3NVNA

Molecular mechanism of guidance cue recognition
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
383
structure length
383
Chain Sequence
SIEWHKFETSEEIISTYLIDDVLYTGVNGAVYTFSNNELNKTGLTNNNNYITTSIKVEDTLVCGTNNGNPKCWKIDGSEDPKYRGRGYAPYQNSKVTIISHNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGVRGAFVDKDGTYDKVYILFTDTIDTKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSKAIKTDNDTILYVFFDSPYSKSALCTYSMNAIKHSFSTSKLGGYTKQLPSPAPGICLPAGKVVPHTTFDIIEQYNELDDIIKPLSQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENTIYSFDTKSKQTRSAQVDARLFSVMVTSKPLFIADIGIGVGIPRMKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
pubmed doi rcsb
source organism Ectromelia virus
molecule tags Viral protein/signaling protein
molecule keywords EVM139
total genus 76
structure length 383
sequence length 383
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3nvnA00
5HE2B 2OVRB 4O3TB 2H6QA 1NR0A 4YVDA 5SXMA 4XYHA 5C9ZB 1GP2B 3UVMA 4FA9D 5THAA 1SQ9A 4D0KA 5H17A 2AGWA 4X60B 3ZWLB 3CIKB 5TEFA 4K3JB 2H13A 4A0AA 4O1QD 2W18A 2GC7A 5GSAA 4CC9A 5FKQA 4PBZA 3SBRA 3NVXA 2P9UC 4J0WA 5IJ7E 4R7AB 1PBYB 4XYIA 2B5NA 3SFZA 3DM0A 4A0BA 3EI2B 3JPXA 1L0QA 3SWSD 2IWKA 2OK4A 3EI1B 4ES0A 2P9IC 3IJ0A 3I8CA 2PM9B 3RFGA 3KRXB 4JXMA 5I5IA 2CO0A 4CZVA 2I0SA 1U2VC 2YBAA 4LG8A 3UVOA 3CFVA 4E54A 2OK6A 2AGLA 2H9MA 4ZOYA 3I7HA 1XIPA 3BG1A 5FLXg 4JSXC 3RN0D 1SQJA 2BBKH 4JSVC 4CZXA 4Y7RA 2AQ5A 4ERQA 5IJ8E 1S4UX 4JSPC 2XU7A 1TBGA 3SBQA 3IIYA 2O9KA 3JAMg 2BCJB 4CI1A 4H5IA 2Z2OA 4CZYA 2B4EA 3L4MD 5JWZA 2J57G 2H9LA 3MKQA 3MMYA 1N6EA 4J86A 4CY1A 3I7PA 2PBIB 2I0TA 3ULEC 3EU7A 4ERZA 3J81g 4GM9A 3I7LA 5AJAA 4GQ2P 2AH0A 2YNNA 4FA5D 3VGZA 3SXTD 3MKSB 3PXSD 2J56H 2P9LC 3EWEA 5EMKB 3PSLA 5IGQA 1N6DA 3EMHA 3C99A 2H14A 3C9CA 2P9PC 3RLMD 3SMRA 4J82A 4FA4D 3DSMA 4IMMA 5K19A 3P4FA 4J8BA 1RI6A 3RSEC 5FKTA 5TEEA 3OTTA 1SHYB 4PNKB 4JT6C 4A09A 1GXRA 1GG2B 4HDJA 2OJYA 4FB1D 1Q47A 2J55H 5AMSA 2P9NC 5CXBA 4A7JA 4CI2A 3PXTD 4A2LA 3EI4B 4LG9A 2CE8A 3K27A 3FRXA 5B4WA 1ERJA 2HKRA 1A0RB 4X63B 5EAPA 4H5JA 2GNQA 3DXMC 4EWRA 4XEIC 3UVLA 3E0CA 5HE0B 3I2NA 4L9OA 4AOWA 5FKSA 4ZOVA 3GFCA 2TRCB 1K32A 4A08B 5CXCB 2H6NA 2OVPB 4MK0B 1B9XA 3EI2A 3F3PA 5EALA 4E5ZA 3KRWB 5IT9g 4CY5A 3OL2A 2H9PA 2YB8B 3K26A 4A11B 5FQDA 4GMBA 4CY3A 3BG0A 4L3HD 4J78A 3AL8A 4Z8LA 1PI6A 3PXWD 2IUPA 3IIWA 3JZGA 1PGUA 3PVUB 5GXIA 4TZ4A 4E5ZB 3V7DB 3MXXA 4PSXB 2HYEA 2MTAH 3JZHA 3W15A 5EMJB 5FKRA 2AGXA 2CNXA 2IUVA 5CXBB 3OKYB 5HE3B 4K3ID 2YNOA 4ESGA 3ODTA 2HJ4A 2OIZA 4J81A 4JSNC 3C75H 2QXVA 2HJBA 3FGBA 3N0EA 3I7OA 3SHFA 5H14A 5FXYA 4FAVD 2UZXB 3B7FA 4GM3A 3JROA 5EMLB 3VA6A 3L4OD 2H47A 2YNPA 4OWRA 4I79A 5I5JA 3SN6B 4L3GD 2Q7QA 3SVWD 4E54B 2G99A 1R5MA 1JJUB 3AL9A 3OKYA 3OL2B 2XL3A 4A11A 2B5MA 1YFQA 1VYHC 5EMMB 4PXWA 3A0FA 4A09B 3IJ1A 3SBPA 3EI3B 2B5LA 3BWSA 2EBSA 3PSCB 5CYKB 4FHLA 1N6FA 1JMZB 5GXHA 3AL8B 2XL2A 5AFU3 1MG3A 4PSWB 3VH0A 4N14A 1QNIA 2AGYA 1JMXB 4QT8A 5K1CC 3RN1D 4J87A 3U4YA 4ZOZA 2CN3A 5FA5B 3CFSB 1MG2A 1OLZA 2AH1A 5C2WB 4Y5RD 3UVKA 1JOFA 1OMWB 5IC7A 4QL1A 3JB9L 4GGDA 3MZLA 3I7NA 3OKTA 5GMKn 4A08A 2HESX 3F3FA 3RMZD 5A2Qg 4O45A 2IAAA 3ORVD 3UVNA 4QQEA 3N0DA 3IKOA 3J80g 2QC5A 5CYKA 3C5MA 1U4CA 2IWFA 2YMUA 3MZKA 4ZOXA 3IJCA 5EAMA 2G9AA 3DWLC 3SCYA 2IUQA 2P9SC 4J84A 4FAND 4AEZA 3AFCA 4FA1D 1XHMA 3RFHA 1NEXB 2I3TA 3PVWB 4O3UB 4GM8A 2GC4A 3EI1A 4PBYA 4ZN4A 4A0BB 1MDAH 2H9NA 5HE1B 2CE9A 4GGAA 4J79A 2IURA 2P9KC 3GREA 4J73A 