4Y5RD

Crystal structure of a t67a maug/pre-methylamine dehydrogenase complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title A T67A mutation in the proximal pocket of the high-spin heme of MauG stabilizes formation of a mixed-valent Fe(II)/Fe(III) state and enhances charge resonance stabilization of the bis-Fe(IV) state.
pubmed doi rcsb
source organism Paracoccus denitrificans (strain pd 1222)
molecule tags Oxidoreductase
total genus 89
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4y5rD00
5CXBB 4GGAA 2IURA 1K32A 1OMWB 4K3JB 3AL8A 4J8GA 5H17A 3I8CA 4A08A 3RN1D 2I3TA 1MG3A 3ORVD 2PM6B 4A0BA 1JJUB 2UZXB 5C2WB 3OTTA 1FWXA 3SMRA 2PM9A 4CY3A 5FLXg 4QL1A 3BWSA 3EWEA 2B5LA 2H9LA 3RSEC 4QQEA 4A11A 2Q7QA 5EALA 4U7AA 3I8EA 3RLMD 3L4OD 1GP2B 1R5MA 3HFQA 3RFHA 2I0RA 4ZOZA 2CN3A 4FAVD 3IKOA 2I0SA 4FHLA 2YB8B 5EM2B 3JAMg 3EI2A 4PXWA 5EAPA 4E54B 5EARA 2O9KA 1B9XA 3I89A 3EMHA 4L1QD 2J57G 2H9PA 1VYHC 2G9AA 3SWSD 3JPXA 1SQJA 4ZOXA 4FA9D 4BL0A 2AGYA 2OVPB 3OKYB 5AJAA 5GXIA 3UKUC 4ERQA 3DXKC 2XL3A 4ERZA 2QXVA 4GZ8A 4GGDA 3EI4A 1PEVA 3VGZA 3DSMA 3UVLA 4X63B 4FB1D 4A0AB 4GQBB 3SCYA 4D0KA 3J81g 2HESX 3JZNA 4CZYA 5KDOB 5H1MA 2YBAA 4CI8A 2Z2NA 1B9YA 4FA5D 5H14A 5FKTA 2B5MA 2MTAH 4R7AB 5GMKn 2Z2OA 2H6NA 2J56H 4GM3A 5GSAA 1U4CA 2AGWA 3JZGA 4E5ZB 2GNQA 4MK0B 5FKRA 4GQ1A 3I7OA 4PC0A 2GC4A 4ZN4A 1K8KC 2GC7A 5C9ZB 5AFU3 4IA9A 2AGZA 4HDJA 3B7FA 1RI6A 2HXCA 3JROA 4Y5RD 3UVKA 5EMKB 3AL8B 3GREA 4XEIC 4J0XA 2H9NA 3RN0D 3JB9L 2IUQA 4A0BB 4J86A 4PBYA 3EI1A 4XYHA 3SN6B 2HYEA 1QNIA 3V5WB 4J0WA 2YNNA 5IC7A 5TF2A 1NR0A 4O3TB 2PM9B 4L3HD 4JSXC 3V9FA 1N6DA 3NVQA 5A2Qg 2P9SC 3BG0A 3MZLA 4A11B 4L9OA 3OKWA 4FWWA 3MKQA 4X61B 2AH0A 3IIWA 4J87A 3EI3A 3RRMC 4J73A 1XKSA 4CI2A 2YNPA 1GG2B 3UR4A 4QRJA 3I7PA 1NEXB 4CY1A 2XL2A 4U1EI 4ZOYA 4YVDA 5IGOA 2B4EA 5CYKA 4A09A 1TYQC 4XYIA 2CE9A 2IWFA 3FGBA 3EU7A 3PSLA 3L4MD 3U4YA 3OL2A 5FA5B 3EI2B 3JZHA 5IJ8E 4ES0A 1GXRA 4CZXA 4OZUA 4FA1D 2H47A 4ESGA 1S4UX 2CO0A 4J81A 4TZ4A 3FRXA 2G99A 4H5IA 3VA6A 2IWKA 5HQGA 3J80g 4JXMA 1GOTB 2AH1A 3GFCA 4J84A 2IAAA 2H68A 4L3GD 4A2MA 4J82A 4BUJC 4JD2C 2W18A 3SBQA 2TRCB 3F3PA 1JMXB 3E0CA 5I5JA 3ODTA 1ERJA 3C99A 2PBIB 4Y7RA 4BH6A 5I5MA 3PE7A 1PGUA 2I0TA 3RFGA 4CY5A 4O9DA 4G56B 3NVNA 3EI4B 5JWZA 5IGQA 2P9KC 4AOWA 3UVMA 3C75H 2P9IC 4JSVC 3I7HA 4A7JA 2YNOA 3CFVA 2IUVA 2IUPA 2B5NA 2CE8A 4FAND 5CXCA 3IIYA 5FKQA 2H9MA 4JT5C 3I7KA 1SHYB 2HKRA 4I79A 2CN2A 2H6KA 2Z2PA 5IT9g 4JSNC 2YMUA 5AMSA 3MXXA 3DXMC 3AH8B 3PXTD 2OK6A 2H3XA 3N0DA 3I7LA 4GM8A 4J78A 3UVOA 4CI3A 3SLED 5HE1B 5C2VB 2H6QA 4A08B 1A0RB 5CXBA 5SXMA 3IJ1A 2H13A 3DWLC 5EMJB 3ZWLB 4FA4D 1PI6A 2OVRB 3MZKA 2J55H 3FM0A 5HE2B 4JSPC 3EI1B 3MMYA 3CFSB 4D6VA 1Q47A 2CO0C 3JRPA 3P4FA 4O45A 1JOFA 3C9CA 3PVWB 4PSWB 4AEZA 3SBRA 2XYIA 2AGXA 1TBGA 4GGCA 3KRXB 3SBPA 2QC5A 5I5IA 3OW8A 3I2NA 4JT6C 3EI3B 5FQDA 3A0FA 4PNKB 5TEEA 3NVXA 3CIKB 3OKTA 4ZOVA 2CNXA 4A2LA 3VH0A 2P9PC 4LG8A 3PXWD 1JMZB 5FKSA 3AFCA 5K1CC 4J8BA 5CYKB 4A09B 5HE3B 5B4WA 3RMZD 4CZVA 3OL2B 1P22A 3SJLD 1XIPA 5TDHB 3SXTD 5EM2A 4J77A 5EAMA 2HJ4A 3W15A 4E54A 4CC9A 5IJ7E 3F3GA 4PBZA 3K27A 4X60B 3SHFA 3SFZA 2I3SA 2OIZA 2BCJB 5FXYA 4GM9A 3KRWB 4CY2A 2PM7B 2P9LC 1N6FA 2H14A 2HJBA 2P9UC 1N6EA 3SVWD 3PVUB 5TEFA 3OKYA 2AGLA 1U2VC 5K19A 3EG6A 3UVNA 2XU7A 5HYNB 4GMBA 4UI9R 4O3UB 4LG9A 4KFMB 5THAA 4QT8A 2AQ5A 4ERYA 4LGNA 1MG2A 1OLZA 2OK4A 5EMLB 2P9NC 3ULEC 4IMMA 4O1QD 2BBKH 4A0AA 4K3ID 4H5JA 5GXHA 2EBSA 3I7NA 1YFQA 4GQ2P 4N14A 5CXCB 1SQ9A 5EMMB 3N0EA 2OJYA 4CI1A 3BG1A 3UKRC 4OWRA 4EWRA 3PXSD 1XHMA 2UZYB 4J79A 4E5ZA 3C5MA 3K26A 4X3EA 1L0QA 4NSXA 3DM0A 5HE0B 4Z8LA 3V7DB 3IJ0A 3IJCA 3AL9A 3MKSB 3F3FA 2HKMA 4PSXB 2OVQB 3PSCB 1PBYB 1MDAH
