1GOTB

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
339
Chain Sequence
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (gtp-binding/transducer)
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
total genus 106
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gotB00
4QRJA 4OWRA 5K1CC 3K26A 2H9LA 3I7HA 3CIKB 3JZHA 3DM0A 4J84A 5C9ZB 4A0AB 4GGDA 4J82A 1JMZB 4CY3A 4GZ8A 4A09A 2AGZA 4J0XA 5THAA 4GGAA 2B5MA 4FAVD 3EI4A 4A0BA 3DSMA 3EMHA 5EMLB 4R7AB 3N0EA 2UZYB 3VA6A 1XKSA 3SJLD 3MMYA 2OVPB 4E5ZB 3AH8B 4ZOZA 2AH0A 3I7OA 1YFQA 4FWWA 4A0AA 2BCJB 5CXBB 3MKSB 4A08B 1B9XA 3P4FA 5FKTA 3SMRA 1N6FA 4LG9A 2IAAA 5FKRA 4JT6C 4J8BA 3PVUB 4GQBB 3UVNA 3C9CA 1PBYB 2CN2A 2Z2NA 2Z2OA 5EMKB 1RI6A 2GNQA 2YNNA 2J56H 4L3GD 2P9PC 3N0DA 1N6EA 3KRXB 3ZWLB 5HYNB 3DXMC 5TF2A 4H5IA 4GM3A 1VYHC 4YVDA 4Y5RD 4H5JA 5CYKB 2OK6A 3SN6B 1Q47A 3V9FA 3VH0A 2IUQA 1JJUB 3U4YA 3MXXA 3IIWA 3NVQA 4GMBA 4JT5C 3CFSB 2HKMA 3UKUC 5GXHA 3SVWD 1PI6A 3E0CA 3IJ0A 3I89A 3VGZA 5AFU3 3IKOA 3SBPA 4AEZA 3JRPA 3SBQA 1K32A 2I3TA 3PVWB 4PNKB 2OK4A 3EG6A 3L4OD 3PSLA 3V5WB 3RLMD 4GQ1A 4XEIC 5CYKA 3OL2A 5GMKn 5IGQA 3GFCA 1SHYB 4E54A 5B4WA 2AGLA 3OKYB 2AGWA 3BG0A 3SXTD 1TBGA 3JB9L 5GSAA 2HYEA 1P22A 4CY2A 2IUPA 2H6QA 2H47A 2YNOA 2P9IC 4JXMA 3RFGA 4J73A 2GC7A 3JPXA 2HESX 2H6NA 2O9KA 5HE3B 3SWSD 2CO0C 2P9SC 4LG8A 5I5IA 2HXCA 2YB8B 4U1EI 3JZNA 3CFVA 2BBKH 4X61B 3KRWB 5H17A 4J86A 3A0FA 5AMSA 3C99A 4JSPC 3J80g 2XL2A 2P9UC 4TZ4A 2I3SA 4FHLA 3NVNA 3I7LA 1L0QA 4MK0B 5IJ7E 5FKSA 3EI2A 3EI3B 5HQGA 3C75H 4LGNA 5EMJB 3IIYA 3NVXA 2CN3A 3DWLC 4GQ2P 2HJBA 5HE0B 3PSCB 1MDAH 3UVKA 2OVRB 4KFMB 4HDJA 5JWZA 4L3HD 2PM9B 5TDHB 4ZN4A 4J81A 4ERYA 3OKTA 4CZYA 4Z8LA 2H68A 1S4UX 4CI3A 4PSWB 2PBIB 4A2LA 1A0RB 4J77A 2B5LA 4EWRA 2H9MA 1GG2B 3GREA 2I0SA 3EI1A 1JMXB 5IGOA 4ESGA 4E5ZA 3I7NA 3I2NA 2QC5A 2P9LC 5FA5B 1GP2B 4XYHA 3IJ1A 4X63B 3FM0A 3J81g 3RFHA 3JAMg 2OJYA 4X60B 2OIZA 2CO0A 2P9NC 3AL8A 2PM6B 4FAND 3SCYA 3C5MA 1XIPA 4O3TB 3AL8B 2PM7B 3AL9A 4CY5A 1ERJA 3OW8A 4BUJC 2HJ4A 4CY1A 3ORVD 2W18A 2IUVA 5EM2B 3ULEC 2AQ5A 2XU7A 2H3XA 5SXMA 3RN0D 3RMZD 3SLED 3UVLA 1K8KC 3HFQA 3RRMC 3MZLA 5EM2A 1NEXB 1NR0A 2MTAH 3FRXA 3I8CA 5IJ8E 4GM9A 3SFZA 3AFCA 1SQJA 3PXTD 4A09B 5FKQA 4J8GA 3MKQA 4G56B 3UR4A 1OLZA 3W15A 2EBSA 4AOWA 2J55H 1JOFA 4CI2A 3EU7A 2B4EA 5FLXg 3F3PA 4X3EA 3OKYA 5EMMB 3L4MD 4ZOYA 4E54B 3EI2B 2IURA 3RN1D 3B7FA 3EWEA 4A2MA 2QXVA 2H9PA 4I79A 1U2VC 2G9AA 4J78A 4Y7RA 4FA5D 5HE1B 5CXCB 5TEFA 4O1QD 2GC4A 2I0TA 4FB1D 4OZUA 2Z2PA 4D6VA 3OTTA 4GGCA 3RSEC 3I8EA 4D0KA 1SQ9A 4A0BB 1OMWB 4K3ID 2J57G 4O9DA 4IMMA 4PBYA 3PXWD 5IC7A 2B5NA 3OKWA 4A11A 3V7DB 5I5MA 3IJCA 5KDOB 2IWKA 3FGBA 5EARA 1TYQC 4PBZA 2H13A 2AH1A 5HE2B 4PSXB 4GM8A 2PM9A 2IWFA 2YMUA 4O3UB 4IA9A 5A2Qg 4ES0A 4PC0A 3UKRC 2YNPA 1B9YA 4CI1A 4CC9A 4UI9R 3F3GA 4ZOXA 2OVQB 3OL2B 3UVOA 1U4CA 5TEEA 1PEVA 3DXKC 2XYIA 2CE8A 1XHMA 4CZVA 4CI8A 4O45A 1MG3A 4L1QD 5FXYA 2UZXB 4XYIA 5I5JA 4CZXA 1R5MA 4NSXA 4FA1D 3JZGA 1GOTB 2I0RA 5EAMA 2TRCB 5IT9g 2AGYA 2YBAA 5K19A 5C2WB 3SBRA 4FA9D 2XL3A 3I7KA 3EI3A 2H6KA 2Q7QA 3F3FA 4J79A 3SHFA 3ODTA 4ERQA 5H1MA 4PXWA 4J87A 4ZOVA 4QQEA 3UVMA 4QT8A 4J0WA 5EALA 4BH6A 4JSNC 4BL0A 4ERZA 4QL1A 5CXBA 5C2VB 4JD2C 5H14A 3EI1B 1GXRA 4FA4D 1PGUA 5EAPA 2H14A 4L9OA 5AJAA 2AGXA 3I7PA 2H9NA 5CXCA 4K3JB 2CNXA 4N14A 1FWXA 3BG1A 1QNIA 3PE7A 5FQDA 3BWSA 2G99A 4JSXC 4A08A 2HKRA 2P9KC 3EI4B 1MG2A 3JROA 4A7JA 2CE9A 4A11B 1N6DA 3MZKA 4JSVC 5GXIA 3PXSD 3K27A 4U7AA
