1GOTB

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
339
Chain Sequence
b'SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (gtp-binding/transducer)
total genus 106
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gotB00
2IWFA 5HQGA 4ESGA 4JT6C 4U7AA 3C75H 3SN6B 4PBYA 2GC7A 4GGDA 2IUQA 2XYIA 3HFQA 5FA5B 5K19A 2I3SA 3GFCA 5TF2A 2HYEA 3F3GA 4Y5RD 2Z2NA 2B5MA 1TBGA 5EMKB 3OKWA 1PBYB 3EU7A 4AOWA 2G99A 4X3EA 2W18A 3ORVD 3SXTD 4L9OA 5FLXg 2OJYA 2B5NA 4J77A 4ZOVA 3C5MA 3PXWD 5A2Qg 3IJCA 3I7KA 2OVPB 3EI1B 3DWLC 3PXTD 5JWZA 3SBQA 4G56B 4U1EI 4Y7RA 5CYKB 2TRCB 5H1MA 3ZWLB 3I7PA 1NR0A 3EI2A 2P9PC 1R5MA 4J82A 5IC7A 2P9NC 4A11A 4GQ2P 5HE2B 3CIKB 2IURA 4ZN4A 1N6EA 1NEXB 1ERJA 2IUVA 2B5LA 3V9FA 4A0BA 4J78A 3KRXB 4GQBB 3OKTA 3I89A 2YBAA 3F3FA 3W15A 4JSVC 4OWRA 3JAMg 2CO0C 4ERQA 4D0KA 2H6KA 1JMZB 3I7HA 3OKYA 2BBKH 4J0WA 2I0SA 5C9ZB 5HYNB 4CI2A 4X61B 2Z2PA 3NVNA 4A08B 4QT8A 4A0AA 3A0FA 5EM2A 1U4CA 2G9AA 3OTTA 2B4EA 5EMLB 5EMMB 5C2VB 4E54A 4E5ZA 3AL9A 1OMWB 3EI4B 3KRWB 2IUPA 5EAPA 5HE3B 4A11B 3JZNA 3RFHA 1SHYB 4PSWB 3SVWD 2P9LC 2PM6B 1XKSA 4XEIC 3RN0D 3J80g 2YNNA 5FQDA 2YB8B 4GQ1A 5EARA 3JB9L 5IJ8E 1L0QA 2H9NA 4K3ID 4L3GD 1K32A 3I7LA 2OK4A 2J57G 2P9SC 4TZ4A 3MZKA 2QC5A 3PSCB 3I8EA 1GG2B 4LGNA 4CY3A 3UR4A 4FA5D 3OKYB 2Z2OA 4H5IA 4PNKB 3RN1D 2H6QA 4ES0A 2XU7A 4GZ8A 3UVOA 1A0RB 2QXVA 1P22A 2PM9A 4A0AB 1OLZA 4FAND 4D6VA 5TDHB 2PBIB 3MXXA 4J8BA 3MKQA 4JSXC 3PVUB 4JSNC 4E54B 4E5ZB 1B9YA 4HDJA 1JMXB 3PVWB 4CI3A 4XYIA 5AJAA 4CZVA 4O3UB 2MTAH 2XL2A 3IJ0A 2GC4A 2CN3A 3BWSA 1K8KC 2P9UC 1PGUA 2HJ4A 3NVQA 3EMHA 5EMJB 2AH1A 4FWWA 2H47A 2BCJB 4QRJA 3SBPA 2HKMA 2IAAA 2GNQA 3EG6A 3RSEC 3UVLA 4ZOZA 4CC9A 4BH6A 4J84A 4LG8A 3VH0A 2H9LA 3UVNA 4ERYA 4QL1A 4YVDA 5IJ7E 5H14A 5IT9g 2PM9B 4KFMB 1QNIA 2YMUA 4EWRA 3AH8B 4A09A 2XL3A 3AFCA 5TEFA 4N14A 3SLED 4ZOYA 3IIYA 3PSLA 3C99A 2PM7B 3VGZA 4A7JA 5B4WA 3K27A 4BL0A 1JJUB 3JPXA 2CO0A 1YFQA 3DXMC 4O1QD 4R7AB 5FKRA 3RFGA 3OW8A 3JROA 3EWEA 3V5WB 4O3TB 1GP2B 5SXMA 5GMKn 4I79A 3C9CA 3SBRA 4X60B 2AQ5A 2H3XA 3EI2B 5HE0B 3I7OA 1XHMA 4J81A 3RMZD 4GM3A 4MK0B 4FA4D 2P9IC 4J79A 5H17A 4L3HD 2OK6A 4A0BB 4J86A 3SWSD 4O45A 3L4MD 3VA6A 4L1QD 4GMBA 4FHLA 3EI1A 3ULEC 2H9PA 4JT5C 4LG9A 2YNPA 3K26A 4A09B 4ERZA 3NVXA 4QQEA 3DM0A 2YNOA 3MMYA 4CY1A 2H13A 5EAMA 1N6DA 5C2WB 3AL8A 2CE8A 5HE1B 2CN2A 2HJBA 3FRXA 3F3PA 5EM2B 3BG1A 4PXWA 4BUJC 5GXHA 3SCYA 4XYHA 5I5JA 2EBSA 4PC0A 5KDOB 4PBZA 4J73A 3N0EA 5K1CC 5CXCA 4FA1D 3FGBA 3OL2A 3UKUC 1XIPA 3DSMA 3JZHA 5FKTA 3BG0A 3J81g 1S4UX 2P9KC 3UKRC 2IWKA 3N0DA 2I0TA 2H14A 3SMRA 2CE9A 5AMSA 2AGXA 4PSXB 2OIZA 5FKQA 4IA9A 3I8CA 2OVQB 3EI3A 5CXBA 4A08A 3I7NA 1N6FA 1Q47A 3U4YA 4A2MA 3PXSD 4IMMA 5I5MA 2UZXB 3P4FA 2HESX 3B7FA 2AGLA 3GREA 4JSPC 4ZOXA 3I2NA 2CNXA 1B9XA 1TYQC 3V7DB 3EI4A 4FA9D 3E0CA 3UVKA 2H6NA 1SQ9A 3AL8B 4GM9A 2I3TA 4X63B 2J55H 3MZLA 1VYHC 3ODTA 4GGAA 2H68A 4O9DA 1MG2A 4CZXA 3IJ1A 5GSAA 1GXRA 4A2LA 5FKSA 5CXCB 3OL2B 4GM8A 2HXCA 4FB1D 1MDAH 1JOFA 3JZGA 2AGYA 4J0XA 3RLMD 5AFU3 1FWXA 4CY2A 1RI6A 5I5IA 1MG3A 1PEVA 3EI3B 5CXBB 2UZYB 3CFVA 2O9KA 4JD2C 5IGOA 2J56H 2AGWA 5EALA 4CI8A 4H5JA 5IGQA 4JXMA 4CI1A 2AGZA 3MKSB 4AEZA 2AH0A 3IIWA 4J87A 3JRPA 2Q7QA 3L4OD 4GGCA 3SJLD 3DXKC 3CFSB 4J8GA 1GOTB 4CZYA 1U2VC 2H9MA 4K3JB 5CYKA 2I0RA 3SFZA 3UVMA 4CY5A 3PE7A 3IKOA 3SHFA 5GXIA 4Z8LA 5FXYA 1PI6A 2HKRA 3RRMC 4OZUA 4FAVD 1SQJA 4NSXA 5THAA 3FM0A 5TEEA 4UI9R 2OVRB