3JRPA 3NVQA 5HYNB 1B9YA 4U1EI 5C2VB 4CI8A 3OKWA 2Z2NA 4A0AB 4D6VA 2CO0C 3JZNA 4BH6A 4BUJC 2AGZA 3UKRC 3PE7A 3F3GA 1TYQC 4CY2A 4QRJA 2H68A 4NSXA 3V5WB 3EI4A 3SLED 3AH8B 4GGCA 4U7AA 4FWWA 2H3XA 2CN2A 3DXKC 3I8EA 4JD2C 2UZYB 3NVNA 4OZUA 4J77A 4GZ8A 2PM9A 3HFQA 5EM2A 4BL0A 5KDOB 3EI3A 3SJLD 2PM7B 1XKSA 2I3SA 4GQBB 5H1MA 5I5MA 1FWXA 2OVQB 1K8KC 5CXCA 5IGOA 4G56B 4A2MA 3V9FA 4JT5C 2HXCA 3I89A 2HKMA 2XYIA 5HQGA 3OW8A 2PM6B 4IA9A 4UI9R 4GQ1A 3UR4A 2I0RA 4X3EA 4L1QD 5TDHB 4X61B 3I7KA 4J8GA 1GOTB 4O9DA 3EG6A 4J0XA 3RRMC 5EM2B 3FM0A 5TF2A 3UKUC 5EARA 4KFMB 4PC0A 4ERYA 4CI3A 2Z2PA 4LGNA 1P22A 1PEVA 2H6KA
chains in the Genus database with same CATH superfamily
5HE2B 2OVRB 1UOQA 2HU7A 4O3TB 2H6QA 1NR0A 4YVDA 5SXMA 4XYHA 5C9ZB 1GP2B 3UVMA 2XE4A 4FA9D 5THAA 4Z7OA 1SQ9A 4D0KA 5H17A 1VZ2A 2XZGA 2AGWA 4X60B 5E6SA 3ZWLB 3CIKB 5TEFA 4K3JB 4O2WA 2H13A 3MVDK 3MUNA 4A0AA 4O1QD 2W18A 2GC7A 4NAAA 5GSAA 4CC9A 5FKQA 4PBZA 3SBRA 3NVXA 2P9UC 4J0WA 2VDQA 4AX4A 5IJ7E 4R7AB 1PBYB 4XYIA 2B5NA 3SFZA 3DM0A 4A0BA 3EI2B 3JPXA 1L0QA 3SWSD 2IWKA 2OK4A 3EI1B 3K72A 4ES0A 2P9IC 3IJ0A 3I8CA 2PM9B 3RFGA 3KRXB 4JXMA 5I5IA 2CO0A 4CZVA 3K71A 2I0SA 1U2VC 2YBAA 4LG8A 5FFOA 3CFVA 3UVOA 2OK6A 4AN1A 4E54A 2AGLA 2H9MA 4AMYA 4ZOYA 3I7HA 1XIPA 3BG1A 5FLXg 4WJKA 4JSXC 3RN0D 3VI3A 1SQJA 2BBKH 4JSVC 4CZXA 4Y7RA 2AQ5A 4ERQA 5IJ8E 1S4UX 2VDOA 4JSPC 2XU7A 4Z7NA 1TBGA 3SBQA 3IIYA 4WK2A 2O9KA 3JAMg 5C92A 2BCJB 4CI1A 3QI0A 4H5IA 1UOPA 2Z2OA 4RE5A 4CZYA 2B4EA 3L4MD 5JWZA 2J57G 2H9LA 3MKQA 3MMYA 1N6EA 4J86A 1H2ZA 4CY1A 3I7PA 2PBIB 2I0TA 3V4PA 3ULEC 3EU7A 4ERZA 3J81g 2VZ3A 4GM9A 3I7LA 5AJAA 4GQ2P 2AH0A 2YNNA 4FA5D 3VGZA 3SXTD 3MKSB 3PXSD 1M1XA 2J56H 2P9LC 3VI4A 3EWEA 5EMKB 4DNVA 3PSLA 4NC4A 5IGQA 1N6DA 3EMHA 3C99A 2H14A 3C9CA 2P9PC 3RLMD 3SMRA 4J82A 1H2XA 4FA4D 3DSMA 4IMMA 5K19A 3P4FA 4J8BA 1RI6A 1VZ3A 3RSEC 5FKTA 5TEEA 3OTTA 1SHYB 4PNKB 3ZDYA 4JT6C 4A09A 4AN0A 3T3PA 1GXRA 1GG2B 5M5RA 3O4HA 4HDJA 3EQ7A 2OJYA 3IUMA 4FB1D 1Q47A 2QZPA 2J55H 5AMSA 2P9NC 1GOFA 5CXBA 4A7JA 4CI2A 3PXTD 4A2LA 3EI4B 4LG9A 2CE8A 3K27A 3FRXA 5B4WA 1ERJA 2HKRA 2VDPA 1A0RB 4X63B 5EAPA 4H5JA 2GNQA 3DXMC 4EWRA 4XEIC 3UVLA 1JTDB 2VDKA 1YR2A 3E0CA 5HE0B 3I2NA 4L9OA 4AOWA 5FKSA 4ZOVA 1H2YA 3GFCA 2TRCB 1K32A 3ZE2A 3ZDZA 4A08B 1T2XA 5CXCB 2EIBA 2H6NA 2OVPB 4MK0B 1B9XA 3EI2A 2VDLA 4MMZA 3F3PA 5HDBA 5EALA 3IVMA 4E5ZA 3KRWB 5IT9g 4UM8A 2VC2A 4BCDA 4CY5A 3OL2A 2H9PA 2YB8B 3K26A 4A11B 4MMYA 5FQDA 4DNUA 4GMBA 4CY3A 3BG0A 4L3HD 1E5TA 3O4JA 1GOHA 4J78A 3AL8A 4Z8LA 1PI6A 4G55A 4BCCA 2EIEA 3PXWD 2IUPA 3IIWA 3JZGA 1L5GA 1PGUA 1QFMA 3PVUB 3NIFA 5GXIA 4TZ4A 4E5ZB 3V7DB 3MXXA 3IUJA 3IURA 3IJEA 3O4IA 4PSXB 2HYEA 2MTAH 3JZHA 4L1MA 2EIDA 3W15A 5EMJB 3NIDA 5FKRA 2AGXA 2CNXA 2IUVA 5CXBB 4DNWA 3OKYB 5HE3B 4K3ID 2YNOA 4ESGA 3ODTA 2HJ4A 2OIZA 4J81A 4JSNC 3C75H 3ZE0A 2JKXA 2QXVA 3EQ8A 2HJBA 2BKLA 3FGBA 3N0EA 3I7OA 3SHFA 1UTCA 5H14A 5FXYA 4FAVD 2UZXB 3B7FA 4GM3A 3JROA 2HU8A 5EMLB 3VA6A 3NIGA 3L4OD 2H47A 2YNPA 1C9IA 4OWRA 4I79A 5I5JA 3SN6B 4L3GD 2Q7QA 3SVWD 4E54B 2G99A 5FFGA 1R5MA 1JJUB 1E8MA 3AL9A 1VE7A 3OL2B 3OKYA 2XL3A 4A11A 4IRZA 3FCUA 2B5MA 1YFQA 1VYHC 5EMMB 4PXWA 3A0FA 4A09B 3IJ1A 3SBPA 3EI3B 2B5LA 3BWSA 2VZ1A 2EBSA 4BP9A 1A12A 3PSCB 5CYKB 4FHLA 3K6SA 4AMZA 1N6FA 2XDWA 4NENA 1JMZB 4G1EA 5GXHA 3AL8B 2XL2A 5AFU3 1MG3A 4PSWB 3MUOA 3DDUA 3VH0A 4MMXA 4N14A 1QNIA 2AGYA 1JMXB 4QT8A 5K1CC 3RN1D 4J87A 3U4YA 4ZOZA 2CN3A 5FA5B 3CFSB 1MG2A 1OLZA 