3NVNA

Molecular mechanism of guidance cue recognition
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
383
structure length
383
Chain Sequence
SIEWHKFETSEEIISTYLIDDVLYTGVNGAVYTFSNNELNKTGLTNNNNYITTSIKVEDTLVCGTNNGNPKCWKIDGSEDPKYRGRGYAPYQNSKVTIISHNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGVRGAFVDKDGTYDKVYILFTDTIDTKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSKAIKTDNDTILYVFFDSPYSKSALCTYSMNAIKHSFSTSKLGGYTKQLPSPAPGICLPAGKVVPHTTFDIIEQYNELDDIIKPLSQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENTIYSFDTKSKQTRSAQVDARLFSVMVTSKPLFIADIGIGVGIPRMKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/signaling protein
molecule keywords EVM139
publication title Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
pubmed doi rcsb
source organism Ectromelia virus
total genus 76
structure length 383
sequence length 383
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3nvnA00
3I7LA 5IC7A 3HFQA 3EMHA 3J81g 3SCYA 2CNXA 4J77A 3NVNA 5GXIA 5JWZA 4PC0A 3ZWLB 4PSXB 3VH0A 3F3FA 4KFMB 2XL3A 2H6QA 2W18A 4J84A 1SQJA 4L3GD 3L4OD 3RRMC 2CN2A 3P4FA 4D0KA 4GGDA 3E0CA 2CN3A 4E54B 4BUJC 5HQGA 3V9FA 5CXBB 4ERZA 3I7KA 2MTAH 4Y5RD 2J56H 2HYEA 3NVXA 2YBAA 5FKSA 2TRCB 3ORVD 4J81A 4E54A 4PBYA 5HE1B 2I3SA 4NSXA 4CZYA 2OK6A 5CXBA 4J8BA 5I5JA 4ZOXA 4OZUA 2B5NA 5FKQA 1JOFA 3I7OA 5HE0B 1SQ9A 1JJUB 2YNPA 5EMLB 3JZNA 3KRXB 5IJ7E 2HXCA 4X60B 2B5MA 5C2VB 1OLZA 2J57G 2H6KA 3JRPA 4JT5C 4L3HD 4JSPC 2CO0A 1N6FA 1SHYB 3CFVA 3I7NA 4K3JB 3SWSD 2HKRA 3BG0A 1MDAH 2OIZA 1MG3A 3SVWD 2P9UC 3W15A 1ERJA 2IAAA 3PVWB 1B9YA 4BH6A 2OJYA 4A0AA 3OKYA 3JZGA 3ULEC 4PNKB 4R7AB 3RFGA 1OMWB 1NR0A 2IUPA 3OL2B 2I0RA 2P9IC 3L4MD 3I7HA 3UVMA 2H9LA 1P22A 1XKSA 2Z2OA 5CXCB 2BBKH 3BG1A 5C9ZB 5H1MA 5THAA 4A08A 5TF2A 2GNQA 2H68A 5FXYA 2CE8A 4FAND 3OL2A 3GREA 4D6VA 4JSXC 4FA5D 5I5MA 5TEFA 5TDHB 5IT9g 3JZHA 1YFQA 4ERYA 1TBGA 5FKTA 5EMKB 5B4WA 2G99A 5C2WB 4A11A 5IJ8E 3N0DA 3SFZA 1NEXB 1PGUA 3IKOA 4Y7RA 3AL9A 4X3EA 3MXXA 4N14A 4ESGA 3V7DB 3MZLA 4JXMA 5HE3B 4IA9A 4CI3A 4J79A 1JMZB 3IJCA 4O3UB 4FA9D 3RN0D 5IGOA 4A0BA 3JPXA 3JAMg 4ERQA 4GQ1A 2J55H 4J0XA 1N6DA 5GSAA 3BWSA 3I2NA 4UI9R 4CZXA 2IUQA 4QT8A 2H9MA 3RMZD 3OW8A 2HESX 2GC7A 4LG8A 3VA6A 4O9DA 1L0QA 4JD2C 1GOTB 4E5ZB 2IWFA 3PXWD 3PE7A 4GGCA 2H13A 2OVQB 5GMKn 4ZN4A 1TYQC 4PXWA 3MKSB 5EMJB 1VYHC 5FQDA 4CY3A 2CE9A 5A2Qg 3I7PA 4GM9A 4AEZA 2EBSA 2H14A 3RN1D 1GG2B 4QRJA 1JMXB 4A0AB 5HE2B 5K19A 3OKYB 3NVQA 3RSEC 4E5ZA 5EMMB 1R5MA 3SJLD 4JT6C 2OVRB 3OKWA 2G9AA 3EI4A 3SHFA 3IIYA 3PXSD 5IGQA 4A08B 5FKRA 1U2VC 4FB1D 3UVOA 4GM8A 3UVNA 1Q47A 3UR4A 2B5LA 3UVLA 1GXRA 4O45A 2AGXA 4H5IA 4YVDA 2Z2PA 3FGBA 2YMUA 1PEVA 4J73A 2IURA 2XL2A 3DXKC 4XEIC 3U4YA 3CFSB 5H17A 1XHMA 2P9KC 1MG2A 4L9OA 4A11B 3SMRA 4LG9A 3ODTA 3FM0A 4J0WA 3J80g 4AOWA 3C99A 1K8KC 3EU7A 3AFCA 1FWXA 4GQBB 3I89A 3AL8A 4FWWA 3V5WB 1XIPA 2H9NA 5I5IA 5EALA 3EI2A 4GGAA 5EM2B 3MMYA 4A09A 2O9KA 5EAMA 4H5JA 4FHLA 4L1QD 4ZOVA 2IWKA 3EI1B 4A0BB 3UKUC 4Z8LA 4QQEA 2OVPB 1K32A 2IUVA 4CY2A 1RI6A 2HJ4A 4PBZA 3IIWA 2AGWA 4XYIA 3N0EA 5EM2A 3K27A 4JSVC 4FAVD 3OKTA 4K3ID 3EI1A 1PBYB 4J82A 4GMBA 4I79A 2PM9A 2XYIA 4OWRA 4CY1A 3C9CA 2UZYB 3EI3A 5H14A 3SBRA 4BL0A 4IMMA 2AH0A 4A2MA 2XU7A 1A0RB 5AJAA 1PI6A 3A0FA 1S4UX 3I8CA 3F3GA 4ZOZA 3IJ0A 1B9XA 2UZXB 4G56B 3JROA 4MK0B 3KRWB 5AFU3 5FA5B 3SBPA 1QNIA 3EI4B 2QXVA 3K26A 3DXMC 4J8GA 3SLED 3I8EA 4GZ8A 4J86A 2AGZA 2AGLA 3EWEA 2PBIB 3IJ1A 4LGNA 4CY5A 