chains in the Genus database with same CATH superfamily
2IWFA 5HQGA 1VE6A 4ESGA 5FFGA 4JT6C 4U7AA 3C75H 3SN6B 4PBYA 2GC7A 4GGDA 2IUQA 2XYIA 3HFQA 5FA5B 5K19A 3ZDXA 2I3SA 3GFCA 5TF2A 3FCUA 2HYEA 3F3GA 4Y5RD 4BCDA 2Z2NA 2B5MA 1TBGA 3MUNA 3OKWA 5EMKB 1PBYB 3EU7A 4AOWA 2G99A 4X3EA 2W18A 5M5TA 3ORVD 3SXTD 4L9OA 5FLXg 2OJYA 2B5NA 4J77A 4ZOVA 5M5RA 4BP9A 3C5MA 3PXWD 5A2Qg 1E8MA 4UM8A 3IJCA 3I7KA 1C9LA 2OVPB 2EICA 3EI1B 3DWLC 3PXTD 5JWZA 3SBQA 4G56B 3ZE1A 4U1EI 4Y7RA 5CYKB 2TRCB 3IJEA 5H1MA 3ZWLB 3I7PA 1UOOA 4MMZA 1VZ3A 1NR0A 2QR5A 3EI2A 2P9PC 1R5MA 4J82A 2QZPA 5IC7A 4AN1A 2P9NC 4A11A 4GQ2P 5HE2B 3CIKB 3K72A 3O4GA 4O2WA 2IURA 4L1MA 1N6EA 4ZN4A 1NEXB 1I2MB 1ERJA 2IUVA 2B5LA 3V9FA 4A0BA 4J78A 3KRXB 2XE4A 4GQBB 5HDBA 3OKTA 3I89A 3V4VA 2YBAA 1E8NA 1GOFA 2EIEA 3F3FA 3W15A 4JSVC 2XDWA 4OWRA 3JAMg 2CO0C 4ERQA 4D0KA 2H6KA 1JMZB 3I7HA 3OKYA 2BBKH 4J0WA 1C9IA 2I0SA 5C9ZB 5HYNB 4CI2A 1H2XA 4X61B 2Z2PA 3EQ7A 3NVNA 4A08B 4QT8A 4JHNA 4A0AA 3A0FA 5EM2A 4UM9A 1U4CA 2G9AA 3OTTA 2B4EA 5EMLB 5M5SA 5EMMB 1E5TA 1O6FA 5C2VB 4E54A 4E5ZA 3AL9A 4MMYA 1OMWB 2JKXA 3EI4B 3KRWB 2VDLA 2IUPA 5EAPA 5HE3B 1UOPA 4Z7OA 4A11B 3JZNA 2BKLA 1UTCA 3RFHA 1SHYB 4PSWB 1BPOA 3SVWD 2P9LC 2PM6B 3IUJA 1XKSA 4XEIC 3RN0D 3J80g 2YNNA 5FQDA 2YB8B 4NENA 4GQ1A 5EARA 3NIFA 4WK2A 3JB9L 3DDUA 5IJ8E 5E6SA 3ZE2A 1L0QA 2H9NA 4K3ID 4L3GD 5C92A 1K32A 3I7LA 2OK4A 2J57G 2P9SC 4TZ4A 3O4HA 3MZKA 2QC5A 3PSCB 3I8EA 1GG2B 4JHPC 4LGNA 4CY3A 3UR4A 4FA5D 3OKYB 3K6SA 2Z2OA 4H5IA 4PNKB 3RN1D 2H6QA 4ES0A 2XU7A 4GZ8A 1JTDB 3UVOA 1A0RB 2QXVA 2VDOA 1P22A 2PM9A 2HU5A 4A0AB 1OLZA 4FAND 5M5VA 4D6VA 5TDHB 2VDKA 4AMZA 2PBIB 3MXXA 4J8BA 3MKQA 1GOGA 4JSXC 3PVUB 4JSNC 4E54B 4E5ZB 1B9YA 4HDJA 1JMXB 3PVWB 4CI3A 1L5GA 3QI0A 4XYIA 1QFSA 5AJAA 4CZVA 4O3UB 2MTAH 2XL2A 3FCSA 1M1XA 3IJ0A 2GC4A 1JV2A 2CN3A 1K8KC 2P9UC 3BWSA 1PGUA 2HJ4A 4MMXA 3NVQA 3EMHA 2XZGA 5EMJB 2AH1A 4FWWA 2H47A 2BCJB 2WQ8A 3IUQA 1T2XA 4AN0A 3V4PA 4QRJA 3SBPA 2HKMA 2IAAA 2GNQA 3EG6A 3RSEC 5FFOA 3UVLA 4Z7NA 4ZOZA 3VI4A 2HU8A 4BH6A 4J84A 4CC9A 4LG8A 3VH0A 2H9LA 5E6RA 3UVNA 4ERYA 3ZDYA 4QL1A 4YVDA 5IJ7E 5H14A 5IT9g 2PM9B 4KFMB 1QNIA 5M61A 4DNWA 2YMUA 4EWRA 3AH8B 4A09A 4WK0A 2XL3A 3AFCA 5TEFA 4N14A 3SLED 4ZOYA 3IIYA 3PSLA 1TYEA 3C99A 2PM7B 3VGZA 4A7JA 5B4WA 3K27A 4BL0A 1JJUB 3JPXA 2CO0A 1YFQA 3DXMC 4O1QD 4R7AB 5FKRA 3RFGA 3OW8A 3JROA 3EWEA 3V5WB 4O3TB 4NC4A 1GP2B 4IRZA 4RE6A 5SXMA 4I79A 5GMKn 3C9CA 3SBRA 4X60B 2AQ5A 4WJKA 2H3XA 2EIBA 3EI2B 5HE0B 3K71A 3I7OA 1XHMA 4J81A 3NIDA 3RMZD 1VZ2A 4GM3A 4MK0B 2VDRA 3IUNA 4AMYA 4FA4D 2P9IC 4J79A 5H17A 4L3HD 2OK6A 4A0BB 4J86A 3SWSD 1UOQA 4O45A 3L4MD 3VA6A 2VDNA 4L1QD 4GMBA 4QAMA 4FHLA 3EI1A 3ULEC 2H9PA 4JT5C 2VDPA 4LG9A 2YNPA 3K26A 4A09B 4ERZA 3NVXA 4QQEA 3DM0A 2YNOA 3MMYA 4BCBA 4CY1A 3QHYB 2H13A 2VZ3A 5EAMA 1N6DA 5C2WB 3KCIA 3AL8A 2CE8A 3NIGA 5HE1B 2CN2A 2HJBA 3FRXA 3F3PA 5EM2B 3BG1A 4PXWA 4BUJC 5GXHA 3SCYA 1O6GA 4XYHA 2VC2A 1U8CA 5I5JA 2EBSA 1K3IA 4PC0A 5KDOB 4NBMA 4PBZA 4J73A 3N0EA 5K1CC 5CXCA 4FA1D 3EQ8A 3FGBA 3OL2A 3T3MA 3UKUC 4Z7QA 1XIPA 3DSMA 3JZHA 5FKTA 3BG0A 3J81g 1S4UX 2P9KC 1A12A 3UKRC 2IWKA 3MUOA 3N0DA 2I0TA 2H14A 3SMRA 2CE9A 5AMSA 2AGXA 4PSXB 2OIZA 4AX4A 5FKQA 2VZ1A 4IA9A 3I8CA 2OVQB 3EI3A 5CXBA 3ZDZA 4A08A 4G1EA 3I7NA 1N6FA 1Q47A 3U4YA 4A2MA 3PXSD 2HU7A 4IMMA 5I5MA 2UZXB 