chains in the Genus database with same CATH superfamily
5CXBB 4GGAA 2IURA 1K32A 1OMWB 4K3JB 3AL8A 4J8GA 5H17A 3I8CA 4A08A 3RN1D 4AN0A 4JHPC 2I3TA 1MG3A 3ORVD 2XE4A 2PM6B 4A0BA 1JJUB 2UZXB 5C2WB 1C9LA 3OTTA 4G55A 2VZ3A 1FWXA 3SMRA 2PM9A 4CY3A 5FLXg 1L5GA 4QL1A 3BWSA 3EWEA 2B5LA 2H9LA 3RSEC 4BCBA 4QQEA 4A11A 3MUNA 2Q7QA 3IUNA 3ZDZA 4DNVA 4UM8A 5EALA 3ZE2A 4U7AA 3GC3B 3I8EA 3O4GA 3QHYB 3RLMD 3L4OD 1GP2B 1R5MA 3HFQA 1UOPA 4DNUA 4BCCA 4UM9A 3RFHA 2I0RA 4ZOZA 2CN3A 3MUOA 3NIFA 4FAVD 4AMZA 3ZE0A 3QI0A 3IKOA 2I0SA 3ZDXA 4FHLA 2VDPA 2YB8B 5EM2B 3JAMg 3EI2A 4PXWA 5EAPA 4E54B 3NIDA 1C9IA 1TYEA 5EARA 4JHNA 2O9KA 1B9XA 3I89A 3EMHA 4L1QD 3O4JA 2J57G 4G1MA 2H9PA 2VZ1A 4AN1A 1VYHC 2G9AA 3SWSD 3JPXA 1SQJA 4RE5A 4ZOXA 4FA9D 4BL0A 2WQ8A 2AGYA 2OVPB 3K6SA 3OKYB 5M5UA 5AJAA 5GXIA 3UKUC 3IUJA 4ERQA 3EQ7A 3DXKC 2XL3A 3IJEA 4ERZA 2QXVA 4GZ8A 4GGDA 3EI4A 1O6FA 4NC4A 1PEVA 3VGZA 3DSMA 3UVLA 3ZE1A 4X63B 4QAMA 4FB1D 4A0AB 4GQBB 1GOGA 3SCYA 4Z7QA 4D0KA 3J81g 2HESX 3JZNA 4CZYA 5KDOB 2XDWA 5H1MA 2YBAA 4CI8A 2Z2NA 1B9YA 4FA5D 5H14A 5FKTA 2B5MA 2MTAH 4R7AB 5GMKn 2Z2OA 2H6NA 2J56H 4GM3A 5GSAA 1U4CA 2AGWA 3JZGA 4E5ZB 2GNQA 4MK0B 5FKRA 4GQ1A 4NENA 3I7OA 4PC0A 2GC4A 4ZN4A 1K8KC 5M61A 2GC7A 4MMZA 5C9ZB 4BCDA 5AFU3 4IA9A 4O02A 2AGZA 4DNWA 4HDJA 3B7FA 5C86A 1RI6A 1E8NA 2HXCA 3JROA 4Y5RD 3UVKA 5EMKB 3AL8B 3GREA 4XEIC 4J0XA 1VE6A 1YR2A 2H9NA 3RN0D 3JB9L 1QFSA 2IUQA 4A0BB 3IULA 4J86A 4D9SA 4PBYA 3EI1A 4XYHA 3SN6B 2HYEA 1QNIA 3V5WB 2VDNA 4J0WA 1H2YA 2YNNA 5IC7A 5TF2A 1NR0A 4O3TB 2PM9B 4L3HD 4JSXC 3V9FA 3OF7A 1N6DA 4MMXA 3NVQA 5A2Qg 2P9SC 3BG0A 3MZLA 4A11B 4L9OA 3OKWA 4FWWA 3MKQA 3VI4A 4X61B 2AH0A 3IIWA 4J87A 3EI3A 3RRMC 4J73A 1XKSA 4CI2A 2YNPA 1GG2B 2VDRA 2VDKA 3IUQA 3UR4A 5HDBA 4QRJA 3I7PA 1NEXB 5M5RA 4CY1A 4RE6A 1K3IA 2XL2A 4U1EI 4ZOYA 4YVDA 5IGOA 2B4EA 5CYKA 5M5VA 4A09A 1TYQC 4XYIA 2CE9A 2IWFA 3FGBA 3EU7A 5E6SA 3PSLA 3L4MD 3U4YA 4L1MA 4O2WA 3OL2A 5FA5B 3O4IA 3JZHA 5IJ8E 3EI2B 2VDLA 1U8CA 1GXRA 4CZXA 4OZUA 4ES0A 4FA1D 3FCSA 2H47A 4ESGA 1S4UX 5FFGA 4BP8A 2CO0A 4J81A 4TZ4A 3FRXA 2G99A 4H5IA 3VA6A 2IWKA 5HQGA 3J80g 4JXMA 2AH1A 1GOTB 3GFCA 4J84A 2IAAA 2H68A 4L3GD 4A2MA 4J82A 4BUJC 4WK0A 4JD2C 1A12A 2W18A 3SBQA 2TRCB 3F3PA 1JMXB 3E0CA 5I5JA 1H2ZA 3ODTA 1ERJA 3C99A 2PBIB 4Y7RA 4BH6A 3KCIA 5I5MA 3PE7A 1PGUA 2I0TA 3RFGA 3MVDK 4CY5A 1T2XA 4O9DA 4G56B 3NVNA 3EI4B 1QFMA 5JWZA 5IGQA 2P9KC 4AOWA 3UVMA 3C75H 2P9IC 4JSVC 3I7HA 2QR5A 1GOFA 2VDOA 4A7JA 2YNOA 3CFVA 2IUVA 2IUPA 2B5NA 2CE8A 2EIDA 4FAND 5CXCA 3V4PA 1UOOA 3IIYA 5FKQA 2H9MA 4JT5C 3I7KA 1SHYB 2HKRA 3VI3A 5C92A 4I79A 2CN2A 1UOQA 2H6KA 2Z2PA 3FCUA 5IT9g 4JSNC 2YMUA 5AMSA 3MXXA 3DXMC 3AH8B 3PXTD 5M5TA 3DDUA 2XZGA 1M1XA 2OK6A 2H3XA 3N0DA 3I7LA 1BPOA 4GM8A 4J78A 3UVOA 4CI3A 3SLED 5HE1B 5C2VB 2H6QA 4A08B 1A0RB 4Z7OA 4NBMA 5CXBA 5SXMA 1O6GA 3IJ1A 2H13A 2JKXA 5E6UA 3DWLC 5EMJB 3ZWLB 4FA4D 2EIBA 1PI6A 2OVRB 3GD1I 3MZKA 2J55H 3FM0A 5HE2B 4JSPC 1UTCA 3EI1B 3MMYA 3CFSB 4D6VA 3ZDYA 1Q47A 3K72A 2CO0C 3JRPA 3P4FA 4O45A 4MMYA 1JOFA 3C9CA 3PVWB 4PSWB 4AEZA 3SBRA 2XYIA 2AGXA 4NAAA 1TBGA 1JTDB 4GGCA 