3NVNA

Molecular mechanism of guidance cue recognition
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
383
structure length
383
Chain Sequence
SIEWHKFETSEEIISTYLIDDVLYTGVNGAVYTFSNNELNKTGLTNNNNYITTSIKVEDTLVCGTNNGNPKCWKIDGSEDPKYRGRGYAPYQNSKVTIISHNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGVRGAFVDKDGTYDKVYILFTDTIDTKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSKAIKTDNDTILYVFFDSPYSKSALCTYSMNAIKHSFSTSKLGGYTKQLPSPAPGICLPAGKVVPHTTFDIIEQYNELDDIIKPLSQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENTIYSFDTKSKQTRSAQVDARLFSVMVTSKPLFIADIGIGVGIPRMKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
pubmed doi rcsb
source organism Ectromelia virus
molecule tags Viral protein/signaling protein
molecule keywords EVM139
total genus 76
structure length 383
sequence length 383
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3nvnA00
3RN1D 4FAND 5EARA 5B4WA 2H6QA 4GQ1A 3SN6B 3RMZD 4PBZA 2I0TA 2CE8A 4GGDA 2OK6A 2YNPA 4J84A 3V9FA 4D0KA 5HYNB 3SFZA 4ES0A 1JMZB 1PBYB 1SHYB 2HKRA 2YNOA 4ZOYA 2Z2PA 1JMXB 4CI2A 3UR4A 4A09A 1YFQA 5GXIA 5GXHA 3I89A 3HFQA 4E5ZB 5K19A 3NVQA 2H6KA 2P9SC 2YBAA 3E0CA 1B9XA 4A7JA 1P22A 4GMBA 2Q7QA 3GFCA 3UVOA 3P4FA 4CY3A 1XIPA 1GXRA 4J79A 2XL3A 4PXWA 5FKTA 4X3EA 3UKRC 4BH6A 5IGOA 4CZXA 2IAAA 2IUQA 5H1MA 3I7LA 2CNXA 3MXXA 4O9DA 4Y7RA 3A0FA 3SMRA 4H5JA 3RFGA 5CYKB 2AQ5A 2IURA 2PBIB 2H9PA 5FXYA 3DXKC 4J82A 3OW8A 3N0EA 4EWRA 4L1QD 4FAVD 4PNKB 4A0AB 3UKUC 4QL1A 4ERZA 2P9UC 3SBPA 3BG1A 3JROA 2IWKA 4CC9A 3EU7A 3OL2B 3EMHA 4O3TB 1L0QA 5H17A 4A0BA 5IJ8E 3ORVD 3NVNA 3DWLC 4K3ID 5HE3B 2OK4A 5FKQA 5TF2A 3EI4B 4BUJC 4TZ4A 3OKYB 4N14A 1K8KC 2CO0C 3RFHA 3EG6A 1N6DA 2AGYA 2AGLA 4O3UB 5EM2A 2UZXB 1MDAH 3C9CA 4J86A 2W18A 3PE7A 3I7PA 4XEIC 4GQBB 2HJBA 2B5LA 4CI3A 1RI6A 4ZN4A 3JB9L 4J77A 5AFU3 5EAMA 2PM9A 3DXMC 5IJ7E 4O1QD 5TEFA 3OL2A 3C5MA 2H6NA 2I3TA 1Q47A 3KRXB 4JXMA 3SBQA 3PXSD 1R5MA 4JSPC 1PGUA 5FLXg 2P9IC 3I7KA 3ULEC 3U4YA 2TRCB 4A09B 3EWEA 3L4OD 4J81A 1NEXB 2I0SA 2OVPB 4GM8A 1MG3A 2OJYA 3J80g 1XKSA 3JZHA 4O45A 4GM3A 3EI3A 3MKQA 4FHLA 4J0XA 4JT5C 5FA5B 2OVRB 2P9PC 2B4EA 2J55H 3MMYA 2B5MA 3EI2B 3RSEC 5IC7A 2BCJB 3ZWLB 4YVDA 5CXCB 3UVMA 5I5IA 4A0AA 5EMJB 3AL9A 3K26A 3SCYA 5KDOB 3I7NA 4GGAA 2H47A 4CY2A 1XHMA 3CFSB 4FWWA 3PVUB 3C99A 3N0DA 3KRWB 5TEEA 3IJ1A 3EI1A 1GOTB 5EAPA 2HKMA 5CXCA 3SLED 3AL8B 3IIYA 4OZUA 4QT8A 4CI8A 4ZOVA 3RRMC 1GP2B 3C75H 3FGBA 5I5MA 3F3PA 4CZVA 4GQ2P 4D6VA 4L3GD 3I7OA 3IKOA 5GMKn 4LGNA 5K1CC 4ESGA 4A2LA 5CXBA 2J56H 2CO0A 3VA6A 3SBRA 3JZGA 4FB1D 2P9LC 5EMKB 3SVWD 3CFVA 2H9LA 3EI4A 3AFCA 2XL2A 1K32A 4J87A 3UVLA 2H13A 3JRPA 4FA5D 1JOFA 2XYIA 4I79A 3PSLA 3UVNA 4E5ZA 2J57G 1S4UX 2G99A 2BBKH 1A0RB 2H14A 5CXBB 3I2NA 4LG9A 2YNNA 4CI1A 1B9YA 1JJUB 2OVQB 4UI9R 3VGZA 3PXTD 4U7AA 1VYHC 3VH0A 3L4MD 4A11B 3PXWD 3UVKA 2G9AA 4BL0A 1OLZA 5A2Qg 3F3GA 2OIZA 2XU7A 4R7AB 4AEZA 3SXTD 4AOWA 5JWZA 4A0BB 3FM0A 3V5WB 4JT6C 2MTAH 3ODTA 4X63B 5TDHB 2PM6B 3IJCA 3RN0D 5IGQA 2I0RA 4JSVC 4JD2C 3I8CA 1N6EA 5C2VB 4U1EI 3MKSB 2H68A 1FWXA 3OKTA 2HJ4A 3JPXA 2HYEA 2IWFA 4G56B 2AGXA 2AGZA 4PBYA 5I5JA 2CE9A 5EMMB 5IT9g 3GREA 4J8BA 4E54A 4L9OA 3V7DB 4X61B 4GM9A 3F3FA 2O9KA 3DSMA 2AH0A 1QNIA 4CY5A 2UZYB 4QQEA 3OKWA 4E54B 3IJ0A 4Y5RD 2GC4A 5EALA 4PSWB 3JAMg 3W15A 2QXVA 4ZOXA 1SQJA 5CYKA 4NSXA 5H14A 2GC7A 1PI6A 2H9MA 5HQGA 2P9KC 1NR0A 1PEVA 2YB8B 5AMSA 2AGWA 3FRXA 4KFMB 3EI1B 2QC5A 4HDJA 5SXMA 2Z2NA 4X60B 3I7HA 