3P4FA 1VE7A 2HESX 3B7FA 2AGLA 3GREA 4JSPC 4ZOXA 1H2ZA 3I2NA 1B9XA 1TYQC 2CNXA 3V7DB 4BP8A 3EI4A 4NAAA 4FA9D 3E0CA 3UVKA 2H6NA 2VDQA 1SQ9A 3AL8B 4GM9A 2I3TA 4X63B 5C86A 2J55H 3IULA 3MZLA 3GC3B 1VYHC 3ODTA 4GGAA 2H68A 4O9DA 1MG2A 4CZXA 1YR2A 3IJ1A 3IVMA 3IUMA 3EQ9A 5GSAA 1GXRA 4A2LA 5FKSA 5CXCB 3VI3A 3OL2B 4RE5A 4GM8A 4G55A 2HXCA 4FB1D 3O4IA 1MDAH 5E6UA 3O4JA 1JOFA 3JZGA 2AGYA 3GD1I 4BCCA 4J0XA 3RLMD 5AFU3 1FWXA 4CY2A 1RI6A 5I5IA 3T3PA 1MG3A 1PEVA 3EI3B 5CXBB 2UZYB 3CFVA 2O9KA 4JD2C 5IGOA 2J56H 3ZE0A 3MVDK 2AGWA 3OF7A 5EALA 4DNUA 4H5JA 4CI8A 5IGQA 4JXMA 4CI1A 2AGZA 3MKSB 4AEZA 1GOHA 2AH0A 3IIWA 4D9SA 4J87A 3JRPA 2Q7QA 3L4OD 1QFMA 4GGCA 3SJLD 4G1MA 3DXKC 4DNVA 3CFSB 4J8GA 1GOTB 4CZYA 1U2VC 2H9MA 4K3JB 5CYKA 4O02A 2I0RA 3SFZA 3UVMA 4CY5A 3PE7A 3IKOA 3SHFA 4WK4A 5GXIA 2VDMA 4Z8LA 3IURA 5FXYA 5M5UA 1PI6A 2HKRA 1H2WA 3RRMC 4OZUA 4FAVD 1SQJA 4NSXA 5THAA 1H2YA 3FM0A 5TEEA 4UI9R 2OVRB 2EIDA
chains in the Genus database with same CATH topology
2IWFA 5HQGA 4ESGA 4JT6C 4U7AA 3C75H 3SN6B 4PBYA 2GC7A 4GGDA 2IUQA 2XYIA 3HFQA 5FA5B 5K19A 2I3SA 3GFCA 5TF2A 2HYEA 3F3GA 4Y5RD 2Z2NA 2B5MA 1TBGA 5EMKB 3OKWA 1PBYB 3EU7A 4AOWA 2G99A 4X3EA 2W18A 3ORVD 3SXTD 4L9OA 5FLXg 2OJYA 2B5NA 4J77A 4ZOVA 3C5MA 3PXWD 5A2Qg 3IJCA 3I7KA 2OVPB 3EI1B 3DWLC 3PXTD 5JWZA 3SBQA 4G56B 4U1EI 4Y7RA 5CYKB 2TRCB 5H1MA 3ZWLB 3I7PA 1NR0A 3EI2A 2P9PC 1R5MA 4J82A 5IC7A 2P9NC 4A11A 4GQ2P 5HE2B 3CIKB 2IURA 4ZN4A 1N6EA 1NEXB 1ERJA 2IUVA 2B5LA 3V9FA 4A0BA 4J78A 3KRXB 4GQBB 3OKTA 3I89A 2YBAA 3F3FA 3W15A 4JSVC 4OWRA 3JAMg 2CO0C 4ERQA 4D0KA 2H6KA 1JMZB 3I7HA 3OKYA 2BBKH 4J0WA 2I0SA 5C9ZB 5HYNB 4CI2A 4X61B 2Z2PA 3NVNA 4A08B 4QT8A 4A0AA 3A0FA 5EM2A 1U4CA 2G9AA 3OTTA 2B4EA 5EMLB 5EMMB 5C2VB 4E54A 4E5ZA 3AL9A 1OMWB 3EI4B 3KRWB 2IUPA 5EAPA 5HE3B 4A11B 3JZNA 3RFHA 1SHYB 4PSWB 3SVWD 2P9LC 2PM6B 1XKSA 4XEIC 3RN0D 3J80g 2YNNA 5FQDA 2YB8B 4GQ1A 5EARA 3JB9L 5IJ8E 1L0QA 2H9NA 4K3ID 4L3GD 1K32A 3I7LA 2OK4A 2J57G 2P9SC 4TZ4A 3MZKA 2QC5A 3PSCB 3I8EA 1GG2B 4LGNA 4CY3A 3UR4A 4FA5D 3OKYB 2Z2OA 4H5IA 4PNKB 3RN1D 2H6QA 4ES0A 2XU7A 4GZ8A 3UVOA 1A0RB 2QXVA 1P22A 2PM9A 4A0AB 1OLZA 4FAND 4D6VA 5TDHB 2PBIB 3MXXA 4J8BA 3MKQA 4JSXC 3PVUB 4JSNC 4E54B 4E5ZB 1B9YA 4HDJA 1JMXB 3PVWB 4CI3A 4XYIA 5AJAA 4CZVA 4O3UB 2MTAH 2XL2A 3IJ0A 2GC4A 2CN3A 3BWSA 1K8KC 2P9UC 1PGUA 2HJ4A 3NVQA 3EMHA 5EMJB 2AH1A 4FWWA 2H47A 2BCJB 4QRJA 3SBPA 2HKMA 2IAAA 2GNQA 3EG6A 3RSEC 3UVLA 4ZOZA 4CC9A 4BH6A 4J84A 4LG8A 3VH0A 2H9LA 3UVNA 4ERYA 4QL1A 4YVDA 5IJ7E 5H14A 5IT9g 2PM9B 4KFMB 1QNIA 2YMUA 4EWRA 3AH8B 4A09A 2XL3A 3AFCA 5TEFA 4N14A 3SLED 4ZOYA 3IIYA 3PSLA 3C99A 2PM7B 3VGZA 4A7JA 5B4WA 3K27A 4BL0A 1JJUB 3JPXA 2CO0A 1YFQA 3DXMC 4O1QD 4R7AB 5FKRA 3RFGA 3OW8A 3JROA 3EWEA 3V5WB 4O3TB 1GP2B 5SXMA 5GMKn 4I79A 3C9CA 3SBRA 4X60B 2AQ5A 2H3XA 3EI2B 5HE0B 3I7OA 1XHMA 4J81A 3RMZD 4GM3A 4MK0B 4FA4D 2P9IC 4J79A 5H17A 4L3HD 2OK6A 4A0BB 4J86A 3SWSD 4O45A 3L4MD 3VA6A 4L1QD 4GMBA 4FHLA 3EI1A 3ULEC 2H9PA 4JT5C 4LG9A 2YNPA 3K26A 4A09B 4ERZA 3NVXA 4QQEA 3DM0A 2YNOA 3MMYA 4CY1A 2H13A 5EAMA 1N6DA 5C2WB 3AL8A 2CE8A 5HE1B 2CN2A 2HJBA 3FRXA 3F3PA 5EM2B 3BG1A 4PXWA 4BUJC 5GXHA 3SCYA 4XYHA 5I5JA 2EBSA 4PC0A 5KDOB 4PBZA 4J73A 3N0EA 5K1CC 5CXCA 4FA1D 3FGBA 3OL2A 3UKUC 1XIPA 3DSMA 3JZHA 5FKTA 3BG0A 3J81g 1S4UX 2P9KC 3UKRC 2IWKA 3N0DA 2I0TA 2H14A 3SMRA 2CE9A 5AMSA 2AGXA 4PSXB 2OIZA 