2HKMA 5SXMA 5FLXg 3DWLC 2I0SA 3OTTA 4HDJA 4A7JA 2H9PA 2CO0C 3MKQA 2AH1A 2H3XA 2GC4A 4FA4D 2P9LC 2Z2NA 3AH8B 4GQ2P 4ZOYA 5TEEA 1N6EA 3PSLA 5CYKB 5EAPA 4TZ4A 3DSMA 2BCJB 1U4CA 5K1CC 3MZKA 4J87A 2PM6B 3PXTD 4CZVA 3B7FA 3UVKA 5HYNB 2Q7QA 3JB9L 2I3TA 3AL8B 4QL1A 4FA1D 5CYKA 4O3TB 3SN6B 4A09B 3EI2B 3DM0A 4X63B 2P9SC 5EARA 5GXHA 2YNOA 4U1EI 4X61B 3SBQA 2YNNA 5KDOB 2OK4A 3PVUB 4A2LA 2HJBA 2QC5A 3EG6A 4ES0A 4XYHA 3C75H 3GFCA 4CI8A 4JSNC 3VGZA 5AMSA 4O1QD 3RFHA 4CI1A 4GM3A 2P9NC 3PSCB 3FRXA 3C5MA 3SXTD 2I0TA 3F3PA 3CIKB 2B4EA 4EWRA 2PM9B 2H47A 2PM7B 5CXCA 4CI2A 2AQ5A 2AGYA 3EI3B 2P9PC 2YB8B 4CC9A 4J78A 3RLMD 3UKRC 4PSWB 1GP2B 2H6NA 4U7AA
chains in the Genus database with same CATH superfamily
3I7LA 4BCBA 5IC7A 3HFQA 3EMHA 3J81g 3SCYA 2CNXA 4J77A 3NVNA 5GXIA 5JWZA 4PC0A 3ZWLB 4PSXB 3VH0A 3F3FA 4KFMB 2XL3A 2H6QA 2W18A 2EICA 4J84A 1SQJA 4L3GD 3L4OD 3RRMC 2CN2A 3P4FA 4D0KA 4GGDA 3E0CA 4BP9A 2CN3A 4E54B 4BUJC 5HQGA 3V9FA 2VDQA 5CXBB 4ERZA 3I7KA 4Z7OA 2MTAH 4Y5RD 3V4PA 2J56H 1QFMA 2EIEA 2HYEA 3NVXA 2YBAA 5FKSA 2TRCB 3ORVD 2VZ3A 4J81A 4E54A 4PBYA 1YR2A 5HE1B 3QI0A 2I3SA 4NSXA 3IJEA 2OK6A 4CZYA 5CXBA 3NIGA 4J8BA 5I5JA 4ZOXA 1E5TA 4OZUA 2B5NA 5FKQA 1JOFA 3I7OA 5HE0B 1SQ9A 1JJUB 2YNPA 4QAMA 5EMLB 3JZNA 3KRXB 5IJ7E 2HXCA 4X60B 5M5RA 2B5MA 1O6GA 5C2VB 1OLZA 2J57G 2H6KA 3JRPA 4JT5C 4L3HD 2CO0A 4JSPC 1N6FA 1SHYB 3CFVA 3I7NA 4K3JB 3SWSD 2HKRA 3BG0A 4G1EA 1MDAH 2OIZA 1MG3A 3SVWD 4L1MA 2P9UC 3W15A 1ERJA 2IAAA 3PVWB 3IUNA 1GOGA 2VDOA 4AX4A 1B9YA 4BH6A 2OJYA 4A0AA 4G1MA 3OKYA 3JZGA 1BPOA 3ULEC 4PNKB 5C86A 4R7AB 3RFGA 1OMWB 1NR0A 2XDWA 3IUJA 2IUPA 3OL2B 2I0RA 2P9IC 3L4MD 3I7HA 2HU7A 3UVMA 2H9LA 1M1XA 4BCDA 1P22A 1XKSA 2Z2OA 5CXCB 3GC3B 2BBKH 3EQ7A 3BG1A 5C9ZB 3K6SA 5H1MA 5THAA 4A08A 5TF2A 2GNQA 2H68A 5FXYA 2CE8A 2VC2A 4FAND 3OL2A 3VI4A 3O4IA 5M5SA 2VDRA 3GREA 4D6VA 4JSXC 4FA5D 1UOOA 1A12A 5I5MA 4JHPC 5TEFA 5TDHB 5IT9g 3NIFA 3JZHA 1YFQA 2BKLA 4ERYA 1TBGA 4WK2A 5FKTA 5EMKB 3FCSA 5B4WA 3ZDYA 2G99A 3O4HA 2XE4A 5C2WB 2VDMA 4A11A 3EQ8A 5IJ8E 3N0DA 3SFZA 4Z7NA 4RE6A 1NEXB 1PGUA 3IKOA 4Y7RA 3AL9A 4X3EA 1UOPA 3MXXA 4O2WA 4N14A 4ESGA 3V7DB 4BCCA 3MZLA 4JXMA 3ZE0A 5HE3B 4IA9A 4UM9A 4WK4A 4CI3A 4MMZA 4J79A 1JMZB 3IJCA 1GOFA 4WK0A 4O3UB 4AN1A 4FA9D 3RN0D 5IGOA 4A0BA 1H2WA 3JPXA 3JAMg 1JTDB 4ERQA 4GQ1A 2J55H 4J0XA 1N6DA 5GSAA 3BWSA 3I2NA 1U8CA 4UI9R 4CZXA 3IVMA 2IUQA 4QT8A 2H9MA 3RMZD 3OW8A 1H2XA 2HESX 3NIDA 2GC7A 1VZ2A 4LG8A 3VA6A 1L0QA 4JD2C 1GOTB 4O9DA 4E5ZB 2IWFA 3PXWD 5E6SA 3PE7A 4GGCA 2H13A 2OVQB 5FFGA 5GMKn 4ZN4A 1TYQC 4PXWA 3MKSB 5EMJB 1T2XA 2VDLA 1VYHC 5FQDA 1E8NA 4CY3A 2CE9A 5A2Qg 3I7PA 4GM9A 4AEZA 1I2MB 2EBSA 1C9LA 2H14A 3RN1D 1GOHA 1GG2B 1E8MA 5C92A 5M5VA 3ZE2A 1VZ3A 4QRJA 1JMXB 4A0AB 5HE2B 5K19A 3OKYB 3NVQA 3RSEC 3IUQA 4E5ZA 4WJKA 3VI3A 5EMMB 1R5MA 3V4VA 3SJLD 4JT6C 2OVRB 3OKWA 3O4JA 3GD1I 2G9AA 1VE7A 3EI4A 2EIDA 3SHFA 4NAAA 3IIYA 2HU5A 4DNVA 3PXSD 5IGQA 4A08B 5FKRA 1U2VC 4RE5A 4FB1D 3UVOA 4DNWA 4GM8A 3UVNA 1Q47A 3UR4A 2B5LA 3UVLA 1GXRA 4MMYA 3OF7A 4O45A 2AGXA 4H5IA 4YVDA 2Z2PA 3K72A 3FGBA 2YMUA 1PEVA 1QFSA 4J73A 2IURA 2XL2A 3DXKC 4XEIC 3U4YA 4AMYA 3CFSB 5H17A 1XHMA 3T3MA 2P9KC 1MG2A 1H2YA 4L9OA 3SMRA 4A11B 4LG9A 3ODTA 3FM0A 4J0WA 3J80g 4AOWA 3C99A 1K8KC 3EU7A 3AFCA 1FWXA 4GQBB 4O02A 3I89A 3AL8A 4FWWA 3V5WB 1XIPA 2VZ1A 2H9NA 2HU8A 4G55A 5I5IA 5EALA 3EI2A 4GGAA 5EM2B 3MMYA 4A09A 2O9KA 5EAMA 4H5JA 4FHLA 4L1QD 4ZOVA 2IWKA 3EI1B 4A0BB 3UKUC 3IULA 4Z8LA 