3NVNA

Molecular mechanism of guidance cue recognition
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
383
structure length
383
Chain Sequence
SIEWHKFETSEEIISTYLIDDVLYTGVNGAVYTFSNNELNKTGLTNNNNYITTSIKVEDTLVCGTNNGNPKCWKIDGSEDPKYRGRGYAPYQNSKVTIISHNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGVRGAFVDKDGTYDKVYILFTDTIDTKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSKAIKTDNDTILYVFFDSPYSKSALCTYSMNAIKHSFSTSKLGGYTKQLPSPAPGICLPAGKVVPHTTFDIIEQYNELDDIIKPLSQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENTIYSFDTKSKQTRSAQVDARLFSVMVTSKPLFIADIGIGVGIPRMKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EVM139
publication title Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
pubmed doi rcsb
source organism Ectromelia virus
molecule tags Viral protein/signaling protein
total genus 76
structure length 383
sequence length 383
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3nvnA00
1XKSA 3SN6B 3L4OD 2H13A 5GXHA 4A0AA 4PXWA 3OW8A 5HQGA 3UKRC 2HKMA 2O9KA 4CY3A 4D0KA 4E5ZB 2IUVA 1L0QA 4IA9A 2UZXB 4FA4D 3EI2A 3U4YA 4K3JB 5EAPA 4ERQA 3PXSD 3RRMC 4JT6C 5GSAA 2CN3A 3HFQA 3OL2B 4J0WA 1PI6A 5IGQA 4BUJC 3W15A 5HE3B 3C75H 2OK4A 2P9PC 3JRPA 3A0FA 4A2LA 1JJUB 5FKQA 3UKUC 2HYEA 2H3XA 2UZYB 4A08A 2Q7QA 4PBYA 1K8KC 3PSCB 4O3TB 5SXMA 5IT9g 2GNQA 2OVPB 3GREA 3UVMA 1N6FA 3EI4A 4GGDA 4BH6A 5CYKA 3ODTA 3F3FA 4N14A 5EAMA 2P9KC 2P9SC 5EALA 4A7JA 4A2MA 3UVKA 5EMJB 1JMZB 4A09A 3I8EA 3C99A 2IUPA 3IJ0A 3UR4A 3VA6A 2YMUA 5KDOB 2BBKH 1OMWB 3CFSB 5C2VB 5TDHB 1SQ9A 2B5MA 2H6QA 4JT5C 4IMMA 4J86A 4XYHA 4GM9A 4J87A 5TEFA 5EMKB 3RFHA 1TBGA 2HJ4A 4BL0A 4LG8A 4JSVC 2J55H 4ZOZA 2YBAA 3NVNA 4A0AB 3JB9L 1GP2B 4AEZA 4QRJA 5FXYA 3FM0A 2P9NC 3RFGA 3UVOA 2H9LA 3I8CA 4I79A 3PVWB 3SWSD 3EI2B 1K32A 3SMRA 3AL9A 4GM8A 1PBYB 3B7FA 1PGUA 2I0SA 1B9YA 4YVDA 5GXIA 4O1QD 4L3HD 3E0CA 5FLXg 4MK0B 3N0DA 3GFCA 3OKYA 3OKTA 2Z2PA 2PM7B 3SCYA 3AH8B 4A08B 3DWLC 2I0RA 4E54A 5EARA 5TF2A 2G9AA 4TZ4A 4FB1D 3V5WB 5AFU3 5AJAA 3PSLA 3RN1D 5HYNB 3EI4B 4JSNC 3EI1A 5CYKB 2I0TA 3I89A 4X63B 4QT8A 4J0XA 3KRXB 3OKWA 3JZNA 4A09B 2CNXA 2PBIB 3I7NA 4Y5RD 1B9XA 3ULEC 4FA9D 4PSWB 3EWEA 1MG2A 4CZXA 4GQBB 4OZUA 4QQEA 1S4UX 3VGZA 4CZYA 2H9PA 2H14A 5CXCA 5I5IA 4OWRA 3NVXA 4GQ2P 4L3GD 5H1MA 3N0EA 2QXVA 3C5MA 4QL1A 4A0BA 4ERYA 4J84A 5FKRA 2I3SA 2J56H 5H14A 4CZVA 1GG2B 4J82A 3MMYA 4LG9A 2IURA 5FA5B 2IWKA 4J73A 3I7KA 4EWRA 4ZN4A 3OKYB 3JZHA 5C9ZB 1NR0A 3C9CA 3JAMg 4E54B 4O9DA 4CY1A 5GMKn 3PXWD 2OJYA 3IKOA 5EMLB 4A11A 2OVQB 5THAA 4J77A 5CXBA 1N6DA 5A2Qg 3I2NA 3I7LA 2IWFA 2IAAA 5FKSA 4FAND 3V9FA 3EI1B 4LGNA 1XIPA 4PBZA 5IGOA 1PEVA 1NEXB 4FHLA 5EM2A 4K3ID 2OK6A 5C2WB 2B4EA 3IJCA 4GM3A 3L4MD 2YB8B 2TRCB 5IC7A 1N6EA 1JMXB 3BWSA 4L1QD 3VH0A 1U2VC 5FKTA 3CFVA 1VYHC 2H6NA 5K1CC 5CXCB 4JXMA 5K19A 4ERZA 4L9OA 1TYQC 4X60B 2CE9A 1GXRA 2CO0A 4GMBA 2PM9A 3I7OA 4A0BB 1MDAH 5I5MA 5HE0B 4PC0A 2PM6B 4UI9R 1A0RB 3SXTD 4J8GA 3PVUB 2Z2OA 2AGXA 3IIYA 1FWXA 3MZLA 2YNNA 3SHFA 4CI3A 2YNOA 4FA1D 2H47A 2Z2NA 4FWWA 2P9LC 4KFMB 3P4FA 4JD2C 2MTAH 1JOFA 2HXCA 3SBRA 2AH1A 4Z8LA 2B5NA 5AMSA 2H6KA 2J57G 1YFQA 4O3UB 4Y7RA 3F3GA 2QC5A 3DM0A 3EI3A 4A11B 1ERJA 5CXBB 3UVNA 1XHMA 2OVRB 3SBPA 3JZGA 2I3TA 3BG1A 5EM2B 2GC4A 2CO0C 4CI8A 2XU7A 5B4WA 5EMMB 4ESGA 4D6VA 4GGCA 4NSXA 4J79A 2AQ5A 4G56B 3OTTA 4FA5D 4ZOVA 3K26A 3I7PA 3I7HA 4X61B 3FRXA 4CI1A 3RN0D 3AL8A 2EBSA 4JSXC 3PE7A 2P9IC 3K27A 4CI2A 3MKQA 3MXXA 5IJ8E 1SQJA 3JROA 4ZOXA 