4Y5RD

Crystal structure of a t67a maug/pre-methylamine dehydrogenase complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
publication title A T67A mutation in the proximal pocket of the high-spin heme of MauG stabilizes formation of a mixed-valent Fe(II)/Fe(III) state and enhances charge resonance stabilization of the bis-Fe(IV) state.
pubmed doi rcsb
source organism Paracoccus denitrificans (strain pd 1222)
total genus 89
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4y5rD00
2OVPB 4O3TB 3OKWA 3AL8A 2P9UC 4PNKB 2P9KC 4QT8A 5H14A 2YNOA 2HJBA 3EI2A 5H17A 2QC5A 3MZKA 4IMMA 3SVWD 3BG1A 3RLMD 3EI3A 3ZWLB 3JPXA 1MG3A 2HKRA 2GC7A 5EAPA 1VYHC 3V7DB 2B5NA 4J84A 3IJ1A 2IUVA 4L3GD 3UKUC 2YB8B 2H9LA 1PGUA 5IC7A 3VGZA 4CI8A 5TF2A 1OMWB 2CO0A 4PSWB 2J57G 5CXCB 3UR4A 3B7FA 4PBYA 2Z2OA 4FA1D 5C2WB 4CI1A 3OL2B 2IWFA 4PC0A 3MZLA 3I7NA 4CZXA 5C2VB 2I0TA 3SMRA 2I0RA 2AGYA 5EM2A 5GXIA 4A11B 1A0RB 4FA5D 2CE8A 2AQ5A 4E5ZA 4GGDA 2P9NC 5B4WA 2AGWA 3UVKA 4ERYA 3SXTD 2Z2PA 2OK6A 3PVUB 3RRMC 2BBKH 3I7KA 3FM0A 4ZOVA 4H5JA 4O1QD 1N6EA 1JMXB 2G99A 2I3SA 3EI1B 5EMKB 2QXVA 3MKQA 1R5MA 1SQ9A 1GP2B 2H9NA 5IGOA 3IJ0A 3RSEC 3CFSB 2CN2A 4CY3A 2GC4A 4ZOYA 5EMLB 5GMKn 4J81A 4PSXB 4PXWA 3EI4A 1TBGA 2XL2A 1PI6A 1OLZA 2IUQA 4J78A 2HXCA 4FA9D 3UVOA 3ORVD 1B9XA 2OVRB 2OIZA 4K3ID 2IURA 3JRPA 4A2LA 2EBSA 3AL8B 4A0BA 3EG6A 4O9DA 1TYQC 1JOFA 1XIPA 3IKOA 5AJAA 3EU7A 4ZN4A 5FKRA 5EAMA 4GZ8A 3EI2B 3OKYA 4IA9A 3I2NA 5A2Qg 4ESGA 3J81g 4JSPC 4AEZA 3EI3B 4CI2A 4L9OA 4GMBA 4A7JA 5CXBA 3MMYA 3SBPA 5IGQA 4ERQA 3JZGA 2YNNA 4XYIA 4L1QD 3PSCB 5HYNB 5KDOB 2H13A 2Z2NA 4KFMB 4JSXC 3PXWD 4A2MA 3KRXB 2Q7QA 3SCYA 3AL9A 3HFQA 4X60B 4J79A 4CY2A 4G56B 4FAVD 2GNQA 3OTTA 2P9IC 4OZUA 4UI9R 3PSLA 2IUPA 3F3FA 3CIKB 2OK4A 1U4CA 5CYKA 5HQGA 5EM2B 4BH6A 2J55H 1P22A 3MXXA 4E5ZB 2IAAA 5K19A 3NVQA 2OJYA 4CY1A 1MG2A 2AGLA 2HJ4A 3F3GA 1L0QA 2B5MA 1N6FA 2CN3A 5C9ZB 1N6DA 2AH0A 3JB9L 4GM9A 5EARA 2P9PC 5SXMA 5HE0B 4FWWA 5FQDA 5AMSA 3I89A 4J73A 3SLED 3K27A 3RN0D 4X63B 4CC9A 3V9FA 4FA4D 4GGAA 2H6QA 3ODTA 4E54A 3IIWA 3DWLC 2PM7B 3CFVA 5IJ7E 2H47A 5FKSA 4CI3A 4NSXA 1PBYB 3GFCA 3PVWB 4J87A 4LGNA 1JJUB 4LG9A 1U2VC 2UZXB 3OL2A 5FXYA 3I8CA 2YMUA 4A08A 3PXSD 1MDAH 3OKTA 2H3XA 5K1CC 5HE1B 3BG0A 4A0AB 3PXTD 3MKSB 2PM6B 4XEIC 5TEEA 3IJCA 4FB1D 5TEFA 3I7PA 3OKYB 1QNIA 3JROA 4TZ4A 2H14A 2PBIB 4GM8A 4OWRA 5FLXg 2PM9A 1SQJA 5CXBB 5EMMB 3L4MD 4XYHA 2BCJB 4QQEA 4PBZA 4GQ2P 3E0CA 2MTAH 4BUJC 4J8GA 3DXKC 3J80g 3GREA 3N0DA 4O45A 4J8BA 1GOTB 5HE2B 3UVMA 2I0SA 3JAMg 2G9AA 1GG2B 5THAA 2CO0C 3RFGA 4CZVA 2AGZA 2P9LC 4GQBB 1Q47A 4J86A 4Y7RA 2OVQB 4YVDA 3DXMC 3SWSD 1SHYB 5FA5B 5CYKB 2HESX 5TDHB 3VA6A 3UVLA 4GGCA 3AFCA 4X3EA 3DM0A 1NR0A 2H9MA 3I8EA 4BL0A 1JMZB 2UZYB 3SBRA 4A09A 4CZYA 2IWKA 2CE9A 3A0FA 5FKQA 5IT9g 3KRWB 4H5IA 4ERZA 4ZOZA 3C99A 4U7AA 3BWSA 4ZOXA 4CY5A 3PE7A 4J0XA 3I7OA 4FHLA 2H9PA 4E54B 3SJLD 4HDJA 4J0WA 4D6VA 1RI6A 4U1EI 4QRJA 1GXRA 2B5LA 5EALA 4AOWA 4FAND 1PEVA 4JSVC 4JT5C 3U4YA 3FGBA 1YFQA 3AH8B 4Z8LA 4J82A 2XL3A 3SFZA 2H6KA 3FRXA 4Y5RD 3IIYA 3I7HA 4I79A 2P9SC 2TRCB 4A08B 4K3JB 4L3HD 2B4EA 3EI4B 2AGXA 5CXCA 4ES0A 2HKMA 5HE3B 4JSNC 2XU7A 2I3TA 5I5IA 4JT6C 2YNPA 5JWZA 5EMJB 3N0EA 4GM3A 3EWEA 4X61B 3C75H 5AFU3 2W18A 4JD2C 2PM9B 2O9KA 5I5MA 1XKSA 4A0BB 5GXHA 1K8KC 3JZNA 4A11A 2H6NA 5GSAA 4N14A 4J77A 3DSMA 4JXMA 3UKRC 3V5WB 3W15A 3UVNA 2XYIA 3L4OD 1FWXA 3I7LA 3RMZD 3C5MA 3SN6B 1XHMA 4GQ1A 4EWRA 2YBAA 2J56H 4MK0B 3EI1A 3P4FA 3NVNA 4D0KA 5FKTA 1NEXB 4LG8A 1K32A 3NVXA 1ERJA 3C9CA 5H1MA 3OW8A 4O3UB 3VH0A 3F3PA 3JZHA 5IJ8E 3EMHA 2HYEA 3SHFA 4A0AA 3SBQA 2AH1A 3ULEC 1S4UX 4R7AB 4QL1A 4A09B 2CNXA 3RN1D 3K26A 3RFHA 2H68A 5I5JA 1B9YA
