1GOTB

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
339
Chain Sequence
b'SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
molecule tags Complex (gtp-binding/transducer)
source organism Bos taurus
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
total genus 106
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gotB00
5FA5B 4GM3A 4FAVD 5C2VB 4GQBB 2YBAA 3EU7A 4J8GA 2P9LC 4ZOXA 4J73A 4K3ID 4E54A 3SHFA 3AFCA 3F3PA 3L4OD 3UVMA 5JWZA 5IT9g 3IJ0A 5H1MA 2CO0A 5TDHB 5GMKn 3EMHA 4BL0A 3OKYA 3C5MA 2MTAH 5EAMA 1XKSA 3JB9L 4GQ1A 3OKWA 4H5JA 3MKQA 3N0DA 3FM0A 1MG3A 3ORVD 4MK0B 4XYIA 4QL1A 5FLXg 4J82A 2UZYB 3ULEC 3HFQA 2EBSA 3JZNA 4XEIC 4OZUA 2AGZA 4ERZA 3V5WB 4A2LA 2O9KA 2P9SC 4A0BB 3SBQA 3UVOA 4J86A 4ES0A 3SVWD 4J81A 3OKYB 4JD2C 3UVLA 3MMYA 2PM9A 1JMZB 1R5MA 3L4MD 2HJ4A 3I7NA 4I79A 3SLED 4GGDA 1MG2A 4JSXC 5AFU3 4YVDA 3EI2B 1L0QA 2Q7QA 2B5LA 4Y7RA 2YNOA 2P9IC 5GXIA 4A2MA 3UKRC 2OVRB 3PVUB 3SBPA 3SCYA 5GXHA 4IMMA 4CC9A 3BG0A 4ZOYA 3I7LA 4QT8A 4CI2A 2YMUA 3C75H 3I7PA 2AH0A 5IJ8E 2P9NC 4FHLA 4E5ZA 4O3UB 4L3GD 5K1CC 4LG8A 5HE0B 4HDJA 5IGOA 2BBKH 2P9KC 3RN1D 2CN2A 5CXCA 3I7KA 2XYIA 2UZXB 3OKTA 3V7DB 5EAPA 1ERJA 4H5IA 4J78A 3MXXA 1TBGA 2H47A 4TZ4A 4A09A 1GG2B 2CNXA 4E54B 4JT6C 4K3JB 5C2WB 3VA6A 1OMWB 4PBYA 5IJ7E 4JSPC 4LG9A 4XYHA 4Y5RD 3OL2A 1K32A 2AGWA 4GM9A 3C9CA 4GGCA 2GNQA 3OTTA 4ZN4A 2I0TA 3J81g 4CI8A 3VGZA 5EALA 3PSLA 3SXTD 5EMKB 4J79A 4U1EI 1JOFA 2PM6B 2AGLA 2Z2NA 5EMJB 1N6FA 4A0AA 5HQGA 5I5IA 4GGAA 4A08A 4GZ8A 2I3TA 2IURA 3AL9A 4CY1A 3AH8B 5H17A 4JT5C 3ZWLB 4D6VA 1MDAH 4U7AA 2J57G 2PM9B 4X60B 1A0RB 3B7FA 2B5MA 3AL8B 2OVQB 3IJ1A 2OIZA 3I7HA 5IC7A 1NR0A 3EI1B 1RI6A 2HYEA 4CI3A 4R7AB 3P4FA 2OK4A 5K19A 3IKOA 1PEVA 3JRPA 1U2VC 3KRXB 1SHYB 2G99A 1PGUA 3EI4B 3PXSD 2H13A 3DM0A 4JSNC 1YFQA 3FGBA 2HKRA 1PBYB 2B4EA 1B9YA 2IWFA 2OVPB 3DSMA 4O9DA 5CXBA 4A11A 5CXCB 2AGYA 2Z2OA 2IWKA 1N6EA 5A2Qg 3PSCB 2I3SA 3SN6B 2CO0C 3RLMD 4FA4D 1XHMA 4X61B 4BH6A 4ZOVA 1SQJA 3F3GA 1U4CA 2H9LA 3CIKB 5I5MA 3E0CA 5KDOB 3CFVA 3JZHA 4LGNA 2GC7A 3JPXA 2G9AA 3NVXA 2OK6A 2IUQA 5THAA 5TEEA 5B4WA 3PXWD 3DXMC 3UKUC 4D0KA 2IAAA 4A7JA 2CE9A 4A11B 4L3HD 3AL8A 5EARA 4JSVC 4FAND 4JXMA 2IUVA 5AMSA 3RN0D 1JMXB 4GM8A 4O3TB 4J87A 3I7OA 4CY2A 4QQEA 3UR4A 1JJUB 4CY3A 5FKQA 1FWXA 2P9PC 3EG6A 4IA9A 1Q47A 3J80g 4X63B 2H9PA 4J77A 1GXRA 5FQDA 3DXKC 4UI9R 3IIYA 4O45A 3FRXA 2H6QA 2Z2PA 5HE1B 2CE8A 3I89A 3VH0A 3RFHA 5EM2B 1B9XA 5EM2A 2YNNA 3JAMg 4J8BA 4CY5A 4A08B 5SXMA 1S4UX 5H14A 3RSEC 4EWRA 4ERYA 4PSXB 3BWSA 3EI3B 3I8EA 3NVNA 2HXCA 3ODTA 1TYQC 3EI2A 4J0XA 1NEXB 2GC4A 2H9NA 2XL3A 4N14A 5FKSA 3KRWB 3N0EA 2XL2A 4FA1D 3SJLD 3GFCA 3RFGA 5GSAA 3DWLC 5FKTA 3I8CA 2QXVA 3MZLA 3SBRA 4A0BA 2HKMA 5HE3B 1P22A 2TRCB 2H9MA 3U4YA 5CYKB 1K8KC 3OL2B 3PVWB 3K27A 4KFMB 3V9FA 3PE7A 4O1QD 4J84A 4CZYA 5IGQA 3JROA 3C99A 4NSXA 4A0AB 3A0FA 4L9OA 5I5JA 3I2NA 4A09B 2QC5A 4CZVA 2PBIB 4GQ2P 2H68A 2H6NA 4G56B 2OJYA 4AOWA 3EI4A 2AGXA 4PXWA 3CFSB 3UVKA 3BG1A 3RMZD 5HYNB 3NVQA 1QNIA 1PI6A 2HESX 2BCJB 2H14A 5CXBB 4PC0A 3EI1A 4PNKB 1GOTB 2H6KA 1SQ9A 3MKSB 1VYHC 4FWWA 3IIWA 4FB1D 5TF2A 2IUPA 2I0SA 3JZGA 2J55H 1GP2B 3SMRA 2J56H 4CI1A 2H3XA 3SFZA 2XU7A 1OLZA 4Z8LA 4E5ZB 2AH1A 3OW8A 2W18A 4CZXA 3W15A 4PSWB 5HE2B 4BUJC 4X3EA 4ERQA 4ESGA 2YNPA 4L1QD 5EMLB 3EI3A 3PXTD 2I0RA 3F3FA 5CYKA 4OWRA 2CN3A 2B5NA 4J0WA 3K26A 3SWSD 1N6DA 4FA9D 4AEZA 4PBZA 5TEFA 2YB8B 2PM7B 5FXYA 2P9UC 2HJBA 3GREA 4GMBA 5FKRA 1XIPA 5AJAA 3MZKA 3EWEA 3UVNA 3RRMC 4FA5D 5EMMB 5C9ZB 4QRJA 2AQ5A 3IJCA 4ZOZA