4GZ8A 2Z2OA 4JSXC 3AH8B 2EBSA 4XYHA 4H5IA 4J78A 2H3XA 4MK0B 1GG2B 3I8EA 2GNQA 4FA9D 3SHFA 2HESX 4CZYA 2AH1A 2H9NA 3EI3B 3NVXA 4PC0A 5FKRA 3JZNA 3IIWA 3PVWB 4GGCA 2IUPA 3EI2A 2PM9B 3PSCB 4LG8A 5THAA 3MZLA 3AL8A 4J73A 4XYIA 4JSNC 2I3SA 1OMWB 2CN3A 3SWSD 2CN2A 4CY1A 3J81g 1N6FA 3DM0A 3MZKA 3OTTA 4IA9A 4J8GA 4QRJA 4Z8LA 3K27A 3CIKB 5HE1B 4ZOZA 1TYQC 3SJLD 4A08B 4A11A 5C2WB 4J0WA 4OWRA 1SQ9A 3BG0A 2HXCA 2B5NA 5HE0B 1U4CA 4A08A 2P9NC 4FA4D 4ERQA 4ERYA 5FQDA 4A2MA 5GSAA 1ERJA 1TBGA 1MG2A 5EM2B 2YMUA 3BWSA 5C9ZB 4IMMA 1U2VC 5AJAA 3OKYA 5EMLB 5HE2B 5FKSA 3RLMD 3B7FA 4PSXB 2IUVA 4FA1D 4L3HD 4K3JB 2PM7B
chains in the Genus database with same CATH superfamily
3RN1D 4FAND 5EARA 4Z7QA 5B4WA 4BP9A 2H6QA 4GQ1A 3SN6B 3RMZD 4PBZA 2I0TA 2CE8A 4GGDA 2OK6A 2YNPA 4J84A 3V9FA 4WK0A 4D0KA 5HYNB 3SFZA 4ES0A 3NIFA 1JMZB 1PBYB 1SHYB 2HKRA 2YNOA 3IULA 3T3MA 4ZOYA 3ZDZA 2Z2PA 1I2MB 1JMXB 4CI2A 3UR4A 4A09A 1YFQA 5GXIA 5GXHA 3I89A 3HFQA 4E5ZB 2XZGA 5K19A 5HDBA 3NVQA 2H6KA 2P9SC 2YBAA 3E0CA 1B9XA 3MVDK 4A7JA 1P22A 4GMBA 2Q7QA 3GFCA 3UVOA 3P4FA 4CY3A 4RE6A 1XIPA 3EQ7A 1GXRA 4J79A 2XL3A 4PXWA 5FKTA 4X3EA 3UKRC 4BH6A 5IGOA 4CZXA 2IAAA 2IUQA 5H1MA 3K6SA 3I7LA 1BPOA 2CNXA 3MXXA 4O9DA 4Y7RA 3A0FA 3NIDA 3SMRA 4H5JA 3RFGA 5CYKB 2AQ5A 5M5SA 2IURA 2PBIB 2H9PA 5FXYA 4BCDA 3DXKC 4J82A 3OW8A 2XE4A 1YR2A 3N0EA 3ZDXA 2HU5A 4EWRA 4L1QD 2VZ1A 4FAVD 2VDPA 4PNKB 5M5TA 1VZ3A 3MUOA 4A0AB 3UKUC 4QL1A 4ERZA 2P9UC 3SBPA 3BG1A 3JROA 3O4JA 2IWKA 5M61A 2EIEA 4CC9A 3EU7A 2VDOA 3OL2B 3EMHA 4O3TB 1L0QA 5H17A 4A0BA 5IJ8E 3ORVD 3K72A 3NVNA 3DWLC 4K3ID 5HE3B 1UOOA 2OK4A 2VDKA 4IRZA 3EI4B 5FKQA 5TF2A 4BUJC 4NENA 4TZ4A 3OKYB 4N14A 4Z7OA 1K8KC 2CO0C 2EICA 3RFHA 3EG6A 1N6DA 2AGYA 2AGLA 4O3UB 1UOPA 5EM2A 2UZXB 1MDAH 3C9CA 4J86A 2W18A 3PE7A 3I7PA 4XEIC 4GQBB 1JV2A 2HJBA 2B5LA 4CI3A 3FCUA 1RI6A 4ZN4A 3JB9L 3GC3B 4J77A 5AFU3 5EAMA 2PM9A 2HU7A 3DXMC 5IJ7E 4O1QD 5TEFA 3OL2A 3C5MA 2H6NA 2I3TA 1Q47A 1VE6A 3KRXB 4JXMA 4L1MA 1E5TA 3SBQA 3PXSD 2EIBA 3ZE0A 2BKLA 1R5MA 4JSPC 1PGUA 3IUMA 4JHPC 5FLXg 2P9IC 3I7KA 3ULEC 3U4YA 4AN0A 2TRCB 2VDLA 4A09B 1U8CA 3EWEA 3L4OD 4J81A 1NEXB 2I0SA 2OVPB 1MG3A 2OJYA 4GM8A 3J80g 1XKSA 3JZHA 5E6SA 4O45A 4GM3A 3VI4A 3EI3A 3MKQA 4FHLA 3ZE1A 4J0XA 4JT5C 5FA5B 2OVRB 2P9PC 2QZPA 3IJEA 3V4PA 2B4EA 2J55H 3MMYA 2B5MA 3EI2B 3RSEC 1C9IA 5IC7A 2BCJB 5FFGA 3ZWLB 4YVDA 5CXCB 3UVMA 5I5IA 4A0AA 5EMJB 4AX4A 3AL9A 2VC2A 3K26A 3SCYA 5KDOB 1E8MA 3I7NA 4GGAA 4UM8A 2H47A 1T2XA 1XHMA 3CFSB 4CY2A 4FWWA 1GOGA 3PVUB 4AMYA 3C99A 5M5UA 3N0DA 3KRWB 5TEEA 1VE7A 3IJ1A 3EI1A 4WK2A 1GOTB 3IUQA 5EAPA 3OF7A 2HKMA 5CXCA 3SLED 3AL8B 3IIYA 4OZUA 4WK4A 4QT8A 4CI8A 4ZOVA 3RRMC 1GP2B 3C75H 3FGBA 5I5MA 3F3PA 4CZVA 3ZE2A 4GQ2P 4D6VA 5M5RA 4L3GD 3I7OA 3IKOA 5GMKn 2VDRA 4LGNA 5K1CC 4ESGA 4A2LA 1GOFA 2J56H 5CXBA 2CO0A 2WQ8A 3VA6A 3SBRA 3JZGA 4FB1D 1QFSA 2P9LC 3DDUA 3O4GA 4G1MA 5EMKB 3SVWD 3CFVA 2VDQA 2H9LA 3EI4A 3AFCA 2XL2A 1K32A 3GD1I 3IUNA 4J87A 3UVLA 2H13A 3JRPA 4NAAA 1JOFA 4FA5D 2XYIA 4I79A 3PSLA 3UVNA 4E5ZA 2J57G 3QHYB 4MMZA 4MMYA 1S4UX 2G99A 2BBKH 1GOHA 1A0RB 2H14A 1QFMA 5CXBB 3I2NA 3MUNA 1L5GA 2YNNA 4LG9A 3K71A 4CI1A 1B9YA 1JJUB 2OVQB 4Z7NA 4UI9R 3VGZA 3PXTD 4U7AA 1VYHC 3VH0A 3L4MD 4A11B 3PXWD 3UVKA 2G9AA 4BL0A 1OLZA 3KCIA 5A2Qg 3F3GA 3EQ9A 2QR5A 1UOQA 2OIZA 2XU7A 4R7AB 4AEZA 3SXTD 4G55A 4AOWA 5JWZA 4A0BB 4NBMA 3FM0A 3V5WB 4JT6C 2MTAH 3ODTA 4X63B 5TDHB 2PM6B 3IJCA 3RN0D 5IGQA 3ZDYA 3V4VA 2I0RA 4JSVC 