chains in the Genus database with same CATH superfamily
1QFSA 2OVPB 4O3TB 3OKWA 3AL8A 2P9UC 4PNKB 1JTDB 2P9KC 4QT8A 5H14A 2YNOA 4BCDA 3OF7A 1E8MA 2HJBA 2BKLA 3EI2A 5H17A 5E6UA 2QC5A 3MZKA 4IMMA 5M5RA 1C9LA 5E6RA 3MUNA 3SVWD 3BG1A 2XE4A 3RLMD 3EI3A 3ZWLB 3JPXA 1MG3A 2HKRA 2GC7A 3KCIA 5EAPA 1VYHC 3V7DB 2B5NA 4J84A 4BP8A 3IJ1A 2IUVA 4L3GD 2HU5A 3UKUC 1E8NA 4Z7QA 2YB8B 2H9LA 3GD1I 1UOPA 1PGUA 5IC7A 3VGZA 4BCCA 4CI8A 2VDLA 5TF2A 1OMWB 2CO0A 4PSWB 2VDPA 3IURA 2J57G 5CXCB 3UR4A 2VDOA 3B7FA 4PBYA 2Z2OA 5FFOA 4FA1D 5C2WB 3IUNA 4CI1A 3OL2B 2IWFA 4PC0A 3MZLA 3I7NA 4CZXA 5C2VB 2I0TA 3SMRA 2I0RA 2AGYA 5EM2A 5GXIA 4A11B 1A0RB 4AMZA 4FA5D 2CE8A 2AQ5A 4E5ZA 4GGDA 2P9NC 5B4WA 2AGWA 3UVKA 4ERYA 3SXTD 2Z2PA 3NIFA 2OK6A 3PVUB 3FCSA 3RRMC 2JKXA 4NC4A 2BBKH 5M5SA 3I7KA 3FM0A 4ZOVA 4H5JA 4O1QD 1N6EA 1JMXB 2G99A 2I3SA 3EI1B 5EMKB 4DNUA 2QXVA 3MKQA 3QI0A 3IVMA 1R5MA 4MMZA 1SQ9A 1GP2B 2H9NA 5IGOA 3IJ0A 3RSEC 3CFSB 2CN2A 4CY3A 2GC4A 4ZOYA 5EMLB 5GMKn 4J81A 1GOHA 3ZE1A 4AN0A 1K3IA 4PSXB 4PXWA 3EI4A 1UOQA 1TBGA 2XL2A 4BCBA 4NBMA 4MMYA 3EQ7A 1PI6A 1E5TA 1OLZA 2IUQA 4J78A 2HXCA 4FA9D 1QFMA 4G1EA 3UVOA 3ORVD 2EICA 1B9XA 2OVRB 2OIZA 4K3ID 2IURA 3JRPA 4A2LA 2EBSA 3AL8B 4A0BA 2VZ3A 3EG6A 4O9DA 1TYQC 1JOFA 1XIPA 3IKOA 4IRZA 5AJAA 3EU7A 4ZN4A 5FKRA 5EAMA 4GZ8A 3EI2B 3OKYA 4UM8A 4IA9A 1VZ3A 3I2NA 5A2Qg 4ESGA 3J81g 4JSPC 4AEZA 3EI3B 4CI2A 4L9OA 4GMBA 4A7JA 5C92A 5CXBA 3MMYA 3SBPA 1UOOA 5IGQA 5E6SA 3IUMA 4ERQA 3K71A 3JZGA 2YNNA 4XYIA 4L1QD 2VDQA 4RE5A 4QAMA 3PSCB 4D9SA 5HYNB 5KDOB 2H13A 1VE6A 2Z2NA 4KFMB 4JSXC 3PXWD 4A2MA 3KRXB 1VE7A 2Q7QA 3SCYA 3O4GA 3AL9A 2VDKA 2VDMA 3HFQA 4J79A 4NAAA 4X60B 4NENA 4CY2A 1U8CA 2XDWA 4G56B 4FAVD 2GNQA 3OTTA 2P9IC 4OZUA 4UI9R 3PSLA 2IUPA 3F3FA 4BP9A 1H2YA 3CIKB 2OK4A 2WQ8A 1U4CA 5CYKA 5HQGA 3ZE2A 5EM2B 4BH6A 2J55H 1P22A 3MXXA 4E5ZB 2IAAA 5K19A 4L1MA 3K6SA 1JV2A 3NVQA 1C9IA 2OJYA 4CY1A 1MG2A 2AGLA 2HJ4A 3F3GA 1L0QA 2B5MA 1N6FA 2CN3A 5C9ZB 1N6DA 2AH0A 4JHPC 3JB9L 3EQ8A 4GM9A 5EARA 2P9PC 5SXMA 2HU7A 5HE0B 4FWWA 4DNVA 5FQDA 5C86A 5AMSA 3I89A 3GC3B 4J73A 3SLED 2QZPA 3K27A 3RN0D 4X63B 4CC9A 3V9FA 4FA4D 4GGAA 2XZGA 2H6QA 3ODTA 4E54A 3IIWA 3DWLC 2PM7B 3CFVA 5IJ7E 2H47A 5FKSA 4CI3A 4NSXA 1PBYB 3GFCA 3PVWB 4J87A 4LGNA 1JJUB 1A12A 3K72A 3V4PA 3VI4A 4LG9A 1TYEA 1U2VC 2UZXB 3OL2A 5FXYA 3DDUA 3I8CA 2YMUA 4MMXA 4A08A 3PXSD 1MDAH 3OKTA 2H3XA 5K1CC 5HE1B 3BG0A 3ZE0A 4A0AB 3PXTD 3MKSB 2PM6B 4XEIC 5TEEA 3IJCA 4FB1D 5TEFA 1UTCA 3I7PA 3OKYB 1QNIA 3JROA 4TZ4A 4AN1A 1O6GA 2H14A 2PBIB 4GM8A 4OWRA 5FLXg 3T3MA 2PM9A 1SQJA 5CXBB 5EMMB 3L4MD 3ZDZA 3NIDA 5HDBA 1H2WA 2BCJB 4XYHA 4QQEA 4PBZA 4GQ2P 4DNWA 3E0CA 2MTAH 4BUJC 5M61A 4J8GA 2VDNA 3DXKC 3J80g 3GREA 3N0DA 4O45A 4J8BA 1GOTB 5HE2B 4WK2A 4G55A 3UVMA 2I0SA 3JAMg 2G9AA 1GG2B 5THAA 1M1XA 2CO0C 3RFGA 4CZVA 2AGZA 3O4IA 4UM9A 2P9LC 4GQBB 3IUJA 3ZDXA 1T2XA 3O4HA 1L5GA 1Q47A 4J86A 4Y7RA 2OVQB 4YVDA 1BPOA 3DXMC 3SWSD 1SHYB 5FA5B 5CYKB 2HESX 5TDHB 3VA6A 3UVLA 4GGCA 3AFCA 4X3EA 5FFGA 3DM0A 1NR0A 1YR2A 2H9MA 3V4VA 3I8EA 4BL0A 1JMZB 2UZYB 3SBRA 4A09A 4O2WA 4CZYA 3VI3A 2IWKA 2CE9A 3A0FA 5FKQA 