chains in the Genus database with same CATH superfamily
1BPOA 3EQ8A 2WQ8A 4QRJA 1UOOA 4OWRA 5K1CC 3K26A 1YR2A 2H9LA 3V4PA 3I7HA 3CIKB 3JZHA 4WJKA 3DM0A 4J84A 5C9ZB 4A0AB 4GGDA 4BCBA 4J82A 1JMZB 4CY3A 4GZ8A 4A09A 2AGZA 3ZDXA 4J0XA 5THAA 1VZ3A 3FCSA 4GGAA 2B5MA 4FAVD 3EI4A 1M1XA 4L1MA 4A0BA 3DSMA 3EMHA 5EMLB 4R7AB 3N0EA 2UZYB 3VA6A 1XKSA 4MMYA 3SJLD 3MMYA 2OVPB 5M5UA 4E5ZB 3AH8B 4ZOZA 4BCDA 2AH0A 4DNUA 3I7OA 1YFQA 4FWWA 3EQ7A 4A0AA 2BCJB 5CXBB 3MKSB 2JKXA 4A08B 1GOHA 1B9XA 3P4FA 4RE6A 5FKTA 1N6FA 3SMRA 4LG9A 1A12A 2IAAA 5FKRA 4JT6C 4J8BA 3PVUB 3NIFA 4GQBB 3UVNA 3C9CA 1PBYB 2CN2A 3O4HA 4AMZA 2Z2NA 2Z2OA 5EMKB 1RI6A 2GNQA 2YNNA 2J56H 2HU8A 2P9PC 4L3GD 3N0DA 3MUNA 1N6EA 3KRXB 3ZWLB 5HYNB 3DXMC 3QHYB 5TF2A 3EQ9A 4H5IA 4GM3A 1VYHC 4YVDA 4Y5RD 4H5JA 5CYKB 2OK6A 3SN6B 5M5VA 1Q47A 5FFOA 3V9FA 3VH0A 2IUQA 1JJUB 2VDMA 3IUJA 3U4YA 3MXXA 3IIWA 3NVQA 4GMBA 4JT5C 3CFSB 2HKMA 3UKUC 5GXHA 3SVWD 1PI6A 3E0CA 3IJ0A 3I89A 3VGZA 2XDWA 5AFU3 2XZGA 3IKOA 3ZDZA 3SBPA 4AEZA 3IUQA 3JRPA 3SBQA 1K32A 1I2MB 2I3TA 3PVWB 4JHNA 4PNKB 2HU7A 2OK4A 3EG6A 3L4OD 3PSLA 3FCUA 3V5WB 3RLMD 4GQ1A 4XEIC 4AN1A 5CYKA 3OL2A 5GMKn 5IGQA 1GOFA 3GFCA 1SHYB 4E54A 3K6SA 5B4WA 2AGLA 3OKYB 2AGWA 3BG0A 3SXTD 1TBGA 3JB9L 5GSAA 2HYEA 1P22A 1VE6A 4CY2A 2IUPA 2H6QA 2H47A 2YNOA 2P9IC 4JXMA 3RFGA 4J73A 2GC7A 2VC2A 4DNVA 3JPXA 4Z7NA 2HESX 2H6NA 2O9KA 5HE3B 3SWSD 2CO0C 2P9SC 3O4JA 4UM8A 3MVDK 4LG8A 5I5IA 2HXCA 2YB8B 4U1EI 2HU5A 3JZNA 3CFVA 2BBKH 4X61B 3KRWB 5H17A 4G1EA 4J86A 3ZE2A 3A0FA 5AMSA 3C99A 4JSPC 3J80g 5E6RA 2XL2A 3QI0A 2BKLA 2P9UC 4TZ4A 2I3SA 4FHLA 3K72A 3I7LA 1L0QA 3NVNA 4MK0B 3VI4A 5IJ7E 2VDPA 5FKSA 3EI2A 3NIGA 3EI3B 1H2ZA 5HQGA 3IVMA 3C75H 4Z7OA 4UM9A 4LGNA 5EMJB 3ZE0A 1C9LA 5M61A 3IIYA 3NVXA 4AMYA 4JHPC 2CN3A 3DWLC 4GQ2P 2HJBA 3IULA 5HE0B 4QAMA 3PSCB 1QFMA 1MDAH 3UVKA 2OVRB 1H2XA 4KFMB 3O4GA 4HDJA 4WK0A 5JWZA 4L3HD 1JV2A 2PM9B 4G1MA 5TDHB 2QZPA 4ZN4A 4J81A 4ERYA 3OKTA 4CZYA 4Z8LA 2H68A 1S4UX 2VDLA 4CI3A 4PSWB 2PBIB 4A2LA 3DDUA 1A0RB 4J77A 3T3MA 2B5LA 4EWRA 4DNWA 2H9MA 1GG2B 1TYEA 1H2YA 3GREA 2I0SA 1E8NA 5FFGA 3EI1A 1JMXB 5IGOA 4ESGA 4E5ZA 3I7NA 4Z7QA 2VDRA 3I2NA 4AX4A 2QC5A 2P9LC 5FA5B 1GP2B 3O4IA 2XE4A 4XYHA 3IJ1A 1U8CA 4X63B 3FM0A 3J81g 3RFHA 3JAMg 2OJYA 4X60B 2OIZA 5M5RA 4NC4A 2CO0A 2P9NC 3AL8A 2PM6B 4FAND 4D9SA 1O6FA 3SCYA 3C5MA 3IURA 5C86A 1XIPA 1JTDB 3GC3B 4O3TB 3AL8B 2PM7B 3AL9A 4CY5A 1ERJA 3IUNA 3OW8A 4BUJC 2HJ4A 4CY1A 3ORVD 4BP9A 2W18A 2IUVA 5EM2B 4G55A 4RE5A 5C92A 3ULEC 2AQ5A 2XU7A 4NBMA 2H3XA 5SXMA 3RN0D 3RMZD 3SLED 1C9IA 3UVLA 1K8KC 1VZ2A 3HFQA 3RRMC 1E5TA 3MZLA 2EIBA 1NEXB 5EM2A 1NR0A 2MTAH 3FRXA 3I8CA 5IJ8E 4GM9A 5HDBA 3SFZA 4IRZA 3AFCA 1SQJA 3PXTD 4A09B 3K71A 5FKQA 4J8GA 3MKQA 4G56B 3UR4A 2VDQA 1OLZA 3W15A 4BCCA 2EBSA 4AOWA 2J55H 1JOFA 4CI2A 3EU7A 2B4EA 5FLXg 3NIDA 3F3PA 4X3EA 3OKYA 5EMMB 3ZE1A 3L4MD 4ZOYA 4E54B 3EI2B 2IURA 3RN1D 3B7FA 3EWEA 4A2MA 4O02A 2QXVA 2H9PA 1L5GA 4I79A 1U2VC 3VI3A 2G9AA 4J78A 4Y7RA 4FA5D 5HE1B 1H2WA 5CXCB 5TEFA 2GC4A 4O1QD 2I0TA 3IJEA 4FB1D 2VDKA 4OZUA 2Z2PA 4D6VA 2EICA 2VZ1A 3OTTA 4GGCA 3RSEC 3GD1I 3I8EA 4D0KA 3ZDYA 1SQ9A 4A0BB 1OMWB 4K3ID 4BP8A 2J57G 4O9DA 4IMMA 4PBYA 1E8MA 3PXWD 5IC7A 2B5NA 3OKWA 4A11A 3V7DB 5I5MA 3IJCA 5KDOB 2IWKA 3FGBA 5EARA 1TYQC 4PBZA 