chains in the Genus database with same CATH superfamily
5FA5B 1O6GA 2XDWA 4GM3A 1JV2A 4FAVD 5C2VB 4GQBB 2YBAA 3EU7A 4J8GA 1T2XA 2P9LC 4ZOXA 4J73A 4K3ID 4E54A 3SHFA 3AFCA 3F3PA 3L4OD 2VZ1A 3UVMA 5JWZA 5IT9g 3IJ0A 2VDQA 5H1MA 2CO0A 5TDHB 5GMKn 3IUMA 1C9IA 3EMHA 4BL0A 3OKYA 3C5MA 2MTAH 2VDNA 5EAMA 1XKSA 1JTDB 3JB9L 4GQ1A 3OKWA 4H5JA 3MKQA 3VI4A 3N0DA 3FM0A 1MG3A 4JHPC 3ORVD 4MK0B 4XYIA 2VZ3A 4DNVA 4QL1A 5FLXg 4J82A 3FCUA 4DNWA 3O4GA 2UZYB 3ULEC 3HFQA 2EBSA 4NC4A 3JZNA 4XEIC 3QI0A 4OZUA 2AGZA 4ERZA 1K3IA 3V5WB 4A2LA 2O9KA 2P9SC 4A0BB 3SBQA 3UVOA 4J86A 4ES0A 2BKLA 3SVWD 4J81A 3OKYB 3NIFA 4JD2C 4AN0A 3UVLA 3MMYA 2PM9A 1JMZB 1R5MA 3L4MD 1GOFA 2HJ4A 3I7NA 4I79A 3SLED 4Z7NA 4GGDA 1MG2A 4JSXC 4O2WA 4YVDA 5AFU3 1L0QA 3EI2B 2Q7QA 2B5LA 4Y7RA 4Z7QA 2YNOA 2P9IC 5GXIA 4A2MA 3IVMA 4MMZA 3UKRC 2OVRB 3PVUB 3SBPA 3SCYA 5GXHA 5HDBA 4IMMA 4CC9A 3BG0A 4D9SA 4ZOYA 1VZ2A 3I7LA 4QT8A 4CI2A 2YMUA 3C75H 3I7PA 2AH0A 4WJKA 5IJ8E 2P9NC 4FHLA 4G1EA 4E5ZA 4O3UB 4L3GD 5K1CC 4LG8A 5HE0B 4HDJA 5IGOA 2BBKH 2P9KC 3RN1D 2CN2A 5CXCA 3I7KA 3GD1I 4BCCA 2XYIA 2UZXB 3ZE0A 3OKTA 3V7DB 5EAPA 1ERJA 4H5IA 4J78A 3MXXA 1TBGA 2H47A 3ZDZA 4TZ4A 4A09A 1GG2B 2CNXA 4E54B 4JT6C 4K3JB 2JKXA 5C2WB 3VA6A 4WK0A 5C86A 3V4PA 1OMWB 4PBYA 4NAAA 5FFGA 3T3MA 5IJ7E 4JSPC 4LG9A 4XYHA 4Y5RD 3OL2A 1K32A 2AGWA 4GM9A 3C9CA 4GGCA 4WK4A 2GNQA 3OTTA 4ZN4A 2I0TA 3J81g 4CI8A 3VGZA 5EALA 3PSLA 1H2YA 3SXTD 4L1MA 4J79A 4U1EI 1JOFA 5EMKB 2PM6B 2AGLA 1BPOA 2Z2NA 5EMJB 1N6FA 4A0AA 5HQGA 5I5IA 4GGAA 1VE6A 5M5SA 4Z7OA 4A08A 4GZ8A 2I3TA 2IURA 3AL9A 4CY1A 3AH8B 5H17A 4JT5C 3ZWLB 4D6VA 1MDAH 4U7AA 2J57G 2PM9B 1U8CA 4X60B 1A0RB 3B7FA 2B5MA 5C92A 4AMZA 3AL8B 4BCDA 4G55A 2OVQB 3IJ1A 2OIZA 3I7HA 1M1XA 4AX4A 1H2WA 1GOHA 4IRZA 5IC7A 1NR0A 3EI1B 2HU8A 1RI6A 2HYEA 3K6SA 4CI3A 4R7AB 3P4FA 2OK4A 5K19A 3IKOA 1PEVA 2QZPA 3JRPA 1U2VC 3KRXB 1SHYB 2G99A 1PGUA 4RE5A 3EI4B 3PXSD 2EICA 2H13A 3DM0A 1E8NA 4JSNC 1YFQA 3K71A 3FGBA 2HKRA 1PBYB 2B4EA 1B9YA 2IWFA 2OVPB 3DSMA 4O9DA 5CXBA 4A11A 5CXCB 1C9LA 2AGYA 1L5GA 2Z2OA 2IWKA 1N6EA 1E8MA 5A2Qg 3PSCB 2I3SA 3SN6B 2CO0C 3RLMD 4FA4D 1XHMA 4X61B 4BH6A 3O4IA 4ZOVA 1SQJA 3QHYB 3F3GA 3IUQA 3MUOA 3ZE2A 3EQ8A 1U4CA 5E6SA 2H9LA 3CIKB 5I5MA 3E0CA 5KDOB 3CFVA 1UOPA 2VDOA 3NIGA 3JZHA 4G1MA 4LGNA 3ZE1A 2GC7A 3JPXA 2G9AA 3NVXA 2OK6A 2IUQA 5E6UA 3NIDA 5THAA 5TEEA 5B4WA 3PXWD 1UOQA 1YR2A 3DXMC 3UKUC 4D0KA 2IAAA 5M5UA 4A7JA 2CE9A 4A11B 4L3HD 3AL8A 3DDUA 5EARA 4JSVC 4FAND 4JXMA 2EIBA 2IUVA 5AMSA 3RN0D 1JMXB 4DNUA 2VC2A 4GM8A 4O3TB 4J87A 3I7OA 3IUJA 4CY2A 4MMXA 4QQEA 3UR4A 1JJUB 4CY3A 5FKQA 1FWXA 2P9PC 5M61A 2HU5A 3EG6A 4IA9A 1Q47A 4AMYA 3J80g 4BCBA 2XZGA 1H2ZA 4X63B 2H9PA 4AN1A 4J77A 1GXRA 5FQDA 3DXKC 4UI9R 3IIYA 3FRXA 4O45A 2H6QA 2Z2PA 5HE1B 2CE8A 3I89A 3VH0A 3RFHA 5EM2B 1B9XA 4BP9A 5EM2A 2EIDA 5M5TA 2YNNA 3IURA 3JAMg 4J8BA 4CY5A 4A08B 5SXMA 1S4UX 1QFSA 5M5VA 3O4HA 5H14A 3RSEC 3T3PA 4EWRA 4ERYA 3OF7A 4PSXB 3EQ9A 3BWSA 1O6FA 3EI3B 3I8EA 3NVNA 2HXCA 3ODTA 1TYQC 2HU7A 3GC3B 4BP8A 3EI2A 4J0XA 1NEXB 2GC4A 2H9NA 2XL3A 4N14A 5FKSA 3KRWB 3N0EA 2XL2A 1VZ3A 4FA1D 3SJLD 3GFCA 3RFGA 5GSAA 3DWLC 5FKTA 3I8CA 2QXVA 3MZLA 2EIEA 5FFOA 3ZDXA 3SBRA 4A0BA 2HKMA 5HE3B 1P22A 4NENA 2TRCB 2H9MA 3U4YA 5CYKB 5E6RA 