2AH1A 5C2WB 4Y5RD 3UVKA 3FCSA 4G1MA 1JOFA 1OMWB 5IC7A 4QL1A 3JB9L 4GGDA 3GD1I 3MZLA 1QFSA 2WQ8A 3I7NA 4WK4A 3OKTA 3GC3B 2VDRA 5GMKn 4A08A 2HESX 3F3FA 3RMZD 5A2Qg 4O45A 4Z7QA 3V4VA 2IAAA 2VDMA 3ORVD 1O6GA 3UVNA 4QQEA 3N0DA 3IKOA 3J80g 2QC5A 5CYKA 3C5MA 1U4CA 1BPOA 2IWFA 4JHNA 1K3IA 2YMUA 3MZKA 4ZOXA 3IJCA 5EAMA 2G9AA 3ZDXA 1TYEA 5M5TA 3DWLC 3SCYA 2IUQA 1GOGA 1VE6A 2P9SC 4J84A 1UOOA 4FAND 5C86A 4AEZA 5E6RA 3AFCA 4FA1D 1XHMA 3RFHA 2VDNA 1NEXB 2I3TA 3PVWB 3ZE1A 4QAMA 4O3UB 4GM8A 2GC4A 3EI1A 4PBYA 4ZN4A 5M5VA 4BCBA 2HU5A 4A0BB 2EICA 1O6FA 1MDAH 2H9NA 5HE1B 2CE9A 4GGAA 4J79A 2IURA 2P9KC 3GREA 4J73A 3JRPA 3NVQA 5HYNB 1B9YA 4U1EI 3QHYB 5C2VB 3OKWA 4CI8A 2Z2NA 4A0AB 4D6VA 2CO0C 3JZNA 4UM9A 4BH6A 1I2MB 4BUJC 2AGZA 3UKRC 3PE7A 3F3GA 1TYQC 4WK0A 4CY2A 4QRJA 2H68A 1U8CA 4NSXA 3V5WB 5M5SA 3EI4A 3SLED 3AH8B 4GGCA 4U7AA 4FWWA 2H3XA 2CN2A 3DXKC 3I8EA 4JHPC 4JD2C 2UZYB 3NVNA 4OZUA 4J77A 1H2WA 4GZ8A 2PM9A 3HFQA 5EM2A 4O02A 4BL0A 5KDOB 3EI3A 1E8NA 2PM7B 3IULA 3IUNA 3SJLD 1XKSA 2I3SA 4GQBB 4NBMA 5E6UA 5H1MA 4D9SA 3EQ9A 5I5MA 1FWXA 2OVQB 3OF7A 1K8KC 5CXCA 5IGOA 4G56B 4A2MA 3V9FA 4JT5C 2HXCA 3I89A 2HKMA 2XYIA 5HQGA 3OW8A 2PM6B 4IA9A 4UI9R 4GQ1A 3UR4A 2I0RA 4X3EA 3O4GA 4L1QD 5M5UA 5TDHB 4X61B 3I7KA 4J8GA 1GOTB 4O9DA 3EG6A 4J0XA 1JV2A 3RRMC 4RE6A 5EM2B 3IUQA 3FM0A 3T3MA 5TF2A 5M61A 2QR5A 3UKUC 5EARA 4KFMB 4PC0A 4ERYA 4CI3A 2Z2PA 4LGNA 1C9LA 1P22A 1PEVA 3KCIA 4BP8A 2H6KA
chains in the Genus database with same CATH topology
5HE2B 2OVRB 4O3TB 2H6QA 1NR0A 4YVDA 5SXMA 4XYHA 5C9ZB 1GP2B 3UVMA 4FA9D 5THAA 1SQ9A 4D0KA 5H17A 2AGWA 4X60B 3ZWLB 3CIKB 5TEFA 4K3JB 2H13A 4A0AA 4O1QD 2W18A 2GC7A 5GSAA 4CC9A 5FKQA 4PBZA 3SBRA 3NVXA 2P9UC 4J0WA 5IJ7E 4R7AB 1PBYB 4XYIA 2B5NA 3SFZA 3DM0A 4A0BA 3EI2B 3JPXA 1L0QA 3SWSD 2IWKA 2OK4A 3EI1B 4ES0A 2P9IC 3IJ0A 3I8CA 2PM9B 3RFGA 3KRXB 4JXMA 5I5IA 2CO0A 4CZVA 2I0SA 1U2VC 2YBAA 4LG8A 3UVOA 3CFVA 4E54A 2OK6A 2AGLA 2H9MA 4ZOYA 3I7HA 1XIPA 3BG1A 5FLXg 4JSXC 3RN0D 1SQJA 2BBKH 4JSVC 4CZXA 4Y7RA 2AQ5A 4ERQA 5IJ8E 1S4UX 4JSPC 2XU7A 1TBGA 3SBQA 3IIYA 2O9KA 3JAMg 2BCJB 4CI1A 4H5IA 2Z2OA 4CZYA 2B4EA 3L4MD 5JWZA 2J57G 2H9LA 3MKQA 3MMYA 1N6EA 4J86A 4CY1A 3I7PA 2PBIB 2I0TA 3ULEC 3EU7A 4ERZA 3J81g 4GM9A 3I7LA 5AJAA 4GQ2P 2AH0A 2YNNA 4FA5D 3VGZA 3SXTD 3MKSB 3PXSD 2J56H 2P9LC 3EWEA 5EMKB 3PSLA 5IGQA 1N6DA 3EMHA 3C99A 2H14A 3C9CA 2P9PC 3RLMD 3SMRA 4J82A 4FA4D 3DSMA 4IMMA 5K19A 3P4FA 4J8BA 1RI6A 3RSEC 5FKTA 5TEEA 3OTTA 1SHYB 4PNKB 4JT6C 4A09A 1GXRA 1GG2B 4HDJA 2OJYA 4FB1D 1Q47A 2J55H 5AMSA 2P9NC 5CXBA 4A7JA 4CI2A 3PXTD 4A2LA 3EI4B 4LG9A 2CE8A 3K27A 3FRXA 5B4WA 1ERJA 2HKRA 1A0RB 4X63B 5EAPA 4H5JA 2GNQA 3DXMC 4EWRA 4XEIC 3UVLA 3E0CA 5HE0B 3I2NA 4L9OA 4AOWA 5FKSA 4ZOVA 3GFCA 2TRCB 1K32A 4A08B 5CXCB 2H6NA 2OVPB 4MK0B 1B9XA 3EI2A 3F3PA 5EALA 4E5ZA 3KRWB 5IT9g 4CY5A 3OL2A 2H9PA 2YB8B 3K26A 4A11B 5FQDA 4GMBA 4CY3A 3BG0A 4L3HD 4J78A 3AL8A 4Z8LA 1PI6A 3PXWD 2IUPA 3IIWA 3JZGA 1PGUA 3PVUB 5GXIA 4TZ4A 4E5ZB 3V7DB 3MXXA 4PSXB 2HYEA 2MTAH 3JZHA 3W15A 5EMJB 5FKRA 2AGXA 2CNXA 2IUVA 5CXBB 3OKYB 5HE3B 4K3ID 2YNOA 4ESGA 3ODTA 2HJ4A 2OIZA 4J81A 4JSNC 3C75H 2QXVA 2HJBA 3FGBA 3N0EA 3I7OA 3SHFA 5H14A 5FXYA 4FAVD 2UZXB 3B7FA 4GM3A 3JROA 5EMLB 3VA6A 3L4OD 2H47A 2YNPA 4OWRA 4I79A 5I5JA 3SN6B 4L3GD 2Q7QA 3SVWD 4E54B 2G99A 1R5MA 1JJUB 3AL9A 3OKYA 3OL2B 2XL3A 4A11A 2B5MA 1YFQA 1VYHC 5EMMB 4PXWA 3A0FA 4A09B 3IJ1A 3SBPA 3EI3B 2B5LA 3BWSA 2EBSA 3PSCB 5CYKB 4FHLA 1N6FA 