4NAAA 3IUMA 5M5SA 2H13A 2AH1A 5HE2B 1T2XA 4PSXB 4GM8A 2PM9A 2IWFA 2YMUA 3KCIA 4IA9A 4O3UB 5A2Qg 4ES0A 1UTCA 5M5TA 4PC0A 3UKRC 2YNPA 1B9YA 1QFSA 4CI1A 4CC9A 4UI9R 3OF7A 3F3GA 1O6GA 4ZOXA 5E6SA 2OVQB 3OL2B 3UVOA 1U4CA 5TEEA 1PEVA 3DXKC 2XYIA 2CE8A 1XHMA 4CZVA 4CI8A 4O45A 1MG3A 4L1QD 4WK4A 2EIEA 5FXYA 2UZXB 1GOGA 4XYIA 5I5JA 4CZXA 1R5MA 4NSXA 4FA1D 3JZGA 1GOTB 2I0RA 5EAMA 2TRCB 5IT9g 2AGYA 2YBAA 4MMXA 4WK2A 5K19A 5C2WB 3SBRA 1UOPA 4FA9D 2XL3A 3I7KA 3EI3A 2H6KA 2Q7QA 3F3FA 4O2WA 4J79A 3SHFA 3ODTA 4ERQA 1K3IA 5H1MA 2QR5A 4J87A 4PXWA 3T3PA 4ZOVA 4QQEA 2EIDA 3UVMA 4QT8A 4J0WA 5EALA 4BH6A 4JSNC 4BL0A 4ERZA 4AN0A 4QL1A 5E6UA 5CXBA 5C2VB 4JD2C 3MUOA 5H14A 2VZ3A 3EI1B 2VDNA 1GXRA 4FA4D 1PGUA 5EAPA 2H14A 4L9OA 5AJAA 2AGXA 3I7PA 2H9NA 4K3JB 5CXCA 2CNXA 4N14A 1FWXA 3BG1A 1QNIA 3PE7A 4NENA 2VDOA 5FQDA 3BWSA 2G99A 4JSXC 4A08A 2HKRA 2P9KC 3EI4B 1MG2A 3JROA 4A7JA 3V4VA 1UOQA 2CE9A 4A11B 1N6DA 3MZKA 4JSVC 5GXIA 3PXSD 4MMZA 3K27A 4U7AA 1VE7A
chains in the Genus database with same CATH topology
4QRJA 4OWRA 5K1CC 3K26A 2H9LA 3I7HA 3CIKB 3JZHA 3DM0A 4J84A 5C9ZB 4A0AB 4GGDA 4J82A 1JMZB 4CY3A 4GZ8A 4A09A 2AGZA 4J0XA 5THAA 4GGAA 2B5MA 4FAVD 3EI4A 4A0BA 3DSMA 3EMHA 5EMLB 4R7AB 3N0EA 2UZYB 3VA6A 1XKSA 3SJLD 3MMYA 2OVPB 4E5ZB 3AH8B 4ZOZA 2AH0A 3I7OA 1YFQA 4FWWA 4A0AA 2BCJB 5CXBB 3MKSB 4A08B 1B9XA 3P4FA 5FKTA 3SMRA 1N6FA 4LG9A 2IAAA 5FKRA 4JT6C 4J8BA 3PVUB 4GQBB 3UVNA 3C9CA 1PBYB 2CN2A 2Z2NA 2Z2OA 5EMKB 1RI6A 2GNQA 2YNNA 2J56H 4L3GD 2P9PC 3N0DA 1N6EA 3KRXB 3ZWLB 5HYNB 3DXMC 5TF2A 4H5IA 4GM3A 1VYHC 4YVDA 4Y5RD 4H5JA 5CYKB 2OK6A 3SN6B 1Q47A 3V9FA 3VH0A 2IUQA 1JJUB 3U4YA 3MXXA 3IIWA 3NVQA 4GMBA 4JT5C 3CFSB 2HKMA 3UKUC 5GXHA 3SVWD 1PI6A 3E0CA 3IJ0A 3I89A 3VGZA 5AFU3 3IKOA 3SBPA 4AEZA 3JRPA 3SBQA 1K32A 2I3TA 3PVWB 4PNKB 2OK4A 3EG6A 3L4OD 3PSLA 3V5WB 3RLMD 4GQ1A 4XEIC 5CYKA 3OL2A 5GMKn 5IGQA 3GFCA 1SHYB 4E54A 5B4WA 2AGLA 3OKYB 2AGWA 3BG0A 3SXTD 1TBGA 3JB9L 5GSAA 2HYEA 1P22A 4CY2A 2IUPA 2H6QA 2H47A 2YNOA 2P9IC 4JXMA 3RFGA 4J73A 2GC7A 3JPXA 2HESX 2H6NA 2O9KA 5HE3B 3SWSD 2CO0C 2P9SC 4LG8A 5I5IA 2HXCA 2YB8B 4U1EI 3JZNA 3CFVA 2BBKH 4X61B 3KRWB 5H17A 4J86A 3A0FA 5AMSA 3C99A 4JSPC 3J80g 2XL2A 2P9UC 4TZ4A 2I3SA 4FHLA 3NVNA 3I7LA 1L0QA 4MK0B 5IJ7E 5FKSA 3EI2A 3EI3B 5HQGA 3C75H 4LGNA 5EMJB 3IIYA 3NVXA 2CN3A 3DWLC 4GQ2P 2HJBA 5HE0B 3PSCB 1MDAH 3UVKA 2OVRB 4KFMB 4HDJA 5JWZA 4L3HD 2PM9B 5TDHB 4ZN4A 4J81A 4ERYA 3OKTA 4CZYA 4Z8LA 2H68A 1S4UX 4CI3A 4PSWB 2PBIB 4A2LA 1A0RB 4J77A 2B5LA 4EWRA 2H9MA 1GG2B 3GREA 2I0SA 3EI1A 1JMXB 5IGOA 4ESGA 4E5ZA 3I7NA 3I2NA 2QC5A 2P9LC 5FA5B 1GP2B 4XYHA 3IJ1A 4X63B 3FM0A 3J81g 3RFHA 3JAMg 2OJYA 4X60B 2OIZA 2CO0A 2P9NC 3AL8A 2PM6B 4FAND 3SCYA 3C5MA 1XIPA 4O3TB 3AL8B 2PM7B 3AL9A 4CY5A 1ERJA 3OW8A 4BUJC 2HJ4A 4CY1A 3ORVD 2W18A 2IUVA 5EM2B 3ULEC 2AQ5A 2XU7A 2H3XA 5SXMA 3RN0D 3RMZD 3SLED 3UVLA 1K8KC 3HFQA 3RRMC 3MZLA 5EM2A 1NEXB 1NR0A 2MTAH 3FRXA 3I8CA 5IJ8E 4GM9A 3SFZA 3AFCA 1SQJA 3PXTD 4A09B 5FKQA 4J8GA 3MKQA 4G56B 3UR4A 1OLZA 3W15A 2EBSA 4AOWA 2J55H 1JOFA 4CI2A 3EU7A 2B4EA 5FLXg 3F3PA 4X3EA 3OKYA 5EMMB 3L4MD 4ZOYA 4E54B 3EI2B 2IURA 3RN1D 3B7FA 3EWEA 4A2MA 2QXVA 2H9PA 4I79A 1U2VC 2G9AA 4J78A 4Y7RA 4FA5D 5HE1B 5CXCB 5TEFA 4O1QD 2GC4A 2I0TA 4FB1D 4OZUA 2Z2PA 4D6VA 3OTTA 4GGCA 3RSEC 3I8EA 4D0KA 1SQ9A 4A0BB 1OMWB 4K3ID 2J57G 4O9DA 4IMMA 4PBYA 3PXWD 5IC7A 2B5NA 3OKWA 4A11A 