1K8KC 3IUNA 3OL2B 3PVWB 3K27A 4KFMB 3V9FA 3PE7A 4O1QD 4J84A 4CZYA 5IGQA 3JROA 3C99A 4NSXA 4RE6A 4A0AB 4UM9A 3A0FA 3IULA 4L9OA 5I5JA 3I2NA 4A09B 2QC5A 4CZVA 2PBIB 4QAMA 4GQ2P 2H68A 1H2XA 3O4JA 1E5TA 4JHNA 2H6NA 4G56B 2OJYA 3V4VA 1GOGA 3MVDK 4AOWA 3EI4A 2VDLA 2AGXA 4PXWA 3CFSB 3UVKA 3BG1A 3RMZD 5HYNB 3NVQA 1QNIA 1PI6A 2HESX 2BCJB 2H14A 4UM8A 4PC0A 5CXBB 3EI1A 4PNKB 1GOTB 1A12A 1I2MB 2VDPA 3MKSB 2H6KA 1SQ9A 1VYHC 2XE4A 3FCSA 3IIWA 4FWWA 4FB1D 5TF2A 2IUPA 2I0SA 3JZGA 1QFMA 2J55H 1GP2B 3SMRA 2J56H 4CI1A 2H3XA 3EQ7A 5M5RA 3SFZA 2XU7A 2VDRA 3K72A 1OLZA 4Z8LA 2VDMA 4E5ZB 2AH1A 3OW8A 2W18A 4CZXA 3W15A 4PSWB 3IJEA 5HE2B 4BUJC 1VE7A 4X3EA 4ERQA 1TYEA 4ESGA 3ZDYA 2YNPA 4L1QD 5EMLB 3EI3A 1UTCA 3VI3A 2VDKA 3PXTD 1UOOA 2I0RA 4NBMA 3F3FA 5CYKA 4OWRA 2CN3A 2B5NA 4J0WA 3K26A 3SWSD 1N6DA 4FA9D 4AEZA 4PBZA 5TEFA 2YB8B 2WQ8A 2PM7B 3MUNA 5FXYA 2P9UC 4WK2A 4MMYA 2HJBA 3GREA 4GMBA 2QR5A 1XIPA 5FKRA 5AJAA 3MZKA 3EWEA 3UVNA 3RRMC 4FA5D 5EMMB 5C9ZB 4QRJA 2AQ5A 3KCIA 4O02A 3IJCA 4ZOZA
chains in the Genus database with same CATH topology
5FA5B 4GM3A 4FAVD 5C2VB 4GQBB 2YBAA 3EU7A 4J8GA 2P9LC 4ZOXA 4J73A 4K3ID 4E54A 3SHFA 3AFCA 3F3PA 3L4OD 3UVMA 5JWZA 5IT9g 3IJ0A 5H1MA 2CO0A 5TDHB 5GMKn 3EMHA 4BL0A 3OKYA 3C5MA 2MTAH 5EAMA 1XKSA 3JB9L 4GQ1A 3OKWA 4H5JA 3MKQA 3N0DA 3FM0A 1MG3A 3ORVD 4MK0B 4XYIA 4QL1A 5FLXg 4J82A 2UZYB 3ULEC 3HFQA 2EBSA 3JZNA 4XEIC 4OZUA 2AGZA 4ERZA 3V5WB 4A2LA 2O9KA 2P9SC 4A0BB 3SBQA 3UVOA 4J86A 4ES0A 3SVWD 4J81A 3OKYB 4JD2C 3UVLA 3MMYA 2PM9A 1JMZB 1R5MA 3L4MD 2HJ4A 3I7NA 4I79A 3SLED 4GGDA 1MG2A 4JSXC 5AFU3 4YVDA 3EI2B 1L0QA 2Q7QA 2B5LA 4Y7RA 2YNOA 2P9IC 5GXIA 4A2MA 3UKRC 2OVRB 3PVUB 3SBPA 3SCYA 5GXHA 4IMMA 4CC9A 3BG0A 4ZOYA 3I7LA 4QT8A 4CI2A 2YMUA 3C75H 3I7PA 2AH0A 5IJ8E 2P9NC 4FHLA 4E5ZA 4O3UB 4L3GD 5K1CC 4LG8A 5HE0B 4HDJA 5IGOA 2BBKH 2P9KC 3RN1D 2CN2A 5CXCA 3I7KA 2XYIA 2UZXB 3OKTA 3V7DB 5EAPA 1ERJA 4H5IA 4J78A 3MXXA 1TBGA 2H47A 4TZ4A 4A09A 1GG2B 2CNXA 4E54B 4JT6C 4K3JB 5C2WB 3VA6A 1OMWB 4PBYA 5IJ7E 4JSPC 4LG9A 4XYHA 4Y5RD 3OL2A 1K32A 2AGWA 4GM9A 3C9CA 4GGCA 2GNQA 3OTTA 4ZN4A 2I0TA 3J81g 4CI8A 3VGZA 5EALA 3PSLA 3SXTD 5EMKB 4J79A 4U1EI 1JOFA 2PM6B 2AGLA 2Z2NA 5EMJB 1N6FA 4A0AA 5HQGA 5I5IA 4GGAA 4A08A 4GZ8A 2I3TA 2IURA 3AL9A 4CY1A 3AH8B 5H17A 4JT5C 3ZWLB 4D6VA 1MDAH 4U7AA 2J57G 2PM9B 4X60B 1A0RB 3B7FA 2B5MA 3AL8B 2OVQB 3IJ1A 2OIZA 3I7HA 5IC7A 1NR0A 3EI1B 1RI6A 2HYEA 4CI3A 4R7AB 3P4FA 2OK4A 5K19A 3IKOA 1PEVA 3JRPA 1U2VC 3KRXB 1SHYB 2G99A 1PGUA 3EI4B 3PXSD 2H13A 3DM0A 4JSNC 1YFQA 3FGBA 2HKRA 1PBYB 2B4EA 1B9YA 2IWFA 2OVPB 3DSMA 4O9DA 5CXBA 4A11A 5CXCB 2AGYA 2Z2OA 2IWKA 1N6EA 5A2Qg 3PSCB 2I3SA 3SN6B 2CO0C 3RLMD 4FA4D 1XHMA 4X61B 4BH6A 4ZOVA 1SQJA 3F3GA 1U4CA 2H9LA 3CIKB 5I5MA 3E0CA 5KDOB 3CFVA 3JZHA 4LGNA 2GC7A 3JPXA 2G9AA 3NVXA 2OK6A 2IUQA 5THAA 5TEEA 5B4WA 3PXWD 3DXMC 3UKUC 4D0KA 2IAAA 4A7JA 2CE9A 4A11B 4L3HD 3AL8A 5EARA 4JSVC 4FAND 4JXMA 2IUVA 5AMSA 3RN0D 1JMXB 4GM8A 4O3TB 4J87A 3I7OA 4CY2A 4QQEA 3UR4A 1JJUB 4CY3A 5FKQA 1FWXA 2P9PC 3EG6A 4IA9A 1Q47A 3J80g 4X63B 2H9PA 4J77A 1GXRA 5FQDA 3DXKC 4UI9R 3IIYA 4O45A 3FRXA 2H6QA 2Z2PA 5HE1B 2CE8A 3I89A 3VH0A 3RFHA 5EM2B 1B9XA 5EM2A 2YNNA 3JAMg 4J8BA 4CY5A 4A08B 5SXMA 1S4UX 5H14A 3RSEC 4EWRA 4ERYA 4PSXB 3BWSA 3EI3B 3I8EA 3NVNA 2HXCA 3ODTA 1TYQC 3EI2A 4J0XA 1NEXB 2GC4A 2H9NA 2XL3A 4N14A 5FKSA 3KRWB 3N0EA 2XL2A 4FA1D 3SJLD 