HDB A;  5SXM A;  2CE8 A;  1GOF A;  2W18 A;  5M5S A;  2HU7 A;  4LG9 A;  4A0A A;  3MVD K;  3K26 A;  2IAA A;  3JPX A;  3F3F A;  3EG6 A;  4RE6 A;  5EMM B;  4JSP C;  3SHF A;  2CO0 C;  5JWZ A;  3SBP A;  1T2X A;  4D6V A;  2YB8 B;  4O9D A;  2UZX B;  4J73 A;  4AMZ A;  4IRZ A;  4E5Z B;  5M61 A;  3RLM D;  1E8N A;  3MXX A;  5FXY A;  3SMR A;  3OL2 B;  3ZDZ A;  2JKX A;  2GC4 A;  3JZG A;  3O4I A;  4JSX C;  4J8G A;  3RN1 D;  4ZOY A;  3C75 H;  2BKL A;  2H14 A;  3NIG A;  5E6U A;  5FKT A;  2AGZ A;  4PBZ A;  4J0X A;  5EMK B;  4A11 A;  1E8M A;  2XL2 A;  5GXI A;  2XE4 A;  1FWX A;  1PI6 A;  4X61 B;  2H6K A;  2H9M A;  2Q7Q A;  2QZP A;  4GM9 A;  3SN6 B;  4QRJ A;  5EAR A;  3KRW B;  4WK2 A;  4JSN C;  4BCB A;  4O1Q D;  5EAL A;  5TEF A;  5HE3 B;  3SJL D;  3SWS D;  2AH1 A;  5IJ8 E;  4A08 A;  2YMU A;  3SLE D;  4L3H D;  3UKU C;  4DNV A;  3C99 A;  5GSA A;  2J56 H;  3BG0 A;  3EI3 A;  5CXB B;  3KCI A;  4GZ8 A;  2VZ1 A;  4BUJ C;  2CNX A;  5TDH B;  1A0R B;  4UM8 A;  4CI1 A;  2TRC B;  2XU7 A;  4A09 A;  1BPO A;  3PE7 A;  5FKQ A;  3O4H A;  4NC4 A;  4OWR A;  4UM9 A;  1JV2 A;  4G1M A;  4ERQ A;  5M5U A;  3BWS A;  3MUN A;  5FFO A;  3PVU B;  2VDN A;  3ZWL B;  3I89 A;  3SFZ A;  3CIK B;  3W15 A;  1GP2 B;  3PXS D;  1VZ3 A;  4CZY A;  2P9N C;  2UZY B;  4ERZ A;  3UVO A;  1U8C A;  3IUR A;  5GMK n;  1GG2 B;  3AL8 A;  1MG3 A;  3EI1 B;  4L9O A;  4CI2 A;  3FCU A;  2OJY A;  5K19 A;  2YBA A;  3IKO A;  3MZL A;  4U1E I;  4AOW A;  2PM9 A;  3I8E A;  4GQ1 A;  1K3I A;  2EID A;  4A0B B;  1H2X A;  4WJK A;  1O6F A;  1TBG A;  5IC7 A;  1B9X A;  1K32 A;  4WK0 A;  5HE0 B;  4E5Z A;  2VDK A;  5I5M A;  3FRX A;  3I7O A;  4RE5 A;  4YVD A;  1VZ2 A;  5I5J A;  4J87 A;  1UOQ A;  2BBK H;  4O45 A;  3QHY B;  3SXT D;  5EM2 B;  5CXC B;  3GC3 B;  3I2N A;  2QXV A;  3IVM A;  4MMX A;  4J78 A; 
#chains in the Genus database with same CATH homology
 1Q47 A;  4X63 B;  3VA6 A;  3UVL A;  4O3U B;  3JZN A;  2CO0 A;  3NVN A;  3ULE C;  5C2V B;  2IUR A;  1XHM A;  4FHL A;  3RFG A;  1YFQ A;  4GQB B;  3BG1 A;  4PC0 A;  1OLZ A;  5HQG A;  3N0E A;  1QNI A;  2QC5 A;  2OK6 A;  2CE9 A;  2HJ4 A;  1P22 A;  5CXB A;  2YNP A;  2H6N A;  2HKR A;  2P9U C;  2B5M A;  2J55 H;  5I5I A;  3ODT A;  