5FKQA 4IA9A 3I8CA 2OVQB 3EI3A 5CXBA 4A08A 3I7NA 1N6FA 1Q47A 3U4YA 4A2MA 3PXSD 4IMMA 5I5MA 2UZXB 3P4FA 2HESX 3B7FA 2AGLA 3GREA 4JSPC 4ZOXA 3I2NA 2CNXA 1B9XA 1TYQC 3V7DB 3EI4A 4FA9D 3E0CA 3UVKA 2H6NA 1SQ9A 3AL8B 4GM9A 2I3TA 4X63B 2J55H 3MZLA 1VYHC 3ODTA 4GGAA 2H68A 4O9DA 1MG2A 4CZXA 3IJ1A 5GSAA 1GXRA 4A2LA 5FKSA 5CXCB 3OL2B 4GM8A 2HXCA 4FB1D 1MDAH 1JOFA 3JZGA 2AGYA 4J0XA 3RLMD 5AFU3 1FWXA 4CY2A 1RI6A 5I5IA 1MG3A 1PEVA 3EI3B 5CXBB 2UZYB 3CFVA 2O9KA 4JD2C 5IGOA 2J56H 2AGWA 5EALA 4CI8A 4H5JA 5IGQA 4JXMA 4CI1A 2AGZA 3MKSB 4AEZA 2AH0A 3IIWA 4J87A 3JRPA 2Q7QA 3L4OD 4GGCA 3SJLD 3DXKC 3CFSB 4J8GA 1GOTB 4CZYA 1U2VC 2H9MA 4K3JB 5CYKA 2I0RA 3SFZA 3UVMA 4CY5A 3PE7A 3IKOA 3SHFA 5GXIA 4Z8LA 5FXYA 1PI6A 2HKRA 3RRMC 4OZUA 4FAVD 1SQJA 4NSXA 5THAA 3FM0A 5TEEA 4UI9R 2OVRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWF A;  5HQG A;  4ESG A;  4JT6 C;  4U7A A;  3C75 H;  3SN6 B;  4PBY A;  2GC7 A;  4GGD A;  2IUQ A;  2XYI A;  3HFQ A;  5FA5 B;  5K19 A;  2I3S A;  3GFC A;  5TF2 A;  2HYE A;  3F3G A;  4Y5R D;  2Z2N A;  2B5M A;  1TBG A;  5EMK B;  3OKW A;  1PBY B;  3EU7 A;  4AOW A;  2G99 A;  4X3E A;  2W18 A;  3ORV D;  3SXT D;  4L9O A;  5FLX g;  2OJY A;  2B5N A;  4J77 A;  4ZOV A;  3C5M A;  3PXW D;  5A2Q g;  3IJC A;  3I7K A;  2OVP B;  3EI1 B;  3DWL C;  3PXT D;  5JWZ A;  3SBQ A;  4G56 B;  4U1E I;  4Y7R A;  5CYK B;  2TRC B;  5H1M A;  3ZWL B;  3I7P A;  1NR0 A;  3EI2 A;  2P9P C;  1R5M A;  4J82 A;  5IC7 A;  2P9N C;  4A11 A;  4GQ2 P;  5HE2 B;  3CIK B;  2IUR A;  4ZN4 A;  1N6E A;  1NEX B;  1ERJ A;  2IUV A;  2B5L A;  3V9F A;  4A0B A;  4J78 A;  3KRX B;  4GQB B;  3OKT A;  3I89 A;  2YBA A;  3F3F A;  3W15 A;  4JSV C;  4OWR A;  3JAM g;  2CO0 C;  4ERQ A;  4D0K A;  2H6K A;  1JMZ B;  3I7H A;  3OKY A;  2BBK H;  4J0W A;  2I0S A;  5C9Z B;  5HYN B;  4CI2 A;  4X61 B;  2Z2P A;  3NVN A;  4A08 B;  4QT8 A;  4A0A A;  3A0F A;  5EM2 A;  1U4C A;  2G9A A;  3OTT A;  2B4E A;  5EML B;  5EMM B;  5C2V B;  4E54 A;  4E5Z A;  3AL9 A;  1OMW B;  3EI4 B;  3KRW B;  2IUP A;  5EAP A;  5HE3 B;  4A11 B;  3JZN A;  3RFH A;  1SHY B;  4PSW B;  3SVW D;  2P9L C;  2PM6 B;  1XKS A;  4XEI C;  3RN0 D;  3J80 g;  2YNN A;  5FQD A;  2YB8 B;  4GQ1 A;  5EAR A;  3JB9 L;  5IJ8 E;  1L0Q A;  2H9N A;  4K3I D;  4L3G D;  1K32 A;  3I7L A;  2OK4 A;  2J57 G;  2P9S C;  4TZ4 A;  3MZK A;  2QC5 A;  3PSC B;  3I8E A;  1GG2 B;  4LGN A;  4CY3 A;  3UR4 A;  4FA5 D;  3OKY B;  2Z2O A;  4H5I A;  4PNK B;  3RN1 D;  2H6Q A;  4ES0 A;  2XU7 A;  4GZ8 A;  3UVO A;  1A0R B;  2QXV A;  1P22 A;  2PM9 A;  4A0A B;  1OLZ A;  4FAN D;  4D6V A;  5TDH B;  2PBI B;  3MXX A;  4J8B A;  3MKQ A;  4JSX C;  3PVU B;  4JSN C;  4E54 B;  4E5Z B;  1B9Y A;  4HDJ A;  1JMX B;  3PVW B;  4CI3 A;  4XYI A;  5AJA A;  4CZV A;  4O3U B;  2MTA H;  2XL2 A;  3IJ0 A;  2GC4 A;  2CN3 A;  3BWS A;  1K8K C;  2P9U C;  1PGU A;  2HJ4 A;  3NVQ A;  3EMH A;  5EMJ B;  2AH1 A;  4FWW A;  2H47 A;  2BCJ B;  4QRJ A;  3SBP A;  2HKM A;  2IAA A;  2GNQ A;  3EG6 A;  3RSE C;  3UVL A;  4ZOZ A;  4CC9 A;  4BH6 A;  4J84 A;  4LG8 A;  3VH0 A;  2H9L A;  3UVN A;  4ERY A;  4QL1 A;  4YVD A;  5IJ7 E;  5H14 A;  5IT9 g;  2PM9 B;  4KFM B;  1QNI A;  2YMU A;  4EWR A;  3AH8 B;  4A09 A;  2XL3 A;  3AFC A;  5TEF A;  4N14 A;  3SLE D;  4ZOY A;  3IIY A;  3PSL A;  3C99 A;  2PM7 B;  3VGZ A;  4A7J A;  5B4W A;  3K27 A;  4BL0 A;  1JJU B;  3JPX