4JD2C 4MMXA 3I8CA 1N6EA 4JHNA 4DNWA 5C2VB 4U1EI 3MKSB 2H68A 1FWXA 3OKTA 2HJ4A 3QI0A 3JPXA 2HYEA 2IWFA 1JTDB 4G56B 2AGXA 2AGZA 1O6FA 4PBYA 2CE9A 5I5JA 4AN1A 5EMMB 5IT9g 3GREA 4J8BA 4WJKA 4E54A 4L9OA 3V7DB 4X61B 4GM9A 3F3FA 2O9KA 3DSMA 5M5VA 3T3PA 2AH0A 1QNIA 4CY5A 2UZYB 4QQEA 3OKWA 4E54B 2VDNA 3IJ0A 4DNUA 4Y5RD 2GC4A 2EIDA 1H2ZA 5EALA 4PSWB 3JAMg 3W15A 4D9SA 2QXVA 4ZOXA 1SQJA 5CYKA 4NSXA 5H14A 3FCSA 1PI6A 2GC7A 2H9MA 5HQGA 2P9KC 1NR0A 1PEVA 2YB8B 5AMSA 1C9LA 1K3IA 2AGWA 3FRXA 4KFMB 3EI1B 2QC5A 4HDJA 5SXMA 2Z2NA 4X60B 3I7HA 4GZ8A 2Z2OA 4JSXC 1VZ2A 5FFOA 3AH8B 2EBSA 4G1EA 4XYHA 4H5IA 4J78A 2H3XA 4QAMA 3VI3A 4MK0B 1GG2B 3I8EA 1M1XA 2GNQA 4FA9D 3O4HA 3SHFA 2HESX 4CZYA 2JKXA 5C92A 2AH1A 2H9NA 3EI3B 1TYEA 3NVXA 4PC0A 5E6UA 5FKRA 3IVMA 3JZNA 3PVWB 3IIWA 4GGCA 4DNVA 2IUPA 3EI2A 2PM9B 3PSCB 4LG8A 4UM9A 5THAA 3MZLA 3AL8A 4J73A 4BP8A 2VDMA 4XYIA 4AMZA 4JSNC 2I3SA 1OMWB 2CN3A 3SWSD 2CN2A 4CY1A 3J81g 1N6FA 2VZ3A 5C86A 3DM0A 3MZKA 3OTTA 3NIGA 1A12A 4IA9A 4BCBA 1UTCA 3IURA 4J8GA 4QRJA 3K27A 3CIKB 4Z8LA 5HE1B 5E6RA 4ZOZA 1TYQC 3SJLD 4A08B 4A11A 5C2WB 4BCCA 3EQ8A 4J0WA 4OWRA 1SQ9A 3BG0A 1O6GA 2HXCA 2B5NA 5HE0B 1U4CA 4O2WA 4A08A 2XDWA 1H2YA 1E8NA 2P9NC 4FA4D 3IUJA 1H2WA 4ERQA 4RE5A 1H2XA 4ERYA 5FQDA 4NC4A 4A2MA 5GSAA 1ERJA 1TBGA 1MG2A 2HU8A 3O4IA 5EM2B 2YMUA 3BWSA 5C9ZB 4IMMA 4O02A 1U2VC 5AJAA 3OKYA 5EMLB 5HE2B 5FKSA 3RLMD 3B7FA 4PSXB 2IUVA 4FA1D 4L3HD 4K3JB 2PM7B
chains in the Genus database with same CATH topology
3RN1D 4FAND 5EARA 5B4WA 2H6QA 4GQ1A 3SN6B 3RMZD 4PBZA 2I0TA 2CE8A 4GGDA 2OK6A 2YNPA 4J84A 3V9FA 4D0KA 5HYNB 3SFZA 4ES0A 1JMZB 1PBYB 1SHYB 2HKRA 2YNOA 4ZOYA 2Z2PA 1JMXB 4CI2A 3UR4A 4A09A 1YFQA 5GXIA 5GXHA 3I89A 3HFQA 4E5ZB 5K19A 3NVQA 2H6KA 2P9SC 2YBAA 3E0CA 1B9XA 4A7JA 1P22A 4GMBA 2Q7QA 3GFCA 3UVOA 3P4FA 4CY3A 1XIPA 1GXRA 4J79A 2XL3A 4PXWA 5FKTA 4X3EA 3UKRC 4BH6A 5IGOA 4CZXA 2IAAA 2IUQA 5H1MA 3I7LA 2CNXA 3MXXA 4O9DA 4Y7RA 3A0FA 3SMRA 4H5JA 3RFGA 5CYKB 2AQ5A 2IURA 2PBIB 2H9PA 5FXYA 3DXKC 4J82A 3OW8A 3N0EA 4EWRA 4L1QD 4FAVD 4PNKB 4A0AB 3UKUC 4QL1A 4ERZA 2P9UC 3SBPA 3BG1A 3JROA 2IWKA 4CC9A 3EU7A 3OL2B 3EMHA 4O3TB 1L0QA 5H17A 4A0BA 5IJ8E 3ORVD 3NVNA 3DWLC 4K3ID 5HE3B 2OK4A 5FKQA 5TF2A 3EI4B 4BUJC 4TZ4A 3OKYB 4N14A 1K8KC 2CO0C 3RFHA 3EG6A 1N6DA 2AGYA 2AGLA 4O3UB 5EM2A 2UZXB 1MDAH 3C9CA 4J86A 2W18A 3PE7A 3I7PA 4XEIC 4GQBB 2HJBA 2B5LA 4CI3A 1RI6A 4ZN4A 3JB9L 4J77A 5AFU3 5EAMA 2PM9A 3DXMC 5IJ7E 4O1QD 5TEFA 3OL2A 3C5MA 2H6NA 2I3TA 1Q47A 3KRXB 4JXMA 3SBQA 3PXSD 1R5MA 4JSPC 1PGUA 5FLXg 2P9IC 3I7KA 3ULEC 3U4YA 2TRCB 4A09B 3EWEA 3L4OD 4J81A 1NEXB 2I0SA 2OVPB 4GM8A 1MG3A 2OJYA 3J80g 1XKSA 3JZHA 4O45A 4GM3A 3EI3A 3MKQA 4FHLA 4J0XA 4JT5C 5FA5B 2OVRB 2P9PC 2B4EA 2J55H 3MMYA 2B5MA 3EI2B 3RSEC 5IC7A 2BCJB 3ZWLB 4YVDA 5CXCB 3UVMA 5I5IA 4A0AA 5EMJB 3AL9A 3K26A 3SCYA 5KDOB 3I7NA 4GGAA 2H47A 4CY2A 1XHMA 3CFSB 4FWWA 3PVUB 3C99A 3N0DA 3KRWB 5TEEA 3IJ1A 3EI1A 1GOTB 5EAPA 2HKMA 5CXCA 3SLED 3AL8B 3IIYA 4OZUA 4QT8A 4CI8A 4ZOVA 3RRMC 1GP2B 3C75H 3FGBA 5I5MA 3F3PA 4CZVA 4GQ2P 4D6VA 4L3GD 3I7OA 3IKOA 5GMKn 4LGNA 5K1CC 4ESGA 4A2LA 5CXBA 2J56H 2CO0A 3VA6A 3SBRA 3JZGA 4FB1D 2P9LC 5EMKB 3SVWD 3CFVA 2H9LA 3EI4A 3AFCA 2XL2A 1K32A 4J87A 3UVLA 2H13A 3JRPA 4FA5D 1JOFA 2XYIA 4I79A 3PSLA 3UVNA 4E5ZA 2J57G 1S4UX 2G99A 2BBKH 1A0RB 2H14A 5CXBB 3I2NA 4LG9A 2YNNA 4CI1A 1B9YA 1JJUB 2OVQB 4UI9R 3VGZA 3PXTD 4U7AA 1VYHC 3VH0A 3L4MD 4A11B 3PXWD 3UVKA 2G9AA 4BL0A 1OLZA 5A2Qg 