3KRXB 3SBPA 2QC5A 5I5IA 3OW8A 3I2NA 4JT6C 3EI3B 3K71A 5FQDA 3A0FA 4PNKB 5TEEA 3NVXA 3CIKB 2HU5A 3OKTA 4ZOVA 2CNXA 4A2LA 3VH0A 2P9PC 4G1EA 4LG8A 5FFOA 3PXWD 1JMZB 5FKSA 3AFCA 5K1CC 1H2XA 3IURA 4J8BA 5CYKB 4A09B 5HE3B 5B4WA 3RMZD 4CZVA 3OL2B 1P22A 3SJLD 1XIPA 5TDHB 3SXTD 5EM2A 5E6RA 4J77A 3IUMA 5EAMA 2HJ4A 3W15A 4E54A 4CC9A 5IJ7E 1H2WA 3O4HA 3F3GA 4PBZA 1VZ2A 3K27A 4X60B 3EQ8A 4WK4A 3SHFA 3SFZA 4AX4A 2I3SA 2OIZA 2BCJB 2HU8A 5FXYA 1JV2A 4GM9A 3KRWB 4CY2A 2PM7B 2P9LC 5M5SA 1N6FA 2H14A 2HJBA 1I2MB 2P9UC 4AMYA 1N6EA 3T3MA 3SVWD 3PVUB 5TEFA 3OKYA 2AGLA 2VC2A 1U2VC 5K19A 3EG6A 2QZPA 3UVNA 2XU7A 5HYNB 4GMBA 4UI9R 4O3UB 4LG9A 4KFMB 1VZ3A 5THAA 4QT8A 2AQ5A 4ERYA 3IVMA 2EICA 4LGNA 1MG2A 1OLZA 2OK4A 1VE7A 2P9NC 5EMLB 3ULEC 4IMMA 4O1QD 2BBKH 4A0AA 4K3ID 2EIEA 4H5JA 5GXHA 2EBSA 3I7NA 2BKLA 3NIGA 1YFQA 4GQ2P 4N14A 5CXCB 1SQ9A 3T3PA 5EMMB 1E5TA 3N0EA 2OJYA 4CI1A 3BG1A 3UKRC 4OWRA 1GOHA 4BP9A 4EWRA 2HU7A 3PXSD 4IRZA 1XHMA 2UZYB 4J79A 4E5ZA 3C5MA 3K26A 4X3EA 1L0QA 4NSXA 3DM0A 5HE0B 4Z8LA 1E8MA 3V7DB 3EQ9A 3IJ0A 3IJCA 3AL9A 4WJKA 4Z7NA 3MKSB 2VDQA 2VDMA 3V4VA 4WK2A 3F3FA 2HKMA 4PSXB 2OVQB 3PSCB 1PBYB 1MDAH
chains in the Genus database with same CATH topology
5CXBB 4GGAA 2IURA 1K32A 1OMWB 4K3JB 3AL8A 4J8GA 5H17A 3I8CA 4A08A 3RN1D 2I3TA 1MG3A 3ORVD 2PM6B 4A0BA 1JJUB 2UZXB 5C2WB 3OTTA 1FWXA 3SMRA 2PM9A 4CY3A 5FLXg 4QL1A 3BWSA 3EWEA 2B5LA 2H9LA 3RSEC 4QQEA 4A11A 2Q7QA 5EALA 4U7AA 3I8EA 3RLMD 3L4OD 1GP2B 1R5MA 3HFQA 3RFHA 2I0RA 4ZOZA 2CN3A 4FAVD 3IKOA 2I0SA 4FHLA 2YB8B 5EM2B 3JAMg 3EI2A 4PXWA 5EAPA 4E54B 5EARA 2O9KA 1B9XA 3I89A 3EMHA 4L1QD 2J57G 2H9PA 1VYHC 2G9AA 3SWSD 3JPXA 1SQJA 4ZOXA 4FA9D 4BL0A 2AGYA 2OVPB 3OKYB 5AJAA 5GXIA 3UKUC 4ERQA 3DXKC 2XL3A 4ERZA 2QXVA 4GZ8A 4GGDA 3EI4A 1PEVA 3VGZA 3DSMA 3UVLA 4X63B 4FB1D 4A0AB 4GQBB 3SCYA 4D0KA 3J81g 2HESX 3JZNA 4CZYA 5KDOB 5H1MA 2YBAA 4CI8A 2Z2NA 1B9YA 4FA5D 5H14A 5FKTA 2B5MA 2MTAH 4R7AB 5GMKn 2Z2OA 2H6NA 2J56H 4GM3A 5GSAA 1U4CA 2AGWA 3JZGA 4E5ZB 2GNQA 4MK0B 5FKRA 4GQ1A 3I7OA 4PC0A 2GC4A 4ZN4A 1K8KC 2GC7A 5C9ZB 5AFU3 4IA9A 2AGZA 4HDJA 3B7FA 1RI6A 2HXCA 3JROA 4Y5RD 3UVKA 5EMKB 3AL8B 3GREA 4XEIC 4J0XA 2H9NA 3RN0D 3JB9L 2IUQA 4A0BB 4J86A 4PBYA 3EI1A 4XYHA 3SN6B 2HYEA 1QNIA 3V5WB 4J0WA 2YNNA 5IC7A 5TF2A 1NR0A 4O3TB 2PM9B 4L3HD 4JSXC 3V9FA 1N6DA 3NVQA 5A2Qg 2P9SC 3BG0A 3MZLA 4A11B 4L9OA 3OKWA 4FWWA 3MKQA 4X61B 2AH0A 3IIWA 4J87A 3EI3A 3RRMC 4J73A 1XKSA 4CI2A 2YNPA 1GG2B 3UR4A 4QRJA 3I7PA 1NEXB 4CY1A 2XL2A 4U1EI 4ZOYA 4YVDA 5IGOA 2B4EA 5CYKA 4A09A 1TYQC 4XYIA 2CE9A 2IWFA 3FGBA 3EU7A 3PSLA 3L4MD 3U4YA 3OL2A 5FA5B 3EI2B 3JZHA 5IJ8E 4ES0A 1GXRA 4CZXA 4OZUA 4FA1D 2H47A 4ESGA 1S4UX 2CO0A 4J81A 4TZ4A 3FRXA 2G99A 4H5IA 3VA6A 2IWKA 5HQGA 3J80g 4JXMA 1GOTB 2AH1A 3GFCA 4J84A 2IAAA 2H68A 4L3GD 4A2MA 4J82A 4BUJC 4JD2C 2W18A 3SBQA 2TRCB 3F3PA 1JMXB 3E0CA 5I5JA 3ODTA 1ERJA 3C99A 2PBIB 4Y7RA 4BH6A 5I5MA 3PE7A 1PGUA 2I0TA 3RFGA 4CY5A 4O9DA 4G56B 3NVNA 3EI4B 5JWZA 5IGQA 2P9KC 4AOWA 3UVMA 3C75H 2P9IC 4JSVC 3I7HA 4A7JA 2YNOA 3CFVA 2IUVA 2IUPA 2B5NA 2CE8A 4FAND 5CXCA 3IIYA 5FKQA 2H9MA 4JT5C 3I7KA 1SHYB 2HKRA 4I79A 2CN2A 2H6KA 2Z2PA 5IT9g 4JSNC 2YMUA 5AMSA 3MXXA 3DXMC 3AH8B 3PXTD 2OK6A 2H3XA 3N0DA 3I7LA 4GM8A 4J78A 3UVOA 4CI3A 3SLED 5HE1B 5C2VB 2H6QA 4A08B 1A0RB 5CXBA 5SXMA 3IJ1A 2H13A 3DWLC 5EMJB 3ZWLB 4FA4D 1PI6A 2OVRB 3MZKA 2J55H 3FM0A 5HE2B 4JSPC 3EI1B 3MMYA 3CFSB 4D6VA 