A;  2CO0 A;  1YFQ A;  3DXM C;  4O1Q D;  4R7A B;  5FKR A;  3RFG A;  3OW8 A;  3JRO A;  3EWE A;  3V5W B;  4O3T B;  1GP2 B;  5SXM A;  5GMK n;  4I79 A;  3C9C A;  3SBR A;  4X60 B;  2AQ5 A;  2H3X A;  3EI2 B;  5HE0 B;  3I7O A;  1XHM A;  4J81 A;  3RMZ D;  4GM3 A;  4MK0 B;  4FA4 D;  2P9I C;  4J79 A;  5H17 A;  4L3H D;  2OK6 A;  4A0B B;  4J86 A;  3SWS D;  4O45 A;  3L4M D;  3VA6 A;  4L1Q D;  4GMB A;  4FHL A;  3EI1 A;  3ULE C;  2H9P A;  4JT5 C;  4LG9 A;  2YNP A;  3K26 A;  4A09 B;  4ERZ A;  3NVX A;  4QQE A;  3DM0 A;  2YNO A;  3MMY A;  4CY1 A;  2H13 A;  5EAM A;  1N6D A;  5C2W B;  3AL8 A;  2CE8 A;  5HE1 B;  2CN2 A;  2HJB A;  3FRX A;  3F3P A;  5EM2 B;  3BG1 A;  4PXW A;  4BUJ C;  5GXH A;  3SCY A;  4XYH A;  5I5J A;  2EBS A;  4PC0 A;  5KDO B;  4PBZ A;  4J73 A;  3N0E A;  5K1C C;  5CXC A;  4FA1 D;  3FGB A;  3OL2 A;  3UKU C;  1XIP A;  3DSM A;  3JZH A;  5FKT A;  3BG0 A;  3J81 g;  1S4U X;  2P9K C;  3UKR C;  2IWK A;  3N0D A;  2I0T A;  2H14 A;  3SMR A;  2CE9 A;  5AMS A;  2AGX A;  4PSX B;  2OIZ A;  5FKQ A;  4IA9 A;  3I8C A;  2OVQ B;  3EI3 A;  5CXB A;  4A08 A;  3I7N A;  1N6F A;  1Q47 A;  3U4Y A;  4A2M A;  3PXS D;  4IMM A;  5I5M A;  2UZX B;  3P4F A;  2HES X;  3B7F A;  2AGL A;  3GRE A;  4JSP C;  4ZOX A;  3I2N A;  2CNX A;  1B9X A;  1TYQ C;  3V7D B;  3EI4 A;  4FA9 D;  3E0C A;  3UVK A;  2H6N A;  1SQ9 A;  3AL8 B;  4GM9 A;  2I3T A;  4X63 B;  2J55 H;  3MZL A;  1VYH C;  3ODT A;  4GGA A;  2H68 A;  4O9D A;  1MG2 A;  4CZX A;  3IJ1 A;  5GSA A;  1GXR A;  4A2L A;  5FKS A;  5CXC B;  3OL2 B;  4GM8 A;  2HXC A;  4FB1 D;  1MDA H;  1JOF A;  3JZG A;  2AGY A;  4J0X A;  3RLM D;  5AFU 3;  1FWX A;  4CY2 A;  1RI6 A;  5I5I A;  1MG3 A;  1PEV A;  3EI3 B;  5CXB B;  2UZY B;  3CFV A;  2O9K A;  4JD2 C;  5IGO A;  2J56 H;  2AGW A;  5EAL A;  4CI8 A;  4H5J A;  5IGQ A;  4JXM A;  4CI1 A;  2AGZ A;  3MKS B;  4AEZ A;  2AH0 A;  3IIW A;  4J87 A;  3JRP A;  2Q7Q A;  3L4O D;  4GGC A;  3SJL D;  3DXK C;  3CFS B;  4J8G A;  1GOT B;  4CZY A;  1U2V C;  2H9M A;  4K3J B;  5CYK A;  2I0R A;  3SFZ A;  3UVM A;  4CY5 A;  3PE7 A;  3IKO A;  3SHF A;  5GXI A;  4Z8L A;  5FXY A;  1PI6 A;  2HKR A;  3RRM C;  4OZU A;  4FAV D;  1SQJ A;  4NSX A;  5THA A;  3FM0 A;  5TEE A;  4UI9 R;  2OVR B; 
#chains in the Genus database with same CATH topology
 2IWF A;  5HQG A;  1VE6 A;  4ESG A;  5FFG A;  4JT6 C;  4U7A A;  3C75 H;  3SN6 B;  4PBY A;  2GC7 A;  4GGD A;  2IUQ A;  2XYI A;  3HFQ A;  5FA5 B;  5K19 A;  3ZDX A;  2I3S A;  3GFC A;  5TF2 A;  3FCU A;  2HYE A;  3F3G A;  4Y5R D;  4BCD A;  2Z2N A;  2B5M A;  1TBG A;  3MUN A;  3OKW A;  5EMK B;  1PBY B;  3EU7 A;  4AOW A;  2G99 A;  4X3E A;  2W18 A;  5M5T A;  3ORV D;  3SXT D;  4L9O A;  5FLX g;  2OJY A;  2B5N A;  4J77 A;  4ZOV A;  5M5R A;  4BP9 A;  3C5M A;  3PXW D;  5A2Q g;  1E8M A;  4UM8 A;  3IJC A;  3I7K A;  1C9L A;  2OVP B;  2EIC A;  3EI1 B;  3DWL C;  3PXT D;  5JWZ A;  3SBQ A;  4G56 B;  3ZE1 A;  4U1E I;  4Y7R A;  5CYK B;  2TRC B;  3IJE A;  5H1M A;  3ZWL B;  3I7P A;  1UOO A;  4MMZ A;  1VZ3 A;  1NR0 A;  2QR5 A;  3EI2 A;  2P9P C;  1R5M A;  4J82 A;  2QZP A;  5IC7 A;  4AN1 A;  2P9N C;  4A11 A;  4GQ2 P;  5HE2 B;  3CIK B;  3K72 A;  3O4G A;  4O2W A;  2IUR A;  4L1M A;  1N6E A;  4ZN4 A;  1NEX B;  1I2M B;  1ERJ A;  2IUV A;  2B5L A;  3V9F A;  4A0B A;  4J78 A;  3KRX B;  2XE4 A;  4GQB B;  5HDB A;  3OKT A;  3I89 A;  3V4V