1K3IA 4QQEA 2OVPB 1K32A 2IUVA 4CY2A 3EQ9A 1RI6A 2HJ4A 2XZGA 4PBZA 3IIWA 2AGWA 4XYIA 3N0EA 1UTCA 4UM8A 5EM2A 3K27A 4JSVC 3DDUA 4FAVD 3OKTA 3MVDK 4K3ID 3EI1A 1PBYB 4J82A 4GMBA 4I79A 2PM9A 2XYIA 3ZDZA 4OWRA 4CY1A 3C9CA 2UZYB 4AMZA 3EI3A 5H14A 3SBRA 4BL0A 4IMMA 2AH0A 1TYEA 4A2MA 2WQ8A 5E6UA 3IURA 5E6RA 2XU7A 1A0RB 5AJAA 1PI6A 3A0FA 1S4UX 3I8CA 3F3GA 4ZOZA 3QHYB 3IJ0A 1B9XA 2UZXB 4G56B 3JROA 4MK0B 3KRWB 5AFU3 5FA5B 2EIBA 2QR5A 3SBPA 5M5UA 1QNIA 3EI4B 2QXVA 4IRZA 3K26A 3DXMC 4J8GA 2QZPA 3SLED 3MUNA 3I8EA 5M5TA 3KCIA 4GZ8A 4J86A 2AGZA 2AGLA 4DNUA 3EWEA 4D9SA 2PBIB 3IJ1A 4MMXA 4LGNA 4CY5A 2HKMA 2JKXA 5SXMA 3DWLC 5FLXg 4AN0A 1C9IA 2I0SA 1UOQA 3OTTA 4HDJA 2H9PA 3T3PA 4A7JA 2CO0C 3MKQA 2AH1A 2H3XA 2GC4A 4FA4D 2P9LC 2Z2NA 5FFOA 3AH8B 4GQ2P 4ZOYA 5TEEA 1N6EA 3PSLA 5CYKB 1H2ZA 5EAPA 4NENA 4TZ4A 3DSMA 2BCJB 3ZE1A 1U4CA 5K1CC 3MZKA 4J87A 1JV2A 2PM6B 3PXTD 4CZVA 3IUMA 3B7FA 3UVKA 5M61A 5HYNB 2Q7QA 3JB9L 4BP8A 2I3TA 3AL8B 3MUOA 4QL1A 4FA1D 5CYKA 4Z7QA 4O3TB 3SN6B 3O4GA 4JHNA 4A09B 3EI2B 3DM0A 4X63B 2P9SC 5EARA 2VDNA 5GXHA 3K71A 2YNOA 2VDPA 5HDBA 4U1EI 4X61B 3SBQA 2VDKA 2YNNA 5KDOB 2OK4A 3PVUB 4A2LA 2HJBA 2QC5A 3EG6A 4ES0A 4XYHA 3C75H 3FCUA 3GFCA 4CI8A 4JSNC 3VGZA 5AMSA 4O1QD 3RFHA 4CI1A 4GM3A 1L5GA 2P9NC 3PSCB 3FRXA 3C5MA 3SXTD 2I0TA 4NBMA 3F3PA 3CIKB 4NC4A 2B4EA 4EWRA 2PM9B 2H47A 2PM7B 5CXCA 4CI2A 2AQ5A 2AGYA 1O6FA 2P9PC 3EI3B 2YB8B 4CC9A 1VE6A 4J78A 3RLMD 3UKRC 4PSWB 1GP2B 3ZDXA 2H6NA 4U7AA
chains in the Genus database with same CATH topology
3I7LA 5IC7A 3HFQA 3EMHA 3J81g 3SCYA 2CNXA 4J77A 3NVNA 5GXIA 5JWZA 4PC0A 3ZWLB 4PSXB 3VH0A 3F3FA 4KFMB 2XL3A 2H6QA 2W18A 4J84A 1SQJA 4L3GD 3L4OD 3RRMC 2CN2A 3P4FA 4D0KA 4GGDA 3E0CA 2CN3A 4E54B 4BUJC 5HQGA 3V9FA 5CXBB 4ERZA 3I7KA 2MTAH 4Y5RD 2J56H 2HYEA 3NVXA 2YBAA 5FKSA 2TRCB 3ORVD 4J81A 4E54A 4PBYA 5HE1B 2I3SA 4NSXA 4CZYA 2OK6A 5CXBA 4J8BA 5I5JA 4ZOXA 4OZUA 2B5NA 5FKQA 1JOFA 3I7OA 5HE0B 1SQ9A 1JJUB 2YNPA 5EMLB 3JZNA 3KRXB 5IJ7E 2HXCA 4X60B 2B5MA 5C2VB 1OLZA 2J57G 2H6KA 3JRPA 4JT5C 4L3HD 4JSPC 2CO0A 1N6FA 1SHYB 3CFVA 3I7NA 4K3JB 3SWSD 2HKRA 3BG0A 1MDAH 2OIZA 1MG3A 3SVWD 2P9UC 3W15A 1ERJA 2IAAA 3PVWB 1B9YA 4BH6A 2OJYA 4A0AA 3OKYA 3JZGA 3ULEC 4PNKB 4R7AB 3RFGA 1OMWB 1NR0A 2IUPA 3OL2B 2I0RA 2P9IC 3L4MD 3I7HA 3UVMA 2H9LA 1P22A 1XKSA 2Z2OA 5CXCB 2BBKH 3BG1A 5C9ZB 5H1MA 5THAA 4A08A 5TF2A 2GNQA 2H68A 5FXYA 2CE8A 4FAND 3OL2A 3GREA 4D6VA 4JSXC 4FA5D 5I5MA 5TEFA 5TDHB 5IT9g 3JZHA 1YFQA 4ERYA 1TBGA 5FKTA 5EMKB 5B4WA 2G99A 5C2WB 4A11A 5IJ8E 3N0DA 3SFZA 1NEXB 1PGUA 3IKOA 4Y7RA 3AL9A 4X3EA 3MXXA 4N14A 4ESGA 3V7DB 3MZLA 4JXMA 5HE3B 4IA9A 4CI3A 4J79A 1JMZB 3IJCA 4O3UB 4FA9D 3RN0D 5IGOA 4A0BA 3JPXA 3JAMg 4ERQA 4GQ1A 2J55H 4J0XA 1N6DA 5GSAA 3BWSA 3I2NA 4UI9R 4CZXA 2IUQA 4QT8A 2H9MA 3RMZD 3OW8A 2HESX 2GC7A 4LG8A 3VA6A 4O9DA 1L0QA 4JD2C 1GOTB 4E5ZB 2IWFA 3PXWD 3PE7A 4GGCA 2H13A 2OVQB 5GMKn 4ZN4A 1TYQC 4PXWA 3MKSB 5EMJB 1VYHC 5FQDA 4CY3A 2CE9A 5A2Qg 3I7PA 4GM9A 4AEZA 2EBSA 2H14A 3RN1D 1GG2B 4QRJA 1JMXB 4A0AB 5HE2B 5K19A 3OKYB 3NVQA 3RSEC 4E5ZA 5EMMB 1R5MA 3SJLD 4JT6C 2OVRB 3OKWA 2G9AA 3EI4A 3SHFA 3IIYA 3PXSD 5IGQA 4A08B 5FKRA 1U2VC 4FB1D 3UVOA 4GM8A 3UVNA 1Q47A 3UR4A 2B5LA 3UVLA 1GXRA 4O45A 2AGXA 4H5IA 4YVDA 2Z2PA 3FGBA 2YMUA 1PEVA 4J73A 2IURA 2XL2A 3DXKC 4XEIC 3U4YA 3CFSB 5H17A 1XHMA 2P9KC 1MG2A 4L9OA 4A11B 3SMRA 4LG9A 3ODTA 3FM0A 4J0WA 3J80g 4AOWA 3C99A 1K8KC 3EU7A 3AFCA 1FWXA 4GQBB 3I89A 3AL8A 4FWWA 3V5WB 1XIPA 