3V7DB 5I5MA 3IJCA 5KDOB 2IWKA 3FGBA 5EARA 1TYQC 4PBZA 2H13A 2AH1A 5HE2B 4PSXB 4GM8A 2PM9A 2IWFA 2YMUA 4O3UB 4IA9A 5A2Qg 4ES0A 4PC0A 3UKRC 2YNPA 1B9YA 4CI1A 4CC9A 4UI9R 3F3GA 4ZOXA 2OVQB 3OL2B 3UVOA 1U4CA 5TEEA 1PEVA 3DXKC 2XYIA 2CE8A 1XHMA 4CZVA 4CI8A 4O45A 1MG3A 4L1QD 5FXYA 2UZXB 4XYIA 5I5JA 4CZXA 1R5MA 4NSXA 4FA1D 3JZGA 1GOTB 2I0RA 5EAMA 2TRCB 5IT9g 2AGYA 2YBAA 5K19A 5C2WB 3SBRA 4FA9D 2XL3A 3I7KA 3EI3A 2H6KA 2Q7QA 3F3FA 4J79A 3SHFA 3ODTA 4ERQA 5H1MA 4PXWA 4J87A 4ZOVA 4QQEA 3UVMA 4QT8A 4J0WA 5EALA 4BH6A 4JSNC 4BL0A 4ERZA 4QL1A 5CXBA 5C2VB 4JD2C 5H14A 3EI1B 1GXRA 4FA4D 1PGUA 5EAPA 2H14A 4L9OA 5AJAA 2AGXA 3I7PA 2H9NA 5CXCA 4K3JB 2CNXA 4N14A 1FWXA 3BG1A 1QNIA 3PE7A 5FQDA 3BWSA 2G99A 4JSXC 4A08A 2HKRA 2P9KC 3EI4B 1MG2A 3JROA 4A7JA 2CE9A 4A11B 1N6DA 3MZKA 4JSVC 5GXIA 3PXSD 3K27A 4U7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRJ A;  4OWR A;  5K1C C;  3K26 A;  2H9L A;  3I7H A;  3CIK B;  3JZH A;  3DM0 A;  4J84 A;  5C9Z B;  4A0A B;  4GGD A;  4J82 A;  1JMZ B;  4CY3 A;  4GZ8 A;  4A09 A;  2AGZ A;  4J0X A;  5THA A;  4GGA A;  2B5M A;  4FAV D;  3EI4 A;  4A0B A;  3DSM A;  3EMH A;  5EML B;  4R7A B;  3N0E A;  2UZY B;  3VA6 A;  1XKS A;  3SJL D;  3MMY A;  2OVP B;  4E5Z B;  3AH8 B;  4ZOZ A;  2AH0 A;  3I7O A;  1YFQ A;  4FWW A;  4A0A A;  2BCJ B;  5CXB B;  3MKS B;  4A08 B;  1B9X A;  3P4F A;  5FKT A;  3SMR A;  1N6F A;  4LG9 A;  2IAA A;  5FKR A;  4JT6 C;  4J8B A;  3PVU B;  4GQB B;  3UVN A;  3C9C A;  1PBY B;  2CN2 A;  2Z2N A;  2Z2O A;  5EMK B;  1RI6 A;  2GNQ A;  2YNN A;  2J56 H;  4L3G D;  2P9P C;  3N0D A;  1N6E A;  3KRX B;  3ZWL B;  5HYN B;  3DXM C;  5TF2 A;  4H5I A;  4GM3 A;  1VYH C;  4YVD A;  4Y5R D;  4H5J A;  5CYK B;  2OK6 A;  3SN6 B;  1Q47 A;  3V9F A;  3VH0 A;  2IUQ A;  1JJU B;  3U4Y A;  3MXX A;  3IIW A;  3NVQ A;  4GMB A;  4JT5 C;  3CFS B;  2HKM A;  3UKU C;  5GXH A;  3SVW D;  1PI6 A;  3E0C A;  3IJ0 A;  3I89 A;  3VGZ A;  5AFU 3;  3IKO A;  3SBP A;  4AEZ A;  3JRP A;  3SBQ A;  1K32 A;  2I3T A;  3PVW B;  4PNK B;  2OK4 A;  3EG6 A;  3L4O D;  3PSL A;  3V5W B;  3RLM D;  4GQ1 A;  4XEI C;  5CYK A;  3OL2 A;  5GMK n;  5IGQ A;  3GFC A;  1SHY B;  4E54 A;  5B4W A;  2AGL A;  3OKY B;  2AGW A;  3BG0 A;  3SXT D;  1TBG A;  3JB9 L;  5GSA A;  2HYE A;  1P22 A;  4CY2 A;  2IUP A;  2H6Q A;  2H47 A;  2YNO A;  2P9I C;  4JXM A;  3RFG A;  4J73 A;  2GC7 A;  3JPX A;  2HES X;  2H6N A;  2O9K A;  5HE3 B;  3SWS D;  2CO0 C;  2P9S C;  4LG8 A;  5I5I A;  2HXC A;  2YB8 B;  4U1E I;  3JZN A;  3CFV A;  2BBK H;  4X61 B;  3KRW B;  5H17 A;  4J86 A;  3A0F A;  5AMS A;  3C99 A;  4JSP C;  3J80 g;  2XL2 A;  2P9U C;  4TZ4 A;  2I3S A;  4FHL A;  3NVN A;  3I7L A;  1L0Q A;  4MK0 B;  5IJ7 E;  5FKS A;  3EI2 A;  3EI3 B;  5HQG A;  3C75 H;  4LGN A;  5EMJ B;  3IIY A;  3NVX A;  2CN3 A;  3DWL C;  4GQ2 P;  2HJB A;  5HE0 B;  3PSC B;  1MDA H;  3UVK A;  2OVR B;  4KFM B;  4HDJ A;  5JWZ A;  4L3H D;  2PM9 B;  5TDH B;  4ZN4 A;  4J81 A;  4ERY A;  3OKT A;  4CZY A;  4Z8L A;  2H68 A;  1S4U X;  4CI3 A;  4PSW B;  2PBI B;  4A2L A;  1A0R B;  4J77 A;  2B5L A;  4EWR A;  2H9M A;  1GG2 B;  3GRE A;  2I0S A;  3EI1 A;  1JMX B;  5IGO A;  4ESG A;  4E5Z A;  3I7N A;  3I2N A;  2QC5 A;  2P9L C;  5FA5 B;  1GP2 B;  4XYH A;  3IJ1 A;  4X63 B;  3FM0 A;  3J81 g;  3RFH A;  3JAM g;  2OJY A;  4X60 B;  2OIZ A;  2CO0 A;  2P9N C;  3AL8 A;  2PM6 B;  4FAN D;  