2HES X;  4CY5 A;  4XYI A;  1JOF A;  4ESG A;  2PBI B;  4Y5R D;  2P9I C;  1PGU A;  3AH8 B;  2GNQ A;  5EMJ B;  3EI2 B;  2I0T A;  5EML B;  3P4F A;  4A2L A;  4FA4 D;  4CY3 A;  4CZV A;  3UVN A;  2Z2P A;  3RMZ D;  2H47 A;  5CYK B;  2OVP B;  3K27 A;  3EI1 A;  2I0S A;  3AFC A;  5H17 A;  2J57 G;  1N6D A;  3EWE A;  3OKT A;  3IJ0 A;  4ES0 A;  4FA5 D;  5A2Q g;  2OVQ B;  4JXM A;  3AL9 A;  3NVQ A;  3UVK A;  4FB1 D;  4ZOX A;  5THA A;  4UI9 R;  4K3I D;  2OK4 A;  2G99 A;  2IUP A;  2XYI A;  4IA9 A;  4U7A A;  4FA1 D;  3C9C A;  4JSV C;  1SQ9 A;  2CN3 A;  3V5W B;  5FLX g;  3JRP A;  3A0F A;  3JRO A;  5HYN B;  1PEV A;  3SBR A;  3JZH A;  1GOT B;  2AGX A;  4D0K A;  3CFV A;  3I7P A;  3N0D A;  4JT6 C;  3GRE A;  2MTA H;  3DSM A;  2AGL A;  4J8B A;  5FA5 B;  3SBQ A;  4IMM A;  3NVX A;  1JMZ B;  1VYH C;  2AGY A;  2H3X A;  4PXW A;  4KFM B;  3PVW B;  5B4W A;  5GXH A;  4XEI C;  3RSE C;  3UKR C;  1L0Q A;  3UVM A;  5FKR A;  2H13 A;  4QL1 A;  3OL2 A;  1MG2 A;  5TF2 A;  2IUQ A;  4A11 B;  2B4E A;  3EI4 B;  1XIP A;  3U4Y A;  3V9F A;  1N6F A;  4GMB A;  4K3J B;  3HFQ A;  4OZU A;  4A7J A;  1GXR A;  4CZX A;  2YNO A;  3CFS B;  5AFU 3;  2H6Q A;  4QQE A;  2Z2N A;  3MMY A;  3OTT A;  4CI8 A;  5IGQ A;  4E54 B;  3L4M D;  4A08 B;  5C9Z B;  2IWK A;  3ORV D;  3EI3 B;  1PBY B;  3J80 g;  3C5M A;  4N14 A;  4XYH A;  5EAM A;  3IIW A;  4A2M A;  2H9N A;  2PM7 B;  4J77 A;  4A09 B;  3OKY B;  4BL0 A;  4MK0 B;  2P9P C;  3IIY A;  3DWL C;  4PSX B;  4Y7R A;  3JB9 L;  2YNN A;  4J81 A;  4EWR A;  3RN0 D;  3I7H A;  1JJU B;  4ERY A;  1NEX B;  3I7L A;  3OW8 A;  4PSW B;  3I7N A;  4LG8 A;  3DM0 A;  2Z2O A;  4GGD A;  3DXM C;  3E0C A;  4CI3 A;  2B5N A;  3AL8 B;  2G9A A;  4FWW A;  4J86 A;  3J81 g;  3I7K A;  4CY2 A;  5IT9 g;  3EMH A;  1K8K C;  4ZOV A;  2PM9 B;  2CN2 A;  4ZN4 A;  2AH0 A;  4L1Q D;  3SCY A;  5H1M A;  4A0B A;  4JT5 C;  3IJ1 A;  3FGB A;  1OMW B;  4FAN D;  2GC7 A;  2IWF A;  1TYQ C;  3I8C A;  3UR4 A;  4L3G D;  1R5M A;  3EI4 A;  5EAP A;  4H5J A;  1U2V C;  5IJ7 E;  4R7A B;  4H5I A;  5EM2 A;  5CXC A;  4G56 B;  2I0R A;  3VH0 A;  5AMS A;  3OKW A;  4FA9 D;  5TEE A;  4E54 A;  3VGZ A;  1JMX B;  1SHY B;  1SQJ A;  2AGW A;  3EU7 A;  3PSC B;  3DXK C;  2P9S C;  2PM6 