5IT9g 4WK4A 3KRWB 3NIGA 4H5IA 4ERZA 3IULA 4ZOZA 3C99A 3EQ9A 4JHNA 4U7AA 3BWSA 4ZOXA 4CY5A 3PE7A 4G1MA 4J0XA 3I7OA 3FCUA 4FHLA 2H9PA 4E54B 1I2MB 4WJKA 2QR5A 3SJLD 4HDJA 4J0WA 3MUOA 4D6VA 1RI6A 4U1EI 4QRJA 1GXRA 2B5LA 5EALA 4AOWA 4RE6A 4FAND 1PEVA 4JSVC 4JT5C 3U4YA 1O6FA 3FGBA 1YFQA 3AH8B 4Z8LA 1H2ZA 4J82A 2VZ1A 5M5TA 2XL3A 3SFZA 2H6KA 3FRXA 4Y5RD 3IIYA 4Z7OA 3I7HA 4I79A 1GOFA 2P9SC 2TRCB 4AMYA 4A08B 4K3JB 4L3HD 2B4EA 3EI4B 2VDRA 2AGXA 5CXCA 4WK0A 4ES0A 2HKMA 5HE3B 4JSNC 2XU7A 2I3TA 5I5IA 4JT6C 2YNPA 5JWZA 3T3PA 5EMJB 1H2XA 3N0EA 4GM3A 3EWEA 4X61B 3C75H 5AFU3 2W18A 4JD2C 2PM9B 2O9KA 5I5MA 1XKSA 2VC2A 4A0BB 5GXHA 1K8KC 3JZNA 4A11A 2H6NA 5M5VA 5GSAA 4N14A 4J77A 4Z7NA 3DSMA 4JXMA 3QHYB 3UKRC 3V5WB 3W15A 3UVNA 2XYIA 3L4OD 1FWXA 3I7LA 3RMZD 3C5MA 3SN6B 1XHMA 4GQ1A 2HU8A 4EWRA 2YBAA 2J56H 3IJEA 4MK0B 5M5UA 3EI1A 3P4FA 3NVNA 4D0KA 5FKTA 4O02A 1NEXB 4LG8A 3MVDK 2EIEA 1VZ2A 1K32A 3O4JA 3NVXA 1ERJA 3IUQA 3C9CA 5H1MA 3OW8A 4O3UB 3VH0A 3F3PA 3ZDYA 3JZHA 5IJ8E 2EIDA 3EMHA 2HYEA 3SHFA 4AX4A 4A0AA 3SBQA 2AH1A 3ULEC 1S4UX 4R7AB 1GOGA 2EIBA 4QL1A 4A09B 2CNXA 3RN1D 3K26A 3RFHA 2H68A 5I5JA 1B9YA
chains in the Genus database with same CATH topology
2OVPB 4O3TB 3OKWA 3AL8A 2P9UC 4PNKB 2P9KC 4QT8A 5H14A 2YNOA 2HJBA 3EI2A 5H17A 2QC5A 3MZKA 4IMMA 3SVWD 3BG1A 3RLMD 3EI3A 3ZWLB 3JPXA 1MG3A 2HKRA 2GC7A 5EAPA 1VYHC 3V7DB 2B5NA 4J84A 3IJ1A 2IUVA 4L3GD 3UKUC 2YB8B 2H9LA 1PGUA 5IC7A 3VGZA 4CI8A 5TF2A 1OMWB 2CO0A 4PSWB 2J57G 5CXCB 3UR4A 3B7FA 4PBYA 2Z2OA 4FA1D 5C2WB 4CI1A 3OL2B 2IWFA 4PC0A 3MZLA 3I7NA 4CZXA 5C2VB 2I0TA 3SMRA 2I0RA 2AGYA 5EM2A 5GXIA 4A11B 1A0RB 4FA5D 2CE8A 2AQ5A 4E5ZA 4GGDA 2P9NC 5B4WA 2AGWA 3UVKA 4ERYA 3SXTD 2Z2PA 2OK6A 3PVUB 3RRMC 2BBKH 3I7KA 3FM0A 4ZOVA 4H5JA 4O1QD 1N6EA 1JMXB 2G99A 2I3SA 3EI1B 5EMKB 2QXVA 3MKQA 1R5MA 1SQ9A 1GP2B 2H9NA 5IGOA 3IJ0A 3RSEC 3CFSB 2CN2A 4CY3A 2GC4A 4ZOYA 5EMLB 5GMKn 4J81A 4PSXB 4PXWA 3EI4A 1TBGA 2XL2A 1PI6A 1OLZA 2IUQA 4J78A 2HXCA 4FA9D 3UVOA 3ORVD 1B9XA 2OVRB 2OIZA 4K3ID 2IURA 3JRPA 4A2LA 2EBSA 3AL8B 4A0BA 3EG6A 4O9DA 1TYQC 1JOFA 1XIPA 3IKOA 5AJAA 3EU7A 4ZN4A 5FKRA 5EAMA 4GZ8A 3EI2B 3OKYA 4IA9A 3I2NA 5A2Qg 4ESGA 3J81g 4JSPC 4AEZA 3EI3B 4CI2A 4L9OA 4GMBA 4A7JA 5CXBA 3MMYA 3SBPA 5IGQA 4ERQA 3JZGA 2YNNA 4XYIA 4L1QD 3PSCB 5HYNB 5KDOB 2H13A 2Z2NA 4KFMB 4JSXC 3PXWD 4A2MA 3KRXB 2Q7QA 3SCYA 3AL9A 3HFQA 4X60B 4J79A 4CY2A 4G56B 4FAVD 2GNQA 3OTTA 2P9IC 4OZUA 4UI9R 3PSLA 2IUPA 3F3FA 3CIKB 2OK4A 1U4CA 5CYKA 5HQGA 5EM2B 4BH6A 2J55H 1P22A 3MXXA 4E5ZB 2IAAA 5K19A 3NVQA 2OJYA 4CY1A 1MG2A 2AGLA 2HJ4A 3F3GA 1L0QA 2B5MA 1N6FA 2CN3A 5C9ZB 1N6DA 2AH0A 3JB9L 4GM9A 5EARA 2P9PC 5SXMA 5HE0B 4FWWA 5FQDA 5AMSA 3I89A 4J73A 3SLED 3K27A 3RN0D 4X63B 4CC9A 3V9FA 4FA4D 4GGAA 2H6QA 3ODTA 4E54A 3IIWA 3DWLC 2PM7B 3CFVA 5IJ7E 2H47A 5FKSA 4CI3A 4NSXA 1PBYB 3GFCA 3PVWB 4J87A 4LGNA 1JJUB 4LG9A 1U2VC 2UZXB 3OL2A 5FXYA 3I8CA 2YMUA 4A08A 3PXSD 1MDAH 3OKTA 2H3XA 5K1CC 5HE1B 3BG0A 4A0AB 3PXTD 3MKSB 2PM6B 4XEIC 5TEEA 3IJCA 4FB1D 5TEFA 3I7PA 3OKYB 1QNIA 3JROA 4TZ4A 2H14A 2PBIB 4GM8A 4OWRA 5FLXg 2PM9A 1SQJA 5CXBB 5EMMB 3L4MD 4XYHA 2BCJB 4QQEA 4PBZA 4GQ2P 3E0CA 2MTAH 4BUJC 4J8GA 3DXKC 3J80g 3GREA 3N0DA 4O45A 4J8BA 1GOTB 5HE2B 3UVMA 2I0SA 3JAMg 2G9AA 1GG2B 5THAA 2CO0C 3RFGA 4CZVA 2AGZA 2P9LC 4GQBB 1Q47A 4J86A 4Y7RA 2OVQB 4YVDA 3DXMC 3SWSD 1SHYB 5FA5B 5CYKB 2HESX 5TDHB 3VA6A 3UVLA 4GGCA 3AFCA 4X3EA 3DM0A 