3J80g 2PM9B 4CC9A 3CIKB 2P9UC 2H68A 2W18A 3KRWB 3SFZA 5HE2B 4E5ZA 2XL3A 2OIZA 2YNPA 3DSMA 1OLZA 2AH0A 3PXTD 4H5JA 2CE8A 3J81g 4GZ8A 1QNIA 4CY5A 2GC7A 4AOWA 3JPXA 3MKSB 4U1EI 2G99A 3EG6A 3OL2A 3EMHA 3IIWA 3F3PA 4H5IA 4J8BA 1MG3A 5H17A 3DXMC 5HE1B 2HKRA 3SVWD 5FQDA 2HJBA 2CN2A 2XYIA 5JWZA 2AGYA 2HESX 3NVQA 3EI3B 2BCJB 3ORVD 4CY2A 4XEIC 4XYIA 2IUQA 4PSXB 3ZWLB 2AGLA 3EU7A 3IJ1A 4GQ1A 2XL2A 5I5JA 5IJ7E 1SHYB 4O45A 3SLED 3V7DB 3UVLA 3DXKC 4ZOYA 1GOTB 3FGBA 4PNKB 5TEEA 1P22A 2H9NA 2H9MA 3RLMD 4HDJA 4X3EA 1U4CA 4U7AA 4FAVD 3MZKA 4JSPC 4R7AB 3SJLD 3AL8B 1R5MA 1Q47A 3AFCA 2AGWA 4GGAA 4ES0A 1RI6A 2AGZA 3RSEC 3SBQA 4J81A 3BG0A 2B5LA 3RMZD 4J78A
chains in the Genus database with same CATH superfamily
1XKSA 4G1EA 3SN6B 3L4OD 2H13A 5GXHA 3ZE1A 4A0AA 4DNWA 4PXWA 3OW8A 5HQGA 3UKRC 2HKMA 2O9KA 4CY3A 4D0KA 4E5ZB 2IUVA 4WK4A 1E5TA 1L0QA 4IA9A 2UZXB 1GOGA 4FA4D 3EI2A 2JKXA 3U4YA 2VC2A 4K3JB 3IUJA 5EAPA 4ERQA 1JTDB 3PXSD 3RRMC 4JT6C 5GSAA 2CN3A 3HFQA 3OL2B 4J0WA 1PI6A 5IGQA 4BUJC 1A12A 3W15A 5HE3B 1L5GA 2OK4A 3C75H 2P9PC 3IUNA 3A0FA 3JRPA 4NAAA 4A2LA 2VDRA 1JJUB 5FKQA 4WK0A 3UKUC 4AMYA 2HYEA 2H3XA 2UZYB 3ZDZA 4A08A 2Q7QA 3O4JA 4AX4A 4PBYA 1TYEA 1K8KC 3PSCB 2EICA 4O3TB 5SXMA 5IT9g 2GNQA 2OVPB 3GREA 2VZ3A 3UVMA 1N6FA 3EI4A 4GGDA 4BH6A 3IVMA 5CYKA 3ODTA 3F3FA 4N14A 5EAMA 2P9KC 4BP8A 2P9SC 5EALA 4A7JA 4A2MA 3UVKA 1QFMA 5EMJB 1JMZB 4A09A 3V4VA 3I8EA 3C99A 2IUPA 3IJ0A 3UR4A 3VA6A 2YMUA 5KDOB 2BBKH 4MMXA 3O4GA 1OMWB 2XDWA 3CFSB 4RE5A 5C2VB 3IUMA 1SQ9A 2B5MA 5TDHB 2H6QA 4JT5C 4WK2A 4IMMA 4J86A 4XYHA 4GM9A 5C86A 4J87A 4BCCA 5TEFA 5EMKB 3RFHA 1TBGA 2HJ4A 4BL0A 4LG8A 4JSVC 3O4HA 2J55H 4ZOZA 2YBAA 3NVNA 4A0AB 3JB9L 1GP2B 4AEZA 2HU5A 2QR5A 1VE6A 4QRJA 5FXYA 3FM0A 4NENA 2P9NC 3RFGA 3UVOA 2H9LA 3I8CA 1QFSA 3DDUA 4I79A 3PVWB 1H2ZA 3SWSD 4WJKA 4Z7NA 2QZPA 3EI2B 1K32A 3KCIA 3SMRA 3MUOA 3AL9A 4GM8A 1PBYB 4JHPC 3B7FA 4BP9A 1PGUA 2I0SA 3K71A 1B9YA 4YVDA 5M5UA 5GXIA 4O1QD 4L3HD 3E0CA 5FLXg 4MK0B 4BCDA 3MUNA 5M5VA 4RE6A 4L1MA 3N0DA 3GFCA 2VZ1A 3OKYA 3OKTA 2Z2PA 4NBMA 2PM7B 3SCYA 3AH8B 4IRZA 4A08B 3DWLC 1O6FA 2I0RA 4E54A 5EARA 1C9LA 5TF2A 2G9AA 4TZ4A 3T3PA 3V5WB 4FB1D 4AN0A 5FFGA 5AFU3 5AJAA 3PSLA 3RN1D 5HYNB 3EI4B 3ZDXA 4JSNC 3EI1A 5CYKB 2I0TA 5M61A 3I89A 4X63B 4QT8A 4J0XA 3KRXB 1O6GA 3OKWA 3JZNA 4A09B 2CNXA 2PBIB 3I7NA 4Y5RD 1B9XA 3ULEC 4FA9D 5M5SA 4PSWB 3EWEA 1MG2A 4CZXA 1GOHA 4G1MA 1H2YA 4GQBB 3OF7A 4OZUA 4QQEA 4AN1A 1S4UX 3VGZA 4CZYA 2H9PA 2H14A 5CXCA 5I5IA 5HDBA 2VDMA 4OWRA 3NVXA 4GQ2P 4L3GD 3V4PA 5H1MA 3N0EA 2QXVA 3C5MA 4QL1A 4A0BA 4ERYA 4AMZA 4J84A 5FKRA 2I3SA 2J56H 5H14A 4MMYA 4CZVA 1GG2B 1U8CA 4J82A 3MMYA 4LG9A 3K6SA 2IURA 5FA5B 2IWKA 4J73A 2EIEA 3I7KA 3MVDK 4EWRA 4ZN4A 3OKYB 3JZHA 3QI0A 5C9ZB 1NR0A 4D9SA 2VDQA 1JV2A 3C9CA 3JAMg 4E54B 4O9DA 4CY1A 5GMKn 3PXWD 2OJYA 3IKOA 5EMLB 4A11A 2OVQB 5THAA 4J77A 5CXBA 1N6DA 5E6SA 3I2NA 5A2Qg 3I7LA 2IWFA 2IAAA 1H2XA 5FKSA 4FAND 3V9FA 3EI1B 1UOQA 4LGNA 1XIPA 4PBZA 1BPOA 5IGOA 1VE7A 3ZE0A 1PEVA 4O02A 1NEXB 4FHLA 5EM2A 4K3ID 2OK6A 5C2WB 2B4EA 3IJCA 4GM3A 4UM9A 3L4MD 2YB8B 2TRCB 1M1XA 2VDLA 5IC7A 1N6EA 1JMXB 1K3IA 2VDNA 1UTCA 3BWSA 4L1QD 3VH0A 1U2VC 2EIDA 5FKTA 3CFVA 1VYHC 2H6NA 5K1CC 4BCBA 4MMZA 4JXMA 5CXCB 5K19A 4ERZA 4L9OA 1TYQC 4X60B 2CE9A 1GXRA 2CO0A 4GMBA 2PM9A 3I7OA 4A0BB 3IUQA 1MDAH 5I5MA 5FFOA 5HE0B 4PC0A 2PM6B 2VDKA 4UI9R 1A0RB 3SXTD 4J8GA 3PVUB 2Z2OA 2AGXA 3NIDA 3IIYA 1FWXA 3MZLA 2YNNA 3SHFA 4DNVA 4CI3A 2YNOA 