3SCY A;  3C5M A;  1XIP A;  4O3T B;  3AL8 B;  2PM7 B;  3AL9 A;  4CY5 A;  1ERJ A;  3OW8 A;  4BUJ C;  2HJ4 A;  4CY1 A;  3ORV D;  2W18 A;  2IUV A;  5EM2 B;  3ULE C;  2AQ5 A;  2XU7 A;  2H3X A;  5SXM A;  3RN0 D;  3RMZ D;  3SLE D;  3UVL A;  1K8K C;  3HFQ A;  3RRM C;  3MZL A;  5EM2 A;  1NEX B;  1NR0 A;  2MTA H;  3FRX A;  3I8C A;  5IJ8 E;  4GM9 A;  3SFZ A;  3AFC A;  1SQJ A;  3PXT D;  4A09 B;  5FKQ A;  4J8G A;  3MKQ A;  4G56 B;  3UR4 A;  1OLZ A;  3W15 A;  2EBS A;  4AOW A;  2J55 H;  1JOF A;  4CI2 A;  3EU7 A;  2B4E A;  5FLX g;  3F3P A;  4X3E A;  3OKY A;  5EMM B;  3L4M D;  4ZOY A;  4E54 B;  3EI2 B;  2IUR A;  3RN1 D;  3B7F A;  3EWE A;  4A2M A;  2QXV A;  2H9P A;  4I79 A;  1U2V C;  2G9A A;  4J78 A;  4Y7R A;  4FA5 D;  5HE1 B;  5CXC B;  5TEF A;  4O1Q D;  2GC4 A;  2I0T A;  4FB1 D;  4OZU A;  2Z2P A;  4D6V A;  3OTT A;  4GGC A;  3RSE C;  3I8E A;  4D0K A;  1SQ9 A;  4A0B B;  1OMW B;  4K3I D;  2J57 G;  4O9D A;  4IMM A;  4PBY A;  3PXW D;  5IC7 A;  2B5N A;  3OKW A;  4A11 A;  3V7D B;  5I5M A;  3IJC A;  5KDO B;  2IWK A;  3FGB A;  5EAR A;  1TYQ C;  4PBZ A;  2H13 A;  2AH1 A;  5HE2 B;  4PSX B;  4GM8 A;  2PM9 A;  2IWF A;  2YMU A;  4O3U B;  4IA9 A;  5A2Q g;  4ES0 A;  4PC0 A;  3UKR C;  2YNP A;  1B9Y A;  4CI1 A;  4CC9 A;  4UI9 R;  3F3G A;  4ZOX A;  2OVQ B;  3OL2 B;  3UVO A;  1U4C A;  5TEE A;  1PEV A;  3DXK C;  2XYI A;  2CE8 A;  1XHM A;  4CZV A;  4CI8 A;  4O45 A;  1MG3 A;  4L1Q D;  5FXY A;  2UZX B;  4XYI A;  5I5J A;  4CZX A;  1R5M A;  4NSX A;  4FA1 D;  3JZG A;  1GOT B;  2I0R A;  5EAM A;  2TRC B;  5IT9 g;  2AGY A;  2YBA A;  5K19 A;  5C2W B;  3SBR A;  4FA9 D;  2XL3 A;  3I7K A;  3EI3 A;  2H6K A;  2Q7Q A;  3F3F A;  4J79 A;  3SHF A;  3ODT A;  4ERQ A;  5H1M A;  4PXW A;  4J87 A;  4ZOV A;  4QQE A;  3UVM A;  4QT8 A;  4J0W A;  5EAL A;  4BH6 A;  4JSN C;  4BL0 A;  4ERZ A;  4QL1 A;  5CXB A;  5C2V B;  4JD2 C;  5H14 A;  3EI1 B;  1GXR A;  4FA4 D;  1PGU A;  5EAP A;  2H14 A;  4L9O A;  5AJA A;  2AGX A;  3I7P A;  2H9N A;  5CXC A;  4K3J B;  2CNX A;  4N14 A;  1FWX A;  3BG1 A;  1QNI A;  3PE7 A;  5FQD A;  3BWS A;  2G99 A;  4JSX C;  4A08 A;  2HKR A;  2P9K C;  3EI4 B;  1MG2 A;  3JRO A;  4A7J A;  2CE9 A;  4A11 B;  1N6D A;  3MZK A;  4JSV C;  5GXI A;  3PXS D;  3K27 A;  4U7A A; 
#chains in the Genus database with same CATH topology
 1BPO A;  3EQ8 A;  2WQ8 A;  4QRJ A;  1UOO A;  4OWR A;  5K1C C;  3K26 A;  1YR2 A;  2H9L A;  3V4P A;  3I7H A;  3CIK B;  3JZH A;  4WJK A;  3DM0 A;  4J84 A;  5C9Z B;  4A0A B;  4GGD A;  4BCB A;  4J82 A;  1JMZ B;  4CY3 A;  4GZ8 A;  4A09 A;  2AGZ A;  3ZDX A;  4J0X A;  5THA A;  1VZ3 A;  3FCS A;  4GGA A;  2B5M A;  4FAV D;  3EI4 A;  1M1X A;  4L1M A;  4A0B A;  3DSM A;  3EMH A;  5EML B;  4R7A B;  3N0E A;  2UZY B;  3VA6 A;  1XKS A;  4MMY A;  3SJL D;  3MMY A;  2OVP B;  5M5U A;  4E5Z B;  3AH8 B;  4ZOZ A;  4BCD A;  2AH0 A;  4DNU A;  3I7O A;  1YFQ A;  4FWW A;  3EQ7 A;  4A0A A;  2BCJ B;  5CXB B;  3MKS B;  2JKX A;  4A08 B;  1GOH A;  1B9X A;  3P4F A;  4RE6 A;  5FKT A;  1N6F A;  3SMR A;  4LG9 A;  1A12 A;  2IAA A;  5FKR A;  4JT6 C;  4J8B A;  3PVU B;  3NIF A;  4GQB B;  3UVN A;  3C9C A;  1PBY B;  2CN2 A;  3O4H A;  4AMZ A;  2Z2N A;  2Z2O A;  5EMK B;  1RI6 A;  2GNQ A;  2YNN A;  2J56 H;  2HU8 A;  2P9P C;  4L3G D;  3N0D A;  3MUN A;  1N6E A;  3KRX B;  3ZWL B;  5HYN B;  3DXM C;  3QHY B;  5TF2 A;  3EQ9 A;  