A;  2YBA A;  1E8N A;  1GOF A;  2EIE A;  3F3F A;  3W15 A;  4JSV C;  2XDW A;  4OWR A;  3JAM g;  2CO0 C;  4ERQ A;  4D0K A;  2H6K A;  1JMZ B;  3I7H A;  3OKY A;  2BBK H;  4J0W A;  1C9I A;  2I0S A;  5C9Z B;  5HYN B;  4CI2 A;  1H2X A;  4X61 B;  2Z2P A;  3EQ7 A;  3NVN A;  4A08 B;  4QT8 A;  4JHN A;  4A0A A;  3A0F A;  5EM2 A;  4UM9 A;  1U4C A;  2G9A A;  3OTT A;  2B4E A;  5EML B;  5M5S A;  5EMM B;  1E5T A;  1O6F A;  5C2V B;  4E54 A;  4E5Z A;  3AL9 A;  4MMY A;  1OMW B;  2JKX A;  3EI4 B;  3KRW B;  2VDL A;  2IUP A;  5EAP A;  5HE3 B;  1UOP A;  4Z7O A;  4A11 B;  3JZN A;  2BKL A;  1UTC A;  3RFH A;  1SHY B;  4PSW B;  1BPO A;  3SVW D;  2P9L C;  2PM6 B;  3IUJ A;  1XKS A;  4XEI C;  3RN0 D;  3J80 g;  2YNN A;  5FQD A;  2YB8 B;  4NEN A;  4GQ1 A;  5EAR A;  3NIF A;  4WK2 A;  3JB9 L;  3DDU A;  5IJ8 E;  5E6S A;  3ZE2 A;  1L0Q A;  2H9N A;  4K3I D;  4L3G D;  5C92 A;  1K32 A;  3I7L A;  2OK4 A;  2J57 G;  2P9S C;  4TZ4 A;  3O4H A;  3MZK A;  2QC5 A;  3PSC B;  3I8E A;  1GG2 B;  4JHP C;  4LGN A;  4CY3 A;  3UR4 A;  4FA5 D;  3OKY B;  3K6S A;  2Z2O A;  4H5I A;  4PNK B;  3RN1 D;  2H6Q A;  4ES0 A;  2XU7 A;  4GZ8 A;  1JTD B;  3UVO A;  1A0R B;  2QXV A;  2VDO A;  1P22 A;  2PM9 A;  2HU5 A;  4A0A B;  1OLZ A;  4FAN D;  5M5V A;  4D6V A;  5TDH B;  2VDK A;  4AMZ A;  2PBI B;  3MXX A;  4J8B A;  3MKQ A;  1GOG A;  4JSX C;  3PVU B;  4JSN C;  4E54 B;  4E5Z B;  1B9Y A;  4HDJ A;  1JMX B;  3PVW B;  4CI3 A;  1L5G A;  3QI0 A;  4XYI A;  1QFS A;  5AJA A;  4CZV A;  4O3U B;  2MTA H;  2XL2 A;  3FCS A;  1M1X A;  3IJ0 A;  2GC4 A;  1JV2 A;  2CN3 A;  1K8K C;  2P9U C;  3BWS A;  1PGU A;  2HJ4 A;  4MMX A;  3NVQ A;  3EMH A;  2XZG A;  5EMJ B;  2AH1 A;  4FWW A;  2H47 A;  2BCJ B;  2WQ8 A;  3IUQ A;  1T2X A;  4AN0 A;  3V4P A;  4QRJ A;  3SBP A;  2HKM A;  2IAA A;  2GNQ A;  3EG6 A;  3RSE C;  5FFO A;  3UVL A;  4Z7N A;  4ZOZ A;  3VI4 A;  2HU8 A;  4BH6 A;  4J84 A;  4CC9 A;  4LG8 A;  3VH0 A;  2H9L A;  5E6R A;  3UVN A;  4ERY A;  3ZDY A;  4QL1 A;  4YVD A;  5IJ7 E;  5H14 A;  5IT9 g;  2PM9 B;  4KFM B;  1QNI A;  5M61 A;  4DNW A;  2YMU A;  4EWR A;  3AH8 B;  4A09 A;  4WK0 A;  2XL3 A;  3AFC A;  5TEF A;  4N14 A;  3SLE D;  4ZOY A;  3IIY A;  3PSL A;  1TYE A;  3C99 A;  2PM7 B;  3VGZ A;  4A7J A;  5B4W A;  3K27 A;  4BL0 A;  1JJU B;  3JPX A;  2CO0 A;  1YFQ A;  3DXM C;  4O1Q D;  4R7A B;  5FKR A;  3RFG A;  3OW8 A;  3JRO A;  3EWE A;  3V5W B;  4O3T B;  4NC4 A;  1GP2 B;  4IRZ A;  4RE6 A;  5SXM A;  4I79 A;  5GMK n;  3C9C A;  3SBR A;  4X60 B;  2AQ5 A;  4WJK A;  2H3X A;  2EIB A;  3EI2 B;  5HE0 B;  3K71 A;  3I7O A;  1XHM A;  4J81 A;  3NID A;  3RMZ D;  1VZ2 A;  4GM3 A;  4MK0 B;  2VDR A;  3IUN A;  4AMY A;  4FA4 D;  2P9I C;  4J79 A;  5H17 A;  4L3H D;  2OK6 A;  4A0B B;  4J86 A;  3SWS D;  1UOQ A;  4O45 A;  3L4M D;  3VA6 A;  2VDN A;  4L1Q D;  4GMB A;  4QAM A;  4FHL A;  3EI1 A;  3ULE C;  2H9P A;  4JT5 C;  2VDP A;  4LG9 A;  2YNP A;  3K26 A;  4A09 B;  4ERZ A;  3NVX A;  4QQE A;  3DM0 A;  2YNO A;  3MMY A;  4BCB A;  4CY1 A;  3QHY B;  2H13 A;  2VZ3 A;  5EAM A;  1N6D A;  5C2W B;  3KCI A;  3AL8 A;  2CE8 A;  3NIG A;  5HE1 B;  2CN2 A;  2HJB A;  3FRX A;  3F3P A;  5EM2 B;  3BG1 A;  4PXW A;  4BUJ C;  5GXH A;  3SCY A;  1O6G A;  4XYH A;  2VC2 A;  1U8C A;  5I5J A;  2EBS A;  1K3I A;  4PC0 A;  5KDO B;  4NBM A;  4PBZ A;  4J73 A;  3N0E A;  5K1C C;  5CXC A;  4FA1 D;  