4Y5RD

Crystal structure of a t67a maug/pre-methylamine dehydrogenase complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title A T67A mutation in the proximal pocket of the high-spin heme of MauG stabilizes formation of a mixed-valent Fe(II)/Fe(III) state and enhances charge resonance stabilization of the bis-Fe(IV) state.
pubmed doi rcsb
source organism Paracoccus denitrificans (strain pd 1222)
molecule tags Oxidoreductase
total genus 89
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4y5rD00
3JROA 5HQGA 3P4FA 3DWLC 5TF2A 1PBYB 2H68A 4BH6A 4A0BA 3IJ0A 3AL8A 3L4OD 3AFCA 5CYKB 4A08B 4LG9A 1PGUA 1GOTB 2P9IC 4J78A 2XU7A 4QQEA 1OMWB 3EU7A 5HE0B 2PM6B 4J84A 1K32A 5CXCA 2OVPB 3MZLA 2OK4A 2PBIB 3OKYA 4I79A 3AL8B 3PSLA 3EI4A 1JOFA 5FKTA 4ZOVA 3CFSB 4JXMA 3I89A 4A09B 3ZWLB 3PXWD 4GM3A 5EMLB 3RLMD 1TBGA 3I7OA 2H6NA 2CO0A 2UZXB 4ESGA 1YFQA 4ERZA 2GC7A 3OKYB 2QC5A 3RFHA 4X60B 3EI4B 1JMZB 4J0WA 2YBAA 4JSVC 2H13A 2CN2A 3IJCA 2OK6A 5FKSA 2H9PA 4O3UB 5EM2B 3OL2A 4ERQA 2J55H 3I7PA 5GXIA 3PVUB 3MZKA 2XYIA 4E5ZA 4GM9A 3VA6A 3EMHA 2QXVA 2BBKH 2B5MA 3JB9L 4X3EA 3SBPA 4CI3A 2CE8A 5C9ZB 2PM7B 4PNKB 2XL3A 4LG8A 5EAPA 1ERJA 2B4EA 2HYEA 2AQ5A 4O45A 2IUQA 4ZOZA 5IC7A 3FRXA 3NVXA 2P9NC 3MKQA 3JAMg 4QRJA 3C9CA 4LGNA 4AOWA 1L0QA 4XYIA 3DM0A 4PC0A 4JT5C 4QL1A 4J79A 3BG0A 3F3FA 3EI3A 4GZ8A 2YNPA 4J82A 4L3HD 1MG2A 2EBSA 3N0DA 3SVWD 4Z8LA 4H5IA 2IAAA 3DXMC 2HJBA 4GMBA 5FA5B 3VGZA 1U2VC 2AH0A 3L4MD 1XIPA 3OW8A 5CYKA 5HE2B 4FAND 4A08A 1NR0A 3W15A 1GP2B 2H9LA 3RRMC 2H6QA 3JZHA 1VYHC 3EI3B 4FA9D 4QT8A 2G9AA 4J77A 2OIZA 2Z2NA 2G99A 5HE1B 5FKRA 3ORVD 2AGLA 2AH1A 3UVOA 4O1QD 3DXKC 4O3TB 1B9YA 1MG3A 1A0RB 3V9FA 2AGYA 2IUPA 3SFZA 4A09A 4A7JA 4CY2A 1N6DA 3FGBA 4PSXB 5C2VB 3EWEA 4R7AB 4CI2A 4ZN4A 5GMKn 3SN6B 4O9DA 3NVQA 3GREA 4GGDA 3I7LA 4JSNC 5IT9g 2AGZA 3I8CA 1SHYB 4J0XA 4XEIC 4CZYA 4GM8A 3UVMA 3V5WB 5EM2A 3RSEC 5EMKB 4A2LA 4N14A 4TZ4A 5C2WB 5TEEA 2IWKA 3C75H 4J8GA 5HYNB 4L3GD 4J86A 4KFMB 3PE7A 4A0AB 1B9XA 4GGCA 4A11A 4H5JA 3SHFA 5GXHA 4CY3A 4Y7RA 4IMMA 5SXMA 1Q47A 4PXWA 1N6FA 5I5IA 5JWZA 1MDAH 3KRWB 5FLXg 1XKSA 2I0SA 4GQBB 2I3TA 4L9OA 4FA4D 4A11B 3RFGA 3UKRC 1GXRA 5AJAA 4J73A 1N6EA 2CN3A 3SBQA 2HXCA 3ULEC 3UVKA 2O9KA 5EALA 2AGWA 2YNNA 4BL0A 1QNIA 2H9MA 3MKSB 4CZXA 4D6VA 2P9PC 1R5MA 2I0TA 4OZUA 5TEFA 4J8BA 3SCYA 5KDOB 2MTAH 2HESX 3I7NA 1JMXB 2W18A 1K8KC 4GGAA 3AL9A 3UR4A 1PI6A 2YMUA 4FWWA 3EI1A 5I5MA 2HJ4A 3EG6A 5TDHB 4HDJA 4JSPC 4ES0A 3I7KA 2J56H 1P22A 3JZNA 3IJ1A 2I0RA 2OVQB 3DSMA 3IIYA 4XYHA 2P9LC 1XHMA 3EI1B 3PVWB 2OVRB 4MK0B 2BCJB 3C99A 5FKQA 3N0EA 5CXBB 3SJLD 2OJYA 5THAA 2B5NA 5I5JA 3EI2B 5FXYA 5IGOA 1GG2B 2H9NA 2CO0C 3C5MA 3UKUC 5GSAA 4E54B 4IA9A 5EARA 3CFVA 3OTTA 4X63B 4ERYA 3K27A 3IKOA 2AGXA 1S4UX 4GQ2P 3I8EA 4UI9R 2Q7QA 4G56B 3SXTD 4BUJC 2YB8B 5H1MA 4A0AA 4AEZA 2PM9B 3I2NA 3NVNA 4FA1D 2P9SC 4CI8A 2H6KA 5IJ7E 3RMZD 3ODTA 1U4CA 4A0BB 4J87A 4FHLA 2HKMA 5EMJB 3E0CA 3JPXA 4A2MA 2H47A 4PBYA 3KRXB 4FAVD 3F3PA 2P9UC 4YVDA 4ZOYA 4CZVA 3PXSD 3GFCA 2UZYB 5AFU3 2XL2A 4PSWB 3SBRA 3J80g 2CNXA 3MXXA 5CXCB 5FQDA 5K19A 4CI1A 3A0FA 3AH8B 2Z2PA 3J81g 4PBZA 2H14A 2P9KC 4Y5RD 4K3JB 3UVLA 4FB1D 4JD2C 4U7AA 5AMSA 4OWRA 5K1CC 3PXTD 5B4WA 3SMRA 2TRCB 3VH0A 3U4YA 5A2Qg 2J57G 2B5LA 2IURA 5H14A 3MMYA 3BWSA 3UVNA 1FWXA 1PEVA 4ZOXA 3JZGA 1TYQC 3CIKB 3OL2B 4CY1A 4NSXA 4L1QD 5HE3B 3K26A 4GQ1A 3SLED 1SQ9A 5IJ8E 4E5ZB 4J81A 4FA5D 2GNQA 2GC4A 2IWFA 5EAMA 2I3SA 3F3GA 4CY5A 5CXBA 1JJUB 5H17A 2Z2OA 3EI2A 3RN0D 3V7DB 5IGQA 4X61B 2YNOA 3BG1A 5EMMB 4E54A 4D0KA 4JT6C 3PSCB 4EWRA 3OKWA 2HKRA 1OLZA 3OKTA 1NEXB 3SWSD 4K3ID 2H3XA 3IIWA 4JSXC 3RN1D 1RI6A 4U1EI 3I7HA 1SQJA 2PM9A 3FM0A 2IUVA 3HFQA 4CC9A 2CE9A 3B7FA 3JRPA