3F3GA 2OIZA 2XU7A 4R7AB 4AEZA 3SXTD 4AOWA 5JWZA 4A0BB 3FM0A 3V5WB 4JT6C 2MTAH 3ODTA 4X63B 5TDHB 2PM6B 3IJCA 3RN0D 5IGQA 2I0RA 4JSVC 4JD2C 3I8CA 1N6EA 5C2VB 4U1EI 3MKSB 2H68A 1FWXA 3OKTA 2HJ4A 3JPXA 2HYEA 2IWFA 4G56B 2AGXA 2AGZA 4PBYA 5I5JA 2CE9A 5EMMB 5IT9g 3GREA 4J8BA 4E54A 4L9OA 3V7DB 4X61B 4GM9A 3F3FA 2O9KA 3DSMA 2AH0A 1QNIA 4CY5A 2UZYB 4QQEA 3OKWA 4E54B 3IJ0A 4Y5RD 2GC4A 5EALA 4PSWB 3JAMg 3W15A 2QXVA 4ZOXA 1SQJA 5CYKA 4NSXA 5H14A 2GC7A 1PI6A 2H9MA 5HQGA 2P9KC 1NR0A 1PEVA 2YB8B 5AMSA 2AGWA 3FRXA 4KFMB 3EI1B 2QC5A 4HDJA 5SXMA 2Z2NA 4X60B 3I7HA 4GZ8A 2Z2OA 4JSXC 3AH8B 2EBSA 4XYHA 4H5IA 4J78A 2H3XA 4MK0B 1GG2B 3I8EA 2GNQA 4FA9D 3SHFA 2HESX 4CZYA 2AH1A 2H9NA 3EI3B 3NVXA 4PC0A 5FKRA 3JZNA 3IIWA 3PVWB 4GGCA 2IUPA 3EI2A 2PM9B 3PSCB 4LG8A 5THAA 3MZLA 3AL8A 4J73A 4XYIA 4JSNC 2I3SA 1OMWB 2CN3A 3SWSD 2CN2A 4CY1A 3J81g 1N6FA 3DM0A 3MZKA 3OTTA 4IA9A 4J8GA 4QRJA 4Z8LA 3K27A 3CIKB 5HE1B 4ZOZA 1TYQC 3SJLD 4A08B 4A11A 5C2WB 4J0WA 4OWRA 1SQ9A 3BG0A 2HXCA 2B5NA 5HE0B 1U4CA 4A08A 2P9NC 4FA4D 4ERQA 4ERYA 5FQDA 4A2MA 5GSAA 1ERJA 1TBGA 1MG2A 5EM2B 2YMUA 3BWSA 5C9ZB 4IMMA 1U2VC 5AJAA 3OKYA 5EMLB 5HE2B 5FKSA 3RLMD 3B7FA 4PSXB 2IUVA 4FA1D 4L3HD 4K3JB 2PM7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN1 D;  4FAN D;  5EAR A;  5B4W A;  2H6Q A;  4GQ1 A;  3SN6 B;  3RMZ D;  4PBZ A;  2I0T A;  2CE8 A;  4GGD A;  2OK6 A;  2YNP A;  4J84 A;  3V9F A;  4D0K A;  5HYN B;  3SFZ A;  4ES0 A;  1JMZ B;  1PBY B;  1SHY B;  2HKR A;  2YNO A;  4ZOY A;  2Z2P A;  1JMX B;  4CI2 A;  3UR4 A;  4A09 A;  1YFQ A;  5GXI A;  5GXH A;  3I89 A;  3HFQ A;  4E5Z B;  5K19 A;  3NVQ A;  2H6K A;  2P9S C;  2YBA A;  3E0C A;  1B9X A;  4A7J A;  1P22 A;  4GMB A;  2Q7Q A;  3GFC A;  3UVO A;  3P4F A;  4CY3 A;  1XIP A;  1GXR A;  4J79 A;  2XL3 A;  4PXW A;  5FKT A;  4X3E A;  3UKR C;  4BH6 A;  5IGO A;  4CZX A;  2IAA A;  2IUQ A;  5H1M A;  3I7L A;  2CNX A;  3MXX A;  4O9D A;  4Y7R A;  3A0F A;  3SMR A;  4H5J A;  3RFG A;  5CYK B;  2AQ5 A;  2IUR A;  2PBI B;  2H9P A;  5FXY A;  3DXK C;  4J82 A;  3OW8 A;  3N0E A;  4EWR A;  4L1Q D;  4FAV D;  4PNK B;  4A0A B;  3UKU C;  4QL1 A;  4ERZ A;  2P9U C;  3SBP A;  3BG1 A;  3JRO A;  2IWK A;  4CC9 A;  3EU7 A;  3OL2 B;  3EMH A;  4O3T B;  1L0Q A;  5H17 A;  4A0B A;  5IJ8 E;  3ORV D;  3NVN A;  3DWL C;  4K3I D;  5HE3 B;  2OK4 A;  5FKQ A;  5TF2 A;  3EI4 B;  4BUJ C;  4TZ4 A;  3OKY B;  4N14 A;  1K8K C;  2CO0 C;  3RFH A;  3EG6 A;  1N6D A;  2AGY A;  2AGL A;  4O3U B;  5EM2 A;  2UZX B;  1MDA H;  3C9C A;  4J86 A;  2W18 A;  3PE7 A;  3I7P A;  4XEI C;  4GQB B;  2HJB A;  2B5L A;  4CI3 A;  1RI6 A;  4ZN4 A;  3JB9 L;  4J77 A;  5AFU 3;  5EAM A;  2PM9 A;  3DXM C;  5IJ7 E;  4O1Q D;  5TEF A;  3OL2 A;  3C5M A;  2H6N A;  2I3T A;  1Q47 A;  3KRX B;  4JXM A;  3SBQ A;  3PXS D;  1R5M A;  4JSP C;  1PGU A;  5FLX g;  2P9I C;  3I7K A;  3ULE C;  3U4Y A;  2TRC B;  4A09 B;  3EWE A;  3L4O D;  4J81 A;  1NEX B;  2I0S A;  2OVP B;  4GM8 A;  1MG3 A;  2OJY A;  3J80 g;  1XKS A;  3JZH A;  4O45 A;  4GM3 A;  3EI3 A;  3MKQ A;  4FHL A;  4J0X A;  4JT5 C;  5FA5 B;  2OVR B;  2P9P C;  2B4E A;  2J55 H;  3MMY A;  2B5M A;  3EI2 B;  3RSE C;  5IC7 A;  2BCJ B;  3ZWL B;  4YVD A;  5CXC B;  3UVM A;  5I5I A;  4A0A A;  5EMJ B;  3AL9 A;  3K26 A;  3SCY A;  5KDO B;  3I7N A;  4GGA A;  2H47 A;  4CY2 A;  1XHM A;  3CFS B;  4FWW A;  3PVU B;  3C99 A;  3N0D A;  3KRW B;  5TEE A;  3IJ1 A;  3EI1 A;  1GOT B;  5EAP A;  2HKM A;  5CXC A;  