4H5I A;  4GM3 A;  1VYH C;  4YVD A;  4Y5R D;  4H5J A;  5CYK B;  2OK6 A;  3SN6 B;  5M5V A;  1Q47 A;  5FFO A;  3V9F A;  3VH0 A;  2IUQ A;  1JJU B;  2VDM A;  3IUJ A;  3U4Y A;  3MXX A;  3IIW A;  3NVQ A;  4GMB A;  4JT5 C;  3CFS B;  2HKM A;  3UKU C;  5GXH A;  3SVW D;  1PI6 A;  3E0C A;  3IJ0 A;  3I89 A;  3VGZ A;  2XDW A;  5AFU 3;  2XZG A;  3IKO A;  3ZDZ A;  3SBP A;  4AEZ A;  3IUQ A;  3JRP A;  3SBQ A;  1K32 A;  1I2M B;  2I3T A;  3PVW B;  4JHN A;  4PNK B;  2HU7 A;  2OK4 A;  3EG6 A;  3L4O D;  3PSL A;  3FCU A;  3V5W B;  3RLM D;  4GQ1 A;  4XEI C;  4AN1 A;  5CYK A;  3OL2 A;  5GMK n;  5IGQ A;  1GOF A;  3GFC A;  1SHY B;  4E54 A;  3K6S A;  5B4W A;  2AGL A;  3OKY B;  2AGW A;  3BG0 A;  3SXT D;  1TBG A;  3JB9 L;  5GSA A;  2HYE A;  1P22 A;  1VE6 A;  4CY2 A;  2IUP A;  2H6Q A;  2H47 A;  2YNO A;  2P9I C;  4JXM A;  3RFG A;  4J73 A;  2GC7 A;  2VC2 A;  4DNV A;  3JPX A;  4Z7N A;  2HES X;  2H6N A;  2O9K A;  5HE3 B;  3SWS D;  2CO0 C;  2P9S C;  3O4J A;  4UM8 A;  3MVD K;  4LG8 A;  5I5I A;  2HXC A;  2YB8 B;  4U1E I;  2HU5 A;  3JZN A;  3CFV A;  2BBK H;  4X61 B;  3KRW B;  5H17 A;  4G1E A;  4J86 A;  3ZE2 A;  3A0F A;  5AMS A;  3C99 A;  4JSP C;  3J80 g;  5E6R A;  2XL2 A;  3QI0 A;  2BKL A;  2P9U C;  4TZ4 A;  2I3S A;  4FHL A;  3K72 A;  3I7L A;  1L0Q A;  3NVN A;  4MK0 B;  3VI4 A;  5IJ7 E;  2VDP A;  5FKS A;  3EI2 A;  3NIG A;  3EI3 B;  1H2Z A;  5HQG A;  3IVM A;  3C75 H;  4Z7O A;  4UM9 A;  4LGN A;  5EMJ B;  3ZE0 A;  1C9L A;  5M61 A;  3IIY A;  3NVX A;  4AMY A;  4JHP C;  2CN3 A;  3DWL C;  4GQ2 P;  2HJB A;  3IUL A;  5HE0 B;  4QAM A;  3PSC B;  1QFM A;  1MDA H;  3UVK A;  2OVR B;  1H2X A;  4KFM B;  3O4G A;  4HDJ A;  4WK0 A;  5JWZ A;  4L3H D;  1JV2 A;  2PM9 B;  4G1M A;  5TDH B;  2QZP A;  4ZN4 A;  4J81 A;  4ERY A;  3OKT A;  4CZY A;  4Z8L A;  2H68 A;  1S4U X;  2VDL A;  4CI3 A;  4PSW B;  2PBI B;  4A2L A;  3DDU A;  1A0R B;  4J77 A;  3T3M A;  2B5L A;  4EWR A;  4DNW A;  2H9M A;  1GG2 B;  1TYE A;  1H2Y A;  3GRE A;  2I0S A;  1E8N A;  5FFG A;  3EI1 A;  1JMX B;  5IGO A;  4ESG A;  4E5Z A;  3I7N A;  4Z7Q A;  2VDR A;  3I2N A;  4AX4 A;  2QC5 A;  2P9L C;  5FA5 B;  1GP2 B;  3O4I A;  2XE4 A;  4XYH A;  3IJ1 A;  1U8C A;  4X63 B;  3FM0 A;  3J81 g;  3RFH A;  3JAM g;  2OJY A;  4X60 B;  2OIZ A;  5M5R A;  4NC4 A;  2CO0 A;  2P9N C;  3AL8 A;  2PM6 B;  4FAN D;  4D9S A;  1O6F A;  3SCY A;  3C5M A;  3IUR A;  5C86 A;  1XIP A;  1JTD B;  3GC3 B;  4O3T B;  3AL8 B;  2PM7 B;  3AL9 A;  4CY5 A;  1ERJ A;  3IUN A;  3OW8 A;  4BUJ C;  2HJ4 A;  4CY1 A;  3ORV D;  4BP9 A;  2W18 A;  2IUV A;  5EM2 B;  4G55 A;  4RE5 A;  5C92 A;  3ULE C;  2AQ5 A;  2XU7 A;  4NBM A;  2H3X A;  5SXM A;  3RN0 D;  3RMZ D;  3SLE D;  1C9I A;  3UVL A;  1K8K C;  1VZ2 A;  3HFQ A;  3RRM C;  1E5T A;  3MZL A;  2EIB A;  1NEX B;  5EM2 A;  1NR0 A;  2MTA H;  3FRX A;  3I8C A;  5IJ8 E;  4GM9 A;  5HDB A;  3SFZ A;  4IRZ A;  3AFC A;  1SQJ A;  3PXT D;  4A09 B;  3K71 A;  5FKQ A;  4J8G A;  3MKQ A;  4G56 B;  3UR4 A;  2VDQ A;  1OLZ A;  3W15 A;  4BCC A;  2EBS A;  4AOW A;  2J55 H;  1JOF A;  4CI2 A;  3EU7 A;  2B4E A;  5FLX g;  3NID A;  3F3P A;  4X3E A;  3OKY A;  5EMM B;  3ZE1 A;  3L4M D;  4ZOY A;  4E54 B;  3EI2 B;  2IUR A;  3RN1 D;  3B7F A;  3EWE A;  4A2M A;  4O02 A;  2QXV A;  2H9P A;  1L5G A;  4I79 A;  1U2V C;  3VI3 A;  2G9A A;  4J78 A;  4Y7R A;  4FA5 D;  5HE1 B;  1H2W A;  5CXC B;  5TEF