1NR0A 2H9MA 3I8EA 4BL0A 1JMZB 2UZYB 3SBRA 4A09A 4CZYA 2IWKA 2CE9A 3A0FA 5FKQA 5IT9g 3KRWB 4H5IA 4ERZA 4ZOZA 3C99A 4U7AA 3BWSA 4ZOXA 4CY5A 3PE7A 4J0XA 3I7OA 4FHLA 2H9PA 4E54B 3SJLD 4HDJA 4J0WA 4D6VA 1RI6A 4U1EI 4QRJA 1GXRA 2B5LA 5EALA 4AOWA 4FAND 1PEVA 4JSVC 4JT5C 3U4YA 3FGBA 1YFQA 3AH8B 4Z8LA 4J82A 2XL3A 3SFZA 2H6KA 3FRXA 4Y5RD 3IIYA 3I7HA 4I79A 2P9SC 2TRCB 4A08B 4K3JB 4L3HD 2B4EA 3EI4B 2AGXA 5CXCA 4ES0A 2HKMA 5HE3B 4JSNC 2XU7A 2I3TA 5I5IA 4JT6C 2YNPA 5JWZA 5EMJB 3N0EA 4GM3A 3EWEA 4X61B 3C75H 5AFU3 2W18A 4JD2C 2PM9B 2O9KA 5I5MA 1XKSA 4A0BB 5GXHA 1K8KC 3JZNA 4A11A 2H6NA 5GSAA 4N14A 4J77A 3DSMA 4JXMA 3UKRC 3V5WB 3W15A 3UVNA 2XYIA 3L4OD 1FWXA 3I7LA 3RMZD 3C5MA 3SN6B 1XHMA 4GQ1A 4EWRA 2YBAA 2J56H 4MK0B 3EI1A 3P4FA 3NVNA 4D0KA 5FKTA 1NEXB 4LG8A 1K32A 3NVXA 1ERJA 3C9CA 5H1MA 3OW8A 4O3UB 3VH0A 3F3PA 3JZHA 5IJ8E 3EMHA 2HYEA 3SHFA 4A0AA 3SBQA 2AH1A 3ULEC 1S4UX 4R7AB 4QL1A 4A09B 2CNXA 3RN1D 3K26A 3RFHA 2H68A 5I5JA 1B9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVP B;  4O3T B;  3OKW A;  3AL8 A;  2P9U C;  4PNK B;  2P9K C;  4QT8 A;  5H14 A;  2YNO A;  2HJB A;  3EI2 A;  5H17 A;  2QC5 A;  3MZK A;  4IMM A;  3SVW D;  3BG1 A;  3RLM D;  3EI3 A;  3ZWL B;  3JPX A;  1MG3 A;  2HKR A;  2GC7 A;  5EAP A;  1VYH C;  3V7D B;  2B5N A;  4J84 A;  3IJ1 A;  2IUV A;  4L3G D;  3UKU C;  2YB8 B;  2H9L A;  1PGU A;  5IC7 A;  3VGZ A;  4CI8 A;  5TF2 A;  1OMW B;  2CO0 A;  4PSW B;  2J57 G;  5CXC B;  3UR4 A;  3B7F A;  4PBY A;  2Z2O A;  4FA1 D;  5C2W B;  4CI1 A;  3OL2 B;  2IWF A;  4PC0 A;  3MZL A;  3I7N A;  4CZX A;  5C2V B;  2I0T A;  3SMR A;  2I0R A;  2AGY A;  5EM2 A;  5GXI A;  4A11 B;  1A0R B;  4FA5 D;  2CE8 A;  2AQ5 A;  4E5Z A;  4GGD A;  2P9N C;  5B4W A;  2AGW A;  3UVK A;  4ERY A;  3SXT D;  2Z2P A;  2OK6 A;  3PVU B;  3RRM C;  2BBK H;  3I7K A;  3FM0 A;  4ZOV A;  4H5J A;  4O1Q D;  1N6E A;  1JMX B;  2G99 A;  2I3S A;  3EI1 B;  5EMK B;  2QXV A;  3MKQ A;  1R5M A;  1SQ9 A;  1GP2 B;  2H9N A;  5IGO A;  3IJ0 A;  3RSE C;  3CFS B;  2CN2 A;  4CY3 A;  2GC4 A;  4ZOY A;  5EML B;  5GMK n;  4J81 A;  4PSX B;  4PXW A;  3EI4 A;  1TBG A;  2XL2 A;  1PI6 A;  1OLZ A;  2IUQ A;  4J78 A;  2HXC A;  4FA9 D;  3UVO A;  3ORV D;  1B9X A;  2OVR B;  2OIZ A;  4K3I D;  2IUR A;  3JRP A;  4A2L A;  2EBS A;  3AL8 B;  4A0B A;  3EG6 A;  4O9D A;  1TYQ C;  1JOF A;  1XIP A;  3IKO A;  5AJA A;  3EU7 A;  4ZN4 A;  5FKR A;  5EAM A;  4GZ8 A;  3EI2 B;  3OKY A;  4IA9 A;  3I2N A;  5A2Q g;  4ESG A;  3J81 g;  4JSP C;  4AEZ A;  3EI3 B;  4CI2 A;  4L9O A;  4GMB A;  4A7J A;  5CXB A;  3MMY A;  3SBP A;  5IGQ A;  4ERQ A;  3JZG A;  2YNN A;  4XYI A;  4L1Q D;  3PSC B;  5HYN B;  5KDO B;  2H13 A;  2Z2N A;  4KFM B;  4JSX C;  3PXW D;  4A2M A;  3KRX B;  2Q7Q A;  3SCY A;  3AL9 A;  3HFQ A;  4X60 B;  4J79 A;  4CY2 A;  4G56 B;  4FAV D;  2GNQ A;  3OTT A;  2P9I C;  4OZU A;  4UI9 R;  3PSL A;  2IUP A;  3F3F A;  3CIK B;  2OK4 A;  1U4C A;  5CYK A;  5HQG A;  5EM2 B;  4BH6 A;  2J55 H;  1P22 A;  3MXX A;  4E5Z B;  2IAA A;  5K19 A;  3NVQ A;  2OJY A;  4CY1 A;  1MG2 A;  2AGL A;  2HJ4 A;  3F3G A;  1L0Q A;  2B5M A;  1N6F A;  2CN3 A;  5C9Z B;  1N6D A;  2AH0 A;  3JB9 L;  4GM9 A;  5EAR A;  2P9P C;  5SXM A;  5HE0 B;  4FWW A;  5FQD A;  5AMS A;  3I89 A;  4J73 A;  3SLE D;  3K27 A;  3RN0 D;  4X63 B;  4CC9 A;  3V9F A;  4FA4 D;  4GGA A;  2H6Q A;  3ODT A;  4E54 A;  3IIW A;  3DWL C;  2PM7 B;  3CFV A;  5IJ7 