chains in the Genus database with same CATH superfamily
3JROA 3ZE1A 5HQGA 3V4PA 4IRZA 3P4FA 3DWLC 3EQ7A 1QFMA 5TF2A 1VE6A 1PBYB 2H68A 4BH6A 4A0BA 3IJ0A 3AL8A 1H2WA 3L4OD 2VDPA 3AFCA 5CYKB 3ZE2A 4A08B 4LG9A 1PGUA 1GOTB 2P9IC 4J78A 2EIEA 2XU7A 1UOOA 4DNUA 4QQEA 1OMWB 3EU7A 4BP9A 5HE0B 4NENA 2PM6B 4J84A 1K32A 5CXCA 2OVPB 3MZLA 4WK4A 2OK4A 2PBIB 3OKYA 4I79A 3AL8B 4WK0A 3PSLA 3EI4A 1A12A 1JOFA 5FKTA 4Z7QA 4ZOVA 3CFSB 3NIGA 4JXMA 4G1MA 3I89A 5C86A 4A09B 3ZWLB 3PXWD 2HU7A 4GM3A 5EMLB 2VZ1A 3RLMD 1TBGA 3I7OA 2H6NA 2CO0A 2UZXB 4D9SA 4ESGA 1YFQA 4ERZA 2GC7A 3OKYB 2QC5A 3RFHA 4X60B 3EI4B 1JMZB 4J0WA 2YBAA 4JSVC 2H13A 2CN2A 3IJCA 2OK6A 5FKSA 2H9PA 4UM8A 4O3UB 5EM2B 3OL2A 4ERQA 2J55H 3I7PA 5GXIA 4DNWA 3PVUB 2VDLA 3MZKA 3MUOA 2XYIA 4E5ZA 3NIFA 1UOPA 4GM9A 1JV2A 3VA6A 2JKXA 3EMHA 2QXVA 2QZPA 2BBKH 2B5MA 3JB9L 4X3EA 3SBPA 4CI3A 2CE8A 5C9ZB 2PM7B 4PNKB 2XL3A 4LG8A 2WQ8A 5EAPA 4JHNA 1ERJA 2B4EA 4NBMA 4DNVA 2HYEA 2AQ5A 4O45A 2IUQA 4ZOZA 2VDKA 5IC7A 3FRXA 3NVXA 2P9NC 3MKQA 4RE5A 3OF7A 3JAMg 4QRJA 1T2XA 3C9CA 4LGNA 3IUNA 4Z7OA 4O2WA 4AOWA 1L0QA 4XYIA 3DM0A 4PC0A 4JT5C 4QL1A 4J79A 3BG0A 3F3FA 3EI3A 4GZ8A 2YNPA 4J82A 1O6FA 4L3HD 1MG2A 2EBSA 3N0DA 2XDWA 4BP8A 3SVWD 3FCUA 1O6GA 4Z8LA 4QAMA 4H5IA 2IAAA 3DXMC 2HJBA 4GMBA 5FA5B 2EIDA 3VGZA 3ZDYA 1U2VC 3IJEA 2AH0A 3L4MD 1XIPA 2VDMA 3OW8A 5CYKA 5HE2B 4FAND 4A08A 1NR0A 3W15A 1GP2B 2H9LA 3RRMC 3MUNA 3ZDZA 2H6QA 1M1XA 3JZHA 2VC2A 1VYHC 3EI3B 4FA9D 4QT8A 5M5UA 2G9AA 4J77A 2OIZA 2Z2NA 4G1EA 2G99A 3GC3B 3IULA 5HE1B 5FKRA 3ORVD 2AGLA 2AH1A 2XZGA 3UVOA 2VDRA 4O1QD 3DXKC 4Z7NA 4O3TB 3T3MA 1B9YA 1MG3A 1A0RB 5E6SA 3V9FA 2AGYA 3IUMA 2IUPA 3SFZA 4A09A 4A7JA 1E5TA 4CY2A 1N6DA 3FGBA 4PSXB 5C2VB 3EWEA 4R7AB 4CI2A 4ZN4A 5GMKn 3SN6B 2VDOA 4O9DA 3NVQA 3GREA 4GGDA 3I7LA 4JSNC 1GOFA 2AGZA 3I8CA 5IT9g 1SHYB 3K6SA 4J0XA 4XEIC 5M5RA 1BPOA 4CZYA 4GM8A 1TYEA 3UVMA 3V5WB 5EM2A 3RSEC 5EMKB 4A2LA 4N14A 4TZ4A 5C2WB 5TEEA 4AX4A 2IWKA 3C75H 4J8GA 5HYNB 4L3GD 3IUJA 3QHYB 1YR2A 4J86A 4KFMB 3PE7A 3V4VA 1B9XA 4GGCA 4A11A 4A0AB 4H5JA 3SHFA 3O4IA 5GXHA 4CY3A 4Y7RA 4IMMA 5SXMA 1Q47A 4WJKA 4PXWA 1H2YA 1N6FA 2QR5A 5I5IA 5JWZA 1MDAH 3GD1I 2EICA 3KRWB 5FLXg 1XKSA 2I0SA 4GQBB 2I3TA 1E8MA 4L9OA 5M61A 4FA4D 4A11B 3RFGA 3UKRC 1GXRA 4G55A 5AJAA 1I2MB 2HU8A 4J73A 1N6EA 5C92A 5M5TA 2CN3A 3SBQA 2XE4A 2HXCA 3ULEC 1VZ2A 1QFSA 3UVKA 2O9KA 5EALA 1UTCA 2AGWA 2YNNA 4BL0A 1QNIA 2H9MA 3MKSB 4CZXA 4D6VA 2HU5A 3FCSA 2P9PC 1R5MA 2I0TA 4OZUA 4MMYA 5TEFA 4J8BA 3SCYA 5KDOB 2MTAH 2HESX 3I7NA 4MMZA 1JMXB 2W18A 1K8KC 4GGAA 3AL9A 3UR4A 1H2XA 1PI6A 2YMUA 4FWWA 3EI1A 4O02A 1K3IA 3DDUA 5I5MA 3NIDA 2HJ4A 3EG6A 5TDHB 4HDJA 3ZE0A 4JSPC 3K71A 4ES0A 3I7KA 2J56H 1P22A 3JZNA 3IJ1A 4NC4A 2I0RA 2OVQB 3DSMA 3IIYA 1C9IA 4XYHA 2P9LC 3MVDK 3IURA 1XHMA 3EI1B 3PVWB 2OVRB 4MK0B 2BCJB 3C99A 5FKQA 3N0EA 5CXBB 5FFGA 2OJYA 3SJLD 4JHPC 5THAA 2B5NA 5I5JA 4MMXA 4AN0A 3EI2B 5FXYA 5IGOA 3VI3A 1GG2B 2H9NA 2CO0C 3C5MA 3UKUC 5GSAA 3ZDXA 4E54B 4IA9A 5EARA 3CFVA 3OTTA 4X63B 4ERYA 5FFOA 3K27A 3IKOA 1VE7A 2AGXA 1S4UX 4GQ2P 3I8EA 5M5SA 1H2ZA 4UI9R 4BCBA 2Q7QA 4G56B 