A;  2GC4 A;  4O1Q D;  2I0T A;  3IJE A;  4FB1 D;  2VDK A;  4OZU A;  2Z2P A;  4D6V A;  2EIC A;  2VZ1 A;  3OTT A;  4GGC A;  3RSE C;  3GD1 I;  3I8E A;  4D0K A;  3ZDY A;  1SQ9 A;  4A0B B;  1OMW B;  4K3I D;  4BP8 A;  2J57 G;  4O9D A;  4IMM A;  4PBY A;  1E8M A;  3PXW D;  5IC7 A;  2B5N A;  3OKW A;  4A11 A;  3V7D B;  5I5M A;  3IJC A;  5KDO B;  2IWK A;  3FGB A;  5EAR A;  1TYQ C;  4PBZ A;  4NAA A;  3IUM A;  5M5S A;  2H13 A;  2AH1 A;  5HE2 B;  1T2X A;  4PSX B;  4GM8 A;  2PM9 A;  2IWF A;  2YMU A;  3KCI A;  4IA9 A;  4O3U B;  5A2Q g;  4ES0 A;  1UTC A;  5M5T A;  4PC0 A;  3UKR C;  2YNP A;  1B9Y A;  1QFS A;  4CI1 A;  4CC9 A;  4UI9 R;  3OF7 A;  3F3G A;  1O6G A;  4ZOX A;  5E6S A;  2OVQ B;  3OL2 B;  3UVO A;  1U4C A;  5TEE A;  1PEV A;  3DXK C;  2XYI A;  2CE8 A;  1XHM A;  4CZV A;  4CI8 A;  4O45 A;  1MG3 A;  4L1Q D;  4WK4 A;  2EIE A;  5FXY A;  2UZX B;  1GOG A;  4XYI A;  5I5J A;  4CZX A;  1R5M A;  4NSX A;  4FA1 D;  3JZG A;  1GOT B;  2I0R A;  5EAM A;  2TRC B;  5IT9 g;  2AGY A;  2YBA A;  4MMX A;  4WK2 A;  5K19 A;  5C2W B;  3SBR A;  1UOP A;  4FA9 D;  2XL3 A;  3I7K A;  3EI3 A;  2H6K A;  2Q7Q A;  3F3F A;  4O2W A;  4J79 A;  3SHF A;  3ODT A;  4ERQ A;  1K3I A;  5H1M A;  2QR5 A;  4J87 A;  4PXW A;  3T3P A;  4ZOV A;  4QQE A;  2EID A;  3UVM A;  4QT8 A;  4J0W A;  5EAL A;  4BH6 A;  4JSN C;  4BL0 A;  4ERZ A;  4AN0 A;  4QL1 A;  5E6U A;  5CXB A;  5C2V B;  4JD2 C;  3MUO A;  5H14 A;  2VZ3 A;  3EI1 B;  2VDN A;  1GXR A;  4FA4 D;  1PGU A;  5EAP A;  2H14 A;  4L9O A;  5AJA A;  2AGX A;  3I7P A;  2H9N A;  4K3J B;  5CXC A;  2CNX A;  4N14 A;  1FWX A;  3BG1 A;  1QNI A;  3PE7 A;  4NEN A;  2VDO A;  5FQD A;  3BWS A;  2G99 A;  4JSX C;  4A08 A;  2HKR A;  2P9K C;  3EI4 B;  1MG2 A;  3JRO A;  4A7J A;  3V4V A;  1UOQ A;  2CE9 A;  4A11 B;  1N6D A;  3MZK A;  4JSV C;  5GXI A;  3PXS D;  4MMZ A;  3K27 A;  4U7A A;  1VE7 A; 
#chains in the Genus database with same CATH homology
 4QRJ A;  4OWR A;  5K1C C;  3K26 A;  2H9L A;  3I7H A;  3CIK B;  3JZH A;  3DM0 A;  4J84 A;  5C9Z B;  4A0A B;  4GGD A;  4J82 A;  1JMZ B;  4CY3 A;  4GZ8 A;  4A09 A;  2AGZ A;  4J0X A;  5THA A;  4GGA A;  2B5M A;  4FAV D;  3EI4 A;  4A0B A;  3DSM A;  3EMH A;  5EML B;  4R7A B;  3N0E A;  2UZY B;  3VA6 A;  1XKS A;  3SJL D;  3MMY A;  2OVP B;  4E5Z B;  3AH8 B;  4ZOZ A;  2AH0 A;  3I7O A;  1YFQ A;  4FWW A;  4A0A A;  2BCJ B;  5CXB B;  3MKS B;  4A08 B;  1B9X A;  3P4F A;  5FKT A;  3SMR A;  1N6F A;  4LG9 A;  2IAA A;  5FKR A;  4JT6 C;  4J8B A;  3PVU B;  4GQB B;  3UVN A;  3C9C A;  1PBY B;  2CN2 A;  2Z2N A;  2Z2O A;  5EMK B;  1RI6 A;  2GNQ A;  2YNN A;  2J56 H;  4L3G D;  2P9P C;  3N0D A;  1N6E A;  3KRX B;  3ZWL B;  5HYN B;  3DXM C;  5TF2 A;  4H5I A;  4GM3 A;  1VYH C;  4YVD A;  4Y5R D;  4H5J A;  5CYK B;  2OK6 A;  3SN6 B;  1Q47 A;  3V9F A;  3VH0 A;  2IUQ A;  1JJU B;  3U4Y A;  3MXX A;  3IIW A;  3NVQ A;  4GMB A;  4JT5 C;  3CFS B;  2HKM A;  3UKU C;  5GXH A;  3SVW D;  1PI6 A;  3E0C A;  3IJ0 A;  3I89 A;  3VGZ A;  5AFU 3;  3IKO A;  3SBP A;  4AEZ A;  3JRP A;  3SBQ A;  1K32 A;  2I3T A;  3PVW B;  4PNK B;  2OK4 A;  3EG6 A;  3L4O D;  3PSL A;  3V5W B;  3RLM D;  4GQ1 A;  4XEI C;  5CYK A;  3OL2 A;  5GMK n;  5IGQ A;  3GFC A;  1SHY B;  4E54 A;  5B4W A;  2AGL A;  3OKY B;  2AGW A;  3BG0 A;  3SXT D;  1TBG A;  3JB9 L;  5GSA A;  2HYE A;  1P22 A;  4CY2 A;  2IUP A;  2H6Q A;  2H47 A;  