3GFCA 3RFGA 5GSAA 3DWLC 5FKTA 3I8CA 2QXVA 3MZLA 3SBRA 4A0BA 2HKMA 5HE3B 1P22A 2TRCB 2H9MA 3U4YA 5CYKB 1K8KC 3OL2B 3PVWB 3K27A 4KFMB 3V9FA 3PE7A 4O1QD 4J84A 4CZYA 5IGQA 3JROA 3C99A 4NSXA 4A0AB 3A0FA 4L9OA 5I5JA 3I2NA 4A09B 2QC5A 4CZVA 2PBIB 4GQ2P 2H68A 2H6NA 4G56B 2OJYA 4AOWA 3EI4A 2AGXA 4PXWA 3CFSB 3UVKA 3BG1A 3RMZD 5HYNB 3NVQA 1QNIA 1PI6A 2HESX 2BCJB 2H14A 5CXBB 4PC0A 3EI1A 4PNKB 1GOTB 2H6KA 1SQ9A 3MKSB 1VYHC 4FWWA 3IIWA 4FB1D 5TF2A 2IUPA 2I0SA 3JZGA 2J55H 1GP2B 3SMRA 2J56H 4CI1A 2H3XA 3SFZA 2XU7A 1OLZA 4Z8LA 4E5ZB 2AH1A 3OW8A 2W18A 4CZXA 3W15A 4PSWB 5HE2B 4BUJC 4X3EA 4ERQA 4ESGA 2YNPA 4L1QD 5EMLB 3EI3A 3PXTD 2I0RA 3F3FA 5CYKA 4OWRA 2CN3A 2B5NA 4J0WA 3K26A 3SWSD 1N6DA 4FA9D 4AEZA 4PBZA 5TEFA 2YB8B 2PM7B 5FXYA 2P9UC 2HJBA 3GREA 4GMBA 5FKRA 1XIPA 5AJAA 3MZKA 3EWEA 3UVNA 3RRMC 4FA5D 5EMMB 5C9ZB 4QRJA 2AQ5A 3IJCA 4ZOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FA5 B;  4GM3 A;  4FAV D;  5C2V B;  4GQB B;  2YBA A;  3EU7 A;  4J8G A;  2P9L C;  4ZOX A;  4J73 A;  4K3I D;  4E54 A;  3SHF A;  3AFC A;  3F3P A;  3L4O D;  3UVM A;  5JWZ A;  5IT9 g;  3IJ0 A;  5H1M A;  2CO0 A;  5TDH B;  5GMK n;  3EMH A;  4BL0 A;  3OKY A;  3C5M A;  2MTA H;  5EAM A;  1XKS A;  3JB9 L;  4GQ1 A;  3OKW A;  4H5J A;  3MKQ A;  3N0D A;  3FM0 A;  1MG3 A;  3ORV D;  4MK0 B;  4XYI A;  4QL1 A;  5FLX g;  4J82 A;  2UZY B;  3ULE C;  3HFQ A;  2EBS A;  3JZN A;  4XEI C;  4OZU A;  2AGZ A;  4ERZ A;  3V5W B;  4A2L A;  2O9K A;  2P9S C;  4A0B B;  3SBQ A;  3UVO A;  4J86 A;  4ES0 A;  3SVW D;  4J81 A;  3OKY B;  4JD2 C;  3UVL A;  3MMY A;  2PM9 A;  1JMZ B;  1R5M A;  3L4M D;  2HJ4 A;  3I7N A;  4I79 A;  3SLE D;  4GGD A;  1MG2 A;  4JSX C;  5AFU 3;  4YVD A;  3EI2 B;  1L0Q A;  2Q7Q A;  2B5L A;  4Y7R A;  2YNO A;  2P9I C;  5GXI A;  4A2M A;  3UKR C;  2OVR B;  3PVU B;  3SBP A;  3SCY A;  5GXH A;  4IMM A;  4CC9 A;  3BG0 A;  4ZOY A;  3I7L A;  4QT8 A;  4CI2 A;  2YMU A;  3C75 H;  3I7P A;  2AH0 A;  5IJ8 E;  2P9N C;  4FHL A;  4E5Z A;  4O3U B;  4L3G D;  5K1C C;  4LG8 A;  5HE0 B;  4HDJ A;  5IGO A;  2BBK H;  2P9K C;  3RN1 D;  2CN2 A;  5CXC A;  3I7K A;  2XYI A;  2UZX B;  3OKT A;  3V7D B;  5EAP A;  1ERJ A;  4H5I A;  4J78 A;  3MXX A;  1TBG A;  2H47 A;  4TZ4 A;  4A09 A;  1GG2 B;  2CNX A;  4E54 B;  4JT6 C;  4K3J B;  5C2W B;  3VA6 A;  1OMW B;  4PBY A;  5IJ7 E;  4JSP C;  4LG9 A;  4XYH A;  4Y5R D;  3OL2 A;  1K32 A;  2AGW A;  4GM9 A;  3C9C A;  4GGC A;  2GNQ A;  3OTT A;  4ZN4 A;  2I0T A;  3J81 g;  4CI8 A;  3VGZ A;  5EAL A;  3PSL A;  3SXT D;  5EMK B;  4J79 A;  4U1E I;  1JOF A;  2PM6 B;  2AGL A;  2Z2N A;  5EMJ B;  1N6F A;  4A0A A;  5HQG A;  5I5I A;  4GGA A;  4A08 A;  4GZ8 A;  2I3T A;  2IUR A;  3AL9 A;  4CY1 A;  3AH8 B;  5H17 A;  4JT5 C;  3ZWL B;  4D6V A;  1MDA H;  4U7A A;  2J57 G;  2PM9 B;  4X60 B;  1A0R B;  3B7F A;  2B5M A;  3AL8 B;  2OVQ B;  3IJ1 A;  2OIZ A;  3I7H A;  5IC7 A;  1NR0 A;  3EI1 B;  1RI6 A;  2HYE A;  4CI3 A;  4R7A B;  3P4F A;  2OK4 A;  5K19 A;  3IKO A;  1PEV A;  3JRP A;  1U2V C;  3KRX B;  1SHY B;  2G99 A;  1PGU A;  3EI4 B;  3PXS D;  2H13 A;  3DM0 A;  4JSN C;  1YFQ A;  3FGB A;  2HKR A;  1PBY B;  2B4E A;  1B9Y A;  2IWF A;  2OVP B;  3DSM A;  4O9D A;  5CXB A;  4A11 A;  5CXC B;  2AGY A;  2Z2O A;  2IWK A;  1N6E A;  5A2Q g;  3PSC B;  2I3S A;  3SN6 B;  2CO0 C;  3RLM D;  4FA4 D;  1XHM A;  4X61 B;  4BH6 A;  4ZOV A;  1SQJ A;  3F3G A;  