4FA1D 3IULA 2H47A 2Z2NA 4FWWA 2P9LC 4KFMB 3NIGA 3P4FA 4JD2C 3EQ8A 2VDPA 2MTAH 3NIFA 4UM8A 1JOFA 2HXCA 1E8NA 3SBRA 2AH1A 4Z8LA 2B5NA 5AMSA 2EIBA 2H6KA 2J57G 1YFQA 4O3UB 4Y7RA 3F3GA 4NC4A 2QC5A 3DM0A 3EI3A 4Z7QA 5E6UA 4A11B 1ERJA 5CXBB 3UVNA 1XHMA 2OVRB 3SBPA 3JZGA 2I3TA 3BG1A 5EM2B 2GC4A 2CO0C 4CI8A 3VI4A 2XU7A 1C9IA 5B4WA 5EMMB 4ESGA 4D6VA 3IURA 4GGCA 4NSXA 4J79A 2AQ5A 2BKLA 4G56B 3OTTA 4FA5D 4ZOVA 2WQ8A 3K26A 3I7PA 3I7HA 4X61B 3FRXA 3T3MA 4CI1A 3RN0D 3AL8A 1UOOA 2EBSA 4JSXC 3PE7A 2P9IC 3K27A 4G55A 4CI2A 3MKQA 3MXXA 5IJ8E 1SQJA 5C92A 3JROA 4ZOXA 3IJEA 3J80g 2PM9B 4CC9A 3CIKB 3FCUA 2P9UC 3GD1I 4DNUA 2H68A 2W18A 3KRWB 3SFZA 5HE2B 4E5ZA 2HU8A 2XL3A 2OIZA 3K72A 3EQ7A 2YNPA 4JHNA 3DSMA 1OLZA 2AH0A 3PXTD 4H5JA 2CE8A 5M5RA 3J81g 4GZ8A 1QNIA 4CY5A 2GC7A 4AOWA 3JPXA 1T2XA 2XE4A 3MKSB 4U1EI 1YR2A 2G99A 3EG6A 1GOFA 3OL2A 3EMHA 3IIWA 3F3PA 1UOPA 4H5IA 4J8BA 1MG3A 5H17A 3DXMC 5HE1B 3VI3A 2HKRA 4QAMA 5FQDA 2HJBA 3SVWD 2CN2A 2XYIA 1VZ2A 5JWZA 2AGYA 2HESX 2HU7A 4O2WA 3EQ9A 3NVQA 3EI3B 5E6RA 3ZDYA 1E8MA 3ZE2A 2BCJB 3ORVD 4CY2A 4XEIC 4XYIA 2IUQA 4PSXB 3ZWLB 2AGLA 3EU7A 3IJ1A 4GQ1A 2XL2A 5I5JA 5IJ7E 1SHYB 1VZ3A 4O45A 3SLED 3V7DB 3UVLA 2VDOA 3DXKC 4ZOYA 1GOTB 3FGBA 4PNKB 4Z7OA 2XZGA 5TEEA 1H2WA 1P22A 2H9NA 2H9MA 3GC3B 3RLMD 4HDJA 4X3EA 1U4CA 4U7AA 4FAVD 3MZKA 4JSPC 4R7AB 1I2MB 3O4IA 3QHYB 3SJLD 3AL8B 1R5MA 3FCSA 1Q47A 3AFCA 2AGWA 4GGAA 4ES0A 1RI6A 2AGZA 3RSEC 3SBQA 5M5TA 4J81A 3BG0A 2B5LA 3RMZD 4J78A
chains in the Genus database with same CATH topology
1XKSA 3SN6B 3L4OD 2H13A 5GXHA 4A0AA 4PXWA 3OW8A 5HQGA 3UKRC 2HKMA 2O9KA 4CY3A 4D0KA 4E5ZB 2IUVA 1L0QA 4IA9A 2UZXB 4FA4D 3EI2A 3U4YA 4K3JB 5EAPA 4ERQA 3PXSD 3RRMC 4JT6C 5GSAA 2CN3A 3HFQA 3OL2B 4J0WA 1PI6A 5IGQA 4BUJC 3W15A 5HE3B 3C75H 2OK4A 2P9PC 3JRPA 3A0FA 4A2LA 1JJUB 5FKQA 3UKUC 2HYEA 2H3XA 2UZYB 4A08A 2Q7QA 4PBYA 1K8KC 3PSCB 4O3TB 5SXMA 5IT9g 2GNQA 2OVPB 3GREA 3UVMA 1N6FA 3EI4A 4GGDA 4BH6A 5CYKA 3ODTA 3F3FA 4N14A 5EAMA 2P9KC 2P9SC 5EALA 4A7JA 4A2MA 3UVKA 5EMJB 1JMZB 4A09A 3I8EA 3C99A 2IUPA 3IJ0A 3UR4A 3VA6A 2YMUA 5KDOB 2BBKH 1OMWB 3CFSB 5C2VB 5TDHB 1SQ9A 2B5MA 2H6QA 4JT5C 4IMMA 4J86A 4XYHA 4GM9A 4J87A 5TEFA 5EMKB 3RFHA 1TBGA 2HJ4A 4BL0A 4LG8A 4JSVC 2J55H 4ZOZA 2YBAA 3NVNA 4A0AB 3JB9L 1GP2B 4AEZA 4QRJA 5FXYA 3FM0A 2P9NC 3RFGA 3UVOA 2H9LA 3I8CA 4I79A 3PVWB 3SWSD 3EI2B 1K32A 3SMRA 3AL9A 4GM8A 1PBYB 3B7FA 1PGUA 2I0SA 1B9YA 4YVDA 5GXIA 4O1QD 4L3HD 3E0CA 5FLXg 4MK0B 3N0DA 3GFCA 3OKYA 3OKTA 2Z2PA 2PM7B 3SCYA 3AH8B 4A08B 3DWLC 2I0RA 4E54A 5EARA 5TF2A 2G9AA 4TZ4A 4FB1D 3V5WB 5AFU3 5AJAA 3PSLA 3RN1D 5HYNB 3EI4B 4JSNC 3EI1A 5CYKB 2I0TA 3I89A 4X63B 4QT8A 4J0XA 3KRXB 3OKWA 3JZNA 4A09B 2CNXA 2PBIB 3I7NA 4Y5RD 1B9XA 3ULEC 4FA9D 4PSWB 3EWEA 1MG2A 4CZXA 4GQBB 4OZUA 4QQEA 1S4UX 3VGZA 4CZYA 2H9PA 2H14A 5CXCA 5I5IA 4OWRA 3NVXA 4GQ2P 4L3GD 5H1MA 3N0EA 2QXVA 3C5MA 4QL1A 4A0BA 4ERYA 4J84A 5FKRA 2I3SA 2J56H 5H14A 4CZVA 1GG2B 4J82A 3MMYA 4LG9A 2IURA 5FA5B 2IWKA 4J73A 3I7KA 4EWRA 4ZN4A 3OKYB 3JZHA 5C9ZB 1NR0A 3C9CA 3JAMg 4E54B 4O9DA 4CY1A 5GMKn 3PXWD 2OJYA 3IKOA 5EMLB 4A11A 2OVQB 5THAA 4J77A 5CXBA 1N6DA 5A2Qg 3I2NA 3I7LA 2IWFA 2IAAA 5FKSA 4FAND 3V9FA 3EI1B 4LGNA 1XIPA 4PBZA 5IGOA 1PEVA 1NEXB 4FHLA 5EM2A 4K3ID 2OK6A 5C2WB 2B4EA 3IJCA 4GM3A 3L4MD 2YB8B 2TRCB 5IC7A 1N6EA 1JMXB 3BWSA 4L1QD 3VH0A 1U2VC 5FKTA 3CFVA 1VYHC 2H6NA 5K1CC 5CXCB 4JXMA 5K19A 4ERZA 4L9OA 1TYQC 4X60B 2CE9A 1GXRA 2CO0A 4GMBA 2PM9A 3I7OA 4A0BB 1MDAH 5I5MA 5HE0B 4PC0A 2PM6B 4UI9R 1A0RB 3SXTD 4J8GA 3PVUB 2Z2OA 2AGXA 3IIYA 1FWXA 3MZLA 2YNNA 3SHFA 4CI3A 2YNOA 4FA1D 2H47A 2Z2NA 4FWWA 2P9LC 4KFMB 3P4FA 4JD2C 2MTAH 1JOFA 2HXCA 3SBRA 2AH1A 4Z8LA 2B5NA 5AMSA 2H6KA 2J57G 1YFQA 4O3UB 4Y7RA 3F3GA 2QC5A 3DM0A 3EI3A 4A11B 1ERJA 5CXBB 3UVNA 1XHMA 2OVRB 3SBPA 3JZGA 2I3TA 3BG1A 5EM2B 2GC4A 2CO0C 4CI8A 2XU7A 5B4WA 5EMMB 4ESGA 4D6VA 4GGCA 4NSXA 4J79A 2AQ5A 4G56B 3OTTA 4FA5D 4ZOVA 3K26A 3I7PA 3I7HA 4X61B 3FRXA 4CI1A 3RN0D 3AL8A 2EBSA 4JSXC 3PE7A 2P9IC 3K27A 4CI2A 3MKQA 3MXXA 5IJ8E 1SQJA 3JROA 4ZOXA 3J80g 2PM9B 4CC9A 3CIKB 2P9UC 2H68A 2W18A 3KRWB 3SFZA 5HE2B 4E5ZA 2XL3A 2OIZA 2YNPA 3DSMA 1OLZA 2AH0A 3PXTD 4H5JA 2CE8A 3J81g 4GZ8A 1QNIA 4CY5A 2GC7A 4AOWA 3JPXA 3MKSB 4U1EI 2G99A 3EG6A 3OL2A 3EMHA 3IIWA 3F3PA 4H5IA 4J8BA 1MG3A 5H17A 3DXMC 5HE1B 2HKRA 3SVWD 5FQDA 2HJBA 2CN2A 2XYIA 5JWZA 2AGYA 2HESX 3NVQA 3EI3B 2BCJB 3ORVD 4CY2A 4XEIC 4XYIA 2IUQA 4PSXB 3ZWLB 2AGLA 3EU7A 3IJ1A 4GQ1A 2XL2A 5I5JA 5IJ7E 1SHYB 4O45A 3SLED 3V7DB 3UVLA 3DXKC 4ZOYA 1GOTB 3FGBA 4PNKB 5TEEA 1P22A 2H9NA 2H9MA 3RLMD 4HDJA 4X3EA 1U4CA 4U7AA 4FAVD 3MZKA 4JSPC 4R7AB 3SJLD 3AL8B 1R5MA 1Q47A 3AFCA 2AGWA 4GGAA 4ES0A 1RI6A 2AGZA 3RSEC 3SBQA 4J81A 3BG0A 2B5LA 3RMZD 4J78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKS A;  3SN6 B;  3L4O D;  2H13 A;  5GXH A;  4A0A A;  4PXW A;  3OW8 A;  5HQG A;  3UKR C;  2HKM A;  2O9K A;  4CY3 A;  4D0K A;  4E5Z B;  2IUV A;  1L0Q A;  4IA9 A;  2UZX B;  4FA4 D;  3EI2 A;  3U4Y A;  4K3J B;  5EAP A;  4ERQ A;  3PXS D;  3RRM C;  4JT6 C;  5GSA A;  2CN3 A;  3HFQ A;  3OL2 B;  4J0W A;  1PI6 A;  5IGQ A;  4BUJ C;  3W15 A;  5HE3 B;  3C75 H;  2OK4 A;  2P9P C;  3JRP A;  3A0F A;  4A2L A;  1JJU B;  5FKQ A;  3UKU C;  2HYE A;  2H3X A;  2UZY B;  4A08 A;  2Q7Q A;  4PBY A;  1K8K C;  3PSC B;  4O3T B;  5SXM A;  5IT9 g;  2GNQ A;  2OVP B;  3GRE A;  3UVM A;  1N6F A;  3EI4 A;  4GGD A;  4BH6 A;  5CYK A;  3ODT A;  3F3F A;  4N14 A;  5EAM A;  2P9K C;  2P9S C;  5EAL A;  4A7J A;  4A2M A;  3UVK A;  5EMJ B;  1JMZ B;  4A09 A;  3I8E A;  3C99 A;  2IUP A;  3IJ0 A;  3UR4 A;  3VA6 A;  2YMU A;  5KDO B;  2BBK H;  1OMW B;  3CFS B;  5C2V B;  5TDH B;  1SQ9 A;  2B5M A;  2H6Q A;  4JT5 C;  4IMM A;  4J86 A;  4XYH A;  4GM9 A;  4J87 A;  5TEF A;  5EMK B;  3RFH A;  1TBG A;  2HJ4 A;  4BL0 A;  4LG8 A;  4JSV C;  2J55 H;  4ZOZ A;  2YBA A;  3NVN A;  4A0A B;  3JB9 L;  1GP2 B;  4AEZ A;  4QRJ A;  5FXY A;  3FM0 A;  2P9N C;  3RFG A;  3UVO A;  2H9L A;  3I8C A;  4I79 A;  3PVW B;  3SWS D;  3EI2 B;  1K32 A;  3SMR A;  3AL9 A;  4GM8 A;  1PBY B;  3B7F A;  1PGU A;  2I0S A;  1B9Y A;  4YVD A;  5GXI A;  4O1Q D;  4L3H D;  3E0C A;  5FLX g;  4MK0 B;  3N0D A;  3GFC A;  3OKY A;  3OKT A;  2Z2P A;  2PM7 B;  3SCY A;  3AH8 B;  4A08 B;  3DWL C;  2I0R A;  4E54 A;  5EAR A;  5TF2 A;  2G9A A;  4TZ4 A;  4FB1 D;  3V5W B;  5AFU 3;  5AJA A;  3PSL A;  3RN1 D;  5HYN B;  3EI4 B;  4JSN C;  3EI1 A;  5CYK B;  2I0T A;  3I89 A;  4X63 B;  4QT8 A;  4J0X A;  3KRX B;  3OKW A;  3JZN A;  4A09 B;  2CNX A;  2PBI B;  3I7N A;  4Y5R D;  1B9X A;  3ULE C;  4FA9 D;  4PSW B;  3EWE A;  1MG2 A;  4CZX A;  4GQB B;  4OZU A;  4QQE A;  1S4U X;  3VGZ A;  4CZY A;  2H9P A;  2H14 A;  5CXC A;  5I5I A;  4OWR A;  3NVX A;  4GQ2 P;  4L3G D;  5H1M A;  3N0E A;  2QXV A;  3C5M A;  4QL1 A;  4A0B A;  4ERY A;  4J84 A;  5FKR A;  2I3S A;  2J56 H;  5H14 A;  4CZV A;  1GG2 B;  4J82 A;  3MMY A;  4LG9 A;  2IUR A;  5FA5 B;  2IWK A;  