E;  2H47 A;  5FKS A;  4CI3 A;  4NSX A;  1PBY B;  3GFC A;  3PVW B;  4J87 A;  4LGN A;  1JJU B;  4LG9 A;  1U2V C;  2UZX B;  3OL2 A;  5FXY A;  3I8C A;  2YMU A;  4A08 A;  3PXS D;  1MDA H;  3OKT A;  2H3X A;  5K1C C;  5HE1 B;  3BG0 A;  4A0A B;  3PXT D;  3MKS B;  2PM6 B;  4XEI C;  5TEE A;  3IJC A;  4FB1 D;  5TEF A;  3I7P A;  3OKY B;  1QNI A;  3JRO A;  4TZ4 A;  2H14 A;  2PBI B;  4GM8 A;  4OWR A;  5FLX g;  2PM9 A;  1SQJ A;  5CXB B;  5EMM B;  3L4M D;  4XYH A;  2BCJ B;  4QQE A;  4PBZ A;  4GQ2 P;  3E0C A;  2MTA H;  4BUJ C;  4J8G A;  3DXK C;  3J80 g;  3GRE A;  3N0D A;  4O45 A;  4J8B A;  1GOT B;  5HE2 B;  3UVM A;  2I0S A;  3JAM g;  2G9A A;  1GG2 B;  5THA A;  2CO0 C;  3RFG A;  4CZV A;  2AGZ A;  2P9L C;  4GQB B;  1Q47 A;  4J86 A;  4Y7R A;  2OVQ B;  4YVD A;  3DXM C;  3SWS D;  1SHY B;  5FA5 B;  5CYK B;  2HES X;  5TDH B;  3VA6 A;  3UVL A;  4GGC A;  3AFC A;  4X3E A;  3DM0 A;  1NR0 A;  2H9M A;  3I8E A;  4BL0 A;  1JMZ B;  2UZY B;  3SBR A;  4A09 A;  4CZY A;  2IWK A;  2CE9 A;  3A0F A;  5FKQ A;  5IT9 g;  3KRW B;  4H5I A;  4ERZ A;  4ZOZ A;  3C99 A;  4U7A A;  3BWS A;  4ZOX A;  4CY5 A;  3PE7 A;  4J0X A;  3I7O A;  4FHL A;  2H9P A;  4E54 B;  3SJL D;  4HDJ A;  4J0W A;  4D6V A;  1RI6 A;  4U1E I;  4QRJ A;  1GXR A;  2B5L A;  5EAL A;  4AOW A;  4FAN D;  1PEV A;  4JSV C;  4JT5 C;  3U4Y A;  3FGB A;  1YFQ A;  3AH8 B;  4Z8L A;  4J82 A;  2XL3 A;  3SFZ A;  2H6K A;  3FRX A;  4Y5R D;  3IIY A;  3I7H A;  4I79 A;  2P9S C;  2TRC B;  4A08 B;  4K3J B;  4L3H D;  2B4E A;  3EI4 B;  2AGX A;  5CXC A;  4ES0 A;  2HKM A;  5HE3 B;  4JSN C;  2XU7 A;  2I3T A;  5I5I A;  4JT6 C;  2YNP A;  5JWZ A;  5EMJ B;  3N0E A;  4GM3 A;  3EWE A;  4X61 B;  3C75 H;  5AFU 3;  2W18 A;  4JD2 C;  2PM9 B;  2O9K A;  5I5M A;  1XKS A;  4A0B B;  5GXH A;  1K8K C;  3JZN A;  4A11 A;  2H6N A;  5GSA A;  4N14 A;  4J77 A;  3DSM A;  4JXM A;  3UKR C;  3V5W B;  3W15 A;  3UVN A;  2XYI A;  3L4O D;  1FWX A;  3I7L A;  3RMZ D;  3C5M A;  3SN6 B;  1XHM A;  4GQ1 A;  4EWR A;  2YBA A;  2J56 H;  4MK0 B;  3EI1 A;  3P4F A;  3NVN A;  4D0K A;  5FKT A;  1NEX B;  4LG8 A;  1K32 A;  3NVX A;  1ERJ A;  3C9C A;  5H1M A;  3OW8 A;  4O3U B;  3VH0 A;  3F3P A;  3JZH A;  5IJ8 E;  3EMH A;  2HYE A;  3SHF A;  4A0A A;  3SBQ A;  2AH1 A;  3ULE C;  1S4U X;  4R7A B;  4QL1 A;  4A09 B;  2CNX A;  3RN1 D;  3K26 A;  3RFH A;  2H68 A;  5I5J A;  1B9Y A; 
#chains in the Genus database with same CATH topology
 1QFS A;  2OVP B;  4O3T B;  3OKW A;  3AL8 A;  2P9U C;  4PNK B;  1JTD B;  2P9K C;  4QT8 A;  5H14 A;  2YNO A;  4BCD A;  3OF7 A;  1E8M A;  2HJB A;  2BKL A;  3EI2 A;  5H17 A;  5E6U A;  2QC5 A;  3MZK A;  4IMM A;  5M5R A;  1C9L A;  5E6R A;  3MUN A;  3SVW D;  3BG1 A;  2XE4 A;  3RLM D;  3EI3 A;  3ZWL B;  3JPX A;  1MG3 A;  2HKR A;  2GC7 A;  3KCI A;  5EAP A;  1VYH C;  3V7D B;  2B5N A;  4J84 A;  4BP8 A;  3IJ1 A;  2IUV A;  4L3G D;  2HU5 A;  3UKU C;  1E8N A;  4Z7Q A;  2YB8 B;  2H9L A;  3GD1 I;  1UOP A;  1PGU A;  5IC7 A;  3VGZ A;  4BCC A;  4CI8 A;  2VDL A;  5TF2 A;  1OMW B;  2CO0 A;  4PSW B;  2VDP A;  3IUR A;  2J57 G;  5CXC B;  3UR4 A;  2VDO A;  3B7F A;  4PBY A;  2Z2O A;  5FFO A;  4FA1 D;  5C2W B;  3IUN A;  4CI1 A;  3OL2 B;  2IWF A;  4PC0 A;  3MZL A;  3I7N A;  4CZX A;  5C2V B;  2I0T A;  3SMR A;  2I0R A;  2AGY A;  5EM2 A;  5GXI A;  4A11 B;  1A0R B;  4AMZ A;  4FA5 D;  2CE8 A;  2AQ5 A;  4E5Z A;  4GGD A;  2P9N C;  5B4W