B;  3MKS B;  4CY1 A;  2I3S A;  1RI6 A;  3L4O D;  4QT8 A;  4A0A B;  2XL3 A;  5KDO B;  4X60 B;  2AQ5 A;  3OKY A;  3SVW D;  4GM8 A;  4GM3 A;  4I79 A;  2EBS A;  4J79 A;  3B7F A;  1S4U X;  3KRX B;  2P9K C;  4O3T B;  4GGC A;  4LGN A;  3IJC A;  4CC9 A;  1XKS A;  2H9L A;  5IGO A;  4J82 A;  3EI2 A;  4Z8L A;  4GQ2 P;  4J0W A;  5K1C C;  2OVR B;  1B9Y A;  5FKS A;  1MDA H;  1U4C A;  3MKQ A;  4NSX A;  3PXW D;  2I3T A;  5CYK A;  5H14 A;  2IUV A;  3F3G A;  3V7D B;  2HKM A;  2BCJ B;  2HXC A;  4HDJ A;  2O9K A;  4PNK B;  4X3E A;  4JD2 C;  3FM0 A;  3JAM g;  2HJB A;  2B5L A;  4TZ4 A;  3MZK A;  3PSL A;  3PXT D;  4BH6 A;  2P9L C;  4J84 A;  2HYE A;  4FAV D;  4PBY A;  3RRM C;  1ERJ A;  2H9P A;  4AEZ A;  5C2W B;  4ZOZ A;  2H68 A;  4GGA A;  1NR0 A;  5AJA A;  2OIZ A;  5HE1 B;  3RFH A;  3GFC A;  1N6E A;  3F3P A;  5HE2 B;  5FQD A;  5SXM A;  2CE8 A;  2W18 A;  4LG9 A;  4A0A A;  3K26 A;  2IAA A;  3JPX A;  3F3F A;  3EG6 A;  5EMM B;  4JSP C;  3SHF A;  2CO0 C;  5JWZ A;  3SBP A;  4D6V A;  2YB8 B;  4O9D A;  2UZX B;  4J73 A;  4E5Z B;  3RLM D;  3MXX A;  5FXY A;  3SMR A;  3OL2 B;  2GC4 A;  3JZG A;  3RN1 D;  4JSX C;  4J8G A;  4ZOY A;  3C75 H;  2H14 A;  5FKT A;  2AGZ A;  4PBZ A;  4J0X A;  5EMK B;  4A11 A;  2XL2 A;  5GXI A;  1FWX A;  1PI6 A;  4X61 B;  2H6K A;  2H9M A;  2Q7Q A;  4GM9 A;  3SN6 B;  4QRJ A;  5EAR A;  3KRW B;  4JSN C;  4O1Q D;  5EAL A;  5TEF A;  5HE3 B;  3SJL D;  3SWS D;  2AH1 A;  5IJ8 E;  4A08 A;  2YMU A;  3SLE D;  4L3H D;  3UKU C;  3C99 A;  5GSA A;  2J56 H;  3BG0 A;  3EI3 A;  5CXB B;  4GZ8 A;  4BUJ C;  2CNX A;  5TDH B;  1A0R B;  4CI1 A;  2TRC B;  2XU7 A;  4A09 A;  3PE7 A;  5FKQ A;  4OWR A;  4ERQ A;  3BWS A;  3PVU B;  3ZWL B;  3I89 A;  3SFZ A;  3CIK B;  3W15 A;  1GP2 B;  3PXS D;  4CZY A;  2P9N C;  2UZY B;  4ERZ A;  3UVO A;  5GMK n;  1GG2 B;  3AL8 A;  1MG3 A;  3EI1 B;  4L9O A;  4CI2 A;  5K19 A;  2OJY A;  2YBA A;  3IKO A;  3MZL A;  4U1E I;  4AOW A;  2PM9 A;  3I8E A;  4GQ1 A;  4A0B B;  1TBG A;  5IC7 A;  1B9X A;  1K32 A;  5HE0 B;  4E5Z A;  5I5M A;  3FRX A;  3I7O A;  4YVD A;  5I5J A;  4J87 A;  2BBK H;  4O45 A;  3SXT D;  5EM2 B;  5CXC B;  3I2N A;  2QXV A;  4J78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...