3EQ8 A;  3FGB A;  3OL2 A;  3T3M A;  3UKU C;  4Z7Q A;  1XIP A;  3DSM A;  3JZH A;  5FKT A;  3BG0 A;  3J81 g;  1S4U X;  2P9K C;  1A12 A;  3UKR C;  2IWK A;  3MUO A;  3N0D A;  2I0T A;  2H14 A;  3SMR A;  2CE9 A;  5AMS A;  2AGX A;  4PSX B;  2OIZ A;  4AX4 A;  5FKQ A;  2VZ1 A;  4IA9 A;  3I8C A;  2OVQ B;  3EI3 A;  5CXB A;  3ZDZ A;  4A08 A;  4G1E A;  3I7N A;  1N6F A;  1Q47 A;  3U4Y A;  4A2M A;  3PXS D;  2HU7 A;  4IMM A;  5I5M A;  2UZX B;  3P4F A;  1VE7 A;  2HES X;  3B7F A;  2AGL A;  3GRE A;  4JSP C;  4ZOX A;  1H2Z A;  3I2N A;  1B9X A;  1TYQ C;  2CNX A;  3V7D B;  4BP8 A;  3EI4 A;  4NAA A;  4FA9 D;  3E0C A;  3UVK A;  2H6N A;  2VDQ A;  1SQ9 A;  3AL8 B;  4GM9 A;  2I3T A;  4X63 B;  5C86 A;  2J55 H;  3IUL A;  3MZL A;  3GC3 B;  1VYH C;  3ODT A;  4GGA A;  2H68 A;  4O9D A;  1MG2 A;  4CZX A;  1YR2 A;  3IJ1 A;  3IVM A;  3IUM A;  3EQ9 A;  5GSA A;  1GXR A;  4A2L A;  5FKS A;  5CXC B;  3VI3 A;  3OL2 B;  4RE5 A;  4GM8 A;  4G55 A;  2HXC A;  4FB1 D;  3O4I A;  1MDA H;  5E6U A;  3O4J A;  1JOF A;  3JZG A;  2AGY A;  3GD1 I;  4BCC A;  4J0X A;  3RLM D;  5AFU 3;  1FWX A;  4CY2 A;  1RI6 A;  5I5I A;  3T3P A;  1MG3 A;  1PEV A;  3EI3 B;  5CXB B;  2UZY B;  3CFV A;  2O9K A;  4JD2 C;  5IGO A;  2J56 H;  3ZE0 A;  3MVD K;  2AGW A;  3OF7 A;  5EAL A;  4DNU A;  4H5J A;  4CI8 A;  5IGQ A;  4JXM A;  4CI1 A;  2AGZ A;  3MKS B;  4AEZ A;  1GOH A;  2AH0 A;  3IIW A;  4D9S A;  4J87 A;  3JRP A;  2Q7Q A;  3L4O D;  1QFM A;  4GGC A;  3SJL D;  4G1M A;  3DXK C;  4DNV A;  3CFS B;  4J8G A;  1GOT B;  4CZY A;  1U2V C;  2H9M A;  4K3J B;  5CYK A;  4O02 A;  2I0R A;  3SFZ A;  3UVM A;  4CY5 A;  3PE7 A;  3IKO A;  3SHF A;  4WK4 A;  5GXI A;  2VDM A;  4Z8L A;  3IUR A;  5FXY A;  5M5U A;  1PI6 A;  2HKR A;  1H2W A;  3RRM C;  4OZU A;  4FAV D;  1SQJ A;  4NSX A;  5THA A;  1H2Y A;  3FM0 A;  5TEE A;  4UI9 R;  2OVR B;  2EID A; 
#chains in the Genus database with same CATH homology
 2IWF A;  5HQG A;  4ESG A;  4JT6 C;  4U7A A;  3C75 H;  3SN6 B;  4PBY A;  2GC7 A;  4GGD A;  2IUQ A;  2XYI A;  3HFQ A;  5FA5 B;  5K19 A;  2I3S A;  3GFC A;  5TF2 A;  2HYE A;  3F3G A;  4Y5R D;  2Z2N A;  2B5M A;  1TBG A;  5EMK B;  3OKW A;  1PBY B;  3EU7 A;  4AOW A;  2G99 A;  4X3E A;  2W18 A;  3ORV D;  3SXT D;  4L9O A;  5FLX g;  2OJY A;  2B5N A;  4J77 A;  4ZOV A;  3C5M A;  3PXW D;  5A2Q g;  3IJC A;  3I7K A;  2OVP B;  3EI1 B;  3DWL C;  3PXT D;  5JWZ A;  3SBQ A;  4G56 B;  4U1E I;  4Y7R A;  5CYK B;  2TRC B;  5H1M A;  3ZWL B;  3I7P A;  1NR0 A;  3EI2 A;  2P9P C;  1R5M A;  4J82 A;  5IC7 A;  2P9N C;  4A11 A;  4GQ2 P;  5HE2 B;  3CIK B;  2IUR A;  4ZN4 A;  1N6E A;  1NEX B;  1ERJ A;  2IUV A;  2B5L A;  3V9F A;  4A0B A;  4J78 A;  3KRX B;  4GQB B;  3OKT A;  3I89 A;  2YBA A;  3F3F A;  3W15 A;  4JSV C;  4OWR A;  3JAM g;  2CO0 C;  4ERQ A;  4D0K A;  2H6K A;  1JMZ B;  3I7H A;  3OKY A;  2BBK H;  4J0W A;  2I0S A;  5C9Z B;  5HYN B;  4CI2 A;  4X61 B;  2Z2P A;  3NVN A;  4A08 B;  4QT8 A;  4A0A A;  3A0F A;  5EM2 A;  1U4C A;  2G9A A;  3OTT A;  2B4E A;  5EML B;  5EMM B;  5C2V B;  4E54 A;  4E5Z A;  3AL9 A;  1OMW B;  3EI4 B;  3KRW B;  2IUP A;  5EAP A;  5HE3 B;  4A11 B;  3JZN A;  3RFH A;  1SHY B;  4PSW B;  3SVW D;  2P9L C;  2PM6 B;  1XKS A;  4XEI C;  3RN0 D;  3J80 g;  2YNN A;  5FQD A;  2YB8 B;  4GQ1 A;  5EAR A;  3JB9 L;  5IJ8 E;  1L0Q A;  2H9N A;  4K3I D;  4L3G D;  1K32 A;  3I7L A;  