1JMZB 5GXHA 3AL8B 2XL2A 5AFU3 1MG3A 4PSWB 3VH0A 4N14A 1QNIA 2AGYA 1JMXB 4QT8A 5K1CC 3RN1D 4J87A 3U4YA 4ZOZA 2CN3A 5FA5B 3CFSB 1MG2A 1OLZA 2AH1A 5C2WB 4Y5RD 3UVKA 1JOFA 1OMWB 5IC7A 4QL1A 3JB9L 4GGDA 3MZLA 3I7NA 3OKTA 5GMKn 4A08A 2HESX 3F3FA 3RMZD 5A2Qg 4O45A 2IAAA 3ORVD 3UVNA 4QQEA 3N0DA 3IKOA 3J80g 2QC5A 5CYKA 3C5MA 1U4CA 2IWFA 2YMUA 3MZKA 4ZOXA 3IJCA 5EAMA 2G9AA 3DWLC 3SCYA 2IUQA 2P9SC 4J84A 4FAND 4AEZA 3AFCA 4FA1D 1XHMA 3RFHA 1NEXB 2I3TA 3PVWB 4O3UB 4GM8A 2GC4A 3EI1A 4PBYA 4ZN4A 4A0BB 1MDAH 2H9NA 5HE1B 2CE9A 4GGAA 4J79A 2IURA 2P9KC 3GREA 4J73A 3JRPA 3NVQA 5HYNB 1B9YA 4U1EI 5C2VB 4CI8A 3OKWA 2Z2NA 4A0AB 4D6VA 2CO0C 3JZNA 4BH6A 4BUJC 2AGZA 3UKRC 3PE7A 3F3GA 1TYQC 4CY2A 4QRJA 2H68A 4NSXA 3V5WB 3EI4A 3SLED 3AH8B 4GGCA 4U7AA 4FWWA 2H3XA 2CN2A 3DXKC 3I8EA 4JD2C 2UZYB 3NVNA 4OZUA 4J77A 4GZ8A 2PM9A 3HFQA 5EM2A 4BL0A 5KDOB 3EI3A 3SJLD 2PM7B 1XKSA 2I3SA 4GQBB 5H1MA 5I5MA 1FWXA 2OVQB 1K8KC 5CXCA 5IGOA 4G56B 4A2MA 3V9FA 4JT5C 2HXCA 3I89A 2HKMA 2XYIA 5HQGA 3OW8A 2PM6B 4IA9A 4UI9R 4GQ1A 3UR4A 2I0RA 4X3EA 4L1QD 5TDHB 4X61B 3I7KA 4J8GA 1GOTB 4O9DA 3EG6A 4J0XA 3RRMC 5EM2B 3FM0A 5TF2A 3UKUC 5EARA 4KFMB 4PC0A 4ERYA 4CI3A 2Z2PA 4LGNA 1P22A 1PEVA 2H6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE2 B;  2OVR B;  4O3T B;  2H6Q A;  1NR0 A;  4YVD A;  5SXM A;  4XYH A;  5C9Z B;  1GP2 B;  3UVM A;  4FA9 D;  5THA A;  1SQ9 A;  4D0K A;  5H17 A;  2AGW A;  4X60 B;  3ZWL B;  3CIK B;  5TEF A;  4K3J B;  2H13 A;  4A0A A;  4O1Q D;  2W18 A;  2GC7 A;  5GSA A;  4CC9 A;  5FKQ A;  4PBZ A;  3SBR A;  3NVX A;  2P9U C;  4J0W A;  5IJ7 E;  4R7A B;  1PBY B;  4XYI A;  2B5N A;  3SFZ A;  3DM0 A;  4A0B A;  3EI2 B;  3JPX A;  1L0Q A;  3SWS D;  2IWK A;  2OK4 A;  3EI1 B;  4ES0 A;  2P9I C;  3IJ0 A;  3I8C A;  2PM9 B;  3RFG A;  3KRX B;  4JXM A;  5I5I A;  2CO0 A;  4CZV A;  2I0S A;  1U2V C;  2YBA A;  4LG8 A;  3UVO A;  3CFV A;  4E54 A;  2OK6 A;  2AGL A;  2H9M A;  4ZOY A;  3I7H A;  1XIP A;  3BG1 A;  5FLX g;  4JSX C;  3RN0 D;  1SQJ A;  2BBK H;  4JSV C;  4CZX A;  4Y7R A;  2AQ5 A;  4ERQ A;  5IJ8 E;  1S4U X;  4JSP C;  2XU7 A;  1TBG A;  3SBQ A;  3IIY A;  2O9K A;  3JAM g;  2BCJ B;  4CI1 A;  4H5I A;  2Z2O A;  4CZY A;  2B4E A;  3L4M D;  5JWZ A;  2J57 G;  2H9L A;  3MKQ A;  3MMY A;  1N6E A;  4J86 A;  4CY1 A;  3I7P A;  2PBI B;  2I0T A;  3ULE C;  3EU7 A;  4ERZ A;  3J81 g;  4GM9 A;  3I7L A;  5AJA A;  4GQ2 P;  2AH0 A;  2YNN A;  4FA5 D;  3VGZ A;  3SXT D;  3MKS B;  3PXS D;  2J56 H;  2P9L C;  3EWE A;  5EMK B;  3PSL A;  5IGQ A;  1N6D A;  3EMH A;  3C99 A;  2H14 A;  3C9C A;  2P9P C;  3RLM D;  3SMR A;  4J82 A;  4FA4 D;  3DSM A;  4IMM A;  5K19 A;  3P4F A;  4J8B A;  1RI6 A;  3RSE C;  5FKT A;  5TEE A;  3OTT A;  1SHY B;  4PNK B;  4JT6 C;  4A09 A;  1GXR A;  1GG2 B;  4HDJ A;  2OJY A;  4FB1 D;  1Q47 A;  2J55 H;  5AMS A;  2P9N C;  5CXB A;  4A7J A;  4CI2 A;  3PXT D;  4A2L A;  3EI4 B;  4LG9 A;  2CE8 A;  3K27 A;  3FRX A;  5B4W A;  1ERJ A;  2HKR A;  1A0R B;  4X63 B;  5EAP A;  4H5J A;  2GNQ A;  3DXM C;  4EWR A;  4XEI C;  3UVL A;  3E0C A;  5HE0 B;  3I2N A;  4L9O A;  4AOW A;  5FKS A;  4ZOV A;  3GFC A;  2TRC B;  1K32 A;  4A08 B;  5CXC B;  2H6N A;  2OVP B;  4MK0 B;  1B9X A;  3EI2 A;  3F3P A;  5EAL A;  4E5Z A;  3KRW B;  5IT9 g;  4CY5 A;  3OL2 A;  2H9P A;  2YB8 B;  3K26 A;  4A11 B;  5FQD A;  4GMB A;  4CY3 A;  3BG0 A;  4L3H D;  4J78 A;  3AL8 A;  4Z8L A;  1PI6 A;  3PXW D;  2IUP A;  3IIW A;  3JZG A;  1PGU A;  