1Q47A 2CO0C 3JRPA 3P4FA 4O45A 1JOFA 3C9CA 3PVWB 4PSWB 4AEZA 3SBRA 2XYIA 2AGXA 1TBGA 4GGCA 3KRXB 3SBPA 2QC5A 5I5IA 3OW8A 3I2NA 4JT6C 3EI3B 5FQDA 3A0FA 4PNKB 5TEEA 3NVXA 3CIKB 3OKTA 4ZOVA 2CNXA 4A2LA 3VH0A 2P9PC 4LG8A 3PXWD 1JMZB 5FKSA 3AFCA 5K1CC 4J8BA 5CYKB 4A09B 5HE3B 5B4WA 3RMZD 4CZVA 3OL2B 1P22A 3SJLD 1XIPA 5TDHB 3SXTD 5EM2A 4J77A 5EAMA 2HJ4A 3W15A 4E54A 4CC9A 5IJ7E 3F3GA 4PBZA 3K27A 4X60B 3SHFA 3SFZA 2I3SA 2OIZA 2BCJB 5FXYA 4GM9A 3KRWB 4CY2A 2PM7B 2P9LC 1N6FA 2H14A 2HJBA 2P9UC 1N6EA 3SVWD 3PVUB 5TEFA 3OKYA 2AGLA 1U2VC 5K19A 3EG6A 3UVNA 2XU7A 5HYNB 4GMBA 4UI9R 4O3UB 4LG9A 4KFMB 5THAA 4QT8A 2AQ5A 4ERYA 4LGNA 1MG2A 1OLZA 2OK4A 5EMLB 2P9NC 3ULEC 4IMMA 4O1QD 2BBKH 4A0AA 4K3ID 4H5JA 5GXHA 2EBSA 3I7NA 1YFQA 4GQ2P 4N14A 5CXCB 1SQ9A 5EMMB 3N0EA 2OJYA 4CI1A 3BG1A 3UKRC 4OWRA 4EWRA 3PXSD 1XHMA 2UZYB 4J79A 4E5ZA 3C5MA 3K26A 4X3EA 1L0QA 4NSXA 3DM0A 5HE0B 4Z8LA 3V7DB 3IJ0A 3IJCA 3AL9A 3MKSB 3F3FA 2HKMA 4PSXB 2OVQB 3PSCB 1PBYB 1MDAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXB B;  4GGA A;  2IUR A;  1K32 A;  1OMW B;  4K3J B;  3AL8 A;  4J8G A;  5H17 A;  3I8C A;  4A08 A;  3RN1 D;  2I3T A;  1MG3 A;  3ORV D;  2PM6 B;  4A0B A;  1JJU B;  2UZX B;  5C2W B;  3OTT A;  1FWX A;  3SMR A;  2PM9 A;  4CY3 A;  5FLX g;  4QL1 A;  3BWS A;  3EWE A;  2B5L A;  2H9L A;  3RSE C;  4QQE A;  4A11 A;  2Q7Q A;  5EAL A;  4U7A A;  3I8E A;  3RLM D;  3L4O D;  1GP2 B;  1R5M A;  3HFQ A;  3RFH A;  2I0R A;  4ZOZ A;  2CN3 A;  4FAV D;  3IKO A;  2I0S A;  4FHL A;  2YB8 B;  5EM2 B;  3JAM g;  3EI2 A;  4PXW A;  5EAP A;  4E54 B;  5EAR A;  2O9K A;  1B9X A;  3I89 A;  3EMH A;  4L1Q D;  2J57 G;  2H9P A;  1VYH C;  2G9A A;  3SWS D;  3JPX A;  1SQJ A;  4ZOX A;  4FA9 D;  4BL0 A;  2AGY A;  2OVP B;  3OKY B;  5AJA A;  5GXI A;  3UKU C;  4ERQ A;  3DXK C;  2XL3 A;  4ERZ A;  2QXV A;  4GZ8 A;  4GGD A;  3EI4 A;  1PEV A;  3VGZ A;  3DSM A;  3UVL A;  4X63 B;  4FB1 D;  4A0A B;  4GQB B;  3SCY A;  4D0K A;  3J81 g;  2HES X;  3JZN A;  4CZY A;  5KDO B;  5H1M A;  2YBA A;  4CI8 A;  2Z2N A;  1B9Y A;  4FA5 D;  5H14 A;  5FKT A;  2B5M A;  2MTA H;  4R7A B;  5GMK n;  2Z2O A;  2H6N A;  2J56 H;  4GM3 A;  5GSA A;  1U4C A;  2AGW A;  3JZG A;  4E5Z B;  2GNQ A;  4MK0 B;  5FKR A;  4GQ1 A;  3I7O A;  4PC0 A;  2GC4 A;  4ZN4 A;  1K8K C;  2GC7 A;  5C9Z B;  5AFU 3;  4IA9 A;  2AGZ A;  4HDJ A;  3B7F A;  1RI6 A;  2HXC A;  3JRO A;  4Y5R D;  3UVK A;  5EMK B;  3AL8 B;  3GRE A;  4XEI C;  4J0X A;  2H9N A;  3RN0 D;  3JB9 L;  2IUQ A;  4A0B B;  4J86 A;  4PBY A;  3EI1 A;  4XYH A;  3SN6 B;  2HYE A;  1QNI A;  3V5W B;  4J0W A;  2YNN A;  5IC7 A;  5TF2 A;  1NR0 A;  4O3T B;  2PM9 B;  4L3H D;  4JSX C;  3V9F A;  1N6D A;  3NVQ A;  5A2Q g;  2P9S C;  3BG0 A;  3MZL A;  4A11 B;  4L9O A;  3OKW A;  4FWW A;  3MKQ A;  4X61 B;  2AH0 A;  3IIW A;  4J87 A;  3EI3 A;  3RRM C;  4J73 A;  1XKS A;  4CI2 A;  2YNP A;  1GG2 B;  3UR4 A;  4QRJ A;  3I7P A;  1NEX B;  4CY1 A;  2XL2 A;  4U1E I;  4ZOY A;  4YVD A;  5IGO A;  2B4E A;  5CYK A;  4A09 A;  1TYQ C;  4XYI A;  2CE9 A;  2IWF A;  3FGB A;  3EU7 A;  3PSL A;  3L4M D;  3U4Y A;  3OL2 A;  5FA5 B;  3EI2 B;  3JZH A;  5IJ8 E;  4ES0 A;  1GXR A;  4CZX A;  4OZU A;  4FA1 D;  2H47 A;  4ESG A;  1S4U X;  2CO0 A;  4J81 A;  4TZ4 A;  3FRX A;  2G99 A;  4H5I A;  3VA6 A;  2IWK A;  5HQG A;  3J80 g;  4JXM A;  1GOT B;  2AH1 A;  3GFC A;  4J84 A;  2IAA A;  2H68 A;  4L3G D;  4A2M A;  4J82 