2YNO A;  2P9I C;  4JXM A;  3RFG A;  4J73 A;  2GC7 A;  3JPX A;  2HES X;  2H6N A;  2O9K A;  5HE3 B;  3SWS D;  2CO0 C;  2P9S C;  4LG8 A;  5I5I A;  2HXC A;  2YB8 B;  4U1E I;  3JZN A;  3CFV A;  2BBK H;  4X61 B;  3KRW B;  5H17 A;  4J86 A;  3A0F A;  5AMS A;  3C99 A;  4JSP C;  3J80 g;  2XL2 A;  2P9U C;  4TZ4 A;  2I3S A;  4FHL A;  3NVN A;  3I7L A;  1L0Q A;  4MK0 B;  5IJ7 E;  5FKS A;  3EI2 A;  3EI3 B;  5HQG A;  3C75 H;  4LGN A;  5EMJ B;  3IIY A;  3NVX A;  2CN3 A;  3DWL C;  4GQ2 P;  2HJB A;  5HE0 B;  3PSC B;  1MDA H;  3UVK A;  2OVR B;  4KFM B;  4HDJ A;  5JWZ A;  4L3H D;  2PM9 B;  5TDH B;  4ZN4 A;  4J81 A;  4ERY A;  3OKT A;  4CZY A;  4Z8L A;  2H68 A;  1S4U X;  4CI3 A;  4PSW B;  2PBI B;  4A2L A;  1A0R B;  4J77 A;  2B5L A;  4EWR A;  2H9M A;  1GG2 B;  3GRE A;  2I0S A;  3EI1 A;  1JMX B;  5IGO A;  4ESG A;  4E5Z A;  3I7N A;  3I2N A;  2QC5 A;  2P9L C;  5FA5 B;  1GP2 B;  4XYH A;  3IJ1 A;  4X63 B;  3FM0 A;  3J81 g;  3RFH A;  3JAM g;  2OJY A;  4X60 B;  2OIZ A;  2CO0 A;  2P9N C;  3AL8 A;  2PM6 B;  4FAN D;  3SCY A;  3C5M A;  1XIP A;  4O3T B;  3AL8 B;  2PM7 B;  3AL9 A;  4CY5 A;  1ERJ A;  3OW8 A;  4BUJ C;  2HJ4 A;  4CY1 A;  3ORV D;  2W18 A;  2IUV A;  5EM2 B;  3ULE C;  2AQ5 A;  2XU7 A;  2H3X A;  5SXM A;  3RN0 D;  3RMZ D;  3SLE D;  3UVL A;  1K8K C;  3HFQ A;  3RRM C;  3MZL A;  5EM2 A;  1NEX B;  1NR0 A;  2MTA H;  3FRX A;  3I8C A;  5IJ8 E;  4GM9 A;  3SFZ A;  3AFC A;  1SQJ A;  3PXT D;  4A09 B;  5FKQ A;  4J8G A;  3MKQ A;  4G56 B;  3UR4 A;  1OLZ A;  3W15 A;  2EBS A;  4AOW A;  2J55 H;  1JOF A;  4CI2 A;  3EU7 A;  2B4E A;  5FLX g;  3F3P A;  4X3E A;  3OKY A;  5EMM B;  3L4M D;  4ZOY A;  4E54 B;  3EI2 B;  2IUR A;  3RN1 D;  3B7F A;  3EWE A;  4A2M A;  2QXV A;  2H9P A;  4I79 A;  1U2V C;  2G9A A;  4J78 A;  4Y7R A;  4FA5 D;  5HE1 B;  5CXC B;  5TEF A;  4O1Q D;  2GC4 A;  2I0T A;  4FB1 D;  4OZU A;  2Z2P A;  4D6V A;  3OTT A;  4GGC A;  3RSE C;  3I8E A;  4D0K A;  1SQ9 A;  4A0B B;  1OMW B;  4K3I D;  2J57 G;  4O9D A;  4IMM A;  4PBY A;  3PXW D;  5IC7 A;  2B5N A;  3OKW A;  4A11 A;  3V7D B;  5I5M A;  3IJC A;  5KDO B;  2IWK A;  3FGB A;  5EAR A;  1TYQ C;  4PBZ A;  2H13 A;  2AH1 A;  5HE2 B;  4PSX B;  4GM8 A;  2PM9 A;  2IWF A;  2YMU A;  4O3U B;  4IA9 A;  5A2Q g;  4ES0 A;  4PC0 A;  3UKR C;  2YNP A;  1B9Y A;  4CI1 A;  4CC9 A;  4UI9 R;  3F3G A;  4ZOX A;  2OVQ B;  3OL2 B;  3UVO A;  1U4C A;  5TEE A;  1PEV A;  3DXK C;  2XYI A;  2CE8 A;  1XHM A;  4CZV A;  4CI8 A;  4O45 A;  1MG3 A;  4L1Q D;  5FXY A;  2UZX B;  4XYI A;  5I5J A;  4CZX A;  1R5M A;  4NSX A;  4FA1 D;  3JZG A;  1GOT B;  2I0R A;  5EAM A;  2TRC B;  5IT9 g;  2AGY A;  2YBA A;  5K19 A;  5C2W B;  3SBR A;  4FA9 D;  2XL3 A;  3I7K A;  3EI3 A;  2H6K A;  2Q7Q A;  3F3F A;  4J79 A;  3SHF A;  3ODT A;  4ERQ A;  5H1M A;  4PXW A;  4J87 A;  4ZOV A;  4QQE A;  3UVM A;  4QT8 A;  4J0W A;  5EAL A;  4BH6 A;  4JSN C;  4BL0 A;  4ERZ A;  4QL1 A;  5CXB A;  5C2V B;  4JD2 C;  5H14 A;  3EI1 B;  1GXR A;  4FA4 D;  1PGU A;  5EAP A;  2H14 A;  4L9O A;  5AJA A;  2AGX A;  3I7P A;  2H9N A;  5CXC A;  4K3J B;  2CNX A;  4N14 A;  1FWX A;  3BG1 A;  1QNI A;  3PE7 A;  5FQD A;  3BWS A;  2G99 A;  4JSX C;  4A08 A;  2HKR A;  2P9K C;  3EI4 B;  1MG2 A;  3JRO A;  4A7J A;  2CE9 A;  4A11 B;  1N6D A;  3MZK A;  4JSV C;  5GXI A;  3PXS D;  3K27 A;  4U7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...