2H9NA 5I5IA 5EALA 3EI2A 4GGAA 5EM2B 3MMYA 4A09A 2O9KA 5EAMA 4H5JA 4FHLA 4L1QD 4ZOVA 2IWKA 3EI1B 4A0BB 3UKUC 4Z8LA 4QQEA 2OVPB 1K32A 2IUVA 4CY2A 1RI6A 2HJ4A 4PBZA 3IIWA 2AGWA 4XYIA 3N0EA 5EM2A 3K27A 4JSVC 4FAVD 3OKTA 4K3ID 3EI1A 1PBYB 4J82A 4GMBA 4I79A 2PM9A 2XYIA 4OWRA 4CY1A 3C9CA 2UZYB 3EI3A 5H14A 3SBRA 4BL0A 4IMMA 2AH0A 4A2MA 2XU7A 1A0RB 5AJAA 1PI6A 3A0FA 1S4UX 3I8CA 3F3GA 4ZOZA 3IJ0A 1B9XA 2UZXB 4G56B 3JROA 4MK0B 3KRWB 5AFU3 5FA5B 3SBPA 1QNIA 3EI4B 2QXVA 3K26A 3DXMC 4J8GA 3SLED 3I8EA 4GZ8A 4J86A 2AGZA 2AGLA 3EWEA 2PBIB 3IJ1A 4LGNA 4CY5A 2HKMA 5SXMA 5FLXg 3DWLC 2I0SA 3OTTA 4HDJA 4A7JA 2H9PA 2CO0C 3MKQA 2AH1A 2H3XA 2GC4A 4FA4D 2P9LC 2Z2NA 3AH8B 4GQ2P 4ZOYA 5TEEA 1N6EA 3PSLA 5CYKB 5EAPA 4TZ4A 3DSMA 2BCJB 1U4CA 5K1CC 3MZKA 4J87A 2PM6B 3PXTD 4CZVA 3B7FA 3UVKA 5HYNB 2Q7QA 3JB9L 2I3TA 3AL8B 4QL1A 4FA1D 5CYKA 4O3TB 3SN6B 4A09B 3EI2B 3DM0A 4X63B 2P9SC 5EARA 5GXHA 2YNOA 4U1EI 4X61B 3SBQA 2YNNA 5KDOB 2OK4A 3PVUB 4A2LA 2HJBA 2QC5A 3EG6A 4ES0A 4XYHA 3C75H 3GFCA 4CI8A 4JSNC 3VGZA 5AMSA 4O1QD 3RFHA 4CI1A 4GM3A 2P9NC 3PSCB 3FRXA 3C5MA 3SXTD 2I0TA 3F3PA 3CIKB 2B4EA 4EWRA 2PM9B 2H47A 2PM7B 5CXCA 4CI2A 2AQ5A 2AGYA 3EI3B 2P9PC 2YB8B 4CC9A 4J78A 3RLMD 3UKRC 4PSWB 1GP2B 2H6NA 4U7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7L A;  5IC7 A;  3HFQ A;  3EMH A;  3J81 g;  3SCY A;  2CNX A;  4J77 A;  3NVN A;  5GXI A;  5JWZ A;  4PC0 A;  3ZWL B;  4PSX B;  3VH0 A;  3F3F A;  4KFM B;  2XL3 A;  2H6Q A;  2W18 A;  4J84 A;  1SQJ A;  4L3G D;  3L4O D;  3RRM C;  2CN2 A;  3P4F A;  4D0K A;  4GGD A;  3E0C A;  2CN3 A;  4E54 B;  4BUJ C;  5HQG A;  3V9F A;  5CXB B;  4ERZ A;  3I7K A;  2MTA H;  4Y5R D;  2J56 H;  2HYE A;  3NVX A;  2YBA A;  5FKS A;  2TRC B;  3ORV D;  4J81 A;  4E54 A;  4PBY A;  5HE1 B;  2I3S A;  4NSX A;  4CZY A;  2OK6 A;  5CXB A;  4J8B A;  5I5J A;  4ZOX A;  4OZU A;  2B5N A;  5FKQ A;  1JOF A;  3I7O A;  5HE0 B;  1SQ9 A;  1JJU B;  2YNP A;  5EML B;  3JZN A;  3KRX B;  5IJ7 E;  2HXC A;  4X60 B;  2B5M A;  5C2V B;  1OLZ A;  2J57 G;  2H6K A;  3JRP A;  4JT5 C;  4L3H D;  4JSP C;  2CO0 A;  1N6F A;  1SHY B;  3CFV A;  3I7N A;  4K3J B;  3SWS D;  2HKR A;  3BG0 A;  1MDA H;  2OIZ A;  1MG3 A;  3SVW D;  2P9U C;  3W15 A;  1ERJ A;  2IAA A;  3PVW B;  1B9Y A;  4BH6 A;  2OJY A;  4A0A A;  3OKY A;  3JZG A;  3ULE C;  4PNK B;  4R7A B;  3RFG A;  1OMW B;  1NR0 A;  2IUP A;  3OL2 B;  2I0R A;  2P9I C;  3L4M D;  3I7H A;  3UVM A;  2H9L A;  1P22 A;  1XKS A;  2Z2O A;  5CXC B;  2BBK H;  3BG1 A;  5C9Z B;  5H1M A;  5THA A;  4A08 A;  5TF2 A;  2GNQ A;  2H68 A;  5FXY A;  2CE8 A;  4FAN D;  3OL2 A;  3GRE A;  4D6V A;  4JSX C;  4FA5 D;  5I5M A;  5TEF A;  5TDH B;  5IT9 g;  3JZH A;  1YFQ A;  4ERY A;  1TBG A;  5FKT A;  5EMK B;  5B4W A;  2G99 A;  5C2W B;  4A11 A;  5IJ8 E;  3N0D A;  3SFZ A;  1NEX B;  1PGU A;  3IKO A;  4Y7R A;  3AL9 A;  4X3E A;  3MXX A;  4N14 A;  4ESG A;  3V7D B;  3MZL A;  4JXM A;  5HE3 B;  4IA9 A;  4CI3 A;  4J79 A;  1JMZ B;  3IJC A;  4O3U B;  4FA9 D;  3RN0 D;  5IGO A;  4A0B A;  3JPX A;  3JAM g;  4ERQ A;  4GQ1 A;  2J55 H;  4J0X A;  1N6D A;  5GSA A;  3BWS A;  3I2N A;  4UI9 R;  4CZX A;  2IUQ A;  4QT8 A;  2H9M A;  3RMZ D;  3OW8 A;  2HES X;  2GC7 A;  4LG8 A;  3VA6 A;  4O9D A;  1L0Q A;  4JD2 C;  1GOT B;  4E5Z B;  2IWF A;  3PXW D;  3PE7 A;  4GGC A;  2H13 A;  2OVQ B;  5GMK n;  4ZN4 A;  1TYQ C;  4PXW A;  3MKS B;  5EMJ B;  1VYH C;  5FQD A;  4CY3 A;  2CE9 A;  5A2Q g;  3I7P A;  4GM9 A;  4AEZ A;  2EBS A;  2H14 A;  3RN1 D;  1GG2 B;  4QRJ A;  1JMX B;  4A0A B;  5HE2 B;  5K19 A;  3OKY B;  3NVQ A;  3RSE C;  4E5Z A;  5EMM B;  1R5M A;  3SJL D;  4JT6 C;  2OVR B;  3OKW A;  2G9A A;  3EI4 A;  3SHF A;  3IIY A;  3PXS D;  5IGQ A;  4A08 B;  5FKR A;  1U2V C;  4FB1 D;  3UVO A;  4GM8 A;  3UVN A;  1Q47 A;  3UR4 A;  2B5L A;  3UVL A;  1GXR A;  4O45 A;  2AGX A;  4H5I A;  4YVD A;  2Z2P A;  3FGB A;  2YMU A;  1PEV A;  4J73 A;  2IUR A;  2XL2 A;  3DXK C;  4XEI C;  3U4Y A;  3CFS B;  5H17 A;  1XHM A;  2P9K C;  1MG2 A;  4L9O A;  4A11 B;  3SMR A;  4LG9 A;  3ODT A;  3FM0 A;  4J0W A;  3J80 g;  4AOW A;  3C99 A;  1K8K C;  3EU7 A;  3AFC A;  1FWX A;  4GQB B;  3I89 A;  3AL8 A;  4FWW A;  3V5W B;  1XIP A;  2H9N A;  5I5I A;  5EAL A;  3EI2 A;  4GGA A;  5EM2 B;  3MMY A;  4A09 A;  2O9K A;  5EAM A;  4H5J A;  4FHL A;  4L1Q D;  4ZOV A;  2IWK A;  3EI1 B;  4A0B B;  3UKU C;  4Z8L A;  4QQE A;  2OVP B;  1K32 A;  2IUV A;  4CY2 A;  1RI6 A;  2HJ4 A;  4PBZ A;  3IIW A;  2AGW A;  4XYI A;  3N0E A;  5EM2 A;  3K27 A;  4JSV C;  4FAV D;  3OKT A;  4K3I D;  3EI1 A;  1PBY B;  4J82 A;  4GMB A;  4I79 A;  2PM9 A;  2XYI A;  4OWR A;  4CY1 A;  3C9C A;  2UZY B;  3EI3 A;  5H14 A;  3SBR A;  4BL0 A;  4IMM A;  2AH0 A;  4A2M A;  2XU7 A;  1A0R B;  5AJA A;  1PI6 A;  3A0F A;  1S4U X;  3I8C A;  3F3G A;  4ZOZ A;  3IJ0 A;  1B9X A;  2UZX B;  4G56 B;  3JRO A;  4MK0 B;  3KRW B;  5AFU 3;  5FA5 B;  3SBP A;  1QNI A;  3EI4 B;  2QXV A;  3K26 A;  3DXM C;  4J8G A;  3SLE D;  3I8E A;  4GZ8 A;  4J86 A;  2AGZ A;  2AGL A;  3EWE A;  2PBI B;  3IJ1 A;  4LGN A;  4CY5 A;  2HKM A;  5SXM A;  5FLX g;  3DWL C;  2I0S A;  3OTT A;  4HDJ A;  4A7J A;  2H9P A;  2CO0 C;  3MKQ A;  2AH1 A;  2H3X A;  2GC4 A;  4FA4 D;  2P9L C;  2Z2N A;  3AH8 B;  4GQ2 P;  4ZOY A;  5TEE A;  1N6E A;  3PSL A;  5CYK B;  5EAP A;  4TZ4 A;  3DSM A;  2BCJ B;  1U4C A;  5K1C C;  3MZK A;  4J87 A;  2PM6 B;  3PXT D;  4CZV A;  3B7F A;  3UVK A;  5HYN B;  2Q7Q A;  3JB9 L;  2I3T A;  3AL8 B;  4QL1 A;  4FA1 D;  5CYK A;  4O3T B;  3SN6 B;  4A09 B;  3EI2 B;  3DM0 A;  4X63 B;  2P9S C;  5EAR A;  5GXH A;  2YNO A;  4U1E I;  4X61 B;  3SBQ A;  2YNN A;  5KDO B;  2OK4 A;  3PVU B;  4A2L A;  2HJB A;  2QC5 A;  3EG6 A;  4ES0 A;  4XYH A;  3C75 H;  3GFC A;  4CI8 A;  4JSN C;  3VGZ A;  5AMS A;  4O1Q D;  3RFH A;  4CI1 A;  4GM3 A;  2P9N C;  3PSC B;  3FRX A;  3C5M A;  3SXT D;  2I0T A;  3F3P A;  3CIK B;  2B4E A;  4EWR A;  2PM9 B;  2H47 A;  2PM7 B;  5CXC A;  4CI2 A;  2AQ5 A;  2AGY A;  3EI3 B;  2P9P C;  2YB8 B;  4CC9 A;  4J78 A;  3RLM D;  3UKR C;  4PSW B;  1GP2 B;  2H6N A;  4U7A A; 
#chains in the Genus database with same CATH topology
 3I7L A;  4BCB A;  5IC7 A;  3HFQ A;  3EMH A;  3J81 g;  3SCY A;  2CNX A;  4J77 A;  3NVN A;  5GXI A;  5JWZ A;  4PC0 A;  3ZWL B;  4PSX B;  3VH0 A;  3F3F A;  4KFM B;  2XL3 A;  2H6Q A;  2W18 A;  2EIC A;  4J84 A;  1SQJ A;  4L3G D;  3L4O D;  3RRM C;  2CN2 A;  3P4F A;  4D0K A;  4GGD A;  3E0C A;  4BP9 A;  2CN3 A;  4E54 B;  4BUJ C;  5HQG A;  3V9F A;  2VDQ A;  5CXB B;  4ERZ A;  3I7K A;  4Z7O A;  2MTA H;  4Y5R D;  3V4P A;  2J56 H;  1QFM A;  2EIE A;  2HYE A;  3NVX A;  2YBA A;  5FKS A;  2TRC B;  3ORV D;  2VZ3 A;  4J81 A;  4E54 A;  4PBY A;  1YR2 A;  5HE1 B;  3QI0 A;  2I3S A;  4NSX A;  3IJE A;  2OK6 A;  4CZY A;  5CXB A;  3NIG A;  4J8B A;  5I5J A;  4ZOX A;  1E5T A;  4OZU A;  2B5N A;  5FKQ A;  1JOF A;  3I7O A;  5HE0 B;  1SQ9 A;  1JJU B;  2YNP A;  4QAM A;  5EML B;  3JZN