2OK4 A;  2J57 G;  2P9S C;  4TZ4 A;  3MZK A;  2QC5 A;  3PSC B;  3I8E A;  1GG2 B;  4LGN A;  4CY3 A;  3UR4 A;  4FA5 D;  3OKY B;  2Z2O A;  4H5I A;  4PNK B;  3RN1 D;  2H6Q A;  4ES0 A;  2XU7 A;  4GZ8 A;  3UVO A;  1A0R B;  2QXV A;  1P22 A;  2PM9 A;  4A0A B;  1OLZ A;  4FAN D;  4D6V A;  5TDH B;  2PBI B;  3MXX A;  4J8B A;  3MKQ A;  4JSX C;  3PVU B;  4JSN C;  4E54 B;  4E5Z B;  1B9Y A;  4HDJ A;  1JMX B;  3PVW B;  4CI3 A;  4XYI A;  5AJA A;  4CZV A;  4O3U B;  2MTA H;  2XL2 A;  3IJ0 A;  2GC4 A;  2CN3 A;  3BWS A;  1K8K C;  2P9U C;  1PGU A;  2HJ4 A;  3NVQ A;  3EMH A;  5EMJ B;  2AH1 A;  4FWW A;  2H47 A;  2BCJ B;  4QRJ A;  3SBP A;  2HKM A;  2IAA A;  2GNQ A;  3EG6 A;  3RSE C;  3UVL A;  4ZOZ A;  4CC9 A;  4BH6 A;  4J84 A;  4LG8 A;  3VH0 A;  2H9L A;  3UVN A;  4ERY A;  4QL1 A;  4YVD A;  5IJ7 E;  5H14 A;  5IT9 g;  2PM9 B;  4KFM B;  1QNI A;  2YMU A;  4EWR A;  3AH8 B;  4A09 A;  2XL3 A;  3AFC A;  5TEF A;  4N14 A;  3SLE D;  4ZOY A;  3IIY A;  3PSL A;  3C99 A;  2PM7 B;  3VGZ A;  4A7J A;  5B4W A;  3K27 A;  4BL0 A;  1JJU B;  3JPX A;  2CO0 A;  1YFQ A;  3DXM C;  4O1Q D;  4R7A B;  5FKR A;  3RFG A;  3OW8 A;  3JRO A;  3EWE A;  3V5W B;  4O3T B;  1GP2 B;  5SXM A;  5GMK n;  4I79 A;  3C9C A;  3SBR A;  4X60 B;  2AQ5 A;  2H3X A;  3EI2 B;  5HE0 B;  3I7O A;  1XHM A;  4J81 A;  3RMZ D;  4GM3 A;  4MK0 B;  4FA4 D;  2P9I C;  4J79 A;  5H17 A;  4L3H D;  2OK6 A;  4A0B B;  4J86 A;  3SWS D;  4O45 A;  3L4M D;  3VA6 A;  4L1Q D;  4GMB A;  4FHL A;  3EI1 A;  3ULE C;  2H9P A;  4JT5 C;  4LG9 A;  2YNP A;  3K26 A;  4A09 B;  4ERZ A;  3NVX A;  4QQE A;  3DM0 A;  2YNO A;  3MMY A;  4CY1 A;  2H13 A;  5EAM A;  1N6D A;  5C2W B;  3AL8 A;  2CE8 A;  5HE1 B;  2CN2 A;  2HJB A;  3FRX A;  3F3P A;  5EM2 B;  3BG1 A;  4PXW A;  4BUJ C;  5GXH A;  3SCY A;  4XYH A;  5I5J A;  2EBS A;  4PC0 A;  5KDO B;  4PBZ A;  4J73 A;  3N0E A;  5K1C C;  5CXC A;  4FA1 D;  3FGB A;  3OL2 A;  3UKU C;  1XIP A;  3DSM A;  3JZH A;  5FKT A;  3BG0 A;  3J81 g;  1S4U X;  2P9K C;  3UKR C;  2IWK A;  3N0D A;  2I0T A;  2H14 A;  3SMR A;  2CE9 A;  5AMS A;  2AGX A;  4PSX B;  2OIZ A;  5FKQ A;  4IA9 A;  3I8C A;  2OVQ B;  3EI3 A;  5CXB A;  4A08 A;  3I7N A;  1N6F A;  1Q47 A;  3U4Y A;  4A2M A;  3PXS D;  4IMM A;  5I5M A;  2UZX B;  3P4F A;  2HES X;  3B7F A;  2AGL A;  3GRE A;  4JSP C;  4ZOX A;  3I2N A;  2CNX A;  1B9X A;  1TYQ C;  3V7D B;  3EI4 A;  4FA9 D;  3E0C A;  3UVK A;  2H6N A;  1SQ9 A;  3AL8 B;  4GM9 A;  2I3T A;  4X63 B;  2J55 H;  3MZL A;  1VYH C;  3ODT A;  4GGA A;  2H68 A;  4O9D A;  1MG2 A;  4CZX A;  3IJ1 A;  5GSA A;  1GXR A;  4A2L A;  5FKS A;  5CXC B;  3OL2 B;  4GM8 A;  2HXC A;  4FB1 D;  1MDA H;  1JOF A;  3JZG A;  2AGY A;  4J0X A;  3RLM D;  5AFU 3;  1FWX A;  4CY2 A;  1RI6 A;  5I5I A;  1MG3 A;  1PEV A;  3EI3 B;  5CXB B;  2UZY B;  3CFV A;  2O9K A;  4JD2 C;  5IGO A;  2J56 H;  2AGW A;  5EAL A;  4CI8 A;  4H5J A;  5IGQ A;  4JXM A;  4CI1 A;  2AGZ A;  3MKS B;  4AEZ A;  2AH0 A;  3IIW A;  4J87 A;  3JRP A;  2Q7Q A;  3L4O D;  4GGC A;  3SJL D;  3DXK C;  3CFS B;  4J8G A;  1GOT B;  4CZY A;  1U2V C;  2H9M A;  4K3J B;  5CYK A;  2I0R A;  3SFZ A;  3UVM A;  4CY5 A;  3PE7 A;  3IKO A;  3SHF A;  5GXI A;  4Z8L A;  5FXY A;  1PI6 A;  2HKR A;  3RRM C;  4OZU A;  4FAV D;  1SQJ A;  4NSX A;  5THA A;  3FM0 A;  5TEE A;  4UI9 R;  2OVR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...