3SXTD 4BUJC 2YB8B 5H1MA 4A0AA 3EQ9A 4AEZA 2PM9B 3I2NA 3NVNA 5HDBA 4FA1D 1VZ3A 2BKLA 2P9SC 4CI8A 2H6KA 5IJ7E 3RMZD 3ODTA 3K72A 1U4CA 4A0BB 4J87A 4FHLA 2HKMA 5EMJB 3E0CA 3JPXA 4A2MA 3EQ8A 2H47A 4UM9A 4PBYA 3KRXB 3O4HA 3T3PA 4FAVD 3F3PA 2P9UC 4YVDA 4ZOYA 4CZVA 3PXSD 3GFCA 2UZYB 5AFU3 2XL2A 4BCCA 4PSWB 3SBRA 4NAAA 3J80g 2CNXA 3MXXA 3VI4A 5CXCB 5FQDA 5K19A 1GOHA 4CI1A 3A0FA 3AH8B 2Z2PA 3J81g 3IVMA 4PBZA 4WK2A 2H14A 2P9KC 4Y5RD 4K3JB 3UVLA 4FB1D 1GOGA 4JD2C 4U7AA 3IUQA 5AMSA 4OWRA 5K1CC 3PXTD 5B4WA 3SMRA 2TRCB 3VH0A 3U4YA 1E8NA 5E6RA 5A2Qg 2J57G 2B5LA 2IURA 5H14A 3MMYA 3BWSA 3O4JA 3UVNA 2VDNA 1FWXA 1PEVA 4ZOXA 3JZGA 1TYQC 3CIKB 3OL2B 2EIBA 5E6UA 4CY1A 1JTDB 4NSXA 1U8CA 4L1QD 5HE3B 4AMZA 3K26A 1UOQA 2VZ3A 4GQ1A 1SQ9A 3SLED 4AMYA 5IJ8E 4E5ZB 1L5GA 4J81A 4FA5D 2GNQA 2GC4A 2IWFA 5EAMA 5M5VA 2I3SA 3F3GA 3KCIA 4CY5A 5CXBA 1JJUB 4AN1A 5H17A 2Z2OA 3EI2A 3RN0D 3V7DB 5IGQA 4X61B 2YNOA 3BG1A 5EMMB 4E54A 4D0KA 4JT6C 4BCDA 3QI0A 1C9LA 3PSCB 4EWRA 3OKWA 2HKRA 1OLZA 2VDQA 3OKTA 1NEXB 3SWSD 3O4GA 4K3ID 2H3XA 3IIWA 4JSXC 3RN1D 1RI6A 4U1EI 3I7HA 1SQJA 2PM9A 3FM0A 2IUVA 3HFQA 4CC9A 2CE9A 4L1MA 3B7FA 4RE6A 3JRPA
chains in the Genus database with same CATH topology
3JROA 5HQGA 3P4FA 3DWLC 5TF2A 1PBYB 2H68A 4BH6A 4A0BA 3IJ0A 3AL8A 3L4OD 3AFCA 5CYKB 4A08B 4LG9A 1PGUA 1GOTB 2P9IC 4J78A 2XU7A 4QQEA 1OMWB 3EU7A 5HE0B 2PM6B 4J84A 1K32A 5CXCA 2OVPB 3MZLA 2OK4A 2PBIB 3OKYA 4I79A 3AL8B 3PSLA 3EI4A 1JOFA 5FKTA 4ZOVA 3CFSB 4JXMA 3I89A 4A09B 3ZWLB 3PXWD 4GM3A 5EMLB 3RLMD 1TBGA 3I7OA 2H6NA 2CO0A 2UZXB 4ESGA 1YFQA 4ERZA 2GC7A 3OKYB 2QC5A 3RFHA 4X60B 3EI4B 1JMZB 4J0WA 2YBAA 4JSVC 2H13A 2CN2A 3IJCA 2OK6A 5FKSA 2H9PA 4O3UB 5EM2B 3OL2A 4ERQA 2J55H 3I7PA 5GXIA 3PVUB 3MZKA 2XYIA 4E5ZA 4GM9A 3VA6A 3EMHA 2QXVA 2BBKH 2B5MA 3JB9L 4X3EA 3SBPA 4CI3A 2CE8A 5C9ZB 2PM7B 4PNKB 2XL3A 4LG8A 5EAPA 1ERJA 2B4EA 2HYEA 2AQ5A 4O45A 2IUQA 4ZOZA 5IC7A 3FRXA 3NVXA 2P9NC 3MKQA 3JAMg 4QRJA 3C9CA 4LGNA 4AOWA 1L0QA 4XYIA 3DM0A 4PC0A 4JT5C 4QL1A 4J79A 3BG0A 3F3FA 3EI3A 4GZ8A 2YNPA 4J82A 4L3HD 1MG2A 2EBSA 3N0DA 3SVWD 4Z8LA 4H5IA 2IAAA 3DXMC 2HJBA 4GMBA 5FA5B 3VGZA 1U2VC 2AH0A 3L4MD 1XIPA 3OW8A 5CYKA 5HE2B 4FAND 4A08A 1NR0A 3W15A 1GP2B 2H9LA 3RRMC 2H6QA 3JZHA 1VYHC 3EI3B 4FA9D 4QT8A 2G9AA 4J77A 2OIZA 2Z2NA 2G99A 5HE1B 5FKRA 3ORVD 2AGLA 2AH1A 3UVOA 4O1QD 3DXKC 4O3TB 1B9YA 1MG3A 1A0RB 3V9FA 2AGYA 2IUPA 3SFZA 4A09A 4A7JA 4CY2A 1N6DA 3FGBA 4PSXB 5C2VB 3EWEA 4R7AB 4CI2A 4ZN4A 5GMKn 3SN6B 4O9DA 3NVQA 3GREA 4GGDA 3I7LA 4JSNC 5IT9g 2AGZA 3I8CA 1SHYB 4J0XA 4XEIC 4CZYA 4GM8A 3UVMA 3V5WB 5EM2A 3RSEC 5EMKB 4A2LA 4N14A 4TZ4A 5C2WB 5TEEA 2IWKA 3C75H 4J8GA 5HYNB 4L3GD 4J86A 4KFMB 3PE7A 4A0AB 1B9XA 4GGCA 4A11A 4H5JA 3SHFA 5GXHA 4CY3A 4Y7RA 4IMMA 5SXMA 1Q47A 4PXWA 1N6FA 5I5IA 5JWZA 1MDAH 3KRWB 5FLXg 1XKSA 2I0SA 4GQBB 2I3TA 4L9OA 4FA4D 4A11B 3RFGA 3UKRC 1GXRA 5AJAA 4J73A 1N6EA 2CN3A 3SBQA 2HXCA 3ULEC 3UVKA 2O9KA 5EALA 2AGWA 2YNNA 4BL0A 1QNIA 2H9MA 3MKSB 4CZXA 4D6VA 2P9PC 1R5MA 2I0TA 4OZUA 5TEFA 4J8BA 3SCYA 5KDOB 2MTAH 2HESX 3I7NA 1JMXB 2W18A 1K8KC 4GGAA 3AL9A 3UR4A 1PI6A 2YMUA 4FWWA 3EI1A 5I5MA 2HJ4A 3EG6A 5TDHB 4HDJA 4JSPC 4ES0A 3I7KA 2J56H 1P22A 3JZNA 3IJ1A 2I0RA 2OVQB 3DSMA 3IIYA 4XYHA 2P9LC 1XHMA 3EI1B 3PVWB 2OVRB 4MK0B 2BCJB 3C99A 5FKQA 3N0EA 5CXBB 3SJLD 2OJYA 5THAA 2B5NA 5I5JA 3EI2B 5FXYA 5IGOA 1GG2B 2H9NA 2CO0C 3C5MA 3UKUC 5GSAA 4E54B 4IA9A 5EARA 3CFVA 