A;  3KRX B;  5IJ7 E;  2HXC A;  4X60 B;  5M5R A;  2B5M A;  1O6G A;  5C2V B;  1OLZ A;  2J57 G;  2H6K A;  3JRP A;  4JT5 C;  4L3H D;  2CO0 A;  4JSP C;  1N6F A;  1SHY B;  3CFV A;  3I7N A;  4K3J B;  3SWS D;  2HKR A;  3BG0 A;  4G1E A;  1MDA H;  2OIZ A;  1MG3 A;  3SVW D;  4L1M A;  2P9U C;  3W15 A;  1ERJ A;  2IAA A;  3PVW B;  3IUN A;  1GOG A;  2VDO A;  4AX4 A;  1B9Y A;  4BH6 A;  2OJY A;  4A0A A;  4G1M A;  3OKY A;  3JZG A;  1BPO A;  3ULE C;  4PNK B;  5C86 A;  4R7A B;  3RFG A;  1OMW B;  1NR0 A;  2XDW A;  3IUJ A;  2IUP A;  3OL2 B;  2I0R A;  2P9I C;  3L4M D;  3I7H A;  2HU7 A;  3UVM A;  2H9L A;  1M1X A;  4BCD A;  1P22 A;  1XKS A;  2Z2O A;  5CXC B;  3GC3 B;  2BBK H;  3EQ7 A;  3BG1 A;  5C9Z B;  3K6S A;  5H1M A;  5THA A;  4A08 A;  5TF2 A;  2GNQ A;  2H68 A;  5FXY A;  2CE8 A;  2VC2 A;  4FAN D;  3OL2 A;  3VI4 A;  3O4I A;  5M5S A;  2VDR A;  3GRE A;  4D6V A;  4JSX C;  4FA5 D;  1UOO A;  1A12 A;  5I5M A;  4JHP C;  5TEF A;  5TDH B;  5IT9 g;  3NIF A;  3JZH A;  1YFQ A;  2BKL A;  4ERY A;  1TBG A;  4WK2 A;  5FKT A;  5EMK B;  3FCS A;  5B4W A;  3ZDY A;  2G99 A;  3O4H A;  2XE4 A;  5C2W B;  2VDM A;  4A11 A;  3EQ8 A;  5IJ8 E;  3N0D A;  3SFZ A;  4Z7N A;  4RE6 A;  1NEX B;  1PGU A;  3IKO A;  4Y7R A;  3AL9 A;  4X3E A;  1UOP A;  3MXX A;  4O2W A;  4N14 A;  4ESG A;  3V7D B;  4BCC A;  3MZL A;  4JXM A;  3ZE0 A;  5HE3 B;  4IA9 A;  4UM9 A;  4WK4 A;  4CI3 A;  4MMZ A;  4J79 A;  1JMZ B;  3IJC A;  1GOF A;  4WK0 A;  4O3U B;  4AN1 A;  4FA9 D;  3RN0 D;  5IGO A;  4A0B A;  1H2W A;  3JPX A;  3JAM g;  1JTD B;  4ERQ A;  4GQ1 A;  2J55 H;  4J0X A;  1N6D A;  5GSA A;  3BWS A;  3I2N A;  1U8C A;  4UI9 R;  4CZX A;  3IVM A;  2IUQ A;  4QT8 A;  2H9M A;  3RMZ D;  3OW8 A;  1H2X A;  2HES X;  3NID A;  2GC7 A;  1VZ2 A;  4LG8 A;  3VA6 A;  1L0Q A;  4JD2 C;  1GOT B;  4O9D A;  4E5Z B;  2IWF A;  3PXW D;  5E6S A;  3PE7 A;  4GGC A;  2H13 A;  2OVQ B;  5FFG A;  5GMK n;  4ZN4 A;  1TYQ C;  4PXW A;  3MKS B;  5EMJ B;  1T2X A;  2VDL A;  1VYH C;  5FQD A;  1E8N A;  4CY3 A;  2CE9 A;  5A2Q g;  3I7P A;  4GM9 A;  4AEZ A;  1I2M B;  2EBS A;  1C9L A;  2H14 A;  3RN1 D;  1GOH A;  1GG2 B;  1E8M A;  5C92 A;  5M5V A;  3ZE2 A;  1VZ3 A;  4QRJ A;  1JMX B;  4A0A B;  5HE2 B;  5K19 A;  3OKY B;  3NVQ A;  3RSE C;  3IUQ A;  4E5Z A;  4WJK A;  3VI3 A;  5EMM B;  1R5M A;  3V4V A;  3SJL D;  4JT6 C;  2OVR B;  3OKW A;  3O4J A;  3GD1 I;  2G9A A;  1VE7 A;  3EI4 A;  2EID A;  3SHF A;  4NAA A;  3IIY A;  2HU5 A;  4DNV A;  3PXS D;  5IGQ A;  4A08 B;  5FKR A;  1U2V C;  4RE5 A;  4FB1 D;  3UVO A;  4DNW A;  4GM8 A;  3UVN A;  1Q47 A;  3UR4 A;  2B5L A;  3UVL A;  1GXR A;  4MMY A;  3OF7 A;  4O45 A;  2AGX A;  4H5I A;  4YVD A;  2Z2P A;  3K72 A;  3FGB A;  2YMU A;  1PEV A;  1QFS A;  4J73 A;  2IUR A;  2XL2 A;  3DXK C;  4XEI C;  3U4Y A;  4AMY A;  3CFS B;  5H17 A;  1XHM A;  3T3M A;  2P9K C;  1MG2 A;  1H2Y A;  4L9O A;  3SMR A;  4A11 B;  4LG9 A;  3ODT A;  3FM0 A;  4J0W A;  3J80 g;  4AOW A;  3C99 A;  1K8K C;  3EU7 A;  3AFC A;  1FWX A;  4GQB B;  4O02 A;  3I89 A;  3AL8 A;  4FWW A;  3V5W B;  1XIP A;  2VZ1 A;  2H9N A;  2HU8 A;  4G55 A;  5I5I A;  5EAL A;  3EI2 A;  4GGA A;  5EM2 B;  3MMY A;  4A09 A;  2O9K A;  5EAM A;  4H5J A;  4FHL A;  4L1Q D;  4ZOV A;  2IWK A;  3EI1 B;  4A0B B;  3UKU C;  3IUL A;  4Z8L A;  1K3I A;  4QQE A;  2OVP B;  1K32 A;  2IUV A;  4CY2 A;  3EQ9 A;  1RI6 A;  2HJ4 A;  2XZG A;  4PBZ A;  3IIW A;  2AGW A;  4XYI A;  3N0E A;  1UTC A;  4UM8 A;  5EM2 