3PVU B;  5GXI A;  4TZ4 A;  4E5Z B;  3V7D B;  3MXX A;  4PSX B;  2HYE A;  2MTA H;  3JZH A;  3W15 A;  5EMJ B;  5FKR A;  2AGX A;  2CNX A;  2IUV A;  5CXB B;  3OKY B;  5HE3 B;  4K3I D;  2YNO A;  4ESG A;  3ODT A;  2HJ4 A;  2OIZ A;  4J81 A;  4JSN C;  3C75 H;  2QXV A;  2HJB A;  3FGB A;  3N0E A;  3I7O A;  3SHF A;  5H14 A;  5FXY A;  4FAV D;  2UZX B;  3B7F A;  4GM3 A;  3JRO A;  5EML B;  3VA6 A;  3L4O D;  2H47 A;  2YNP A;  4OWR A;  4I79 A;  5I5J A;  3SN6 B;  4L3G D;  2Q7Q A;  3SVW D;  4E54 B;  2G99 A;  1R5M A;  1JJU B;  3AL9 A;  3OKY A;  3OL2 B;  2XL3 A;  4A11 A;  2B5M A;  1YFQ A;  1VYH C;  5EMM B;  4PXW A;  3A0F A;  4A09 B;  3IJ1 A;  3SBP A;  3EI3 B;  2B5L A;  3BWS A;  2EBS A;  3PSC B;  5CYK B;  4FHL A;  1N6F A;  1JMZ B;  5GXH A;  3AL8 B;  2XL2 A;  5AFU 3;  1MG3 A;  4PSW B;  3VH0 A;  4N14 A;  1QNI A;  2AGY A;  1JMX B;  4QT8 A;  5K1C C;  3RN1 D;  4J87 A;  3U4Y A;  4ZOZ A;  2CN3 A;  5FA5 B;  3CFS B;  1MG2 A;  1OLZ A;  2AH1 A;  5C2W B;  4Y5R D;  3UVK A;  1JOF A;  1OMW B;  5IC7 A;  4QL1 A;  3JB9 L;  4GGD A;  3MZL A;  3I7N A;  3OKT A;  5GMK n;  4A08 A;  2HES X;  3F3F A;  3RMZ D;  5A2Q g;  4O45 A;  2IAA A;  3ORV D;  3UVN A;  4QQE A;  3N0D A;  3IKO A;  3J80 g;  2QC5 A;  5CYK A;  3C5M A;  1U4C A;  2IWF A;  2YMU A;  3MZK A;  4ZOX A;  3IJC A;  5EAM A;  2G9A A;  3DWL C;  3SCY A;  2IUQ A;  2P9S C;  4J84 A;  4FAN D;  4AEZ A;  3AFC A;  4FA1 D;  1XHM A;  3RFH A;  1NEX B;  2I3T A;  3PVW B;  4O3U B;  4GM8 A;  2GC4 A;  3EI1 A;  4PBY A;  4ZN4 A;  4A0B B;  1MDA H;  2H9N A;  5HE1 B;  2CE9 A;  4GGA A;  4J79 A;  2IUR A;  2P9K C;  3GRE A;  4J73 A;  3JRP A;  3NVQ A;  5HYN B;  1B9Y A;  4U1E I;  5C2V B;  4CI8 A;  3OKW A;  2Z2N A;  4A0A B;  4D6V A;  2CO0 C;  3JZN A;  4BH6 A;  4BUJ C;  2AGZ A;  3UKR C;  3PE7 A;  3F3G A;  1TYQ C;  4CY2 A;  4QRJ A;  2H68 A;  4NSX A;  3V5W B;  3EI4 A;  3SLE D;  3AH8 B;  4GGC A;  4U7A A;  4FWW A;  2H3X A;  2CN2 A;  3DXK C;  3I8E A;  4JD2 C;  2UZY B;  3NVN A;  4OZU A;  4J77 A;  4GZ8 A;  2PM9 A;  3HFQ A;  5EM2 A;  4BL0 A;  5KDO B;  3EI3 A;  3SJL D;  2PM7 B;  1XKS A;  2I3S A;  4GQB B;  5H1M A;  5I5M A;  1FWX A;  2OVQ B;  1K8K C;  5CXC A;  5IGO A;  4G56 B;  4A2M A;  3V9F A;  4JT5 C;  2HXC A;  3I89 A;  2HKM A;  2XYI A;  5HQG A;  3OW8 A;  2PM6 B;  4IA9 A;  4UI9 R;  4GQ1 A;  3UR4 A;  2I0R A;  4X3E A;  4L1Q D;  5TDH B;  4X61 B;  3I7K A;  4J8G A;  1GOT B;  4O9D A;  3EG6 A;  4J0X A;  3RRM C;  5EM2 B;  3FM0 A;  5TF2 A;  3UKU C;  5EAR A;  4KFM B;  4PC0 A;  4ERY A;  4CI3 A;  2Z2P A;  4LGN A;  1P22 A;  1PEV A;  2H6K A; 
#chains in the Genus database with same CATH topology
 5HE2 B;  2OVR B;  1UOQ A;  2HU7 A;  4O3T B;  2H6Q A;  1NR0 A;  4YVD A;  5SXM A;  4XYH A;  5C9Z B;  1GP2 B;  3UVM A;  2XE4 A;  4FA9 D;  5THA A;  4Z7O A;  1SQ9 A;  4D0K A;  5H17 A;  1VZ2 A;  2XZG A;  2AGW A;  4X60 B;  5E6S A;  3ZWL B;  3CIK B;  5TEF A;  4K3J B;  4O2W A;  2H13 A;  3MVD K;  3MUN A;  4A0A A;  4O1Q D;  2W18 A;  2GC7 A;  4NAA A;  5GSA A;  4CC9 A;  5FKQ A;  4PBZ A;  3SBR A;  3NVX A;  2P9U C;  4J0W A;  2VDQ A;  4AX4 A;  5IJ7 E;  4R7A B;  1PBY B;  4XYI A;  2B5N A;  3SFZ A;  3DM0 A;  4A0B A;  3EI2 B;  3JPX A;  1L0Q A;  3SWS D;  2IWK A;  2OK4 A;  3EI1 B;  3K72 A;  4ES0 A;  2P9I C;  3IJ0 A;  3I8C A;  2PM9 B;  3RFG A;  3KRX B;  4JXM A;  5I5I A;  2CO0 A;  4CZV A;  3K71 A;  2I0S A;  1U2V C;  2YBA A;  4LG8 A;  5FFO A;  3CFV A;  3UVO A;  2OK6 A;  4AN1 A;  4E54 A;  