1U4C A;  2H9L A;  3CIK B;  5I5M A;  3E0C A;  5KDO B;  3CFV A;  3JZH A;  4LGN A;  2GC7 A;  3JPX A;  2G9A A;  3NVX A;  2OK6 A;  2IUQ A;  5THA A;  5TEE A;  5B4W A;  3PXW D;  3DXM C;  3UKU C;  4D0K A;  2IAA A;  4A7J A;  2CE9 A;  4A11 B;  4L3H D;  3AL8 A;  5EAR A;  4JSV C;  4FAN D;  4JXM A;  2IUV A;  5AMS A;  3RN0 D;  1JMX B;  4GM8 A;  4O3T B;  4J87 A;  3I7O A;  4CY2 A;  4QQE A;  3UR4 A;  1JJU B;  4CY3 A;  5FKQ A;  1FWX A;  2P9P C;  3EG6 A;  4IA9 A;  1Q47 A;  3J80 g;  4X63 B;  2H9P A;  4J77 A;  1GXR A;  5FQD A;  3DXK C;  4UI9 R;  3IIY A;  4O45 A;  3FRX A;  2H6Q A;  2Z2P A;  5HE1 B;  2CE8 A;  3I89 A;  3VH0 A;  3RFH A;  5EM2 B;  1B9X A;  5EM2 A;  2YNN A;  3JAM g;  4J8B A;  4CY5 A;  4A08 B;  5SXM A;  1S4U X;  5H14 A;  3RSE C;  4EWR A;  4ERY A;  4PSX B;  3BWS A;  3EI3 B;  3I8E A;  3NVN A;  2HXC A;  3ODT A;  1TYQ C;  3EI2 A;  4J0X A;  1NEX B;  2GC4 A;  2H9N A;  2XL3 A;  4N14 A;  5FKS A;  3KRW B;  3N0E A;  2XL2 A;  4FA1 D;  3SJL D;  3GFC A;  3RFG A;  5GSA A;  3DWL C;  5FKT A;  3I8C A;  2QXV A;  3MZL A;  3SBR A;  4A0B A;  2HKM A;  5HE3 B;  1P22 A;  2TRC B;  2H9M A;  3U4Y A;  5CYK B;  1K8K C;  3OL2 B;  3PVW B;  3K27 A;  4KFM B;  3V9F A;  3PE7 A;  4O1Q D;  4J84 A;  4CZY A;  5IGQ A;  3JRO A;  3C99 A;  4NSX A;  4A0A B;  3A0F A;  4L9O A;  5I5J A;  3I2N A;  4A09 B;  2QC5 A;  4CZV A;  2PBI B;  4GQ2 P;  2H68 A;  2H6N A;  4G56 B;  2OJY A;  4AOW A;  3EI4 A;  2AGX A;  4PXW A;  3CFS B;  3UVK A;  3BG1 A;  3RMZ D;  5HYN B;  3NVQ A;  1QNI A;  1PI6 A;  2HES X;  2BCJ B;  2H14 A;  5CXB B;  4PC0 A;  3EI1 A;  4PNK B;  1GOT B;  2H6K A;  1SQ9 A;  3MKS B;  1VYH C;  4FWW A;  3IIW A;  4FB1 D;  5TF2 A;  2IUP A;  2I0S A;  3JZG A;  2J55 H;  1GP2 B;  3SMR A;  2J56 H;  4CI1 A;  2H3X A;  3SFZ A;  2XU7 A;  1OLZ A;  4Z8L A;  4E5Z B;  2AH1 A;  3OW8 A;  2W18 A;  4CZX A;  3W15 A;  4PSW B;  5HE2 B;  4BUJ C;  4X3E A;  4ERQ A;  4ESG A;  2YNP A;  4L1Q D;  5EML B;  3EI3 A;  3PXT D;  2I0R A;  3F3F A;  5CYK A;  4OWR A;  2CN3 A;  2B5N A;  4J0W A;  3K26 A;  3SWS D;  1N6D A;  4FA9 D;  4AEZ A;  4PBZ A;  5TEF A;  2YB8 B;  2PM7 B;  5FXY A;  2P9U C;  2HJB A;  3GRE A;  4GMB A;  5FKR A;  1XIP A;  5AJA A;  3MZK A;  3EWE A;  3UVN A;  3RRM C;  4FA5 D;  5EMM B;  5C9Z B;  4QRJ A;  2AQ5 A;  3IJC A;  4ZOZ A; 
#chains in the Genus database with same CATH topology
 5FA5 B;  1O6G A;  2XDW A;  4GM3 A;  1JV2 A;  4FAV D;  5C2V B;  4GQB B;  2YBA A;  3EU7 A;  4J8G A;  1T2X A;  2P9L C;  4ZOX A;  4J73 A;  4K3I D;  4E54 A;  3SHF A;  3AFC A;  3F3P A;  3L4O D;  2VZ1 A;  3UVM A;  5JWZ A;  5IT9 g;  3IJ0 A;  2VDQ A;  5H1M A;  2CO0 A;  5TDH B;  5GMK n;  3IUM A;  1C9I A;  3EMH A;  4BL0 A;  3OKY A;  3C5M A;  2MTA H;  2VDN A;  5EAM A;  1XKS A;  1JTD B;  3JB9 L;  4GQ1 A;  3OKW A;  4H5J A;  3MKQ A;  3VI4 A;  3N0D A;  3FM0 A;  1MG3 A;  4JHP C;  3ORV D;  4MK0 B;  4XYI A;  2VZ3 A;  4DNV A;  4QL1 A;  5FLX g;  4J82 A;  3FCU A;  4DNW A;  3O4G A;  2UZY B;  3ULE C;  3HFQ A;  2EBS A;  4NC4 A;  3JZN A;  4XEI C;  3QI0 A;  4OZU A;  2AGZ A;  4ERZ A;  1K3I A;  3V5W B;  4A2L A;  2O9K A;  2P9S C;  4A0B B;  3SBQ A;  3UVO A;  4J86 A;  4ES0 A;  2BKL A;  3SVW D;  4J81 A;  3OKY B;  3NIF A;  4JD2 C;  4AN0 A;  3UVL A;  3MMY A;  2PM9 A;  1JMZ B;  1R5M A;  3L4M D;  1GOF A;  2HJ4 A;  3I7N A;  4I79 A;  3SLE D;  4Z7N A;  4GGD A;  1MG2 A;  4JSX C;  4O2W A;  4YVD A;  