A;  4BUJ C;  4JD2 C;  2W18 A;  3SBQ A;  2TRC B;  3F3P A;  1JMX B;  3E0C A;  5I5J A;  3ODT A;  1ERJ A;  3C99 A;  2PBI B;  4Y7R A;  4BH6 A;  5I5M A;  3PE7 A;  1PGU A;  2I0T A;  3RFG A;  4CY5 A;  4O9D A;  4G56 B;  3NVN A;  3EI4 B;  5JWZ A;  5IGQ A;  2P9K C;  4AOW A;  3UVM A;  3C75 H;  2P9I C;  4JSV C;  3I7H A;  4A7J A;  2YNO A;  3CFV A;  2IUV A;  2IUP A;  2B5N A;  2CE8 A;  4FAN D;  5CXC A;  3IIY A;  5FKQ A;  2H9M A;  4JT5 C;  3I7K A;  1SHY B;  2HKR A;  4I79 A;  2CN2 A;  2H6K A;  2Z2P A;  5IT9 g;  4JSN C;  2YMU A;  5AMS A;  3MXX A;  3DXM C;  3AH8 B;  3PXT D;  2OK6 A;  2H3X A;  3N0D A;  3I7L A;  4GM8 A;  4J78 A;  3UVO A;  4CI3 A;  3SLE D;  5HE1 B;  5C2V B;  2H6Q A;  4A08 B;  1A0R B;  5CXB A;  5SXM A;  3IJ1 A;  2H13 A;  3DWL C;  5EMJ B;  3ZWL B;  4FA4 D;  1PI6 A;  2OVR B;  3MZK A;  2J55 H;  3FM0 A;  5HE2 B;  4JSP C;  3EI1 B;  3MMY A;  3CFS B;  4D6V A;  1Q47 A;  2CO0 C;  3JRP A;  3P4F A;  4O45 A;  1JOF A;  3C9C A;  3PVW B;  4PSW B;  4AEZ A;  3SBR A;  2XYI A;  2AGX A;  1TBG A;  4GGC A;  3KRX B;  3SBP A;  2QC5 A;  5I5I A;  3OW8 A;  3I2N A;  4JT6 C;  3EI3 B;  5FQD A;  3A0F A;  4PNK B;  5TEE A;  3NVX A;  3CIK B;  3OKT A;  4ZOV A;  2CNX A;  4A2L A;  3VH0 A;  2P9P C;  4LG8 A;  3PXW D;  1JMZ B;  5FKS A;  3AFC A;  5K1C C;  4J8B A;  5CYK B;  4A09 B;  5HE3 B;  5B4W A;  3RMZ D;  4CZV A;  3OL2 B;  1P22 A;  3SJL D;  1XIP A;  5TDH B;  3SXT D;  5EM2 A;  4J77 A;  5EAM A;  2HJ4 A;  3W15 A;  4E54 A;  4CC9 A;  5IJ7 E;  3F3G A;  4PBZ A;  3K27 A;  4X60 B;  3SHF A;  3SFZ A;  2I3S A;  2OIZ A;  2BCJ B;  5FXY A;  4GM9 A;  3KRW B;  4CY2 A;  2PM7 B;  2P9L C;  1N6F A;  2H14 A;  2HJB A;  2P9U C;  1N6E A;  3SVW D;  3PVU B;  5TEF A;  3OKY A;  2AGL A;  1U2V C;  5K19 A;  3EG6 A;  3UVN A;  2XU7 A;  5HYN B;  4GMB A;  4UI9 R;  4O3U B;  4LG9 A;  4KFM B;  5THA A;  4QT8 A;  2AQ5 A;  4ERY A;  4LGN A;  1MG2 A;  1OLZ A;  2OK4 A;  5EML B;  2P9N C;  3ULE C;  4IMM A;  4O1Q D;  2BBK H;  4A0A A;  4K3I D;  4H5J A;  5GXH A;  2EBS A;  3I7N A;  1YFQ A;  4GQ2 P;  4N14 A;  5CXC B;  1SQ9 A;  5EMM B;  3N0E A;  2OJY A;  4CI1 A;  3BG1 A;  3UKR C;  4OWR A;  4EWR A;  3PXS D;  1XHM A;  2UZY B;  4J79 A;  4E5Z A;  3C5M A;  3K26 A;  4X3E A;  1L0Q A;  4NSX A;  3DM0 A;  5HE0 B;  4Z8L A;  3V7D B;  3IJ0 A;  3IJC A;  3AL9 A;  3MKS B;  3F3F A;  2HKM A;  4PSX B;  2OVQ B;  3PSC B;  1PBY B;  1MDA H; 
#chains in the Genus database with same CATH topology
 5CXB B;  4GGA A;  2IUR A;  1K32 A;  1OMW B;  4K3J B;  3AL8 A;  4J8G A;  5H17 A;  3I8C A;  4A08 A;  3RN1 D;  4AN0 A;  4JHP C;  2I3T A;  1MG3 A;  3ORV D;  2XE4 A;  2PM6 B;  4A0B A;  1JJU B;  2UZX B;  5C2W B;  1C9L A;  3OTT A;  4G55 A;  2VZ3 A;  1FWX A;  3SMR A;  2PM9 A;  4CY3 A;  5FLX g;  1L5G A;  4QL1 A;  3BWS A;  3EWE A;  2B5L A;  2H9L A;  3RSE C;  4BCB A;  4QQE A;  4A11 A;  3MUN A;  2Q7Q A;  3IUN A;  3ZDZ A;  4DNV A;  4UM8 A;  5EAL A;  3ZE2 A;  4U7A A;  3GC3 B;  3I8E A;  3O4G A;  3QHY B;  3RLM D;  3L4O D;  1GP2 B;  1R5M A;  3HFQ A;  1UOP A;  4DNU A;  4BCC A;  4UM9 A;  3RFH A;  2I0R A;  4ZOZ A;  2CN3 A;  3MUO A;  3NIF A;  4FAV D;  4AMZ A;  3ZE0 A;  3QI0 A;  3IKO A;  2I0S A;  3ZDX A;  4FHL A;  2VDP A;  2YB8 B;  5EM2 B;  3JAM g;  3EI2 A;  4PXW A;  5EAP A;  4E54 B;  3NID A;  1C9I A;  1TYE A;  5EAR A;  4JHN A;  2O9K A;  1B9X A;  3I89 A;  3EMH A;  4L1Q D;  3O4J A;  2J57 G;  4G1M A;  2H9P A;  2VZ1 A;  