2AGL A;  2H9M A;  4AMY A;  4ZOY A;  3I7H A;  1XIP A;  3BG1 A;  5FLX g;  4WJK A;  4JSX C;  3RN0 D;  3VI3 A;  1SQJ A;  2BBK H;  4JSV C;  4CZX A;  4Y7R A;  2AQ5 A;  4ERQ A;  5IJ8 E;  1S4U X;  2VDO A;  4JSP C;  2XU7 A;  4Z7N A;  1TBG A;  3SBQ A;  3IIY A;  4WK2 A;  2O9K A;  3JAM g;  5C92 A;  2BCJ B;  4CI1 A;  3QI0 A;  4H5I A;  1UOP A;  2Z2O A;  4RE5 A;  4CZY A;  2B4E A;  3L4M D;  5JWZ A;  2J57 G;  2H9L A;  3MKQ A;  3MMY A;  1N6E A;  4J86 A;  1H2Z A;  4CY1 A;  3I7P A;  2PBI B;  2I0T A;  3V4P A;  3ULE C;  3EU7 A;  4ERZ A;  3J81 g;  2VZ3 A;  4GM9 A;  3I7L A;  5AJA A;  4GQ2 P;  2AH0 A;  2YNN A;  4FA5 D;  3VGZ A;  3SXT D;  3MKS B;  3PXS D;  1M1X A;  2J56 H;  2P9L C;  3VI4 A;  3EWE A;  5EMK B;  4DNV A;  3PSL A;  4NC4 A;  5IGQ A;  1N6D A;  3EMH A;  3C99 A;  2H14 A;  3C9C A;  2P9P C;  3RLM D;  3SMR A;  4J82 A;  1H2X A;  4FA4 D;  3DSM A;  4IMM A;  5K19 A;  3P4F A;  4J8B A;  1RI6 A;  1VZ3 A;  3RSE C;  5FKT A;  5TEE A;  3OTT A;  1SHY B;  4PNK B;  3ZDY A;  4JT6 C;  4A09 A;  4AN0 A;  3T3P A;  1GXR A;  1GG2 B;  5M5R A;  3O4H A;  4HDJ A;  3EQ7 A;  2OJY A;  3IUM A;  4FB1 D;  1Q47 A;  2QZP A;  2J55 H;  5AMS A;  2P9N C;  1GOF A;  5CXB A;  4A7J A;  4CI2 A;  3PXT D;  4A2L A;  3EI4 B;  4LG9 A;  2CE8 A;  3K27 A;  3FRX A;  5B4W A;  1ERJ A;  2HKR A;  2VDP A;  1A0R B;  4X63 B;  5EAP A;  4H5J A;  2GNQ A;  3DXM C;  4EWR A;  4XEI C;  3UVL A;  1JTD B;  2VDK A;  1YR2 A;  3E0C A;  5HE0 B;  3I2N A;  4L9O A;  4AOW A;  5FKS A;  4ZOV A;  1H2Y A;  3GFC A;  2TRC B;  1K32 A;  3ZE2 A;  3ZDZ A;  4A08 B;  1T2X A;  5CXC B;  2EIB A;  2H6N A;  2OVP B;  4MK0 B;  1B9X A;  3EI2 A;  2VDL A;  4MMZ A;  3F3P A;  5HDB A;  5EAL A;  3IVM A;  4E5Z A;  3KRW B;  5IT9 g;  4UM8 A;  2VC2 A;  4BCD A;  4CY5 A;  3OL2 A;  2H9P A;  2YB8 B;  3K26 A;  4A11 B;  4MMY A;  5FQD A;  4DNU A;  4GMB A;  4CY3 A;  3BG0 A;  4L3H D;  1E5T A;  3O4J A;  1GOH A;  4J78 A;  3AL8 A;  4Z8L A;  1PI6 A;  4G55 A;  4BCC A;  2EIE A;  3PXW D;  2IUP A;  3IIW A;  3JZG A;  1L5G A;  1PGU A;  1QFM A;  3PVU B;  3NIF A;  5GXI A;  4TZ4 A;  4E5Z B;  3V7D B;  3MXX A;  3IUJ A;  3IUR A;  3IJE A;  3O4I A;  4PSX B;  2HYE A;  2MTA H;  3JZH A;  4L1M A;  2EID A;  3W15 A;  5EMJ B;  3NID A;  5FKR A;  2AGX A;  2CNX A;  2IUV A;  5CXB B;  4DNW A;  3OKY B;  5HE3 B;  4K3I D;  2YNO A;  4ESG A;  3ODT A;  2HJ4 A;  2OIZ A;  4J81 A;  4JSN C;  3C75 H;  3ZE0 A;  2JKX A;  2QXV A;  3EQ8 A;  2HJB A;  2BKL A;  3FGB A;  3N0E A;  3I7O A;  3SHF A;  1UTC A;  5H14 A;  5FXY A;  4FAV D;  2UZX B;  3B7F A;  4GM3 A;  3JRO A;  2HU8 A;  5EML B;  3VA6 A;  3NIG A;  3L4O D;  2H47 A;  2YNP A;  1C9I A;  4OWR A;  4I79 A;  5I5J A;  3SN6 B;  4L3G D;  2Q7Q A;  3SVW D;  4E54 B;  2G99 A;  5FFG A;  1R5M A;  1JJU B;  1E8M A;  3AL9 A;  1VE7 A;  3OL2 B;  3OKY A;  2XL3 A;  4A11 A;  4IRZ A;  3FCU A;  2B5M A;  1YFQ A;  1VYH C;  5EMM B;  4PXW A;  3A0F A;  4A09 B;  3IJ1 A;  3SBP A;  3EI3 B;  2B5L A;  3BWS A;  2VZ1 A;  2EBS A;  4BP9 A;  1A12 A;  3PSC B;  5CYK B;  4FHL A;  3K6S A;  4AMZ A;  1N6F A;  2XDW A;  4NEN A;  1JMZ B;  4G1E A;  5GXH A;  3AL8 B;  2XL2 A;  5AFU 3;  1MG3 A;  4PSW B;  3MUO A;  3DDU A;  3VH0 A;  4MMX A;  4N14 A;  1QNI A;  2AGY A;  1JMX B;  4QT8 A;  5K1C C;  3RN1 D;  4J87 A;  3U4Y A;  4ZOZ A;  2CN3 A;  5FA5 B;  3CFS B;  1MG2 A;  1OLZ A;  2AH1 A;  5C2W B;  4Y5R D;  3UVK A;  3FCS A;  4G1M A;  1JOF A;  1OMW B;  5IC7 A;  4QL1 A;  3JB9 L;  4GGD A;  3GD1 I;  3MZL