A;  3K27 A;  4JSV C;  3DDU A;  4FAV D;  3OKT A;  3MVD K;  4K3I D;  3EI1 A;  1PBY B;  4J82 A;  4GMB A;  4I79 A;  2PM9 A;  2XYI A;  3ZDZ A;  4OWR A;  4CY1 A;  3C9C A;  2UZY B;  4AMZ A;  3EI3 A;  5H14 A;  3SBR A;  4BL0 A;  4IMM A;  2AH0 A;  1TYE A;  4A2M A;  2WQ8 A;  5E6U A;  3IUR A;  5E6R A;  2XU7 A;  1A0R B;  5AJA A;  1PI6 A;  3A0F A;  1S4U X;  3I8C A;  3F3G A;  4ZOZ A;  3QHY B;  3IJ0 A;  1B9X A;  2UZX B;  4G56 B;  3JRO A;  4MK0 B;  3KRW B;  5AFU 3;  5FA5 B;  2EIB A;  2QR5 A;  3SBP A;  5M5U A;  1QNI A;  3EI4 B;  2QXV A;  4IRZ A;  3K26 A;  3DXM C;  4J8G A;  2QZP A;  3SLE D;  3MUN A;  3I8E A;  5M5T A;  3KCI A;  4GZ8 A;  4J86 A;  2AGZ A;  2AGL A;  4DNU A;  3EWE A;  4D9S A;  2PBI B;  3IJ1 A;  4MMX A;  4LGN A;  4CY5 A;  2HKM A;  2JKX A;  5SXM A;  3DWL C;  5FLX g;  4AN0 A;  1C9I A;  2I0S A;  1UOQ A;  3OTT A;  4HDJ A;  2H9P A;  3T3P A;  4A7J A;  2CO0 C;  3MKQ A;  2AH1 A;  2H3X A;  2GC4 A;  4FA4 D;  2P9L C;  2Z2N A;  5FFO A;  3AH8 B;  4GQ2 P;  4ZOY A;  5TEE A;  1N6E A;  3PSL A;  5CYK B;  1H2Z A;  5EAP A;  4NEN A;  4TZ4 A;  3DSM A;  2BCJ B;  3ZE1 A;  1U4C A;  5K1C C;  3MZK A;  4J87 A;  1JV2 A;  2PM6 B;  3PXT D;  4CZV A;  3IUM A;  3B7F A;  3UVK A;  5M61 A;  5HYN B;  2Q7Q A;  3JB9 L;  4BP8 A;  2I3T A;  3AL8 B;  3MUO A;  4QL1 A;  4FA1 D;  5CYK A;  4Z7Q A;  4O3T B;  3SN6 B;  3O4G A;  4JHN A;  4A09 B;  3EI2 B;  3DM0 A;  4X63 B;  2P9S C;  5EAR A;  2VDN A;  5GXH A;  3K71 A;  2YNO A;  2VDP A;  5HDB A;  4U1E I;  4X61 B;  3SBQ A;  2VDK A;  2YNN A;  5KDO B;  2OK4 A;  3PVU B;  4A2L A;  2HJB A;  2QC5 A;  3EG6 A;  4ES0 A;  4XYH A;  3C75 H;  3FCU A;  3GFC A;  4CI8 A;  4JSN C;  3VGZ A;  5AMS A;  4O1Q D;  3RFH A;  4CI1 A;  4GM3 A;  1L5G A;  2P9N C;  3PSC B;  3FRX A;  3C5M A;  3SXT D;  2I0T A;  4NBM A;  3F3P A;  3CIK B;  4NC4 A;  2B4E A;  4EWR A;  2PM9 B;  2H47 A;  2PM7 B;  5CXC A;  4CI2 A;  2AQ5 A;  2AGY A;  1O6F A;  2P9P C;  3EI3 B;  2YB8 B;  4CC9 A;  1VE6 A;  4J78 A;  3RLM D;  3UKR C;  4PSW B;  1GP2 B;  3ZDX A;  2H6N A;  4U7A A; 
#chains in the Genus database with same CATH homology
 3I7L A;  5IC7 A;  3HFQ A;  3EMH A;  3J81 g;  3SCY A;  2CNX A;  4J77 A;  3NVN A;  5GXI A;  5JWZ A;  4PC0 A;  3ZWL B;  4PSX B;  3VH0 A;  3F3F A;  4KFM B;  2XL3 A;  2H6Q A;  2W18 A;  4J84 A;  1SQJ A;  4L3G D;  3L4O D;  3RRM C;  2CN2 A;  3P4F A;  4D0K A;  4GGD A;  3E0C A;  2CN3 A;  4E54 B;  4BUJ C;  5HQG A;  3V9F A;  5CXB B;  4ERZ A;  3I7K A;  2MTA H;  4Y5R D;  2J56 H;  2HYE A;  3NVX A;  2YBA A;  5FKS A;  2TRC B;  3ORV D;  4J81 A;  4E54 A;  4PBY A;  5HE1 B;  2I3S A;  4NSX A;  4CZY A;  2OK6 A;  5CXB A;  4J8B A;  5I5J A;  4ZOX A;  4OZU A;  2B5N A;  5FKQ A;  1JOF A;  3I7O A;  5HE0 B;  1SQ9 A;  1JJU B;  2YNP A;  5EML B;  3JZN A;  3KRX B;  5IJ7 E;  2HXC A;  4X60 B;  2B5M A;  5C2V B;  1OLZ A;  2J57 G;  2H6K A;  3JRP A;  4JT5 C;  4L3H D;  4JSP C;  2CO0 A;  1N6F A;  1SHY B;  3CFV A;  3I7N A;  4K3J B;  3SWS D;  2HKR A;  3BG0 A;  1MDA H;  2OIZ A;  1MG3 A;  3SVW D;  2P9U C;  3W15 A;  1ERJ A;  2IAA A;  3PVW B;  1B9Y A;  4BH6 A;  2OJY A;  4A0A A;  3OKY A;  3JZG A;  3ULE C;  4PNK B;  4R7A B;  3RFG A;  1OMW B;  1NR0 A;  2IUP A;  3OL2 B;  2I0R A;  2P9I C;  3L4M D;  3I7H A;  3UVM A;  2H9L A;  1P22 A;  1XKS A;  2Z2O A;  5CXC B;  2BBK H;  3BG1 A;  5C9Z B;  5H1M A;  5THA A;  4A08 A;  5TF2 A;  2GNQ A;  2H68 A;  5FXY A;  2CE8 A;  4FAN D;  3OL2 A;  3GRE A;  4D6V A;  4JSX C;  4FA5 D;  5I5M