4J73 A;  3I7K A;  4EWR A;  4ZN4 A;  3OKY B;  3JZH A;  5C9Z B;  1NR0 A;  3C9C A;  3JAM g;  4E54 B;  4O9D A;  4CY1 A;  5GMK n;  3PXW D;  2OJY A;  3IKO A;  5EML B;  4A11 A;  2OVQ B;  5THA A;  4J77 A;  5CXB A;  1N6D A;  5A2Q g;  3I2N A;  3I7L A;  2IWF A;  2IAA A;  5FKS A;  4FAN D;  3V9F A;  3EI1 B;  4LGN A;  1XIP A;  4PBZ A;  5IGO A;  1PEV A;  1NEX B;  4FHL A;  5EM2 A;  4K3I D;  2OK6 A;  5C2W B;  2B4E A;  3IJC A;  4GM3 A;  3L4M D;  2YB8 B;  2TRC B;  5IC7 A;  1N6E A;  1JMX B;  3BWS A;  4L1Q D;  3VH0 A;  1U2V C;  5FKT A;  3CFV A;  1VYH C;  2H6N A;  5K1C C;  5CXC B;  4JXM A;  5K19 A;  4ERZ A;  4L9O A;  1TYQ C;  4X60 B;  2CE9 A;  1GXR A;  2CO0 A;  4GMB A;  2PM9 A;  3I7O A;  4A0B B;  1MDA H;  5I5M A;  5HE0 B;  4PC0 A;  2PM6 B;  4UI9 R;  1A0R B;  3SXT D;  4J8G A;  3PVU B;  2Z2O A;  2AGX A;  3IIY A;  1FWX A;  3MZL A;  2YNN A;  3SHF A;  4CI3 A;  2YNO A;  4FA1 D;  2H47 A;  2Z2N A;  4FWW A;  2P9L C;  4KFM B;  3P4F A;  4JD2 C;  2MTA H;  1JOF A;  2HXC A;  3SBR A;  2AH1 A;  4Z8L A;  2B5N A;  5AMS A;  2H6K A;  2J57 G;  1YFQ A;  4O3U B;  4Y7R A;  3F3G A;  2QC5 A;  3DM0 A;  3EI3 A;  4A11 B;  1ERJ A;  5CXB B;  3UVN A;  1XHM A;  2OVR B;  3SBP A;  3JZG A;  2I3T A;  3BG1 A;  5EM2 B;  2GC4 A;  2CO0 C;  4CI8 A;  2XU7 A;  5B4W A;  5EMM B;  4ESG A;  4D6V A;  4GGC A;  4NSX A;  4J79 A;  2AQ5 A;  4G56 B;  3OTT A;  4FA5 D;  4ZOV A;  3K26 A;  3I7P A;  3I7H A;  4X61 B;  3FRX A;  4CI1 A;  3RN0 D;  3AL8 A;  2EBS A;  4JSX C;  3PE7 A;  2P9I C;  3K27 A;  4CI2 A;  3MKQ A;  3MXX A;  5IJ8 E;  1SQJ A;  3JRO A;  4ZOX A;  3J80 g;  2PM9 B;  4CC9 A;  3CIK B;  2P9U C;  2H68 A;  2W18 A;  3KRW B;  3SFZ A;  5HE2 B;  4E5Z A;  2XL3 A;  2OIZ A;  2YNP A;  3DSM A;  1OLZ A;  2AH0 A;  3PXT D;  4H5J A;  2CE8 A;  3J81 g;  4GZ8 A;  1QNI A;  4CY5 A;  2GC7 A;  4AOW A;  3JPX A;  3MKS B;  4U1E I;  2G99 A;  3EG6 A;  3OL2 A;  3EMH A;  3IIW A;  3F3P A;  4H5I A;  4J8B A;  1MG3 A;  5H17 A;  3DXM C;  5HE1 B;  2HKR A;  3SVW D;  5FQD A;  2HJB A;  2CN2 A;  2XYI A;  5JWZ A;  2AGY A;  2HES X;  3NVQ A;  3EI3 B;  2BCJ B;  3ORV D;  4CY2 A;  4XEI C;  4XYI A;  2IUQ A;  4PSX B;  3ZWL B;  2AGL A;  3EU7 A;  3IJ1 A;  4GQ1 A;  2XL2 A;  5I5J A;  5IJ7 E;  1SHY B;  4O45 A;  3SLE D;  3V7D B;  3UVL A;  3DXK C;  4ZOY A;  1GOT B;  3FGB A;  4PNK B;  5TEE A;  1P22 A;  2H9N A;  2H9M A;  3RLM D;  4HDJ A;  4X3E A;  1U4C A;  4U7A A;  4FAV D;  3MZK A;  4JSP C;  4R7A B;  3SJL D;  3AL8 B;  1R5M A;  1Q47 A;  3AFC A;  2AGW A;  4GGA A;  4ES0 A;  1RI6 A;  2AGZ A;  3RSE C;  3SBQ A;  4J81 A;  3BG0 A;  2B5L A;  3RMZ D;  4J78 A; 
#chains in the Genus database with same CATH topology
 1XKS A;  4G1E A;  3SN6 B;  3L4O D;  2H13 A;  5GXH A;  3ZE1 A;  4A0A A;  4DNW A;  4PXW A;  3OW8 A;  5HQG A;  3UKR C;  2HKM A;  2O9K A;  4CY3 A;  4D0K A;  4E5Z B;  2IUV A;  4WK4 A;  1E5T A;  1L0Q A;  4IA9 A;  2UZX B;  1GOG A;  4FA4 D;  3EI2 A;  2JKX A;  3U4Y A;  2VC2 A;  4K3J B;  3IUJ A;  5EAP A;  4ERQ A;  1JTD B;  3PXS D;  3RRM C;  4JT6 C;  5GSA A;  2CN3 A;  3HFQ A;  3OL2 B;  4J0W A;  1PI6 A;  5IGQ A;  4BUJ C;  1A12 A;  3W15 A;  5HE3 B;  1L5G A;  2OK4 A;  3C75 H;  2P9P C;  3IUN A;  3A0F A;  3JRP A;  4NAA A;  4A2L A;  2VDR A;  1JJU B;  5FKQ A;  4WK0 A;  3UKU C;  4AMY A;  2HYE A;  2H3X A;  2UZY B;  3ZDZ A;  4A08 A;  2Q7Q A;  3O4J A;  4AX4 A;  4PBY A;  1TYE A;  1K8K C;  3PSC B;  2EIC A;  4O3T B;  5SXM A;  5IT9 g;  2GNQ A;  2OVP B;  3GRE A;  2VZ3 A;  