5AFU 3;  1L0Q A;  3EI2 B;  2Q7Q A;  2B5L A;  4Y7R A;  4Z7Q A;  2YNO A;  2P9I C;  5GXI A;  4A2M A;  3IVM A;  4MMZ A;  3UKR C;  2OVR B;  3PVU B;  3SBP A;  3SCY A;  5GXH A;  5HDB A;  4IMM A;  4CC9 A;  3BG0 A;  4D9S A;  4ZOY A;  1VZ2 A;  3I7L A;  4QT8 A;  4CI2 A;  2YMU A;  3C75 H;  3I7P A;  2AH0 A;  4WJK A;  5IJ8 E;  2P9N C;  4FHL A;  4G1E A;  4E5Z A;  4O3U B;  4L3G D;  5K1C C;  4LG8 A;  5HE0 B;  4HDJ A;  5IGO A;  2BBK H;  2P9K C;  3RN1 D;  2CN2 A;  5CXC A;  3I7K A;  3GD1 I;  4BCC A;  2XYI A;  2UZX B;  3ZE0 A;  3OKT A;  3V7D B;  5EAP A;  1ERJ A;  4H5I A;  4J78 A;  3MXX A;  1TBG A;  2H47 A;  3ZDZ A;  4TZ4 A;  4A09 A;  1GG2 B;  2CNX A;  4E54 B;  4JT6 C;  4K3J B;  2JKX A;  5C2W B;  3VA6 A;  4WK0 A;  5C86 A;  3V4P A;  1OMW B;  4PBY A;  4NAA A;  5FFG A;  3T3M A;  5IJ7 E;  4JSP C;  4LG9 A;  4XYH A;  4Y5R D;  3OL2 A;  1K32 A;  2AGW A;  4GM9 A;  3C9C A;  4GGC A;  4WK4 A;  2GNQ A;  3OTT A;  4ZN4 A;  2I0T A;  3J81 g;  4CI8 A;  3VGZ A;  5EAL A;  3PSL A;  1H2Y A;  3SXT D;  4L1M A;  4J79 A;  4U1E I;  1JOF A;  5EMK B;  2PM6 B;  2AGL A;  1BPO A;  2Z2N A;  5EMJ B;  1N6F A;  4A0A A;  5HQG A;  5I5I A;  4GGA A;  1VE6 A;  5M5S A;  4Z7O A;  4A08 A;  4GZ8 A;  2I3T A;  2IUR A;  3AL9 A;  4CY1 A;  3AH8 B;  5H17 A;  4JT5 C;  3ZWL B;  4D6V A;  1MDA H;  4U7A A;  2J57 G;  2PM9 B;  1U8C A;  4X60 B;  1A0R B;  3B7F A;  2B5M A;  5C92 A;  4AMZ A;  3AL8 B;  4BCD A;  4G55 A;  2OVQ B;  3IJ1 A;  2OIZ A;  3I7H A;  1M1X A;  4AX4 A;  1H2W A;  1GOH A;  4IRZ A;  5IC7 A;  1NR0 A;  3EI1 B;  2HU8 A;  1RI6 A;  2HYE A;  3K6S A;  4CI3 A;  4R7A B;  3P4F A;  2OK4 A;  5K19 A;  3IKO A;  1PEV A;  2QZP A;  3JRP A;  1U2V C;  3KRX B;  1SHY B;  2G99 A;  1PGU A;  4RE5 A;  3EI4 B;  3PXS D;  2EIC A;  2H13 A;  3DM0 A;  1E8N A;  4JSN C;  1YFQ A;  3K71 A;  3FGB A;  2HKR A;  1PBY B;  2B4E A;  1B9Y A;  2IWF A;  2OVP B;  3DSM A;  4O9D A;  5CXB A;  4A11 A;  5CXC B;  1C9L A;  2AGY A;  1L5G A;  2Z2O A;  2IWK A;  1N6E A;  1E8M A;  5A2Q g;  3PSC B;  2I3S A;  3SN6 B;  2CO0 C;  3RLM D;  4FA4 D;  1XHM A;  4X61 B;  4BH6 A;  3O4I A;  4ZOV A;  1SQJ A;  3QHY B;  3F3G A;  3IUQ A;  3MUO A;  3ZE2 A;  3EQ8 A;  1U4C A;  5E6S A;  2H9L A;  3CIK B;  5I5M A;  3E0C A;  5KDO B;  3CFV A;  1UOP A;  2VDO A;  3NIG A;  3JZH A;  4G1M A;  4LGN A;  3ZE1 A;  2GC7 A;  3JPX A;  2G9A A;  3NVX A;  2OK6 A;  2IUQ A;  5E6U A;  3NID A;  5THA A;  5TEE A;  5B4W A;  3PXW D;  1UOQ A;  1YR2 A;  3DXM C;  3UKU C;  4D0K A;  2IAA A;  5M5U A;  4A7J A;  2CE9 A;  4A11 B;  4L3H D;  3AL8 A;  3DDU A;  5EAR A;  4JSV C;  4FAN D;  4JXM A;  2EIB A;  2IUV A;  5AMS A;  3RN0 D;  1JMX B;  4DNU A;  2VC2 A;  4GM8 A;  4O3T B;  4J87 A;  3I7O A;  3IUJ A;  4CY2 A;  4MMX A;  4QQE A;  3UR4 A;  1JJU B;  4CY3 A;  5FKQ A;  1FWX A;  2P9P C;  5M61 A;  2HU5 A;  3EG6 A;  4IA9 A;  1Q47 A;  4AMY A;  3J80 g;  4BCB A;  2XZG A;  1H2Z A;  4X63 B;  2H9P A;  4AN1 A;  4J77 A;  1GXR A;  5FQD A;  3DXK C;  4UI9 R;  3IIY A;  3FRX A;  4O45 A;  2H6Q A;  2Z2P A;  5HE1 B;  2CE8 A;  3I89 A;  3VH0 A;  3RFH A;  5EM2 B;  1B9X A;  4BP9 A;  5EM2 A;  2EID A;  5M5T A;  2YNN A;  3IUR A;  3JAM g;  4J8B A;  4CY5 A;  4A08 B;  5SXM A;  1S4U X;  1QFS A;  5M5V A;  3O4H A;  5H14 A;  3RSE C;  3T3P A;  4EWR A;  4ERY A;  3OF7 A;  4PSX B;  3EQ9 A;  3BWS A;  1O6F A;  3EI3 B;  3I8E A;  3NVN A;  2HXC A;  3ODT A;  1TYQ C;  2HU7 A;  