3SLE D;  3AL8 B;  3IIY A;  4OZU A;  4QT8 A;  4CI8 A;  4ZOV A;  3RRM C;  1GP2 B;  3C75 H;  3FGB A;  5I5M A;  3F3P A;  4CZV A;  4GQ2 P;  4D6V A;  4L3G D;  3I7O A;  3IKO A;  5GMK n;  4LGN A;  5K1C C;  4ESG A;  4A2L A;  5CXB A;  2J56 H;  2CO0 A;  3VA6 A;  3SBR A;  3JZG A;  4FB1 D;  2P9L C;  5EMK B;  3SVW D;  3CFV A;  2H9L A;  3EI4 A;  3AFC A;  2XL2 A;  1K32 A;  4J87 A;  3UVL A;  2H13 A;  3JRP A;  4FA5 D;  1JOF A;  2XYI A;  4I79 A;  3PSL A;  3UVN A;  4E5Z A;  2J57 G;  1S4U X;  2G99 A;  2BBK H;  1A0R B;  2H14 A;  5CXB B;  3I2N A;  4LG9 A;  2YNN A;  4CI1 A;  1B9Y A;  1JJU B;  2OVQ B;  4UI9 R;  3VGZ A;  3PXT D;  4U7A A;  1VYH C;  3VH0 A;  3L4M D;  4A11 B;  3PXW D;  3UVK A;  2G9A A;  4BL0 A;  1OLZ A;  5A2Q g;  3F3G A;  2OIZ A;  2XU7 A;  4R7A B;  4AEZ A;  3SXT D;  4AOW A;  5JWZ A;  4A0B B;  3FM0 A;  3V5W B;  4JT6 C;  2MTA H;  3ODT A;  4X63 B;  5TDH B;  2PM6 B;  3IJC A;  3RN0 D;  5IGQ A;  2I0R A;  4JSV C;  4JD2 C;  3I8C A;  1N6E A;  5C2V B;  4U1E I;  3MKS B;  2H68 A;  1FWX A;  3OKT A;  2HJ4 A;  3JPX A;  2HYE A;  2IWF A;  4G56 B;  2AGX A;  2AGZ A;  4PBY A;  5I5J A;  2CE9 A;  5EMM B;  5IT9 g;  3GRE A;  4J8B A;  4E54 A;  4L9O A;  3V7D B;  4X61 B;  4GM9 A;  3F3F A;  2O9K A;  3DSM A;  2AH0 A;  1QNI A;  4CY5 A;  2UZY B;  4QQE A;  3OKW A;  4E54 B;  3IJ0 A;  4Y5R D;  2GC4 A;  5EAL A;  4PSW B;  3JAM g;  3W15 A;  2QXV A;  4ZOX A;  1SQJ A;  5CYK A;  4NSX A;  5H14 A;  2GC7 A;  1PI6 A;  2H9M A;  5HQG A;  2P9K C;  1NR0 A;  1PEV A;  2YB8 B;  5AMS A;  2AGW A;  3FRX A;  4KFM B;  3EI1 B;  2QC5 A;  4HDJ A;  5SXM A;  2Z2N A;  4X60 B;  3I7H A;  4GZ8 A;  2Z2O A;  4JSX C;  3AH8 B;  2EBS A;  4XYH A;  4H5I A;  4J78 A;  2H3X A;  4MK0 B;  1GG2 B;  3I8E A;  2GNQ A;  4FA9 D;  3SHF A;  2HES X;  4CZY A;  2AH1 A;  2H9N A;  3EI3 B;  3NVX A;  4PC0 A;  5FKR A;  3JZN A;  3IIW A;  3PVW B;  4GGC A;  2IUP A;  3EI2 A;  2PM9 B;  3PSC B;  4LG8 A;  5THA A;  3MZL A;  3AL8 A;  4J73 A;  4XYI A;  4JSN C;  2I3S A;  1OMW B;  2CN3 A;  3SWS D;  2CN2 A;  4CY1 A;  3J81 g;  1N6F A;  3DM0 A;  3MZK A;  3OTT A;  4IA9 A;  4J8G A;  4QRJ A;  4Z8L A;  3K27 A;  3CIK B;  5HE1 B;  4ZOZ A;  1TYQ C;  3SJL D;  4A08 B;  4A11 A;  5C2W B;  4J0W A;  4OWR A;  1SQ9 A;  3BG0 A;  2HXC A;  2B5N A;  5HE0 B;  1U4C A;  4A08 A;  2P9N C;  4FA4 D;  4ERQ A;  4ERY A;  5FQD A;  4A2M A;  5GSA A;  1ERJ A;  1TBG A;  1MG2 A;  5EM2 B;  2YMU A;  3BWS A;  5C9Z B;  4IMM A;  1U2V C;  5AJA A;  3OKY A;  5EML B;  5HE2 B;  5FKS A;  3RLM D;  3B7F A;  4PSX B;  2IUV A;  4FA1 D;  4L3H D;  4K3J B;  2PM7 B; 
#chains in the Genus database with same CATH topology
 3RN1 D;  4FAN D;  5EAR A;  4Z7Q A;  5B4W A;  4BP9 A;  2H6Q A;  4GQ1 A;  3SN6 B;  3RMZ D;  4PBZ A;  2I0T A;  2CE8 A;  4GGD A;  2OK6 A;  2YNP A;  4J84 A;  3V9F A;  4WK0 A;  4D0K A;  5HYN B;  3SFZ A;  4ES0 A;  3NIF A;  1JMZ B;  1PBY B;  1SHY B;  2HKR A;  2YNO A;  3IUL A;  3T3M A;  4ZOY A;  3ZDZ A;  2Z2P A;  1I2M B;  1JMX B;  4CI2 A;  3UR4 A;  4A09 A;  1YFQ A;  5GXI A;  5GXH A;  3I89 A;  3HFQ A;  4E5Z B;  2XZG A;  5K19 A;  5HDB A;  3NVQ A;  2H6K A;  2P9S C;  2YBA A;  3E0C A;  1B9X A;  3MVD K;  4A7J A;  1P22 A;  4GMB A;  2Q7Q A;  3GFC A;  3UVO A;  3P4F A;  4CY3 A;  4RE6 A;  1XIP A;  3EQ7 A;  1GXR A;  4J79 A;  2XL3 A;  4PXW A;  5FKT A;  4X3E A;  3UKR C;  4BH6 A;  5IGO A;  4CZX A;  2IAA A;  2IUQ A;  5H1M A;  3K6S A;  3I7L A;  1BPO A;  2CNX A;  3MXX A;  4O9D A;  4Y7R A;  