3UVM A;  1N6F A;  3EI4 A;  4GGD A;  4BH6 A;  3IVM A;  5CYK A;  3ODT A;  3F3F A;  4N14 A;  5EAM A;  2P9K C;  4BP8 A;  2P9S C;  5EAL A;  4A7J A;  4A2M A;  3UVK A;  1QFM A;  5EMJ B;  1JMZ B;  4A09 A;  3V4V A;  3I8E A;  3C99 A;  2IUP A;  3IJ0 A;  3UR4 A;  3VA6 A;  2YMU A;  5KDO B;  2BBK H;  4MMX A;  3O4G A;  1OMW B;  2XDW A;  3CFS B;  4RE5 A;  5C2V B;  3IUM A;  1SQ9 A;  2B5M A;  5TDH B;  2H6Q A;  4JT5 C;  4WK2 A;  4IMM A;  4J86 A;  4XYH A;  4GM9 A;  5C86 A;  4J87 A;  4BCC A;  5TEF A;  5EMK B;  3RFH A;  1TBG A;  2HJ4 A;  4BL0 A;  4LG8 A;  4JSV C;  3O4H A;  2J55 H;  4ZOZ A;  2YBA A;  3NVN A;  4A0A B;  3JB9 L;  1GP2 B;  4AEZ A;  2HU5 A;  2QR5 A;  1VE6 A;  4QRJ A;  5FXY A;  3FM0 A;  4NEN A;  2P9N C;  3RFG A;  3UVO A;  2H9L A;  3I8C A;  1QFS A;  3DDU A;  4I79 A;  3PVW B;  1H2Z A;  3SWS D;  4WJK A;  4Z7N A;  2QZP A;  3EI2 B;  1K32 A;  3KCI A;  3SMR A;  3MUO A;  3AL9 A;  4GM8 A;  1PBY B;  4JHP C;  3B7F A;  4BP9 A;  1PGU A;  2I0S A;  3K71 A;  1B9Y A;  4YVD A;  5M5U A;  5GXI A;  4O1Q D;  4L3H D;  3E0C A;  5FLX g;  4MK0 B;  4BCD A;  3MUN A;  5M5V A;  4RE6 A;  4L1M A;  3N0D A;  3GFC A;  2VZ1 A;  3OKY A;  3OKT A;  2Z2P A;  4NBM A;  2PM7 B;  3SCY A;  3AH8 B;  4IRZ A;  4A08 B;  3DWL C;  1O6F A;  2I0R A;  4E54 A;  5EAR A;  1C9L A;  5TF2 A;  2G9A A;  4TZ4 A;  3T3P A;  3V5W B;  4FB1 D;  4AN0 A;  5FFG A;  5AFU 3;  5AJA A;  3PSL A;  3RN1 D;  5HYN B;  3EI4 B;  3ZDX A;  4JSN C;  3EI1 A;  5CYK B;  2I0T A;  5M61 A;  3I89 A;  4X63 B;  4QT8 A;  4J0X A;  3KRX B;  1O6G A;  3OKW A;  3JZN A;  4A09 B;  2CNX A;  2PBI B;  3I7N A;  4Y5R D;  1B9X A;  3ULE C;  4FA9 D;  5M5S A;  4PSW B;  3EWE A;  1MG2 A;  4CZX A;  1GOH A;  4G1M A;  1H2Y A;  4GQB B;  3OF7 A;  4OZU A;  4QQE A;  4AN1 A;  1S4U X;  3VGZ A;  4CZY A;  2H9P A;  2H14 A;  5CXC A;  5I5I A;  5HDB A;  2VDM A;  4OWR A;  3NVX A;  4GQ2 P;  4L3G D;  3V4P A;  5H1M A;  3N0E A;  2QXV A;  3C5M A;  4QL1 A;  4A0B A;  4ERY A;  4AMZ A;  4J84 A;  5FKR A;  2I3S A;  2J56 H;  5H14 A;  4MMY A;  4CZV A;  1GG2 B;  1U8C A;  4J82 A;  3MMY A;  4LG9 A;  3K6S A;  2IUR A;  5FA5 B;  2IWK A;  4J73 A;  2EIE A;  3I7K A;  3MVD K;  4EWR A;  4ZN4 A;  3OKY B;  3JZH A;  3QI0 A;  5C9Z B;  1NR0 A;  4D9S A;  2VDQ A;  1JV2 A;  3C9C A;  3JAM g;  4E54 B;  4O9D A;  4CY1 A;  5GMK n;  3PXW D;  2OJY A;  3IKO A;  5EML B;  4A11 A;  2OVQ B;  5THA A;  4J77 A;  5CXB A;  1N6D A;  5E6S A;  3I2N A;  5A2Q g;  3I7L A;  2IWF A;  2IAA A;  1H2X A;  5FKS A;  4FAN D;  3V9F A;  3EI1 B;  1UOQ A;  4LGN A;  1XIP A;  4PBZ A;  1BPO A;  5IGO A;  1VE7 A;  3ZE0 A;  1PEV A;  4O02 A;  1NEX B;  4FHL A;  5EM2 A;  4K3I D;  2OK6 A;  5C2W B;  2B4E A;  3IJC A;  4GM3 A;  4UM9 A;  3L4M D;  2YB8 B;  2TRC B;  1M1X A;  2VDL A;  5IC7 A;  1N6E A;  1JMX B;  1K3I A;  2VDN A;  1UTC A;  3BWS A;  4L1Q D;  3VH0 A;  1U2V C;  2EID A;  5FKT A;  3CFV A;  1VYH C;  2H6N A;  5K1C C;  4BCB A;  4MMZ A;  4JXM A;  5CXC B;  5K19 A;  4ERZ A;  4L9O A;  1TYQ C;  4X60 B;  2CE9 A;  1GXR A;  2CO0 A;  4GMB A;  2PM9 A;  3I7O A;  4A0B B;  3IUQ A;  1MDA H;  5I5M A;  5FFO A;  5HE0 B;  4PC0 A;  2PM6 B;  2VDK A;  4UI9 R;  1A0R B;  3SXT D;  4J8G A;  3PVU B;  2Z2O A;  2AGX A;  3NID A;  3IIY A;  1FWX A;  3MZL A;  2YNN A;  3SHF A;  4DNV A;  4CI3 A;  2YNO A;  4FA1 D;  3IUL A;  2H47 A;  2Z2N A;  4FWW A;  2P9L C;  4KFM B;  3NIG A;  3P4F A;  4JD2 C;  3EQ8 A;  2VDP A;  2MTA H;  3NIF A;  4UM8 A;  1JOF A;  2HXC A;  1E8N A;  3SBR