3OTTA 4X63B 4ERYA 3K27A 3IKOA 2AGXA 1S4UX 4GQ2P 3I8EA 4UI9R 2Q7QA 4G56B 3SXTD 4BUJC 2YB8B 5H1MA 4A0AA 4AEZA 2PM9B 3I2NA 3NVNA 4FA1D 2P9SC 4CI8A 2H6KA 5IJ7E 3RMZD 3ODTA 1U4CA 4A0BB 4J87A 4FHLA 2HKMA 5EMJB 3E0CA 3JPXA 4A2MA 2H47A 4PBYA 3KRXB 4FAVD 3F3PA 2P9UC 4YVDA 4ZOYA 4CZVA 3PXSD 3GFCA 2UZYB 5AFU3 2XL2A 4PSWB 3SBRA 3J80g 2CNXA 3MXXA 5CXCB 5FQDA 5K19A 4CI1A 3A0FA 3AH8B 2Z2PA 3J81g 4PBZA 2H14A 2P9KC 4Y5RD 4K3JB 3UVLA 4FB1D 4JD2C 4U7AA 5AMSA 4OWRA 5K1CC 3PXTD 5B4WA 3SMRA 2TRCB 3VH0A 3U4YA 5A2Qg 2J57G 2B5LA 2IURA 5H14A 3MMYA 3BWSA 3UVNA 1FWXA 1PEVA 4ZOXA 3JZGA 1TYQC 3CIKB 3OL2B 4CY1A 4NSXA 4L1QD 5HE3B 3K26A 4GQ1A 3SLED 1SQ9A 5IJ8E 4E5ZB 4J81A 4FA5D 2GNQA 2GC4A 2IWFA 5EAMA 2I3SA 3F3GA 4CY5A 5CXBA 1JJUB 5H17A 2Z2OA 3EI2A 3RN0D 3V7DB 5IGQA 4X61B 2YNOA 3BG1A 5EMMB 4E54A 4D0KA 4JT6C 3PSCB 4EWRA 3OKWA 2HKRA 1OLZA 3OKTA 1NEXB 3SWSD 4K3ID 2H3XA 3IIWA 4JSXC 3RN1D 1RI6A 4U1EI 3I7HA 1SQJA 2PM9A 3FM0A 2IUVA 3HFQA 4CC9A 2CE9A 3B7FA 3JRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRO A;  5HQG A;  3P4F A;  3DWL C;  5TF2 A;  1PBY B;  2H68 A;  4BH6 A;  4A0B A;  3IJ0 A;  3AL8 A;  3L4O D;  3AFC A;  5CYK B;  4A08 B;  4LG9 A;  1PGU A;  1GOT B;  2P9I C;  4J78 A;  2XU7 A;  4QQE A;  1OMW B;  3EU7 A;  5HE0 B;  2PM6 B;  4J84 A;  1K32 A;  5CXC A;  2OVP B;  3MZL A;  2OK4 A;  2PBI B;  3OKY A;  4I79 A;  3AL8 B;  3PSL A;  3EI4 A;  1JOF A;  5FKT A;  4ZOV A;  3CFS B;  4JXM A;  3I89 A;  4A09 B;  3ZWL B;  3PXW D;  4GM3 A;  5EML B;  3RLM D;  1TBG A;  3I7O A;  2H6N A;  2CO0 A;  2UZX B;  4ESG A;  1YFQ A;  4ERZ A;  2GC7 A;  3OKY B;  2QC5 A;  3RFH A;  4X60 B;  3EI4 B;  1JMZ B;  4J0W A;  2YBA A;  4JSV C;  2H13 A;  2CN2 A;  3IJC A;  2OK6 A;  5FKS A;  2H9P A;  4O3U B;  5EM2 B;  3OL2 A;  4ERQ A;  2J55 H;  3I7P A;  5GXI A;  3PVU B;  3MZK A;  2XYI A;  4E5Z A;  4GM9 A;  3VA6 A;  3EMH A;  2QXV A;  2BBK H;  2B5M A;  3JB9 L;  4X3E A;  3SBP A;  4CI3 A;  2CE8 A;  5C9Z B;  2PM7 B;  4PNK B;  2XL3 A;  4LG8 A;  5EAP A;  1ERJ A;  2B4E A;  2HYE A;  2AQ5 A;  4O45 A;  2IUQ A;  4ZOZ A;  5IC7 A;  3FRX A;  3NVX A;  2P9N C;  3MKQ A;  3JAM g;  4QRJ A;  3C9C A;  4LGN A;  4AOW A;  1L0Q A;  4XYI A;  3DM0 A;  4PC0 A;  4JT5 C;  4QL1 A;  4J79 A;  3BG0 A;  3F3F A;  3EI3 A;  4GZ8 A;  2YNP A;  4J82 A;  4L3H D;  1MG2 A;  2EBS A;  3N0D A;  3SVW D;  4Z8L A;  4H5I A;  2IAA A;  3DXM C;  2HJB A;  4GMB A;  5FA5 B;  3VGZ A;  1U2V C;  2AH0 A;  3L4M D;  1XIP A;  3OW8 A;  5CYK A;  5HE2 B;  4FAN D;  4A08 A;  1NR0 A;  3W15 A;  1GP2 B;  2H9L A;  3RRM C;  2H6Q A;  3JZH A;  1VYH C;  3EI3 B;  4FA9 D;  4QT8 A;  2G9A A;  4J77 A;  2OIZ A;  2Z2N A;  2G99 A;  5HE1 B;  5FKR A;  3ORV D;  2AGL A;  2AH1 A;  3UVO A;  4O1Q D;  3DXK C;  4O3T B;  1B9Y A;  1MG3 A;  1A0R B;  3V9F A;  2AGY A;  2IUP A;  3SFZ A;  4A09 A;  4A7J A;  4CY2 A;  1N6D A;  3FGB A;  4PSX B;  5C2V B;  3EWE A;  4R7A B;  4CI2 A;  4ZN4 A;  5GMK n;  3SN6 B;  4O9D A;  3NVQ A;  3GRE A;  4GGD A;  3I7L A;  4JSN C;  5IT9 g;  2AGZ A;  3I8C A;  1SHY B;  4J0X A;  4XEI C;  4CZY A;  4GM8 A;  3UVM A;  3V5W B;  5EM2 A;  3RSE C;  5EMK B;  4A2L A;  4N14 A;  4TZ4 A;  5C2W B;  5TEE A;  2IWK A;  3C75 H;  4J8G A;  5HYN B;  4L3G D;  4J86 A;  4KFM B;  3PE7 A;  4A0A B;  1B9X A;  4GGC A;  4A11 A;  4H5J A;  3SHF A;  5GXH A;  4CY3 A;  4Y7R A;  4IMM A;  5SXM A;  1Q47 A;  4PXW A;  1N6F A;  5I5I A;  5JWZ A;  1MDA H;  3KRW B;  5FLX