3A0F A;  3NID A;  3SMR A;  4H5J A;  3RFG A;  5CYK B;  2AQ5 A;  5M5S A;  2IUR A;  2PBI B;  2H9P A;  5FXY A;  4BCD A;  3DXK C;  4J82 A;  3OW8 A;  2XE4 A;  1YR2 A;  3N0E A;  3ZDX A;  2HU5 A;  4EWR A;  4L1Q D;  2VZ1 A;  4FAV D;  2VDP A;  4PNK B;  5M5T A;  1VZ3 A;  3MUO A;  4A0A B;  3UKU C;  4QL1 A;  4ERZ A;  2P9U C;  3SBP A;  3BG1 A;  3JRO A;  3O4J A;  2IWK A;  5M61 A;  2EIE A;  4CC9 A;  3EU7 A;  2VDO A;  3OL2 B;  3EMH A;  4O3T B;  1L0Q A;  5H17 A;  4A0B A;  5IJ8 E;  3ORV D;  3K72 A;  3NVN A;  3DWL C;  4K3I D;  5HE3 B;  1UOO A;  2OK4 A;  2VDK A;  4IRZ A;  3EI4 B;  5FKQ A;  5TF2 A;  4BUJ C;  4NEN A;  4TZ4 A;  3OKY B;  4N14 A;  4Z7O A;  1K8K C;  2CO0 C;  2EIC A;  3RFH A;  3EG6 A;  1N6D A;  2AGY A;  2AGL A;  4O3U B;  1UOP A;  5EM2 A;  2UZX B;  1MDA H;  3C9C A;  4J86 A;  2W18 A;  3PE7 A;  3I7P A;  4XEI C;  4GQB B;  1JV2 A;  2HJB A;  2B5L A;  4CI3 A;  3FCU A;  1RI6 A;  4ZN4 A;  3JB9 L;  3GC3 B;  4J77 A;  5AFU 3;  5EAM A;  2PM9 A;  2HU7 A;  3DXM C;  5IJ7 E;  4O1Q D;  5TEF A;  3OL2 A;  3C5M A;  2H6N A;  2I3T A;  1Q47 A;  1VE6 A;  3KRX B;  4JXM A;  4L1M A;  1E5T A;  3SBQ A;  3PXS D;  2EIB A;  3ZE0 A;  2BKL A;  1R5M A;  4JSP C;  1PGU A;  3IUM A;  4JHP C;  5FLX g;  2P9I C;  3I7K A;  3ULE C;  3U4Y A;  4AN0 A;  2TRC B;  2VDL A;  4A09 B;  1U8C A;  3EWE A;  3L4O D;  4J81 A;  1NEX B;  2I0S A;  2OVP B;  1MG3 A;  2OJY A;  4GM8 A;  3J80 g;  1XKS A;  3JZH A;  5E6S A;  4O45 A;  4GM3 A;  3VI4 A;  3EI3 A;  3MKQ A;  4FHL A;  3ZE1 A;  4J0X A;  4JT5 C;  5FA5 B;  2OVR B;  2P9P C;  2QZP A;  3IJE A;  3V4P A;  2B4E A;  2J55 H;  3MMY A;  2B5M A;  3EI2 B;  3RSE C;  1C9I A;  5IC7 A;  2BCJ B;  5FFG A;  3ZWL B;  4YVD A;  5CXC B;  3UVM A;  5I5I A;  4A0A A;  5EMJ B;  4AX4 A;  3AL9 A;  2VC2 A;  3K26 A;  3SCY A;  5KDO B;  1E8M A;  3I7N A;  4GGA A;  4UM8 A;  2H47 A;  1T2X A;  1XHM A;  3CFS B;  4CY2 A;  4FWW A;  1GOG A;  3PVU B;  4AMY A;  3C99 A;  5M5U A;  3N0D A;  3KRW B;  5TEE A;  1VE7 A;  3IJ1 A;  3EI1 A;  4WK2 A;  1GOT B;  3IUQ A;  5EAP A;  3OF7 A;  2HKM A;  5CXC A;  3SLE D;  3AL8 B;  3IIY A;  4OZU A;  4WK4 A;  4QT8 A;  4CI8 A;  4ZOV A;  3RRM C;  1GP2 B;  3C75 H;  3FGB A;  5I5M A;  3F3P A;  4CZV A;  3ZE2 A;  4GQ2 P;  4D6V A;  5M5R A;  4L3G D;  3I7O A;  3IKO A;  5GMK n;  2VDR A;  4LGN A;  5K1C C;  4ESG A;  4A2L A;  1GOF A;  2J56 H;  5CXB A;  2CO0 A;  2WQ8 A;  3VA6 A;  3SBR A;  3JZG A;  4FB1 D;  1QFS A;  2P9L C;  3DDU A;  3O4G A;  4G1M A;  5EMK B;  3SVW D;  3CFV A;  2VDQ A;  2H9L A;  3EI4 A;  3AFC A;  2XL2 A;  1K32 A;  3GD1 I;  3IUN A;  4J87 A;  3UVL A;  2H13 A;  3JRP A;  4NAA A;  1JOF A;  4FA5 D;  2XYI A;  4I79 A;  3PSL A;  3UVN A;  4E5Z A;  2J57 G;  3QHY B;  4MMZ A;  4MMY A;  1S4U X;  2G99 A;  2BBK H;  1GOH A;  1A0R B;  2H14 A;  1QFM A;  5CXB B;  3I2N A;  3MUN A;  1L5G A;  2YNN A;  4LG9 A;  3K71 A;  4CI1 A;  1B9Y A;  1JJU B;  2OVQ B;  4Z7N A;  4UI9 R;  3VGZ A;  3PXT D;  4U7A A;  1VYH C;  3VH0 A;  3L4M D;  4A11 B;  3PXW D;  3UVK A;  2G9A A;  4BL0 A;  1OLZ A;  3KCI A;  5A2Q g;  3F3G A;  3EQ9 A;  2QR5 A;  1UOQ A;  2OIZ A;  2XU7 A;  4R7A B;  4AEZ A;  3SXT D;  4G55 A;  4AOW A;  5JWZ A;  4A0B B;  4NBM A;  3FM0 A;  3V5W B;  4JT6 C;  2MTA H;  3ODT A;  4X63 B;  5TDH B;  2PM6 B;  3IJC A;  3RN0 D;  5IGQ A;  3ZDY A;  3V4V A;  2I0R A;  4JSV C;  4JD2 C;  4MMX A;  3I8C A;  1N6E A;  4JHN A;  4DNW A;  5C2V B;  4U1E I;  3MKS B;  2H68 A;  1FWX A;  3OKT A;  2HJ4 A;  3QI0 