A;  2AH1 A;  4Z8L A;  2B5N A;  5AMS A;  2EIB A;  2H6K A;  2J57 G;  1YFQ A;  4O3U B;  4Y7R A;  3F3G A;  4NC4 A;  2QC5 A;  3DM0 A;  3EI3 A;  4Z7Q A;  5E6U A;  4A11 B;  1ERJ A;  5CXB B;  3UVN A;  1XHM A;  2OVR B;  3SBP A;  3JZG A;  2I3T A;  3BG1 A;  5EM2 B;  2GC4 A;  2CO0 C;  4CI8 A;  3VI4 A;  2XU7 A;  1C9I A;  5B4W A;  5EMM B;  4ESG A;  4D6V A;  3IUR A;  4GGC A;  4NSX A;  4J79 A;  2AQ5 A;  2BKL A;  4G56 B;  3OTT A;  4FA5 D;  4ZOV A;  2WQ8 A;  3K26 A;  3I7P A;  3I7H A;  4X61 B;  3FRX A;  3T3M A;  4CI1 A;  3RN0 D;  3AL8 A;  1UOO A;  2EBS A;  4JSX C;  3PE7 A;  2P9I C;  3K27 A;  4G55 A;  4CI2 A;  3MKQ A;  3MXX A;  5IJ8 E;  1SQJ A;  5C92 A;  3JRO A;  4ZOX A;  3IJE A;  3J80 g;  2PM9 B;  4CC9 A;  3CIK B;  3FCU A;  2P9U C;  3GD1 I;  4DNU A;  2H68 A;  2W18 A;  3KRW B;  3SFZ A;  5HE2 B;  4E5Z A;  2HU8 A;  2XL3 A;  2OIZ A;  3K72 A;  3EQ7 A;  2YNP A;  4JHN A;  3DSM A;  1OLZ A;  2AH0 A;  3PXT D;  4H5J A;  2CE8 A;  5M5R A;  3J81 g;  4GZ8 A;  1QNI A;  4CY5 A;  2GC7 A;  4AOW A;  3JPX A;  1T2X A;  2XE4 A;  3MKS B;  4U1E I;  1YR2 A;  2G99 A;  3EG6 A;  1GOF A;  3OL2 A;  3EMH A;  3IIW A;  3F3P A;  1UOP A;  4H5I A;  4J8B A;  1MG3 A;  5H17 A;  3DXM C;  5HE1 B;  3VI3 A;  2HKR A;  4QAM A;  5FQD A;  2HJB A;  3SVW D;  2CN2 A;  2XYI A;  1VZ2 A;  5JWZ A;  2AGY A;  2HES X;  2HU7 A;  4O2W A;  3EQ9 A;  3NVQ A;  3EI3 B;  5E6R A;  3ZDY A;  1E8M A;  3ZE2 A;  2BCJ B;  3ORV D;  4CY2 A;  4XEI C;  4XYI A;  2IUQ A;  4PSX B;  3ZWL B;  2AGL A;  3EU7 A;  3IJ1 A;  4GQ1 A;  2XL2 A;  5I5J A;  5IJ7 E;  1SHY B;  1VZ3 A;  4O45 A;  3SLE D;  3V7D B;  3UVL A;  2VDO A;  3DXK C;  4ZOY A;  1GOT B;  3FGB A;  4PNK B;  4Z7O A;  2XZG A;  5TEE A;  1H2W A;  1P22 A;  2H9N A;  2H9M A;  3GC3 B;  3RLM D;  4HDJ A;  4X3E A;  1U4C A;  4U7A A;  4FAV D;  3MZK A;  4JSP C;  4R7A B;  1I2M B;  3O4I A;  3QHY B;  3SJL D;  3AL8 B;  1R5M A;  3FCS A;  1Q47 A;  3AFC A;  2AGW A;  4GGA A;  4ES0 A;  1RI6 A;  2AGZ A;  3RSE C;  3SBQ A;  5M5T A;  4J81 A;  3BG0 A;  2B5L A;  3RMZ D;  4J78 A; 
#chains in the Genus database with same CATH homology
 1XKS A;  3SN6 B;  3L4O D;  2H13 A;  5GXH A;  4A0A A;  4PXW A;  3OW8 A;  5HQG A;  3UKR C;  2HKM A;  2O9K A;  4CY3 A;  4D0K A;  4E5Z B;  2IUV A;  1L0Q A;  4IA9 A;  2UZX B;  4FA4 D;  3EI2 A;  3U4Y A;  4K3J B;  5EAP A;  4ERQ A;  3PXS D;  3RRM C;  4JT6 C;  5GSA A;  2CN3 A;  3HFQ A;  3OL2 B;  4J0W A;  1PI6 A;  5IGQ A;  4BUJ C;  3W15 A;  5HE3 B;  3C75 H;  2OK4 A;  2P9P C;  3JRP A;  3A0F A;  4A2L A;  1JJU B;  5FKQ A;  3UKU C;  2HYE A;  2H3X A;  2UZY B;  4A08 A;  2Q7Q A;  4PBY A;  1K8K C;  3PSC B;  4O3T B;  5SXM A;  5IT9 g;  2GNQ A;  2OVP B;  3GRE A;  3UVM A;  1N6F A;  3EI4 A;  4GGD A;  4BH6 A;  5CYK A;  3ODT A;  3F3F A;  4N14 A;  5EAM A;  2P9K C;  2P9S C;  5EAL A;  4A7J A;  4A2M A;  3UVK A;  5EMJ B;  1JMZ B;  4A09 A;  3I8E A;  3C99 A;  2IUP A;  3IJ0 A;  3UR4 A;  3VA6 A;  2YMU A;  5KDO B;  2BBK H;  1OMW B;  3CFS B;  5C2V B;  5TDH B;  1SQ9 A;  2B5M A;  2H6Q A;  4JT5 C;  4IMM A;  4J86 A;  4XYH A;  4GM9 A;  4J87 A;  5TEF A;  5EMK B;  3RFH A;  1TBG A;  2HJ4 A;  4BL0 A;  4LG8 A;  4JSV C;  2J55 H;  4ZOZ A;  2YBA A;  3NVN A;  4A0A B;  3JB9 L;  1GP2 B;  4AEZ A;  4QRJ A;  5FXY A;  3FM0 A;  2P9N C;  3RFG A;  3UVO A;  2H9L A;  3I8C A;  4I79 A;  3PVW B;  3SWS D;  3EI2 B;  1K32 A;  3SMR A;  3AL9 A;  4GM8 A;  1PBY B;  3B7F A;  1PGU A;  2I0S A;  1B9Y A;  4YVD A;  5GXI A;  4O1Q D;  4L3H