g;  1XKS A;  2I0S A;  4GQB B;  2I3T A;  4L9O A;  4FA4 D;  4A11 B;  3RFG A;  3UKR C;  1GXR A;  5AJA A;  4J73 A;  1N6E A;  2CN3 A;  3SBQ A;  2HXC A;  3ULE C;  3UVK A;  2O9K A;  5EAL A;  2AGW A;  2YNN A;  4BL0 A;  1QNI A;  2H9M A;  3MKS B;  4CZX A;  4D6V A;  2P9P C;  1R5M A;  2I0T A;  4OZU A;  5TEF A;  4J8B A;  3SCY A;  5KDO B;  2MTA H;  2HES X;  3I7N A;  1JMX B;  2W18 A;  1K8K C;  4GGA A;  3AL9 A;  3UR4 A;  1PI6 A;  2YMU A;  4FWW A;  3EI1 A;  5I5M A;  2HJ4 A;  3EG6 A;  5TDH B;  4HDJ A;  4JSP C;  4ES0 A;  3I7K A;  2J56 H;  1P22 A;  3JZN A;  3IJ1 A;  2I0R A;  2OVQ B;  3DSM A;  3IIY A;  4XYH A;  2P9L C;  1XHM A;  3EI1 B;  3PVW B;  2OVR B;  4MK0 B;  2BCJ B;  3C99 A;  5FKQ A;  3N0E A;  5CXB B;  3SJL D;  2OJY A;  5THA A;  2B5N A;  5I5J A;  3EI2 B;  5FXY A;  5IGO A;  1GG2 B;  2H9N A;  2CO0 C;  3C5M A;  3UKU C;  5GSA A;  4E54 B;  4IA9 A;  5EAR A;  3CFV A;  3OTT A;  4X63 B;  4ERY A;  3K27 A;  3IKO A;  2AGX A;  1S4U X;  4GQ2 P;  3I8E A;  4UI9 R;  2Q7Q A;  4G56 B;  3SXT D;  4BUJ C;  2YB8 B;  5H1M A;  4A0A A;  4AEZ A;  2PM9 B;  3I2N A;  3NVN A;  4FA1 D;  2P9S C;  4CI8 A;  2H6K A;  5IJ7 E;  3RMZ D;  3ODT A;  1U4C A;  4A0B B;  4J87 A;  4FHL A;  2HKM A;  5EMJ B;  3E0C A;  3JPX A;  4A2M A;  2H47 A;  4PBY A;  3KRX B;  4FAV D;  3F3P A;  2P9U C;  4YVD A;  4ZOY A;  4CZV A;  3PXS D;  3GFC A;  2UZY B;  5AFU 3;  2XL2 A;  4PSW B;  3SBR A;  3J80 g;  2CNX A;  3MXX A;  5CXC B;  5FQD A;  5K19 A;  4CI1 A;  3A0F A;  3AH8 B;  2Z2P A;  3J81 g;  4PBZ A;  2H14 A;  2P9K C;  4Y5R D;  4K3J B;  3UVL A;  4FB1 D;  4JD2 C;  4U7A A;  5AMS A;  4OWR A;  5K1C C;  3PXT D;  5B4W A;  3SMR A;  2TRC B;  3VH0 A;  3U4Y A;  5A2Q g;  2J57 G;  2B5L A;  2IUR A;  5H14 A;  3MMY A;  3BWS A;  3UVN A;  1FWX A;  1PEV A;  4ZOX A;  3JZG A;  1TYQ C;  3CIK B;  3OL2 B;  4CY1 A;  4NSX A;  4L1Q D;  5HE3 B;  3K26 A;  4GQ1 A;  3SLE D;  1SQ9 A;  5IJ8 E;  4E5Z B;  4J81 A;  4FA5 D;  2GNQ A;  2GC4 A;  2IWF A;  5EAM A;  2I3S A;  3F3G A;  4CY5 A;  5CXB A;  1JJU B;  5H17 A;  2Z2O A;  3EI2 A;  3RN0 D;  3V7D B;  5IGQ A;  4X61 B;  2YNO A;  3BG1 A;  5EMM B;  4E54 A;  4D0K A;  4JT6 C;  3PSC B;  4EWR A;  3OKW A;  2HKR A;  1OLZ A;  3OKT A;  1NEX B;  3SWS D;  4K3I D;  2H3X A;  3IIW A;  4JSX C;  3RN1 D;  1RI6 A;  4U1E I;  3I7H A;  1SQJ A;  2PM9 A;  3FM0 A;  2IUV A;  3HFQ A;  4CC9 A;  2CE9 A;  3B7F A;  3JRP A; 
#chains in the Genus database with same CATH topology
 3JRO A;  3ZE1 A;  5HQG A;  3V4P A;  4IRZ A;  3P4F A;  3DWL C;  3EQ7 A;  1QFM A;  5TF2 A;  1VE6 A;  1PBY B;  2H68 A;  4BH6 A;  4A0B A;  3IJ0 A;  3AL8 A;  1H2W A;  3L4O D;  2VDP A;  3AFC A;  5CYK B;  3ZE2 A;  4A08 B;  4LG9 A;  1PGU A;  1GOT B;  2P9I C;  4J78 A;  2EIE A;  2XU7 A;  1UOO A;  4DNU A;  4QQE A;  1OMW B;  3EU7 A;  4BP9 A;  5HE0 B;  4NEN A;  2PM6 B;  4J84 A;  1K32 A;  5CXC A;  2OVP B;  3MZL A;  4WK4 A;  2OK4 A;  2PBI B;  3OKY A;  4I79 A;  3AL8 B;  4WK0 A;  3PSL A;  3EI4 A;  1A12 A;  1JOF A;  5FKT A;  4Z7Q A;  4ZOV A;  3CFS B;  3NIG A;  4JXM A;  4G1M A;  3I89 A;  5C86 A;  4A09 B;  3ZWL B;  3PXW D;  2HU7 A;  4GM3 A;  5EML B;  2VZ1 A;  3RLM D;  1TBG A;  3I7O A;  2H6N A;  2CO0 A;  2UZX B;  4D9S A;  4ESG A;  1YFQ A;  4ERZ A;  2GC7 A;  3OKY B;  2QC5 A;  3RFH A;  4X60 B;  3EI4 B;  1JMZ B;  4J0W A;  2YBA A;  4JSV C;  2H13 A;  2CN2 A;  3IJC A;  2OK6 A;  5FKS A;  2H9P A;  4UM8 A;  4O3U B;  5EM2 B;  