A;  2AGW A;  3UVK A;  4ERY A;  3SXT D;  2Z2P A;  3NIF A;  2OK6 A;  3PVU B;  3FCS A;  3RRM C;  2JKX A;  4NC4 A;  2BBK H;  5M5S A;  3I7K A;  3FM0 A;  4ZOV A;  4H5J A;  4O1Q D;  1N6E A;  1JMX B;  2G99 A;  2I3S A;  3EI1 B;  5EMK B;  4DNU A;  2QXV A;  3MKQ A;  3QI0 A;  3IVM A;  1R5M A;  4MMZ A;  1SQ9 A;  1GP2 B;  2H9N A;  5IGO A;  3IJ0 A;  3RSE C;  3CFS B;  2CN2 A;  4CY3 A;  2GC4 A;  4ZOY A;  5EML B;  5GMK n;  4J81 A;  1GOH A;  3ZE1 A;  4AN0 A;  1K3I A;  4PSX B;  4PXW A;  3EI4 A;  1UOQ A;  1TBG A;  2XL2 A;  4BCB A;  4NBM A;  4MMY A;  3EQ7 A;  1PI6 A;  1E5T A;  1OLZ A;  2IUQ A;  4J78 A;  2HXC A;  4FA9 D;  1QFM A;  4G1E A;  3UVO A;  3ORV D;  2EIC A;  1B9X A;  2OVR B;  2OIZ A;  4K3I D;  2IUR A;  3JRP A;  4A2L A;  2EBS A;  3AL8 B;  4A0B A;  2VZ3 A;  3EG6 A;  4O9D A;  1TYQ C;  1JOF A;  1XIP A;  3IKO A;  4IRZ A;  5AJA A;  3EU7 A;  4ZN4 A;  5FKR A;  5EAM A;  4GZ8 A;  3EI2 B;  3OKY A;  4UM8 A;  4IA9 A;  1VZ3 A;  3I2N A;  5A2Q g;  4ESG A;  3J81 g;  4JSP C;  4AEZ A;  3EI3 B;  4CI2 A;  4L9O A;  4GMB A;  4A7J A;  5C92 A;  5CXB A;  3MMY A;  3SBP A;  1UOO A;  5IGQ A;  5E6S A;  3IUM A;  4ERQ A;  3K71 A;  3JZG A;  2YNN A;  4XYI A;  4L1Q D;  2VDQ A;  4RE5 A;  4QAM A;  3PSC B;  4D9S A;  5HYN B;  5KDO B;  2H13 A;  1VE6 A;  2Z2N A;  4KFM B;  4JSX C;  3PXW D;  4A2M A;  3KRX B;  1VE7 A;  2Q7Q A;  3SCY A;  3O4G A;  3AL9 A;  2VDK A;  2VDM A;  3HFQ A;  4J79 A;  4NAA A;  4X60 B;  4NEN A;  4CY2 A;  1U8C A;  2XDW A;  4G56 B;  4FAV D;  2GNQ A;  3OTT A;  2P9I C;  4OZU A;  4UI9 R;  3PSL A;  2IUP A;  3F3F A;  4BP9 A;  1H2Y A;  3CIK B;  2OK4 A;  2WQ8 A;  1U4C A;  5CYK A;  5HQG A;  3ZE2 A;  5EM2 B;  4BH6 A;  2J55 H;  1P22 A;  3MXX A;  4E5Z B;  2IAA A;  5K19 A;  4L1M A;  3K6S A;  1JV2 A;  3NVQ A;  1C9I A;  2OJY A;  4CY1 A;  1MG2 A;  2AGL A;  2HJ4 A;  3F3G A;  1L0Q A;  2B5M A;  1N6F A;  2CN3 A;  5C9Z B;  1N6D A;  2AH0 A;  4JHP C;  3JB9 L;  3EQ8 A;  4GM9 A;  5EAR A;  2P9P C;  5SXM A;  2HU7 A;  5HE0 B;  4FWW A;  4DNV A;  5FQD A;  5C86 A;  5AMS A;  3I89 A;  3GC3 B;  4J73 A;  3SLE D;  2QZP A;  3K27 A;  3RN0 D;  4X63 B;  4CC9 A;  3V9F A;  4FA4 D;  4GGA A;  2XZG A;  2H6Q A;  3ODT A;  4E54 A;  3IIW A;  3DWL C;  2PM7 B;  3CFV A;  5IJ7 E;  2H47 A;  5FKS A;  4CI3 A;  4NSX A;  1PBY B;  3GFC A;  3PVW B;  4J87 A;  4LGN A;  1JJU B;  1A12 A;  3K72 A;  3V4P A;  3VI4 A;  4LG9 A;  1TYE A;  1U2V C;  2UZX B;  3OL2 A;  5FXY A;  3DDU A;  3I8C A;  2YMU A;  4MMX A;  4A08 A;  3PXS D;  1MDA H;  3OKT A;  2H3X A;  5K1C C;  5HE1 B;  3BG0 A;  3ZE0 A;  4A0A B;  3PXT D;  3MKS B;  2PM6 B;  4XEI C;  5TEE A;  3IJC A;  4FB1 D;  5TEF A;  1UTC A;  3I7P A;  3OKY B;  1QNI A;  3JRO A;  4TZ4 A;  4AN1 A;  1O6G A;  2H14 A;  2PBI B;  4GM8 A;  4OWR A;  5FLX g;  3T3M A;  2PM9 A;  1SQJ A;  5CXB B;  5EMM B;  3L4M D;  3ZDZ A;  3NID A;  5HDB A;  1H2W A;  2BCJ B;  4XYH A;  4QQE A;  4PBZ A;  4GQ2 P;  4DNW A;  3E0C A;  2MTA H;  4BUJ C;  5M61 A;  4J8G A;  2VDN A;  3DXK C;  3J80 g;  3GRE A;  3N0D A;  4O45 A;  4J8B A;  1GOT B;  5HE2 B;  4WK2 A;  4G55 A;  3UVM A;  2I0S A;  3JAM g;  2G9A A;  1GG2 B;  5THA A;  1M1X A;  2CO0 C;  3RFG A;  4CZV A;  2AGZ A;  3O4I A;  4UM9 A;  2P9L C;  4GQB B;  3IUJ A;  3ZDX A;  1T2X A;  3O4H A;  1L5G A;  1Q47 A;  4J86 A;  4Y7R A;  2OVQ B;  4YVD A;  1BPO A;  3DXM C;  3SWS D;  1SHY B;  5FA5 B;  5CYK B;  2HES X;  5TDH B;  3VA6 A;  3UVL A;  