3GC3 B;  4BP8 A;  3EI2 A;  4J0X A;  1NEX B;  2GC4 A;  2H9N A;  2XL3 A;  4N14 A;  5FKS A;  3KRW B;  3N0E A;  2XL2 A;  1VZ3 A;  4FA1 D;  3SJL D;  3GFC A;  3RFG A;  5GSA A;  3DWL C;  5FKT A;  3I8C A;  2QXV A;  3MZL A;  2EIE A;  5FFO A;  3ZDX A;  3SBR A;  4A0B A;  2HKM A;  5HE3 B;  1P22 A;  4NEN A;  2TRC B;  2H9M A;  3U4Y A;  5CYK B;  5E6R A;  1K8K C;  3IUN A;  3OL2 B;  3PVW B;  3K27 A;  4KFM B;  3V9F A;  3PE7 A;  4O1Q D;  4J84 A;  4CZY A;  5IGQ A;  3JRO A;  3C99 A;  4NSX A;  4RE6 A;  4A0A B;  4UM9 A;  3A0F A;  3IUL A;  4L9O A;  5I5J A;  3I2N A;  4A09 B;  2QC5 A;  4CZV A;  2PBI B;  4QAM A;  4GQ2 P;  2H68 A;  1H2X A;  3O4J A;  1E5T A;  4JHN A;  2H6N A;  4G56 B;  2OJY A;  3V4V A;  1GOG A;  3MVD K;  4AOW A;  3EI4 A;  2VDL A;  2AGX A;  4PXW A;  3CFS B;  3UVK A;  3BG1 A;  3RMZ D;  5HYN B;  3NVQ A;  1QNI A;  1PI6 A;  2HES X;  2BCJ B;  2H14 A;  4UM8 A;  4PC0 A;  5CXB B;  3EI1 A;  4PNK B;  1GOT B;  1A12 A;  1I2M B;  2VDP A;  3MKS B;  2H6K A;  1SQ9 A;  1VYH C;  2XE4 A;  3FCS A;  3IIW A;  4FWW A;  4FB1 D;  5TF2 A;  2IUP A;  2I0S A;  3JZG A;  1QFM A;  2J55 H;  1GP2 B;  3SMR A;  2J56 H;  4CI1 A;  2H3X A;  3EQ7 A;  5M5R A;  3SFZ A;  2XU7 A;  2VDR A;  3K72 A;  1OLZ A;  4Z8L A;  2VDM A;  4E5Z B;  2AH1 A;  3OW8 A;  2W18 A;  4CZX A;  3W15 A;  4PSW B;  3IJE A;  5HE2 B;  4BUJ C;  1VE7 A;  4X3E A;  4ERQ A;  1TYE A;  4ESG A;  3ZDY A;  2YNP A;  4L1Q D;  5EML B;  3EI3 A;  1UTC A;  3VI3 A;  2VDK A;  3PXT D;  1UOO A;  2I0R A;  4NBM A;  3F3F A;  5CYK A;  4OWR A;  2CN3 A;  2B5N A;  4J0W A;  3K26 A;  3SWS D;  1N6D A;  4FA9 D;  4AEZ A;  4PBZ A;  5TEF A;  2YB8 B;  2WQ8 A;  2PM7 B;  3MUN A;  5FXY A;  2P9U C;  4WK2 A;  4MMY A;  2HJB A;  3GRE A;  4GMB A;  2QR5 A;  1XIP A;  5FKR A;  5AJA A;  3MZK A;  3EWE A;  3UVN A;  3RRM C;  4FA5 D;  5EMM B;  5C9Z B;  4QRJ A;  2AQ5 A;  3KCI A;  4O02 A;  3IJC A;  4ZOZ A; 
#chains in the Genus database with same CATH homology
 5FA5 B;  4GM3 A;  4FAV D;  5C2V B;  4GQB B;  2YBA A;  3EU7 A;  4J8G A;  2P9L C;  4ZOX A;  4J73 A;  4K3I D;  4E54 A;  3SHF A;  3AFC A;  3F3P A;  3L4O D;  3UVM A;  5JWZ A;  5IT9 g;  3IJ0 A;  5H1M A;  2CO0 A;  5TDH B;  5GMK n;  3EMH A;  4BL0 A;  3OKY A;  3C5M A;  2MTA H;  5EAM A;  1XKS A;  3JB9 L;  4GQ1 A;  3OKW A;  4H5J A;  3MKQ A;  3N0D A;  3FM0 A;  1MG3 A;  3ORV D;  4MK0 B;  4XYI A;  4QL1 A;  5FLX g;  4J82 A;  2UZY B;  3ULE C;  3HFQ A;  2EBS A;  3JZN A;  4XEI C;  4OZU A;  2AGZ A;  4ERZ A;  3V5W B;  4A2L A;  2O9K A;  2P9S C;  4A0B B;  3SBQ A;  3UVO A;  4J86 A;  4ES0 A;  3SVW D;  4J81 A;  3OKY B;  4JD2 C;  3UVL A;  3MMY A;  2PM9 A;  1JMZ B;  1R5M A;  3L4M D;  2HJ4 A;  3I7N A;  4I79 A;  3SLE D;  4GGD A;  1MG2 A;  4JSX C;  5AFU 3;  4YVD A;  3EI2 B;  1L0Q A;  2Q7Q A;  2B5L A;  4Y7R A;  2YNO A;  2P9I C;  5GXI A;  4A2M A;  3UKR C;  2OVR B;  3PVU B;  3SBP A;  3SCY A;  5GXH A;  4IMM A;  4CC9 A;  3BG0 A;  4ZOY A;  3I7L A;  4QT8 A;  4CI2 A;  2YMU A;  3C75 H;  3I7P A;  2AH0 A;  5IJ8 E;  2P9N C;  4FHL A;  4E5Z A;  4O3U B;  4L3G D;  5K1C C;  4LG8 A;  5HE0 B;  4HDJ A;  5IGO A;  2BBK H;  2P9K C;  3RN1 D;  2CN2 A;  5CXC A;  3I7K A;  2XYI A;  2UZX B;  3OKT A;  3V7D B;  5EAP A;  1ERJ A;  4H5I A;  4J78 A;  3MXX A;  1TBG A;  2H47 A;  4TZ4 A;  4A09 A;  1GG2 B;  2CNX A;  4E54 B;  4JT6 C;  4K3J B;  5C2W B;  3VA6 A;  1OMW B;  4PBY A;  5IJ7 E;  4JSP C;  4LG9 