A;  3JPX A;  2HYE A;  2IWF A;  1JTD B;  4G56 B;  2AGX A;  2AGZ A;  1O6F A;  4PBY A;  2CE9 A;  5I5J A;  4AN1 A;  5EMM B;  5IT9 g;  3GRE A;  4J8B A;  4WJK A;  4E54 A;  4L9O A;  3V7D B;  4X61 B;  4GM9 A;  3F3F A;  2O9K A;  3DSM A;  5M5V A;  3T3P A;  2AH0 A;  1QNI A;  4CY5 A;  2UZY B;  4QQE A;  3OKW A;  4E54 B;  2VDN A;  3IJ0 A;  4DNU A;  4Y5R D;  2GC4 A;  2EID A;  1H2Z A;  5EAL A;  4PSW B;  3JAM g;  3W15 A;  4D9S A;  2QXV A;  4ZOX A;  1SQJ A;  5CYK A;  4NSX A;  5H14 A;  3FCS A;  1PI6 A;  2GC7 A;  2H9M A;  5HQG A;  2P9K C;  1NR0 A;  1PEV A;  2YB8 B;  5AMS A;  1C9L A;  1K3I A;  2AGW A;  3FRX A;  4KFM B;  3EI1 B;  2QC5 A;  4HDJ A;  5SXM A;  2Z2N A;  4X60 B;  3I7H A;  4GZ8 A;  2Z2O A;  4JSX C;  1VZ2 A;  5FFO A;  3AH8 B;  2EBS A;  4G1E A;  4XYH A;  4H5I A;  4J78 A;  2H3X A;  4QAM A;  3VI3 A;  4MK0 B;  1GG2 B;  3I8E A;  1M1X A;  2GNQ A;  4FA9 D;  3O4H A;  3SHF A;  2HES X;  4CZY A;  2JKX A;  5C92 A;  2AH1 A;  2H9N A;  3EI3 B;  1TYE A;  3NVX A;  4PC0 A;  5E6U A;  5FKR A;  3IVM A;  3JZN A;  3PVW B;  3IIW A;  4GGC A;  4DNV A;  2IUP A;  3EI2 A;  2PM9 B;  3PSC B;  4LG8 A;  4UM9 A;  5THA A;  3MZL A;  3AL8 A;  4J73 A;  4BP8 A;  2VDM A;  4XYI A;  4AMZ A;  4JSN C;  2I3S A;  1OMW B;  2CN3 A;  3SWS D;  2CN2 A;  4CY1 A;  3J81 g;  1N6F A;  2VZ3 A;  5C86 A;  3DM0 A;  3MZK A;  3OTT A;  3NIG A;  1A12 A;  4IA9 A;  4BCB A;  1UTC A;  3IUR A;  4J8G A;  4QRJ A;  3K27 A;  3CIK B;  4Z8L A;  5HE1 B;  5E6R A;  4ZOZ A;  1TYQ C;  3SJL D;  4A08 B;  4A11 A;  5C2W B;  4BCC A;  3EQ8 A;  4J0W A;  4OWR A;  1SQ9 A;  3BG0 A;  1O6G A;  2HXC A;  2B5N A;  5HE0 B;  1U4C A;  4O2W A;  4A08 A;  2XDW A;  1H2Y A;  1E8N A;  2P9N C;  4FA4 D;  3IUJ A;  1H2W A;  4ERQ A;  4RE5 A;  1H2X A;  4ERY A;  5FQD A;  4NC4 A;  4A2M A;  5GSA A;  1ERJ A;  1TBG A;  1MG2 A;  2HU8 A;  3O4I A;  5EM2 B;  2YMU A;  3BWS A;  5C9Z B;  4IMM A;  4O02 A;  1U2V C;  5AJA A;  3OKY A;  5EML B;  5HE2 B;  5FKS A;  3RLM D;  3B7F A;  4PSX B;  2IUV A;  4FA1 D;  4L3H D;  4K3J B;  2PM7 B; 
#chains in the Genus database with same CATH homology
 3RN1 D;  4FAN D;  5EAR A;  5B4W A;  2H6Q A;  4GQ1 A;  3SN6 B;  3RMZ D;  4PBZ A;  2I0T A;  2CE8 A;  4GGD A;  2OK6 A;  2YNP A;  4J84 A;  3V9F A;  4D0K A;  5HYN B;  3SFZ A;  4ES0 A;  1JMZ B;  1PBY B;  1SHY B;  2HKR A;  2YNO A;  4ZOY A;  2Z2P A;  1JMX B;  4CI2 A;  3UR4 A;  4A09 A;  1YFQ A;  5GXI A;  5GXH A;  3I89 A;  3HFQ A;  4E5Z B;  5K19 A;  3NVQ A;  2H6K A;  2P9S C;  2YBA A;  3E0C A;  1B9X A;  4A7J A;  1P22 A;  4GMB A;  2Q7Q A;  3GFC A;  3UVO A;  3P4F A;  4CY3 A;  1XIP A;  1GXR A;  4J79 A;  2XL3 A;  4PXW A;  5FKT A;  4X3E A;  3UKR C;  4BH6 A;  5IGO A;  4CZX A;  2IAA A;  2IUQ A;  5H1M A;  3I7L A;  2CNX A;  3MXX A;  4O9D A;  4Y7R A;  3A0F A;  3SMR A;  4H5J A;  3RFG A;  5CYK B;  2AQ5 A;  2IUR A;  2PBI B;  2H9P A;  5FXY A;  3DXK C;  4J82 A;  3OW8 A;  3N0E A;  4EWR A;  4L1Q D;  4FAV D;  4PNK B;  4A0A B;  3UKU C;  4QL1 A;  4ERZ A;  2P9U C;  3SBP A;  3BG1 A;  3JRO A;  2IWK A;  4CC9 A;  3EU7 A;  3OL2 B;  3EMH A;  4O3T B;  1L0Q A;  5H17 A;  4A0B A;  5IJ8 E;  3ORV D;  3NVN A;  3DWL C;  4K3I D;  5HE3 B;  2OK4 A;  5FKQ A;  5TF2 A;  3EI4 B;  4BUJ C;  4TZ4 A;  3OKY B;  4N14 A;  1K8K C;  2CO0 C;  3RFH A;  3EG6 A;  1N6D A;  2AGY A;  2AGL A;  4O3U B;  5EM2 A;  2UZX B;  1MDA H;  3C9C A;  4J86 A;  2W18 A;  3PE7 A;  3I7P A;  4XEI C;  4GQB B;  2HJB A;  2B5L A;  4CI3 A;  1RI6 A;  4ZN4 A;  