3OL2 A;  4ERQ A;  2J55 H;  3I7P A;  5GXI A;  4DNW A;  3PVU B;  2VDL A;  3MZK A;  3MUO A;  2XYI A;  4E5Z A;  3NIF A;  1UOP A;  4GM9 A;  1JV2 A;  3VA6 A;  2JKX A;  3EMH A;  2QXV A;  2QZP A;  2BBK H;  2B5M A;  3JB9 L;  4X3E A;  3SBP A;  4CI3 A;  2CE8 A;  5C9Z B;  2PM7 B;  4PNK B;  2XL3 A;  4LG8 A;  2WQ8 A;  5EAP A;  4JHN A;  1ERJ A;  2B4E A;  4NBM A;  4DNV A;  2HYE A;  2AQ5 A;  4O45 A;  2IUQ A;  4ZOZ A;  2VDK A;  5IC7 A;  3FRX A;  3NVX A;  2P9N C;  3MKQ A;  4RE5 A;  3OF7 A;  3JAM g;  4QRJ A;  1T2X A;  3C9C A;  4LGN A;  3IUN A;  4Z7O A;  4O2W A;  4AOW A;  1L0Q A;  4XYI A;  3DM0 A;  4PC0 A;  4JT5 C;  4QL1 A;  4J79 A;  3BG0 A;  3F3F A;  3EI3 A;  4GZ8 A;  2YNP A;  4J82 A;  1O6F A;  4L3H D;  1MG2 A;  2EBS A;  3N0D A;  2XDW A;  4BP8 A;  3SVW D;  3FCU A;  1O6G A;  4Z8L A;  4QAM A;  4H5I A;  2IAA A;  3DXM C;  2HJB A;  4GMB A;  5FA5 B;  2EID A;  3VGZ A;  3ZDY A;  1U2V C;  3IJE A;  2AH0 A;  3L4M D;  1XIP A;  2VDM A;  3OW8 A;  5CYK A;  5HE2 B;  4FAN D;  4A08 A;  1NR0 A;  3W15 A;  1GP2 B;  2H9L A;  3RRM C;  3MUN A;  3ZDZ A;  2H6Q A;  1M1X A;  3JZH A;  2VC2 A;  1VYH C;  3EI3 B;  4FA9 D;  4QT8 A;  5M5U A;  2G9A A;  4J77 A;  2OIZ A;  2Z2N A;  4G1E A;  2G99 A;  3GC3 B;  3IUL A;  5HE1 B;  5FKR A;  3ORV D;  2AGL A;  2AH1 A;  2XZG A;  3UVO A;  2VDR A;  4O1Q D;  3DXK C;  4Z7N A;  4O3T B;  3T3M A;  1B9Y A;  1MG3 A;  1A0R B;  5E6S A;  3V9F A;  2AGY A;  3IUM A;  2IUP A;  3SFZ A;  4A09 A;  4A7J A;  1E5T A;  4CY2 A;  1N6D A;  3FGB A;  4PSX B;  5C2V B;  3EWE A;  4R7A B;  4CI2 A;  4ZN4 A;  5GMK n;  3SN6 B;  2VDO A;  4O9D A;  3NVQ A;  3GRE A;  4GGD A;  3I7L A;  4JSN C;  1GOF A;  2AGZ A;  3I8C A;  5IT9 g;  1SHY B;  3K6S A;  4J0X A;  4XEI C;  5M5R A;  1BPO A;  4CZY A;  4GM8 A;  1TYE A;  3UVM A;  3V5W B;  5EM2 A;  3RSE C;  5EMK B;  4A2L A;  4N14 A;  4TZ4 A;  5C2W B;  5TEE A;  4AX4 A;  2IWK A;  3C75 H;  4J8G A;  5HYN B;  4L3G D;  3IUJ A;  3QHY B;  1YR2 A;  4J86 A;  4KFM B;  3PE7 A;  3V4V A;  1B9X A;  4GGC A;  4A11 A;  4A0A B;  4H5J A;  3SHF A;  3O4I A;  5GXH A;  4CY3 A;  4Y7R A;  4IMM A;  5SXM A;  1Q47 A;  4WJK A;  4PXW A;  1H2Y A;  1N6F A;  2QR5 A;  5I5I A;  5JWZ A;  1MDA H;  3GD1 I;  2EIC A;  3KRW B;  5FLX g;  1XKS A;  2I0S A;  4GQB B;  2I3T A;  1E8M A;  4L9O A;  5M61 A;  4FA4 D;  4A11 B;  3RFG A;  3UKR C;  1GXR A;  4G55 A;  5AJA A;  1I2M B;  2HU8 A;  4J73 A;  1N6E A;  5C92 A;  5M5T A;  2CN3 A;  3SBQ A;  2XE4 A;  2HXC A;  3ULE C;  1VZ2 A;  1QFS A;  3UVK A;  2O9K A;  5EAL A;  1UTC A;  2AGW A;  2YNN A;  4BL0 A;  1QNI A;  2H9M A;  3MKS B;  4CZX A;  4D6V A;  2HU5 A;  3FCS A;  2P9P C;  1R5M A;  2I0T A;  4OZU A;  4MMY A;  5TEF A;  4J8B A;  3SCY A;  5KDO B;  2MTA H;  2HES X;  3I7N A;  4MMZ A;  1JMX B;  2W18 A;  1K8K C;  4GGA A;  3AL9 A;  3UR4 A;  1H2X A;  1PI6 A;  2YMU A;  4FWW A;  3EI1 A;  4O02 A;  1K3I A;  3DDU A;  5I5M A;  3NID A;  2HJ4 A;  3EG6 A;  5TDH B;  4HDJ A;  3ZE0 A;  4JSP C;  3K71 A;  4ES0 A;  3I7K A;  2J56 H;  1P22 A;  3JZN A;  3IJ1 A;  4NC4 A;  2I0R A;  2OVQ B;  3DSM A;  3IIY A;  1C9I A;  4XYH A;  2P9L C;  3MVD K;  3IUR A;  1XHM A;  3EI1 B;  3PVW B;  2OVR B;  4MK0 B;  2BCJ B;  3C99 A;  5FKQ A;  3N0E A;  5CXB B;  5FFG A;  2OJY A;  3SJL D;  4JHP C;  5THA A;  2B5N A;  5I5J A;  4MMX A;  4AN0 A;  3EI2 B;  5FXY A;  5IGO A;  3VI3 A;  1GG2 B;  2H9N A;  2CO0 C;  3C5M A;  3UKU C;  5GSA A;  3ZDX A;  4E54 