4AN1 A;  1VYH C;  2G9A A;  3SWS D;  3JPX A;  1SQJ A;  4RE5 A;  4ZOX A;  4FA9 D;  4BL0 A;  2WQ8 A;  2AGY A;  2OVP B;  3K6S A;  3OKY B;  5M5U A;  5AJA A;  5GXI A;  3UKU C;  3IUJ A;  4ERQ A;  3EQ7 A;  3DXK C;  2XL3 A;  3IJE A;  4ERZ A;  2QXV A;  4GZ8 A;  4GGD A;  3EI4 A;  1O6F A;  4NC4 A;  1PEV A;  3VGZ A;  3DSM A;  3UVL A;  3ZE1 A;  4X63 B;  4QAM A;  4FB1 D;  4A0A B;  4GQB B;  1GOG A;  3SCY A;  4Z7Q A;  4D0K A;  3J81 g;  2HES X;  3JZN A;  4CZY A;  5KDO B;  2XDW A;  5H1M A;  2YBA A;  4CI8 A;  2Z2N A;  1B9Y A;  4FA5 D;  5H14 A;  5FKT A;  2B5M A;  2MTA H;  4R7A B;  5GMK n;  2Z2O A;  2H6N A;  2J56 H;  4GM3 A;  5GSA A;  1U4C A;  2AGW A;  3JZG A;  4E5Z B;  2GNQ A;  4MK0 B;  5FKR A;  4GQ1 A;  4NEN A;  3I7O A;  4PC0 A;  2GC4 A;  4ZN4 A;  1K8K C;  5M61 A;  2GC7 A;  4MMZ A;  5C9Z B;  4BCD A;  5AFU 3;  4IA9 A;  4O02 A;  2AGZ A;  4DNW A;  4HDJ A;  3B7F A;  5C86 A;  1RI6 A;  1E8N A;  2HXC A;  3JRO A;  4Y5R D;  3UVK A;  5EMK B;  3AL8 B;  3GRE A;  4XEI C;  4J0X A;  1VE6 A;  1YR2 A;  2H9N A;  3RN0 D;  3JB9 L;  1QFS A;  2IUQ A;  4A0B B;  3IUL A;  4J86 A;  4D9S A;  4PBY A;  3EI1 A;  4XYH A;  3SN6 B;  2HYE A;  1QNI A;  3V5W B;  2VDN A;  4J0W A;  1H2Y A;  2YNN A;  5IC7 A;  5TF2 A;  1NR0 A;  4O3T B;  2PM9 B;  4L3H D;  4JSX C;  3V9F A;  3OF7 A;  1N6D A;  4MMX A;  3NVQ A;  5A2Q g;  2P9S C;  3BG0 A;  3MZL A;  4A11 B;  4L9O A;  3OKW A;  4FWW A;  3MKQ A;  3VI4 A;  4X61 B;  2AH0 A;  3IIW A;  4J87 A;  3EI3 A;  3RRM C;  4J73 A;  1XKS A;  4CI2 A;  2YNP A;  1GG2 B;  2VDR A;  2VDK A;  3IUQ A;  3UR4 A;  5HDB A;  4QRJ A;  3I7P A;  1NEX B;  5M5R A;  4CY1 A;  4RE6 A;  1K3I A;  2XL2 A;  4U1E I;  4ZOY A;  4YVD A;  5IGO A;  2B4E A;  5CYK A;  5M5V A;  4A09 A;  1TYQ C;  4XYI A;  2CE9 A;  2IWF A;  3FGB A;  3EU7 A;  5E6S A;  3PSL A;  3L4M D;  3U4Y A;  4L1M A;  4O2W A;  3OL2 A;  5FA5 B;  3O4I A;  3JZH A;  5IJ8 E;  3EI2 B;  2VDL A;  1U8C A;  1GXR A;  4CZX A;  4OZU A;  4ES0 A;  4FA1 D;  3FCS A;  2H47 A;  4ESG A;  1S4U X;  5FFG A;  4BP8 A;  2CO0 A;  4J81 A;  4TZ4 A;  3FRX A;  2G99 A;  4H5I A;  3VA6 A;  2IWK A;  5HQG A;  3J80 g;  4JXM A;  2AH1 A;  1GOT B;  3GFC A;  4J84 A;  2IAA A;  2H68 A;  4L3G D;  4A2M A;  4J82 A;  4BUJ C;  4WK0 A;  4JD2 C;  1A12 A;  2W18 A;  3SBQ A;  2TRC B;  3F3P A;  1JMX B;  3E0C A;  5I5J A;  1H2Z A;  3ODT A;  1ERJ A;  3C99 A;  2PBI B;  4Y7R A;  4BH6 A;  3KCI A;  5I5M A;  3PE7 A;  1PGU A;  2I0T A;  3RFG A;  3MVD K;  4CY5 A;  1T2X A;  4O9D A;  4G56 B;  3NVN A;  3EI4 B;  1QFM A;  5JWZ A;  5IGQ A;  2P9K C;  4AOW A;  3UVM A;  3C75 H;  2P9I C;  4JSV C;  3I7H A;  2QR5 A;  1GOF A;  2VDO A;  4A7J A;  2YNO A;  3CFV A;  2IUV A;  2IUP A;  2B5N A;  2CE8 A;  2EID A;  4FAN D;  5CXC A;  3V4P A;  1UOO A;  3IIY A;  5FKQ A;  2H9M A;  4JT5 C;  3I7K A;  1SHY B;  2HKR A;  3VI3 A;  5C92 A;  4I79 A;  2CN2 A;  1UOQ A;  2H6K A;  2Z2P A;  3FCU A;  5IT9 g;  4JSN C;  2YMU A;  5AMS A;  3MXX A;  3DXM C;  3AH8 B;  3PXT D;  5M5T A;  3DDU A;  2XZG A;  1M1X A;  2OK6 A;  2H3X A;  3N0D A;  3I7L A;  1BPO A;  4GM8 A;  4J78 A;  3UVO A;  4CI3 A;  3SLE D;  5HE1 B;  5C2V B;  2H6Q A;  4A08 B;  1A0R B;  4Z7O A;  4NBM A;  5CXB A;  5SXM A;  1O6G A;  3IJ1 A;  2H13 A;  2JKX A;  5E6U A;  3DWL C;  5EMJ B;  3ZWL B;  4FA4 D;  2EIB A;  1PI6 A;  2OVR B;  3GD1 I;  3MZK A;  2J55 H;  3FM0 A;  5HE2 B;  4JSP C;  1UTC A;  3EI1 B;  3MMY A;  3CFS B;  4D6V