D;  3E0C A;  5FLX g;  4MK0 B;  3N0D A;  3GFC A;  3OKY A;  3OKT A;  2Z2P A;  2PM7 B;  3SCY A;  3AH8 B;  4A08 B;  3DWL C;  2I0R A;  4E54 A;  5EAR A;  5TF2 A;  2G9A A;  4TZ4 A;  4FB1 D;  3V5W B;  5AFU 3;  5AJA A;  3PSL A;  3RN1 D;  5HYN B;  3EI4 B;  4JSN C;  3EI1 A;  5CYK B;  2I0T A;  3I89 A;  4X63 B;  4QT8 A;  4J0X A;  3KRX B;  3OKW A;  3JZN A;  4A09 B;  2CNX A;  2PBI B;  3I7N A;  4Y5R D;  1B9X A;  3ULE C;  4FA9 D;  4PSW B;  3EWE A;  1MG2 A;  4CZX A;  4GQB B;  4OZU A;  4QQE A;  1S4U X;  3VGZ A;  4CZY A;  2H9P A;  2H14 A;  5CXC A;  5I5I A;  4OWR A;  3NVX A;  4GQ2 P;  4L3G D;  5H1M A;  3N0E A;  2QXV A;  3C5M A;  4QL1 A;  4A0B A;  4ERY A;  4J84 A;  5FKR A;  2I3S A;  2J56 H;  5H14 A;  4CZV A;  1GG2 B;  4J82 A;  3MMY A;  4LG9 A;  2IUR A;  5FA5 B;  2IWK A;  4J73 A;  3I7K A;  4EWR A;  4ZN4 A;  3OKY B;  3JZH A;  5C9Z B;  1NR0 A;  3C9C A;  3JAM g;  4E54 B;  4O9D A;  4CY1 A;  5GMK n;  3PXW D;  2OJY A;  3IKO A;  5EML B;  4A11 A;  2OVQ B;  5THA A;  4J77 A;  5CXB A;  1N6D A;  5A2Q g;  3I2N A;  3I7L A;  2IWF A;  2IAA A;  5FKS A;  4FAN D;  3V9F A;  3EI1 B;  4LGN A;  1XIP A;  4PBZ A;  5IGO A;  1PEV A;  1NEX B;  4FHL A;  5EM2 A;  4K3I D;  2OK6 A;  5C2W B;  2B4E A;  3IJC A;  4GM3 A;  3L4M D;  2YB8 B;  2TRC B;  5IC7 A;  1N6E A;  1JMX B;  3BWS A;  4L1Q D;  3VH0 A;  1U2V C;  5FKT A;  3CFV A;  1VYH C;  2H6N A;  5K1C C;  5CXC B;  4JXM A;  5K19 A;  4ERZ A;  4L9O A;  1TYQ C;  4X60 B;  2CE9 A;  1GXR A;  2CO0 A;  4GMB A;  2PM9 A;  3I7O A;  4A0B B;  1MDA H;  5I5M A;  5HE0 B;  4PC0 A;  2PM6 B;  4UI9 R;  1A0R B;  3SXT D;  4J8G A;  3PVU B;  2Z2O A;  2AGX A;  3IIY A;  1FWX A;  3MZL A;  2YNN A;  3SHF A;  4CI3 A;  2YNO A;  4FA1 D;  2H47 A;  2Z2N A;  4FWW A;  2P9L C;  4KFM B;  3P4F A;  4JD2 C;  2MTA H;  1JOF A;  2HXC A;  3SBR A;  2AH1 A;  4Z8L A;  2B5N A;  5AMS A;  2H6K A;  2J57 G;  1YFQ A;  4O3U B;  4Y7R A;  3F3G A;  2QC5 A;  3DM0 A;  3EI3 A;  4A11 B;  1ERJ A;  5CXB B;  3UVN A;  1XHM A;  2OVR B;  3SBP A;  3JZG A;  2I3T A;  3BG1 A;  5EM2 B;  2GC4 A;  2CO0 C;  4CI8 A;  2XU7 A;  5B4W A;  5EMM B;  4ESG A;  4D6V A;  4GGC A;  4NSX A;  4J79 A;  2AQ5 A;  4G56 B;  3OTT A;  4FA5 D;  4ZOV A;  3K26 A;  3I7P A;  3I7H A;  4X61 B;  3FRX A;  4CI1 A;  3RN0 D;  3AL8 A;  2EBS A;  4JSX C;  3PE7 A;  2P9I C;  3K27 A;  4CI2 A;  3MKQ A;  3MXX A;  5IJ8 E;  1SQJ A;  3JRO A;  4ZOX A;  3J80 g;  2PM9 B;  4CC9 A;  3CIK B;  2P9U C;  2H68 A;  2W18 A;  3KRW B;  3SFZ A;  5HE2 B;  4E5Z A;  2XL3 A;  2OIZ A;  2YNP A;  3DSM A;  1OLZ A;  2AH0 A;  3PXT D;  4H5J A;  2CE8 A;  3J81 g;  4GZ8 A;  1QNI A;  4CY5 A;  2GC7 A;  4AOW A;  3JPX A;  3MKS B;  4U1E I;  2G99 A;  3EG6 A;  3OL2 A;  3EMH A;  3IIW A;  3F3P A;  4H5I A;  4J8B A;  1MG3 A;  5H17 A;  3DXM C;  5HE1 B;  2HKR A;  3SVW D;  5FQD A;  2HJB A;  2CN2 A;  2XYI A;  5JWZ A;  2AGY A;  2HES X;  3NVQ A;  3EI3 B;  2BCJ B;  3ORV D;  4CY2 A;  4XEI C;  4XYI A;  2IUQ A;  4PSX B;  3ZWL B;  2AGL A;  3EU7 A;  3IJ1 A;  4GQ1 A;  2XL2 A;  5I5J A;  5IJ7 E;  1SHY B;  4O45 A;  3SLE D;  3V7D B;  3UVL A;  3DXK C;  4ZOY A;  1GOT B;  3FGB A;  4PNK B;  5TEE A;  1P22 A;  2H9N A;  2H9M A;  3RLM D;  4HDJ A;  4X3E A;  1U4C A;  4U7A A;  4FAV D;  3MZK A;  4JSP C;  4R7A B;  3SJL D;  3AL8 B;  1R5M A;  1Q47 A;  3AFC A;  2AGW A;  4GGA A;  4ES0 A;  1RI6 A;  2AGZ A;  3RSE C;  3SBQ A;  4J81 A;  3BG0 A;  2B5L A;  3RMZ D;  4J78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...