4GGC A;  3AFC A;  4X3E A;  5FFG A;  3DM0 A;  1NR0 A;  1YR2 A;  2H9M A;  3V4V A;  3I8E A;  4BL0 A;  1JMZ B;  2UZY B;  3SBR A;  4A09 A;  4O2W A;  4CZY A;  3VI3 A;  2IWK A;  2CE9 A;  3A0F A;  5FKQ A;  5IT9 g;  4WK4 A;  3KRW B;  3NIG A;  4H5I A;  4ERZ A;  3IUL A;  4ZOZ A;  3C99 A;  3EQ9 A;  4JHN A;  4U7A A;  3BWS A;  4ZOX A;  4CY5 A;  3PE7 A;  4G1M A;  4J0X A;  3I7O A;  3FCU A;  4FHL A;  2H9P A;  4E54 B;  1I2M B;  4WJK A;  2QR5 A;  3SJL D;  4HDJ A;  4J0W A;  3MUO A;  4D6V A;  1RI6 A;  4U1E I;  4QRJ A;  1GXR A;  2B5L A;  5EAL A;  4AOW A;  4RE6 A;  4FAN D;  1PEV A;  4JSV C;  4JT5 C;  3U4Y A;  1O6F A;  3FGB A;  1YFQ A;  3AH8 B;  4Z8L A;  1H2Z A;  4J82 A;  2VZ1 A;  5M5T A;  2XL3 A;  3SFZ A;  2H6K A;  3FRX A;  4Y5R D;  3IIY A;  4Z7O A;  3I7H A;  4I79 A;  1GOF A;  2P9S C;  2TRC B;  4AMY A;  4A08 B;  4K3J B;  4L3H D;  2B4E A;  3EI4 B;  2VDR A;  2AGX A;  5CXC A;  4WK0 A;  4ES0 A;  2HKM A;  5HE3 B;  4JSN C;  2XU7 A;  2I3T A;  5I5I A;  4JT6 C;  2YNP A;  5JWZ A;  3T3P A;  5EMJ B;  1H2X A;  3N0E A;  4GM3 A;  3EWE A;  4X61 B;  3C75 H;  5AFU 3;  2W18 A;  4JD2 C;  2PM9 B;  2O9K A;  5I5M A;  1XKS A;  2VC2 A;  4A0B B;  5GXH A;  1K8K C;  3JZN A;  4A11 A;  2H6N A;  5M5V A;  5GSA A;  4N14 A;  4J77 A;  4Z7N A;  3DSM A;  4JXM A;  3QHY B;  3UKR C;  3V5W B;  3W15 A;  3UVN A;  2XYI A;  3L4O D;  1FWX A;  3I7L A;  3RMZ D;  3C5M A;  3SN6 B;  1XHM A;  4GQ1 A;  2HU8 A;  4EWR A;  2YBA A;  2J56 H;  3IJE A;  4MK0 B;  5M5U A;  3EI1 A;  3P4F A;  3NVN A;  4D0K A;  5FKT A;  4O02 A;  1NEX B;  4LG8 A;  3MVD K;  2EIE A;  1VZ2 A;  1K32 A;  3O4J A;  3NVX A;  1ERJ A;  3IUQ A;  3C9C A;  5H1M A;  3OW8 A;  4O3U B;  3VH0 A;  3F3P A;  3ZDY A;  3JZH A;  5IJ8 E;  2EID A;  3EMH A;  2HYE A;  3SHF A;  4AX4 A;  4A0A A;  3SBQ A;  2AH1 A;  3ULE C;  1S4U X;  4R7A B;  1GOG A;  2EIB A;  4QL1 A;  4A09 B;  2CNX A;  3RN1 D;  3K26 A;  3RFH A;  2H68 A;  5I5J A;  1B9Y A; 
#chains in the Genus database with same CATH homology
 2OVP B;  4O3T B;  3OKW A;  3AL8 A;  2P9U C;  4PNK B;  2P9K C;  4QT8 A;  5H14 A;  2YNO A;  2HJB A;  3EI2 A;  5H17 A;  2QC5 A;  3MZK A;  4IMM A;  3SVW D;  3BG1 A;  3RLM D;  3EI3 A;  3ZWL B;  3JPX A;  1MG3 A;  2HKR A;  2GC7 A;  5EAP A;  1VYH C;  3V7D B;  2B5N A;  4J84 A;  3IJ1 A;  2IUV A;  4L3G D;  3UKU C;  2YB8 B;  2H9L A;  1PGU A;  5IC7 A;  3VGZ A;  4CI8 A;  5TF2 A;  1OMW B;  2CO0 A;  4PSW B;  2J57 G;  5CXC B;  3UR4 A;  3B7F A;  4PBY A;  2Z2O A;  4FA1 D;  5C2W B;  4CI1 A;  3OL2 B;  2IWF A;  4PC0 A;  3MZL A;  3I7N A;  4CZX A;  5C2V B;  2I0T A;  3SMR A;  2I0R A;  2AGY A;  5EM2 A;  5GXI A;  4A11 B;  1A0R B;  4FA5 D;  2CE8 A;  2AQ5 A;  4E5Z A;  4GGD A;  2P9N C;  5B4W A;  2AGW A;  3UVK A;  4ERY A;  3SXT D;  2Z2P A;  2OK6 A;  3PVU B;  3RRM C;  2BBK H;  3I7K A;  3FM0 A;  4ZOV A;  4H5J A;  4O1Q D;  1N6E A;  1JMX B;  2G99 A;  2I3S A;  3EI1 B;  5EMK B;  2QXV A;  3MKQ A;  1R5M A;  1SQ9 A;  1GP2 B;  2H9N A;  5IGO A;  3IJ0 A;  3RSE C;  3CFS B;  2CN2 A;  4CY3 A;  2GC4 A;  4ZOY A;  5EML B;  5GMK n;  4J81 A;  4PSX B;  4PXW A;  3EI4 A;  1TBG A;  2XL2 A;  1PI6 A;  1OLZ A;  2IUQ A;  4J78 A;  2HXC A;  4FA9 D;  3UVO A;  3ORV D;  1B9X A;  2OVR B;  2OIZ A;  4K3I D;  2IUR A;  3JRP A;  4A2L A;  2EBS A;  3AL8 B;  4A0B A;  3EG6 A;  4O9D A;  1TYQ C;  1JOF A;  1XIP A;  3IKO A;  5AJA A;  3EU7 A;  4ZN4 A;  5FKR A;  5EAM A;  4GZ8 A;  3EI2 B;  