A;  4XYH A;  4Y5R D;  3OL2 A;  1K32 A;  2AGW A;  4GM9 A;  3C9C A;  4GGC A;  2GNQ A;  3OTT A;  4ZN4 A;  2I0T A;  3J81 g;  4CI8 A;  3VGZ A;  5EAL A;  3PSL A;  3SXT D;  5EMK B;  4J79 A;  4U1E I;  1JOF A;  2PM6 B;  2AGL A;  2Z2N A;  5EMJ B;  1N6F A;  4A0A A;  5HQG A;  5I5I A;  4GGA A;  4A08 A;  4GZ8 A;  2I3T A;  2IUR A;  3AL9 A;  4CY1 A;  3AH8 B;  5H17 A;  4JT5 C;  3ZWL B;  4D6V A;  1MDA H;  4U7A A;  2J57 G;  2PM9 B;  4X60 B;  1A0R B;  3B7F A;  2B5M A;  3AL8 B;  2OVQ B;  3IJ1 A;  2OIZ A;  3I7H A;  5IC7 A;  1NR0 A;  3EI1 B;  1RI6 A;  2HYE A;  4CI3 A;  4R7A B;  3P4F A;  2OK4 A;  5K19 A;  3IKO A;  1PEV A;  3JRP A;  1U2V C;  3KRX B;  1SHY B;  2G99 A;  1PGU A;  3EI4 B;  3PXS D;  2H13 A;  3DM0 A;  4JSN C;  1YFQ A;  3FGB A;  2HKR A;  1PBY B;  2B4E A;  1B9Y A;  2IWF A;  2OVP B;  3DSM A;  4O9D A;  5CXB A;  4A11 A;  5CXC B;  2AGY A;  2Z2O A;  2IWK A;  1N6E A;  5A2Q g;  3PSC B;  2I3S A;  3SN6 B;  2CO0 C;  3RLM D;  4FA4 D;  1XHM A;  4X61 B;  4BH6 A;  4ZOV A;  1SQJ A;  3F3G A;  1U4C A;  2H9L A;  3CIK B;  5I5M A;  3E0C A;  5KDO B;  3CFV A;  3JZH A;  4LGN A;  2GC7 A;  3JPX A;  2G9A A;  3NVX A;  2OK6 A;  2IUQ A;  5THA A;  5TEE A;  5B4W A;  3PXW D;  3DXM C;  3UKU C;  4D0K A;  2IAA A;  4A7J A;  2CE9 A;  4A11 B;  4L3H D;  3AL8 A;  5EAR A;  4JSV C;  4FAN D;  4JXM A;  2IUV A;  5AMS A;  3RN0 D;  1JMX B;  4GM8 A;  4O3T B;  4J87 A;  3I7O A;  4CY2 A;  4QQE A;  3UR4 A;  1JJU B;  4CY3 A;  5FKQ A;  1FWX A;  2P9P C;  3EG6 A;  4IA9 A;  1Q47 A;  3J80 g;  4X63 B;  2H9P A;  4J77 A;  1GXR A;  5FQD A;  3DXK C;  4UI9 R;  3IIY A;  4O45 A;  3FRX A;  2H6Q A;  2Z2P A;  5HE1 B;  2CE8 A;  3I89 A;  3VH0 A;  3RFH A;  5EM2 B;  1B9X A;  5EM2 A;  2YNN A;  3JAM g;  4J8B A;  4CY5 A;  4A08 B;  5SXM A;  1S4U X;  5H14 A;  3RSE C;  4EWR A;  4ERY A;  4PSX B;  3BWS A;  3EI3 B;  3I8E A;  3NVN A;  2HXC A;  3ODT A;  1TYQ C;  3EI2 A;  4J0X A;  1NEX B;  2GC4 A;  2H9N A;  2XL3 A;  4N14 A;  5FKS A;  3KRW B;  3N0E A;  2XL2 A;  4FA1 D;  3SJL D;  3GFC A;  3RFG A;  5GSA A;  3DWL C;  5FKT A;  3I8C A;  2QXV A;  3MZL A;  3SBR A;  4A0B A;  2HKM A;  5HE3 B;  1P22 A;  2TRC B;  2H9M A;  3U4Y A;  5CYK B;  1K8K C;  3OL2 B;  3PVW B;  3K27 A;  4KFM B;  3V9F A;  3PE7 A;  4O1Q D;  4J84 A;  4CZY A;  5IGQ A;  3JRO A;  3C99 A;  4NSX A;  4A0A B;  3A0F A;  4L9O A;  5I5J A;  3I2N A;  4A09 B;  2QC5 A;  4CZV A;  2PBI B;  4GQ2 P;  2H68 A;  2H6N A;  4G56 B;  2OJY A;  4AOW A;  3EI4 A;  2AGX A;  4PXW A;  3CFS B;  3UVK A;  3BG1 A;  3RMZ D;  5HYN B;  3NVQ A;  1QNI A;  1PI6 A;  2HES X;  2BCJ B;  2H14 A;  5CXB B;  4PC0 A;  3EI1 A;  4PNK B;  1GOT B;  2H6K A;  1SQ9 A;  3MKS B;  1VYH C;  4FWW A;  3IIW A;  4FB1 D;  5TF2 A;  2IUP A;  2I0S A;  3JZG A;  2J55 H;  1GP2 B;  3SMR A;  2J56 H;  4CI1 A;  2H3X A;  3SFZ A;  2XU7 A;  1OLZ A;  4Z8L A;  4E5Z B;  2AH1 A;  3OW8 A;  2W18 A;  4CZX A;  3W15 A;  4PSW B;  5HE2 B;  4BUJ C;  4X3E A;  4ERQ A;  4ESG A;  2YNP A;  4L1Q D;  5EML B;  3EI3 A;  3PXT D;  2I0R A;  3F3F A;  5CYK A;  4OWR A;  2CN3 A;  2B5N A;  4J0W A;  3K26 A;  3SWS D;  1N6D A;  4FA9 D;  4AEZ A;  4PBZ A;  5TEF A;  2YB8 B;  2PM7 B;  5FXY A;  2P9U C;  2HJB A;  3GRE A;  4GMB A;  5FKR A;  1XIP A;  5AJA A;  3MZK A;  3EWE A;  3UVN A;  3RRM C;  4FA5 D;  5EMM B;  5C9Z B;  4QRJ A;  2AQ5 A;  3IJC A;  4ZOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...