A;  5TEF A;  5TDH B;  5IT9 g;  3JZH A;  1YFQ A;  4ERY A;  1TBG A;  5FKT A;  5EMK B;  5B4W A;  2G99 A;  5C2W B;  4A11 A;  5IJ8 E;  3N0D A;  3SFZ A;  1NEX B;  1PGU A;  3IKO A;  4Y7R A;  3AL9 A;  4X3E A;  3MXX A;  4N14 A;  4ESG A;  3V7D B;  3MZL A;  4JXM A;  5HE3 B;  4IA9 A;  4CI3 A;  4J79 A;  1JMZ B;  3IJC A;  4O3U B;  4FA9 D;  3RN0 D;  5IGO A;  4A0B A;  3JPX A;  3JAM g;  4ERQ A;  4GQ1 A;  2J55 H;  4J0X A;  1N6D A;  5GSA A;  3BWS A;  3I2N A;  4UI9 R;  4CZX A;  2IUQ A;  4QT8 A;  2H9M A;  3RMZ D;  3OW8 A;  2HES X;  2GC7 A;  4LG8 A;  3VA6 A;  4O9D A;  1L0Q A;  4JD2 C;  1GOT B;  4E5Z B;  2IWF A;  3PXW D;  3PE7 A;  4GGC A;  2H13 A;  2OVQ B;  5GMK n;  4ZN4 A;  1TYQ C;  4PXW A;  3MKS B;  5EMJ B;  1VYH C;  5FQD A;  4CY3 A;  2CE9 A;  5A2Q g;  3I7P A;  4GM9 A;  4AEZ A;  2EBS A;  2H14 A;  3RN1 D;  1GG2 B;  4QRJ A;  1JMX B;  4A0A B;  5HE2 B;  5K19 A;  3OKY B;  3NVQ A;  3RSE C;  4E5Z A;  5EMM B;  1R5M A;  3SJL D;  4JT6 C;  2OVR B;  3OKW A;  2G9A A;  3EI4 A;  3SHF A;  3IIY A;  3PXS D;  5IGQ A;  4A08 B;  5FKR A;  1U2V C;  4FB1 D;  3UVO A;  4GM8 A;  3UVN A;  1Q47 A;  3UR4 A;  2B5L A;  3UVL A;  1GXR A;  4O45 A;  2AGX A;  4H5I A;  4YVD A;  2Z2P A;  3FGB A;  2YMU A;  1PEV A;  4J73 A;  2IUR A;  2XL2 A;  3DXK C;  4XEI C;  3U4Y A;  3CFS B;  5H17 A;  1XHM A;  2P9K C;  1MG2 A;  4L9O A;  4A11 B;  3SMR A;  4LG9 A;  3ODT A;  3FM0 A;  4J0W A;  3J80 g;  4AOW A;  3C99 A;  1K8K C;  3EU7 A;  3AFC A;  1FWX A;  4GQB B;  3I89 A;  3AL8 A;  4FWW A;  3V5W B;  1XIP A;  2H9N A;  5I5I A;  5EAL A;  3EI2 A;  4GGA A;  5EM2 B;  3MMY A;  4A09 A;  2O9K A;  5EAM A;  4H5J A;  4FHL A;  4L1Q D;  4ZOV A;  2IWK A;  3EI1 B;  4A0B B;  3UKU C;  4Z8L A;  4QQE A;  2OVP B;  1K32 A;  2IUV A;  4CY2 A;  1RI6 A;  2HJ4 A;  4PBZ A;  3IIW A;  2AGW A;  4XYI A;  3N0E A;  5EM2 A;  3K27 A;  4JSV C;  4FAV D;  3OKT A;  4K3I D;  3EI1 A;  1PBY B;  4J82 A;  4GMB A;  4I79 A;  2PM9 A;  2XYI A;  4OWR A;  4CY1 A;  3C9C A;  2UZY B;  3EI3 A;  5H14 A;  3SBR A;  4BL0 A;  4IMM A;  2AH0 A;  4A2M A;  2XU7 A;  1A0R B;  5AJA A;  1PI6 A;  3A0F A;  1S4U X;  3I8C A;  3F3G A;  4ZOZ A;  3IJ0 A;  1B9X A;  2UZX B;  4G56 B;  3JRO A;  4MK0 B;  3KRW B;  5AFU 3;  5FA5 B;  3SBP A;  1QNI A;  3EI4 B;  2QXV A;  3K26 A;  3DXM C;  4J8G A;  3SLE D;  3I8E A;  4GZ8 A;  4J86 A;  2AGZ A;  2AGL A;  3EWE A;  2PBI B;  3IJ1 A;  4LGN A;  4CY5 A;  2HKM A;  5SXM A;  5FLX g;  3DWL C;  2I0S A;  3OTT A;  4HDJ A;  4A7J A;  2H9P A;  2CO0 C;  3MKQ A;  2AH1 A;  2H3X A;  2GC4 A;  4FA4 D;  2P9L C;  2Z2N A;  3AH8 B;  4GQ2 P;  4ZOY A;  5TEE A;  1N6E A;  3PSL A;  5CYK B;  5EAP A;  4TZ4 A;  3DSM A;  2BCJ B;  1U4C A;  5K1C C;  3MZK A;  4J87 A;  2PM6 B;  3PXT D;  4CZV A;  3B7F A;  3UVK A;  5HYN B;  2Q7Q A;  3JB9 L;  2I3T A;  3AL8 B;  4QL1 A;  4FA1 D;  5CYK A;  4O3T B;  3SN6 B;  4A09 B;  3EI2 B;  3DM0 A;  4X63 B;  2P9S C;  5EAR A;  5GXH A;  2YNO A;  4U1E I;  4X61 B;  3SBQ A;  2YNN A;  5KDO B;  2OK4 A;  3PVU B;  4A2L A;  2HJB A;  2QC5 A;  3EG6 A;  4ES0 A;  4XYH A;  3C75 H;  3GFC A;  4CI8 A;  4JSN C;  3VGZ A;  5AMS A;  4O1Q D;  3RFH A;  4CI1 A;  4GM3 A;  2P9N C;  3PSC B;  3FRX A;  3C5M A;  3SXT D;  2I0T A;  3F3P A;  3CIK B;  2B4E A;  4EWR A;  2PM9 B;  2H47 A;  2PM7 B;  5CXC A;  4CI2 A;  2AQ5 A;  2AGY A;  3EI3 B;  2P9P C;  2YB8 B;  4CC9 A;  4J78 A;  3RLM D;  3UKR C;  4PSW B;  1GP2 B;  2H6N A;  4U7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...