A;  1QFS A;  2WQ8 A;  3I7N A;  4WK4 A;  3OKT A;  3GC3 B;  2VDR A;  5GMK n;  4A08 A;  2HES X;  3F3F A;  3RMZ D;  5A2Q g;  4O45 A;  4Z7Q A;  3V4V A;  2IAA A;  2VDM A;  3ORV D;  1O6G A;  3UVN A;  4QQE A;  3N0D A;  3IKO A;  3J80 g;  2QC5 A;  5CYK A;  3C5M A;  1U4C A;  1BPO A;  2IWF A;  4JHN A;  1K3I A;  2YMU A;  3MZK A;  4ZOX A;  3IJC A;  5EAM A;  2G9A A;  3ZDX A;  1TYE A;  5M5T A;  3DWL C;  3SCY A;  2IUQ A;  1GOG A;  1VE6 A;  2P9S C;  4J84 A;  1UOO A;  4FAN D;  5C86 A;  4AEZ A;  5E6R A;  3AFC A;  4FA1 D;  1XHM A;  3RFH A;  2VDN A;  1NEX B;  2I3T A;  3PVW B;  3ZE1 A;  4QAM A;  4O3U B;  4GM8 A;  2GC4 A;  3EI1 A;  4PBY A;  4ZN4 A;  5M5V A;  4BCB A;  2HU5 A;  4A0B B;  2EIC A;  1O6F A;  1MDA H;  2H9N A;  5HE1 B;  2CE9 A;  4GGA A;  4J79 A;  2IUR A;  2P9K C;  3GRE A;  4J73 A;  3JRP A;  3NVQ A;  5HYN B;  1B9Y A;  4U1E I;  3QHY B;  5C2V B;  3OKW A;  4CI8 A;  2Z2N A;  4A0A B;  4D6V A;  2CO0 C;  3JZN A;  4UM9 A;  4BH6 A;  1I2M B;  4BUJ C;  2AGZ A;  3UKR C;  3PE7 A;  3F3G A;  1TYQ C;  4WK0 A;  4CY2 A;  4QRJ A;  2H68 A;  1U8C A;  4NSX A;  3V5W B;  5M5S A;  3EI4 A;  3SLE D;  3AH8 B;  4GGC A;  4U7A A;  4FWW A;  2H3X A;  2CN2 A;  3DXK C;  3I8E A;  4JHP C;  4JD2 C;  2UZY B;  3NVN A;  4OZU A;  4J77 A;  1H2W A;  4GZ8 A;  2PM9 A;  3HFQ A;  5EM2 A;  4O02 A;  4BL0 A;  5KDO B;  3EI3 A;  1E8N A;  2PM7 B;  3IUL A;  3IUN A;  3SJL D;  1XKS A;  2I3S A;  4GQB B;  4NBM A;  5E6U A;  5H1M A;  4D9S A;  3EQ9 A;  5I5M A;  1FWX A;  2OVQ B;  3OF7 A;  1K8K C;  5CXC A;  5IGO A;  4G56 B;  4A2M A;  3V9F A;  4JT5 C;  2HXC A;  3I89 A;  2HKM A;  2XYI A;  5HQG A;  3OW8 A;  2PM6 B;  4IA9 A;  4UI9 R;  4GQ1 A;  3UR4 A;  2I0R A;  4X3E A;  3O4G A;  4L1Q D;  5M5U A;  5TDH B;  4X61 B;  3I7K A;  4J8G A;  1GOT B;  4O9D A;  3EG6 A;  4J0X A;  1JV2 A;  3RRM C;  4RE6 A;  5EM2 B;  3IUQ A;  3FM0 A;  3T3M A;  5TF2 A;  5M61 A;  2QR5 A;  3UKU C;  5EAR A;  4KFM B;  4PC0 A;  4ERY A;  4CI3 A;  2Z2P A;  4LGN A;  1C9L A;  1P22 A;  1PEV A;  3KCI A;  4BP8 A;  2H6K A; 
#chains in the Genus database with same CATH homology
 5HE2 B;  2OVR B;  4O3T B;  2H6Q A;  1NR0 A;  4YVD A;  5SXM A;  4XYH A;  5C9Z B;  1GP2 B;  3UVM A;  4FA9 D;  5THA A;  1SQ9 A;  4D0K A;  5H17 A;  2AGW A;  4X60 B;  3ZWL B;  3CIK B;  5TEF A;  4K3J B;  2H13 A;  4A0A A;  4O1Q D;  2W18 A;  2GC7 A;  5GSA A;  4CC9 A;  5FKQ A;  4PBZ A;  3SBR A;  3NVX A;  2P9U C;  4J0W A;  5IJ7 E;  4R7A B;  1PBY B;  4XYI A;  2B5N A;  3SFZ A;  3DM0 A;  4A0B A;  3EI2 B;  3JPX A;  1L0Q A;  3SWS D;  2IWK A;  2OK4 A;  3EI1 B;  4ES0 A;  2P9I C;  3IJ0 A;  3I8C A;  2PM9 B;  3RFG A;  3KRX B;  4JXM A;  5I5I A;  2CO0 A;  4CZV A;  2I0S A;  1U2V C;  2YBA A;  4LG8 A;  3UVO A;  3CFV A;  4E54 A;  2OK6 A;  2AGL A;  2H9M A;  4ZOY A;  3I7H A;  1XIP A;  3BG1 A;  5FLX g;  4JSX C;  3RN0 D;  1SQJ A;  2BBK H;  4JSV C;  4CZX A;  4Y7R A;  2AQ5 A;  4ERQ A;  5IJ8 E;  1S4U X;  4JSP C;  2XU7 A;  1TBG A;  3SBQ A;  3IIY A;  2O9K A;  3JAM g;  2BCJ B;  4CI1 A;  4H5I A;  2Z2O A;  4CZY A;  2B4E A;  3L4M D;  5JWZ A;  2J57 G;  2H9L A;  3MKQ A;  3MMY A;  1N6E A;  4J86 A;  4CY1 A;  3I7P A;  2PBI B;  2I0T A;  3ULE C;  3EU7 A;  4ERZ A;  3J81 g;  4GM9 A;  3I7L A;  5AJA A;  4GQ2 P;  2AH0 A;  2YNN A;  4FA5 D;  3VGZ A;  3SXT D;  3MKS B;  3PXS D;  2J56 H;  2P9L C;  3EWE A;  5EMK B;  3PSL A;  5IGQ A;  1N6D A;  3EMH A;  3C99 A;  2H14 A;  3C9C A;  2P9P C;  3RLM D;  3SMR A;  4J82 A;  4FA4 D;  