3OKY A;  4IA9 A;  3I2N A;  5A2Q g;  4ESG A;  3J81 g;  4JSP C;  4AEZ A;  3EI3 B;  4CI2 A;  4L9O A;  4GMB A;  4A7J A;  5CXB A;  3MMY A;  3SBP A;  5IGQ A;  4ERQ A;  3JZG A;  2YNN A;  4XYI A;  4L1Q D;  3PSC B;  5HYN B;  5KDO B;  2H13 A;  2Z2N A;  4KFM B;  4JSX C;  3PXW D;  4A2M A;  3KRX B;  2Q7Q A;  3SCY A;  3AL9 A;  3HFQ A;  4X60 B;  4J79 A;  4CY2 A;  4G56 B;  4FAV D;  2GNQ A;  3OTT A;  2P9I C;  4OZU A;  4UI9 R;  3PSL A;  2IUP A;  3F3F A;  3CIK B;  2OK4 A;  1U4C A;  5CYK A;  5HQG A;  5EM2 B;  4BH6 A;  2J55 H;  1P22 A;  3MXX A;  4E5Z B;  2IAA A;  5K19 A;  3NVQ A;  2OJY A;  4CY1 A;  1MG2 A;  2AGL A;  2HJ4 A;  3F3G A;  1L0Q A;  2B5M A;  1N6F A;  2CN3 A;  5C9Z B;  1N6D A;  2AH0 A;  3JB9 L;  4GM9 A;  5EAR A;  2P9P C;  5SXM A;  5HE0 B;  4FWW A;  5FQD A;  5AMS A;  3I89 A;  4J73 A;  3SLE D;  3K27 A;  3RN0 D;  4X63 B;  4CC9 A;  3V9F A;  4FA4 D;  4GGA A;  2H6Q A;  3ODT A;  4E54 A;  3IIW A;  3DWL C;  2PM7 B;  3CFV A;  5IJ7 E;  2H47 A;  5FKS A;  4CI3 A;  4NSX A;  1PBY B;  3GFC A;  3PVW B;  4J87 A;  4LGN A;  1JJU B;  4LG9 A;  1U2V C;  2UZX B;  3OL2 A;  5FXY A;  3I8C A;  2YMU A;  4A08 A;  3PXS D;  1MDA H;  3OKT A;  2H3X A;  5K1C C;  5HE1 B;  3BG0 A;  4A0A B;  3PXT D;  3MKS B;  2PM6 B;  4XEI C;  5TEE A;  3IJC A;  4FB1 D;  5TEF A;  3I7P A;  3OKY B;  1QNI A;  3JRO A;  4TZ4 A;  2H14 A;  2PBI B;  4GM8 A;  4OWR A;  5FLX g;  2PM9 A;  1SQJ A;  5CXB B;  5EMM B;  3L4M D;  4XYH A;  2BCJ B;  4QQE A;  4PBZ A;  4GQ2 P;  3E0C A;  2MTA H;  4BUJ C;  4J8G A;  3DXK C;  3J80 g;  3GRE A;  3N0D A;  4O45 A;  4J8B A;  1GOT B;  5HE2 B;  3UVM A;  2I0S A;  3JAM g;  2G9A A;  1GG2 B;  5THA A;  2CO0 C;  3RFG A;  4CZV A;  2AGZ A;  2P9L C;  4GQB B;  1Q47 A;  4J86 A;  4Y7R A;  2OVQ B;  4YVD A;  3DXM C;  3SWS D;  1SHY B;  5FA5 B;  5CYK B;  2HES X;  5TDH B;  3VA6 A;  3UVL A;  4GGC A;  3AFC A;  4X3E A;  3DM0 A;  1NR0 A;  2H9M A;  3I8E A;  4BL0 A;  1JMZ B;  2UZY B;  3SBR A;  4A09 A;  4CZY A;  2IWK A;  2CE9 A;  3A0F A;  5FKQ A;  5IT9 g;  3KRW B;  4H5I A;  4ERZ A;  4ZOZ A;  3C99 A;  4U7A A;  3BWS A;  4ZOX A;  4CY5 A;  3PE7 A;  4J0X A;  3I7O A;  4FHL A;  2H9P A;  4E54 B;  3SJL D;  4HDJ A;  4J0W A;  4D6V A;  1RI6 A;  4U1E I;  4QRJ A;  1GXR A;  2B5L A;  5EAL A;  4AOW A;  4FAN D;  1PEV A;  4JSV C;  4JT5 C;  3U4Y A;  3FGB A;  1YFQ A;  3AH8 B;  4Z8L A;  4J82 A;  2XL3 A;  3SFZ A;  2H6K A;  3FRX A;  4Y5R D;  3IIY A;  3I7H A;  4I79 A;  2P9S C;  2TRC B;  4A08 B;  4K3J B;  4L3H D;  2B4E A;  3EI4 B;  2AGX A;  5CXC A;  4ES0 A;  2HKM A;  5HE3 B;  4JSN C;  2XU7 A;  2I3T A;  5I5I A;  4JT6 C;  2YNP A;  5JWZ A;  5EMJ B;  3N0E A;  4GM3 A;  3EWE A;  4X61 B;  3C75 H;  5AFU 3;  2W18 A;  4JD2 C;  2PM9 B;  2O9K A;  5I5M A;  1XKS A;  4A0B B;  5GXH A;  1K8K C;  3JZN A;  4A11 A;  2H6N A;  5GSA A;  4N14 A;  4J77 A;  3DSM A;  4JXM A;  3UKR C;  3V5W B;  3W15 A;  3UVN A;  2XYI A;  3L4O D;  1FWX A;  3I7L A;  3RMZ D;  3C5M A;  3SN6 B;  1XHM A;  4GQ1 A;  4EWR A;  2YBA A;  2J56 H;  4MK0 B;  3EI1 A;  3P4F A;  3NVN A;  4D0K A;  5FKT A;  1NEX B;  4LG8 A;  1K32 A;  3NVX A;  1ERJ A;  3C9C A;  5H1M A;  3OW8 A;  4O3U B;  3VH0 A;  3F3P A;  3JZH A;  5IJ8 E;  3EMH A;  2HYE A;  3SHF A;  4A0A A;  3SBQ A;  2AH1 A;  3ULE C;  1S4U X;  4R7A B;  4QL1 A;  4A09 B;  2CNX A;  3RN1 D;  3K26 A;  3RFH A;  2H68 A;  5I5J A;  1B9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...