B;  4IA9 A;  5EAR A;  3CFV A;  3OTT A;  4X63 B;  4ERY A;  5FFO A;  3K27 A;  3IKO A;  1VE7 A;  2AGX A;  1S4U X;  4GQ2 P;  3I8E A;  5M5S A;  1H2Z A;  4UI9 R;  4BCB A;  2Q7Q A;  4G56 B;  3SXT D;  4BUJ C;  2YB8 B;  5H1M A;  4A0A A;  3EQ9 A;  4AEZ A;  2PM9 B;  3I2N A;  3NVN A;  5HDB A;  4FA1 D;  1VZ3 A;  2BKL A;  2P9S C;  4CI8 A;  2H6K A;  5IJ7 E;  3RMZ D;  3ODT A;  3K72 A;  1U4C A;  4A0B B;  4J87 A;  4FHL A;  2HKM A;  5EMJ B;  3E0C A;  3JPX A;  4A2M A;  3EQ8 A;  2H47 A;  4UM9 A;  4PBY A;  3KRX B;  3O4H A;  3T3P A;  4FAV D;  3F3P A;  2P9U C;  4YVD A;  4ZOY A;  4CZV A;  3PXS D;  3GFC A;  2UZY B;  5AFU 3;  2XL2 A;  4BCC A;  4PSW B;  3SBR A;  4NAA A;  3J80 g;  2CNX A;  3MXX A;  3VI4 A;  5CXC B;  5FQD A;  5K19 A;  1GOH A;  4CI1 A;  3A0F A;  3AH8 B;  2Z2P A;  3J81 g;  3IVM A;  4PBZ A;  4WK2 A;  2H14 A;  2P9K C;  4Y5R D;  4K3J B;  3UVL A;  4FB1 D;  1GOG A;  4JD2 C;  4U7A A;  3IUQ A;  5AMS A;  4OWR A;  5K1C C;  3PXT D;  5B4W A;  3SMR A;  2TRC B;  3VH0 A;  3U4Y A;  1E8N A;  5E6R A;  5A2Q g;  2J57 G;  2B5L A;  2IUR A;  5H14 A;  3MMY A;  3BWS A;  3O4J A;  3UVN A;  2VDN A;  1FWX A;  1PEV A;  4ZOX A;  3JZG A;  1TYQ C;  3CIK B;  3OL2 B;  2EIB A;  5E6U A;  4CY1 A;  1JTD B;  4NSX A;  1U8C A;  4L1Q D;  5HE3 B;  4AMZ A;  3K26 A;  1UOQ A;  2VZ3 A;  4GQ1 A;  1SQ9 A;  3SLE D;  4AMY A;  5IJ8 E;  4E5Z B;  1L5G A;  4J81 A;  4FA5 D;  2GNQ A;  2GC4 A;  2IWF A;  5EAM A;  5M5V A;  2I3S A;  3F3G A;  3KCI A;  4CY5 A;  5CXB A;  1JJU B;  4AN1 A;  5H17 A;  2Z2O A;  3EI2 A;  3RN0 D;  3V7D B;  5IGQ A;  4X61 B;  2YNO A;  3BG1 A;  5EMM B;  4E54 A;  4D0K A;  4JT6 C;  4BCD A;  3QI0 A;  1C9L A;  3PSC B;  4EWR A;  3OKW A;  2HKR A;  1OLZ A;  2VDQ A;  3OKT A;  1NEX B;  3SWS D;  3O4G A;  4K3I D;  2H3X A;  3IIW A;  4JSX C;  3RN1 D;  1RI6 A;  4U1E I;  3I7H A;  1SQJ A;  2PM9 A;  3FM0 A;  2IUV A;  3HFQ A;  4CC9 A;  2CE9 A;  4L1M A;  3B7F A;  4RE6 A;  3JRP A; 
#chains in the Genus database with same CATH homology
 3JRO A;  5HQG A;  3P4F A;  3DWL C;  5TF2 A;  1PBY B;  2H68 A;  4BH6 A;  4A0B A;  3IJ0 A;  3AL8 A;  3L4O D;  3AFC A;  5CYK B;  4A08 B;  4LG9 A;  1PGU A;  1GOT B;  2P9I C;  4J78 A;  2XU7 A;  4QQE A;  1OMW B;  3EU7 A;  5HE0 B;  2PM6 B;  4J84 A;  1K32 A;  5CXC A;  2OVP B;  3MZL A;  2OK4 A;  2PBI B;  3OKY A;  4I79 A;  3AL8 B;  3PSL A;  3EI4 A;  1JOF A;  5FKT A;  4ZOV A;  3CFS B;  4JXM A;  3I89 A;  4A09 B;  3ZWL B;  3PXW D;  4GM3 A;  5EML B;  3RLM D;  1TBG A;  3I7O A;  2H6N A;  2CO0 A;  2UZX B;  4ESG A;  1YFQ A;  4ERZ A;  2GC7 A;  3OKY B;  2QC5 A;  3RFH A;  4X60 B;  3EI4 B;  1JMZ B;  4J0W A;  2YBA A;  4JSV C;  2H13 A;  2CN2 A;  3IJC A;  2OK6 A;  5FKS A;  2H9P A;  4O3U B;  5EM2 B;  3OL2 A;  4ERQ A;  2J55 H;  3I7P A;  5GXI A;  3PVU B;  3MZK A;  2XYI A;  4E5Z A;  4GM9 A;  3VA6 A;  3EMH A;  2QXV A;  2BBK H;  2B5M A;  3JB9 L;  4X3E A;  3SBP A;  4CI3 A;  2CE8 A;  5C9Z B;  2PM7 B;  4PNK B;  2XL3 A;  4LG8 A;  5EAP A;  1ERJ A;  2B4E A;  2HYE A;  2AQ5 A;  4O45 A;  2IUQ A;  4ZOZ A;  5IC7 A;  3FRX A;  3NVX A;  2P9N C;  3MKQ A;  3JAM g;  4QRJ A;  3C9C A;  4LGN A;  4AOW A;  1L0Q A;  4XYI A;  3DM0 A;  4PC0 A;  4JT5 C;  4QL1 A;  4J79 A;  3BG0 A;  3F3F A;  3EI3 A;  4GZ8 A;  2YNP A;  4J82 A;  4L3H D;  1MG2 A;  2EBS A;  3N0D A;  3SVW D;  4Z8L A;  4H5I A;  2IAA A;  3DXM C;  2HJB A;  4GMB A;  5FA5 B;  3VGZ A;  1U2V C;  2AH0 A;  3L4M D;  