3DSM A;  4IMM A;  5K19 A;  3P4F A;  4J8B A;  1RI6 A;  3RSE C;  5FKT A;  5TEE A;  3OTT A;  1SHY B;  4PNK B;  4JT6 C;  4A09 A;  1GXR A;  1GG2 B;  4HDJ A;  2OJY A;  4FB1 D;  1Q47 A;  2J55 H;  5AMS A;  2P9N C;  5CXB A;  4A7J A;  4CI2 A;  3PXT D;  4A2L A;  3EI4 B;  4LG9 A;  2CE8 A;  3K27 A;  3FRX A;  5B4W A;  1ERJ A;  2HKR A;  1A0R B;  4X63 B;  5EAP A;  4H5J A;  2GNQ A;  3DXM C;  4EWR A;  4XEI C;  3UVL A;  3E0C A;  5HE0 B;  3I2N A;  4L9O A;  4AOW A;  5FKS A;  4ZOV A;  3GFC A;  2TRC B;  1K32 A;  4A08 B;  5CXC B;  2H6N A;  2OVP B;  4MK0 B;  1B9X A;  3EI2 A;  3F3P A;  5EAL A;  4E5Z A;  3KRW B;  5IT9 g;  4CY5 A;  3OL2 A;  2H9P A;  2YB8 B;  3K26 A;  4A11 B;  5FQD A;  4GMB A;  4CY3 A;  3BG0 A;  4L3H D;  4J78 A;  3AL8 A;  4Z8L A;  1PI6 A;  3PXW D;  2IUP A;  3IIW A;  3JZG A;  1PGU A;  3PVU B;  5GXI A;  4TZ4 A;  4E5Z B;  3V7D B;  3MXX A;  4PSX B;  2HYE A;  2MTA H;  3JZH A;  3W15 A;  5EMJ B;  5FKR A;  2AGX A;  2CNX A;  2IUV A;  5CXB B;  3OKY B;  5HE3 B;  4K3I D;  2YNO A;  4ESG A;  3ODT A;  2HJ4 A;  2OIZ A;  4J81 A;  4JSN C;  3C75 H;  2QXV A;  2HJB A;  3FGB A;  3N0E A;  3I7O A;  3SHF A;  5H14 A;  5FXY A;  4FAV D;  2UZX B;  3B7F A;  4GM3 A;  3JRO A;  5EML B;  3VA6 A;  3L4O D;  2H47 A;  2YNP A;  4OWR A;  4I79 A;  5I5J A;  3SN6 B;  4L3G D;  2Q7Q A;  3SVW D;  4E54 B;  2G99 A;  1R5M A;  1JJU B;  3AL9 A;  3OKY A;  3OL2 B;  2XL3 A;  4A11 A;  2B5M A;  1YFQ A;  1VYH C;  5EMM B;  4PXW A;  3A0F A;  4A09 B;  3IJ1 A;  3SBP A;  3EI3 B;  2B5L A;  3BWS A;  2EBS A;  3PSC B;  5CYK B;  4FHL A;  1N6F A;  1JMZ B;  5GXH A;  3AL8 B;  2XL2 A;  5AFU 3;  1MG3 A;  4PSW B;  3VH0 A;  4N14 A;  1QNI A;  2AGY A;  1JMX B;  4QT8 A;  5K1C C;  3RN1 D;  4J87 A;  3U4Y A;  4ZOZ A;  2CN3 A;  5FA5 B;  3CFS B;  1MG2 A;  1OLZ A;  2AH1 A;  5C2W B;  4Y5R D;  3UVK A;  1JOF A;  1OMW B;  5IC7 A;  4QL1 A;  3JB9 L;  4GGD A;  3MZL A;  3I7N A;  3OKT A;  5GMK n;  4A08 A;  2HES X;  3F3F A;  3RMZ D;  5A2Q g;  4O45 A;  2IAA A;  3ORV D;  3UVN A;  4QQE A;  3N0D A;  3IKO A;  3J80 g;  2QC5 A;  5CYK A;  3C5M A;  1U4C A;  2IWF A;  2YMU A;  3MZK A;  4ZOX A;  3IJC A;  5EAM A;  2G9A A;  3DWL C;  3SCY A;  2IUQ A;  2P9S C;  4J84 A;  4FAN D;  4AEZ A;  3AFC A;  4FA1 D;  1XHM A;  3RFH A;  1NEX B;  2I3T A;  3PVW B;  4O3U B;  4GM8 A;  2GC4 A;  3EI1 A;  4PBY A;  4ZN4 A;  4A0B B;  1MDA H;  2H9N A;  5HE1 B;  2CE9 A;  4GGA A;  4J79 A;  2IUR A;  2P9K C;  3GRE A;  4J73 A;  3JRP A;  3NVQ A;  5HYN B;  1B9Y A;  4U1E I;  5C2V B;  4CI8 A;  3OKW A;  2Z2N A;  4A0A B;  4D6V A;  2CO0 C;  3JZN A;  4BH6 A;  4BUJ C;  2AGZ A;  3UKR C;  3PE7 A;  3F3G A;  1TYQ C;  4CY2 A;  4QRJ A;  2H68 A;  4NSX A;  3V5W B;  3EI4 A;  3SLE D;  3AH8 B;  4GGC A;  4U7A A;  4FWW A;  2H3X A;  2CN2 A;  3DXK C;  3I8E A;  4JD2 C;  2UZY B;  3NVN A;  4OZU A;  4J77 A;  4GZ8 A;  2PM9 A;  3HFQ A;  5EM2 A;  4BL0 A;  5KDO B;  3EI3 A;  3SJL D;  2PM7 B;  1XKS A;  2I3S A;  4GQB B;  5H1M A;  5I5M A;  1FWX A;  2OVQ B;  1K8K C;  5CXC A;  5IGO A;  4G56 B;  4A2M A;  3V9F A;  4JT5 C;  2HXC A;  3I89 A;  2HKM A;  2XYI A;  5HQG A;  3OW8 A;  2PM6 B;  4IA9 A;  4UI9 R;  4GQ1 A;  3UR4 A;  2I0R A;  4X3E A;  4L1Q D;  5TDH B;  4X61 B;  3I7K A;  4J8G A;  1GOT B;  4O9D A;  3EG6 A;  4J0X A;  3RRM C;  5EM2 B;  3FM0 A;  5TF2 A;  3UKU C;  5EAR A;  4KFM B;  4PC0 A;  4ERY A;  4CI3 A;  2Z2P A;  4LGN A;  1P22 A;  1PEV A;  2H6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...