A;  3ZDY A;  1Q47 A;  3K72 A;  2CO0 C;  3JRP A;  3P4F A;  4O45 A;  4MMY A;  1JOF A;  3C9C A;  3PVW B;  4PSW B;  4AEZ A;  3SBR A;  2XYI A;  2AGX A;  4NAA A;  1TBG A;  1JTD B;  4GGC A;  3KRX B;  3SBP A;  2QC5 A;  5I5I A;  3OW8 A;  3I2N A;  4JT6 C;  3EI3 B;  3K71 A;  5FQD A;  3A0F A;  4PNK B;  5TEE A;  3NVX A;  3CIK B;  2HU5 A;  3OKT A;  4ZOV A;  2CNX A;  4A2L A;  3VH0 A;  2P9P C;  4G1E A;  4LG8 A;  5FFO A;  3PXW D;  1JMZ B;  5FKS A;  3AFC A;  5K1C C;  1H2X A;  3IUR A;  4J8B A;  5CYK B;  4A09 B;  5HE3 B;  5B4W A;  3RMZ D;  4CZV A;  3OL2 B;  1P22 A;  3SJL D;  1XIP A;  5TDH B;  3SXT D;  5EM2 A;  5E6R A;  4J77 A;  3IUM A;  5EAM A;  2HJ4 A;  3W15 A;  4E54 A;  4CC9 A;  5IJ7 E;  1H2W A;  3O4H A;  3F3G A;  4PBZ A;  1VZ2 A;  3K27 A;  4X60 B;  3EQ8 A;  4WK4 A;  3SHF A;  3SFZ A;  4AX4 A;  2I3S A;  2OIZ A;  2BCJ B;  2HU8 A;  5FXY A;  1JV2 A;  4GM9 A;  3KRW B;  4CY2 A;  2PM7 B;  2P9L C;  5M5S A;  1N6F A;  2H14 A;  2HJB A;  1I2M B;  2P9U C;  4AMY A;  1N6E A;  3T3M A;  3SVW D;  3PVU B;  5TEF A;  3OKY A;  2AGL A;  2VC2 A;  1U2V C;  5K19 A;  3EG6 A;  2QZP A;  3UVN A;  2XU7 A;  5HYN B;  4GMB A;  4UI9 R;  4O3U B;  4LG9 A;  4KFM B;  1VZ3 A;  5THA A;  4QT8 A;  2AQ5 A;  4ERY A;  3IVM A;  2EIC A;  4LGN A;  1MG2 A;  1OLZ A;  2OK4 A;  1VE7 A;  2P9N C;  5EML B;  3ULE C;  4IMM A;  4O1Q D;  2BBK H;  4A0A A;  4K3I D;  2EIE A;  4H5J A;  5GXH A;  2EBS A;  3I7N A;  2BKL A;  3NIG A;  1YFQ A;  4GQ2 P;  4N14 A;  5CXC B;  1SQ9 A;  3T3P A;  5EMM B;  1E5T A;  3N0E A;  2OJY A;  4CI1 A;  3BG1 A;  3UKR C;  4OWR A;  1GOH A;  4BP9 A;  4EWR A;  2HU7 A;  3PXS D;  4IRZ A;  1XHM A;  2UZY B;  4J79 A;  4E5Z A;  3C5M A;  3K26 A;  4X3E A;  1L0Q A;  4NSX A;  3DM0 A;  5HE0 B;  4Z8L A;  1E8M A;  3V7D B;  3EQ9 A;  3IJ0 A;  3IJC A;  3AL9 A;  4WJK A;  4Z7N A;  3MKS B;  2VDQ A;  2VDM A;  3V4V A;  4WK2 A;  3F3F A;  2HKM A;  4PSX B;  2OVQ B;  3PSC B;  1PBY B;  1MDA H; 
#chains in the Genus database with same CATH homology
 5CXB B;  4GGA A;  2IUR A;  1K32 A;  1OMW B;  4K3J B;  3AL8 A;  4J8G A;  5H17 A;  3I8C A;  4A08 A;  3RN1 D;  2I3T A;  1MG3 A;  3ORV D;  2PM6 B;  4A0B A;  1JJU B;  2UZX B;  5C2W B;  3OTT A;  1FWX A;  3SMR A;  2PM9 A;  4CY3 A;  5FLX g;  4QL1 A;  3BWS A;  3EWE A;  2B5L A;  2H9L A;  3RSE C;  4QQE A;  4A11 A;  2Q7Q A;  5EAL A;  4U7A A;  3I8E A;  3RLM D;  3L4O D;  1GP2 B;  1R5M A;  3HFQ A;  3RFH A;  2I0R A;  4ZOZ A;  2CN3 A;  4FAV D;  3IKO A;  2I0S A;  4FHL A;  2YB8 B;  5EM2 B;  3JAM g;  3EI2 A;  4PXW A;  5EAP A;  4E54 B;  5EAR A;  2O9K A;  1B9X A;  3I89 A;  3EMH A;  4L1Q D;  2J57 G;  2H9P A;  1VYH C;  2G9A A;  3SWS D;  3JPX A;  1SQJ A;  4ZOX A;  4FA9 D;  4BL0 A;  2AGY A;  2OVP B;  3OKY B;  5AJA A;  5GXI A;  3UKU C;  4ERQ A;  3DXK C;  2XL3 A;  4ERZ A;  2QXV A;  4GZ8 A;  4GGD A;  3EI4 A;  1PEV A;  3VGZ A;  3DSM A;  3UVL A;  4X63 B;  4FB1 D;  4A0A B;  4GQB B;  3SCY A;  4D0K A;  3J81 g;  2HES X;  3JZN A;  4CZY A;  5KDO B;  5H1M A;  2YBA A;  4CI8 A;  2Z2N A;  1B9Y A;  4FA5 D;  5H14 A;  5FKT A;  2B5M A;  2MTA H;  4R7A B;  5GMK n;  2Z2O A;  2H6N A;  2J56 H;  4GM3 A;  5GSA A;  1U4C A;  2AGW A;  3JZG A;  4E5Z B;  2GNQ A;  4MK0 B;  5FKR A;  4GQ1 A;  3I7O A;  4PC0 A;  2GC4 A;  4ZN4 A;  1K8K C;  2GC7 A;  5C9Z B;  5AFU 3;  4IA9 A;  2AGZ A;  4HDJ A;  3B7F A;  1RI6 A;  2HXC A;  3JRO A;  4Y5R D;  3UVK A;  5EMK B;  3AL8 B;  3GRE A;  