1XIP A;  3OW8 A;  5CYK A;  5HE2 B;  4FAN D;  4A08 A;  1NR0 A;  3W15 A;  1GP2 B;  2H9L A;  3RRM C;  2H6Q A;  3JZH A;  1VYH C;  3EI3 B;  4FA9 D;  4QT8 A;  2G9A A;  4J77 A;  2OIZ A;  2Z2N A;  2G99 A;  5HE1 B;  5FKR A;  3ORV D;  2AGL A;  2AH1 A;  3UVO A;  4O1Q D;  3DXK C;  4O3T B;  1B9Y A;  1MG3 A;  1A0R B;  3V9F A;  2AGY A;  2IUP A;  3SFZ A;  4A09 A;  4A7J A;  4CY2 A;  1N6D A;  3FGB A;  4PSX B;  5C2V B;  3EWE A;  4R7A B;  4CI2 A;  4ZN4 A;  5GMK n;  3SN6 B;  4O9D A;  3NVQ A;  3GRE A;  4GGD A;  3I7L A;  4JSN C;  5IT9 g;  2AGZ A;  3I8C A;  1SHY B;  4J0X A;  4XEI C;  4CZY A;  4GM8 A;  3UVM A;  3V5W B;  5EM2 A;  3RSE C;  5EMK B;  4A2L A;  4N14 A;  4TZ4 A;  5C2W B;  5TEE A;  2IWK A;  3C75 H;  4J8G A;  5HYN B;  4L3G D;  4J86 A;  4KFM B;  3PE7 A;  4A0A B;  1B9X A;  4GGC A;  4A11 A;  4H5J A;  3SHF A;  5GXH A;  4CY3 A;  4Y7R A;  4IMM A;  5SXM A;  1Q47 A;  4PXW A;  1N6F A;  5I5I A;  5JWZ A;  1MDA H;  3KRW B;  5FLX g;  1XKS A;  2I0S A;  4GQB B;  2I3T A;  4L9O A;  4FA4 D;  4A11 B;  3RFG A;  3UKR C;  1GXR A;  5AJA A;  4J73 A;  1N6E A;  2CN3 A;  3SBQ A;  2HXC A;  3ULE C;  3UVK A;  2O9K A;  5EAL A;  2AGW A;  2YNN A;  4BL0 A;  1QNI A;  2H9M A;  3MKS B;  4CZX A;  4D6V A;  2P9P C;  1R5M A;  2I0T A;  4OZU A;  5TEF A;  4J8B A;  3SCY A;  5KDO B;  2MTA H;  2HES X;  3I7N A;  1JMX B;  2W18 A;  1K8K C;  4GGA A;  3AL9 A;  3UR4 A;  1PI6 A;  2YMU A;  4FWW A;  3EI1 A;  5I5M A;  2HJ4 A;  3EG6 A;  5TDH B;  4HDJ A;  4JSP C;  4ES0 A;  3I7K A;  2J56 H;  1P22 A;  3JZN A;  3IJ1 A;  2I0R A;  2OVQ B;  3DSM A;  3IIY A;  4XYH A;  2P9L C;  1XHM A;  3EI1 B;  3PVW B;  2OVR B;  4MK0 B;  2BCJ B;  3C99 A;  5FKQ A;  3N0E A;  5CXB B;  3SJL D;  2OJY A;  5THA A;  2B5N A;  5I5J A;  3EI2 B;  5FXY A;  5IGO A;  1GG2 B;  2H9N A;  2CO0 C;  3C5M A;  3UKU C;  5GSA A;  4E54 B;  4IA9 A;  5EAR A;  3CFV A;  3OTT A;  4X63 B;  4ERY A;  3K27 A;  3IKO A;  2AGX A;  1S4U X;  4GQ2 P;  3I8E A;  4UI9 R;  2Q7Q A;  4G56 B;  3SXT D;  4BUJ C;  2YB8 B;  5H1M A;  4A0A A;  4AEZ A;  2PM9 B;  3I2N A;  3NVN A;  4FA1 D;  2P9S C;  4CI8 A;  2H6K A;  5IJ7 E;  3RMZ D;  3ODT A;  1U4C A;  4A0B B;  4J87 A;  4FHL A;  2HKM A;  5EMJ B;  3E0C A;  3JPX A;  4A2M A;  2H47 A;  4PBY A;  3KRX B;  4FAV D;  3F3P A;  2P9U C;  4YVD A;  4ZOY A;  4CZV A;  3PXS D;  3GFC A;  2UZY B;  5AFU 3;  2XL2 A;  4PSW B;  3SBR A;  3J80 g;  2CNX A;  3MXX A;  5CXC B;  5FQD A;  5K19 A;  4CI1 A;  3A0F A;  3AH8 B;  2Z2P A;  3J81 g;  4PBZ A;  2H14 A;  2P9K C;  4Y5R D;  4K3J B;  3UVL A;  4FB1 D;  4JD2 C;  4U7A A;  5AMS A;  4OWR A;  5K1C C;  3PXT D;  5B4W A;  3SMR A;  2TRC B;  3VH0 A;  3U4Y A;  5A2Q g;  2J57 G;  2B5L A;  2IUR A;  5H14 A;  3MMY A;  3BWS A;  3UVN A;  1FWX A;  1PEV A;  4ZOX A;  3JZG A;  1TYQ C;  3CIK B;  3OL2 B;  4CY1 A;  4NSX A;  4L1Q D;  5HE3 B;  3K26 A;  4GQ1 A;  3SLE D;  1SQ9 A;  5IJ8 E;  4E5Z B;  4J81 A;  4FA5 D;  2GNQ A;  2GC4 A;  2IWF A;  5EAM A;  2I3S A;  3F3G A;  4CY5 A;  5CXB A;  1JJU B;  5H17 A;  2Z2O A;  3EI2 A;  3RN0 D;  3V7D B;  5IGQ A;  4X61 B;  2YNO A;  3BG1 A;  5EMM B;  4E54 A;  4D0K A;  4JT6 C;  3PSC B;  4EWR A;  3OKW A;  2HKR A;  1OLZ A;  3OKT A;  1NEX B;  3SWS D;  4K3I D;  2H3X A;  3IIW A;  4JSX C;  3RN1 D;  1RI6 A;  4U1E I;  3I7H A;  1SQJ A;  2PM9 A;  3FM0 A;  2IUV A;  3HFQ A;  4CC9 A;  2CE9 A;  3B7F A;  3JRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...