3JB9 L;  4J77 A;  5AFU 3;  5EAM A;  2PM9 A;  3DXM C;  5IJ7 E;  4O1Q D;  5TEF A;  3OL2 A;  3C5M A;  2H6N A;  2I3T A;  1Q47 A;  3KRX B;  4JXM A;  3SBQ A;  3PXS D;  1R5M A;  4JSP C;  1PGU A;  5FLX g;  2P9I C;  3I7K A;  3ULE C;  3U4Y A;  2TRC B;  4A09 B;  3EWE A;  3L4O D;  4J81 A;  1NEX B;  2I0S A;  2OVP B;  4GM8 A;  1MG3 A;  2OJY A;  3J80 g;  1XKS A;  3JZH A;  4O45 A;  4GM3 A;  3EI3 A;  3MKQ A;  4FHL A;  4J0X A;  4JT5 C;  5FA5 B;  2OVR B;  2P9P C;  2B4E A;  2J55 H;  3MMY A;  2B5M A;  3EI2 B;  3RSE C;  5IC7 A;  2BCJ B;  3ZWL B;  4YVD A;  5CXC B;  3UVM A;  5I5I A;  4A0A A;  5EMJ B;  3AL9 A;  3K26 A;  3SCY A;  5KDO B;  3I7N A;  4GGA A;  2H47 A;  4CY2 A;  1XHM A;  3CFS B;  4FWW A;  3PVU B;  3C99 A;  3N0D A;  3KRW B;  5TEE A;  3IJ1 A;  3EI1 A;  1GOT B;  5EAP A;  2HKM A;  5CXC A;  3SLE D;  3AL8 B;  3IIY A;  4OZU A;  4QT8 A;  4CI8 A;  4ZOV A;  3RRM C;  1GP2 B;  3C75 H;  3FGB A;  5I5M A;  3F3P A;  4CZV A;  4GQ2 P;  4D6V A;  4L3G D;  3I7O A;  3IKO A;  5GMK n;  4LGN A;  5K1C C;  4ESG A;  4A2L A;  5CXB A;  2J56 H;  2CO0 A;  3VA6 A;  3SBR A;  3JZG A;  4FB1 D;  2P9L C;  5EMK B;  3SVW D;  3CFV A;  2H9L A;  3EI4 A;  3AFC A;  2XL2 A;  1K32 A;  4J87 A;  3UVL A;  2H13 A;  3JRP A;  4FA5 D;  1JOF A;  2XYI A;  4I79 A;  3PSL A;  3UVN A;  4E5Z A;  2J57 G;  1S4U X;  2G99 A;  2BBK H;  1A0R B;  2H14 A;  5CXB B;  3I2N A;  4LG9 A;  2YNN A;  4CI1 A;  1B9Y A;  1JJU B;  2OVQ B;  4UI9 R;  3VGZ A;  3PXT D;  4U7A A;  1VYH C;  3VH0 A;  3L4M D;  4A11 B;  3PXW D;  3UVK A;  2G9A A;  4BL0 A;  1OLZ A;  5A2Q g;  3F3G A;  2OIZ A;  2XU7 A;  4R7A B;  4AEZ A;  3SXT D;  4AOW A;  5JWZ A;  4A0B B;  3FM0 A;  3V5W B;  4JT6 C;  2MTA H;  3ODT A;  4X63 B;  5TDH B;  2PM6 B;  3IJC A;  3RN0 D;  5IGQ A;  2I0R A;  4JSV C;  4JD2 C;  3I8C A;  1N6E A;  5C2V B;  4U1E I;  3MKS B;  2H68 A;  1FWX A;  3OKT A;  2HJ4 A;  3JPX A;  2HYE A;  2IWF A;  4G56 B;  2AGX A;  2AGZ A;  4PBY A;  5I5J A;  2CE9 A;  5EMM B;  5IT9 g;  3GRE A;  4J8B A;  4E54 A;  4L9O A;  3V7D B;  4X61 B;  4GM9 A;  3F3F A;  2O9K A;  3DSM A;  2AH0 A;  1QNI A;  4CY5 A;  2UZY B;  4QQE A;  3OKW A;  4E54 B;  3IJ0 A;  4Y5R D;  2GC4 A;  5EAL A;  4PSW B;  3JAM g;  3W15 A;  2QXV A;  4ZOX A;  1SQJ A;  5CYK A;  4NSX A;  5H14 A;  2GC7 A;  1PI6 A;  2H9M A;  5HQG A;  2P9K C;  1NR0 A;  1PEV A;  2YB8 B;  5AMS A;  2AGW A;  3FRX A;  4KFM B;  3EI1 B;  2QC5 A;  4HDJ A;  5SXM A;  2Z2N A;  4X60 B;  3I7H A;  4GZ8 A;  2Z2O A;  4JSX C;  3AH8 B;  2EBS A;  4XYH A;  4H5I A;  4J78 A;  2H3X A;  4MK0 B;  1GG2 B;  3I8E A;  2GNQ A;  4FA9 D;  3SHF A;  2HES X;  4CZY A;  2AH1 A;  2H9N A;  3EI3 B;  3NVX A;  4PC0 A;  5FKR A;  3JZN A;  3IIW A;  3PVW B;  4GGC A;  2IUP A;  3EI2 A;  2PM9 B;  3PSC B;  4LG8 A;  5THA A;  3MZL A;  3AL8 A;  4J73 A;  4XYI A;  4JSN C;  2I3S A;  1OMW B;  2CN3 A;  3SWS D;  2CN2 A;  4CY1 A;  3J81 g;  1N6F A;  3DM0 A;  3MZK A;  3OTT A;  4IA9 A;  4J8G A;  4QRJ A;  4Z8L A;  3K27 A;  3CIK B;  5HE1 B;  4ZOZ A;  1TYQ C;  3SJL D;  4A08 B;  4A11 A;  5C2W B;  4J0W A;  4OWR A;  1SQ9 A;  3BG0 A;  2HXC A;  2B5N A;  5HE0 B;  1U4C A;  4A08 A;  2P9N C;  4FA4 D;  4ERQ A;  4ERY A;  5FQD A;  4A2M A;  5GSA A;  1ERJ A;  1TBG A;  1MG2 A;  5EM2 B;  2YMU A;  3BWS A;  5C9Z B;  4IMM A;  1U2V C;  5AJA A;  3OKY A;  5EML B;  5HE2 B;  5FKS A;  3RLM D;  3B7F A;  4PSX B;  2IUV A;  4FA1 D;  4L3H D;  4K3J B;  2PM7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...