4XEI C;  4J0X A;  2H9N A;  3RN0 D;  3JB9 L;  2IUQ A;  4A0B B;  4J86 A;  4PBY A;  3EI1 A;  4XYH A;  3SN6 B;  2HYE A;  1QNI A;  3V5W B;  4J0W A;  2YNN A;  5IC7 A;  5TF2 A;  1NR0 A;  4O3T B;  2PM9 B;  4L3H D;  4JSX C;  3V9F A;  1N6D A;  3NVQ A;  5A2Q g;  2P9S C;  3BG0 A;  3MZL A;  4A11 B;  4L9O A;  3OKW A;  4FWW A;  3MKQ A;  4X61 B;  2AH0 A;  3IIW A;  4J87 A;  3EI3 A;  3RRM C;  4J73 A;  1XKS A;  4CI2 A;  2YNP A;  1GG2 B;  3UR4 A;  4QRJ A;  3I7P A;  1NEX B;  4CY1 A;  2XL2 A;  4U1E I;  4ZOY A;  4YVD A;  5IGO A;  2B4E A;  5CYK A;  4A09 A;  1TYQ C;  4XYI A;  2CE9 A;  2IWF A;  3FGB A;  3EU7 A;  3PSL A;  3L4M D;  3U4Y A;  3OL2 A;  5FA5 B;  3EI2 B;  3JZH A;  5IJ8 E;  4ES0 A;  1GXR A;  4CZX A;  4OZU A;  4FA1 D;  2H47 A;  4ESG A;  1S4U X;  2CO0 A;  4J81 A;  4TZ4 A;  3FRX A;  2G99 A;  4H5I A;  3VA6 A;  2IWK A;  5HQG A;  3J80 g;  4JXM A;  1GOT B;  2AH1 A;  3GFC A;  4J84 A;  2IAA A;  2H68 A;  4L3G D;  4A2M A;  4J82 A;  4BUJ C;  4JD2 C;  2W18 A;  3SBQ A;  2TRC B;  3F3P A;  1JMX B;  3E0C A;  5I5J A;  3ODT A;  1ERJ A;  3C99 A;  2PBI B;  4Y7R A;  4BH6 A;  5I5M A;  3PE7 A;  1PGU A;  2I0T A;  3RFG A;  4CY5 A;  4O9D A;  4G56 B;  3NVN A;  3EI4 B;  5JWZ A;  5IGQ A;  2P9K C;  4AOW A;  3UVM A;  3C75 H;  2P9I C;  4JSV C;  3I7H A;  4A7J A;  2YNO A;  3CFV A;  2IUV A;  2IUP A;  2B5N A;  2CE8 A;  4FAN D;  5CXC A;  3IIY A;  5FKQ A;  2H9M A;  4JT5 C;  3I7K A;  1SHY B;  2HKR A;  4I79 A;  2CN2 A;  2H6K A;  2Z2P A;  5IT9 g;  4JSN C;  2YMU A;  5AMS A;  3MXX A;  3DXM C;  3AH8 B;  3PXT D;  2OK6 A;  2H3X A;  3N0D A;  3I7L A;  4GM8 A;  4J78 A;  3UVO A;  4CI3 A;  3SLE D;  5HE1 B;  5C2V B;  2H6Q A;  4A08 B;  1A0R B;  5CXB A;  5SXM A;  3IJ1 A;  2H13 A;  3DWL C;  5EMJ B;  3ZWL B;  4FA4 D;  1PI6 A;  2OVR B;  3MZK A;  2J55 H;  3FM0 A;  5HE2 B;  4JSP C;  3EI1 B;  3MMY A;  3CFS B;  4D6V A;  1Q47 A;  2CO0 C;  3JRP A;  3P4F A;  4O45 A;  1JOF A;  3C9C A;  3PVW B;  4PSW B;  4AEZ A;  3SBR A;  2XYI A;  2AGX A;  1TBG A;  4GGC A;  3KRX B;  3SBP A;  2QC5 A;  5I5I A;  3OW8 A;  3I2N A;  4JT6 C;  3EI3 B;  5FQD A;  3A0F A;  4PNK B;  5TEE A;  3NVX A;  3CIK B;  3OKT A;  4ZOV A;  2CNX A;  4A2L A;  3VH0 A;  2P9P C;  4LG8 A;  3PXW D;  1JMZ B;  5FKS A;  3AFC A;  5K1C C;  4J8B A;  5CYK B;  4A09 B;  5HE3 B;  5B4W A;  3RMZ D;  4CZV A;  3OL2 B;  1P22 A;  3SJL D;  1XIP A;  5TDH B;  3SXT D;  5EM2 A;  4J77 A;  5EAM A;  2HJ4 A;  3W15 A;  4E54 A;  4CC9 A;  5IJ7 E;  3F3G A;  4PBZ A;  3K27 A;  4X60 B;  3SHF A;  3SFZ A;  2I3S A;  2OIZ A;  2BCJ B;  5FXY A;  4GM9 A;  3KRW B;  4CY2 A;  2PM7 B;  2P9L C;  1N6F A;  2H14 A;  2HJB A;  2P9U C;  1N6E A;  3SVW D;  3PVU B;  5TEF A;  3OKY A;  2AGL A;  1U2V C;  5K19 A;  3EG6 A;  3UVN A;  2XU7 A;  5HYN B;  4GMB A;  4UI9 R;  4O3U B;  4LG9 A;  4KFM B;  5THA A;  4QT8 A;  2AQ5 A;  4ERY A;  4LGN A;  1MG2 A;  1OLZ A;  2OK4 A;  5EML B;  2P9N C;  3ULE C;  4IMM A;  4O1Q D;  2BBK H;  4A0A A;  4K3I D;  4H5J A;  5GXH A;  2EBS A;  3I7N A;  1YFQ A;  4GQ2 P;  4N14 A;  5CXC B;  1SQ9 A;  5EMM B;  3N0E A;  2OJY A;  4CI1 A;  3BG1 A;  3UKR C;  4OWR A;  4EWR A;  3PXS D;  1XHM A;  2UZY B;  4J79 A;  4E5Z A;  3C5M A;  3K26 A;  4X3E A;  1L0Q A;  4NSX A;  3DM0 A;  5HE0 B;  4Z8L A;  3V7D B;  3IJ0 A;  3IJC A;  3AL9 A;  3MKS B;  3F3F A;  2HKM A;  4PSX B;  2OVQ B;  3PSC B;  1PBY B;  1MDA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...