2H13A

Crystal structure of wdr5/histone h3 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Molecular recognition of histone H3 by the WD40 protein WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 102
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h13A00
3SBRA 5EMKB 1RI6A 4HDJA 4AEZA 5KDOB 2H9PA 3EU7A 3PE7A 4H5IA 4BUJC 4QT8A 3C9CA 5THAA 4K3JB 3F3FA 1MG2A 2OVRB 3RMZD 4O1QD 2YNPA 5EARA 4GGCA 3GREA 3OKYA 2XL2A 4CI1A 4E5ZA 3OKTA 3I8CA 5EAPA 3PVUB 4R7AB 1NEXB 2W18A 5TF2A 3I7NA 4FB1D 4Z8LA 3IJ1A 3PSLA 4A11A 3UVLA 2YNNA 1SQJA 4GM8A 5TDHB 4ERYA 2GC4A 4J79A 3JZNA 1GP2B 3J81g 2QC5A 1OLZA 2B5MA 5FKQA 3JZHA 5GXHA 1YFQA 4J84A 3SCYA 3EI1A 5FKTA 4EWRA 4GGDA 5FKRA 3MZLA 1XKSA 1OMWB 3OKYB 2IURA 5H1MA 3NVNA 3I7LA 4PSXB 4ZOXA 3UVKA 4ERQA 3I7KA 2OVQB 5EMJB 3AH8B 2P9LC 1ERJA 5FXYA 4A11B 3N0DA 3SN6B 2G9AA 3ULEC 4ERZA 5EMMB 3SFZA 4CZXA 3RN1D 4J86A 4J81A 5C2WB 1PI6A 4J0XA 2MTAH 4OWRA 2HKRA 4CY2A 5I5IA 3F3GA 1TYQC 2I3TA 3AL8B 3DM0A 2G99A 4QRJA 5HQGA 5K19A 1P22A 3J80g 2P9KC 5GSAA 2AGLA 3FM0A 3IJCA 4UI9R 3EI1B 3UVOA 3RN0D 4GQBB 4A7JA 2I0SA 5SXMA 1U4CA 2HJ4A 4L1QD 1K8KC 4J73A 5H14A 1U2VC 4JSVC 2P9UC 4A0AA 5GXIA 4Y5RD 4L3HD 4J0WA 3I7OA 1VYHC 2AGZA 3ODTA 4GZ8A 3V7DB 2H6KA 3I2NA 1SQ9A 4QQEA 1JMXB 2P9NC 2H9MA 4Y7RA 4YVDA 2YBAA 4A09A 2XYIA 1N6DA 4CZYA 3OW8A 2H3XA 1XHMA 2B5NA 3SVWD 2H68A 3JAMg 3KRWB 5EALA 2HESX 2PM7B 3E0CA 4KFMB 4A2LA 4ES0A 3ZWLB 1L0QA 2PM6B 3V5WB 5IGQA 4QL1A 4O45A 1GXRA 4XEIC 2OK4A 1SHYB 3OKWA 5EAMA 3RLMD 5CYKB 2CN3A 4J87A 5CXCA 2IUPA 3UKUC 2OIZA 4XYHA 2OVPB 2CE9A 4OZUA 4A09B 4MK0B 4GMBA 3V9FA 3CFVA 4FAVD 2AH0A 5FQDA 3K26A 3L4MD 4CY3A 2Z2NA 3OTTA 4IA9A 4JXMA 4X3EA 4CC9A 4G56B 1Q47A 3ORVD 2HYEA 2HJBA 5AFU3 3IJ0A 3K27A 2BBKH 4N14A 3AFCA 3JROA 3C75H 4J77A 3JZGA 3NVQA 3SJLD 2OK6A 4ZN4A 5IJ7E 3EG6A 3DXMC 4J8BA 2IWKA 3PXTD 2J55H 4FA9D 2CO0C 3RSEC 3VGZA 4JSNC 5CXCB 4CY5A 2IUQA 4X63B 2IAAA 4E5ZB 1PEVA 4A2MA 3C99A 3DXKC 3CIKB 4ZOZA 5K1CC 2P9SC 2H47A 1TBGA 3PSCB 3SBQA 2XU7A 4BL0A 4I79A 4O9DA 3CFSB 3UR4A 1PGUA 1R5MA 2BCJB 3UKRC 3B7FA 3FGBA 3IIYA 4D0KA 5HE3B 1QNIA 5FLXg 1XIPA 3IKOA 2B5LA 3I7HA 3RFGA 5FA5B 4O3UB 5TEEA 4NSXA 3BG0A 3FRXA 1B9XA 3MZKA 1NR0A 2YB8B 3BG1A 2IUVA 5AJAA 4JT6C 5C9ZB 2HKMA 3MMYA 3W15A 4JSXC 3SXTD 4GM3A 1N6EA 4GQ1A 5HYNB 4H5JA 3UVNA 4ZOYA 3SBPA 2QXVA 2H9NA 1JMZB 2IWFA 3AL9A 3PXSD 4PNKB 4CZVA 4CI8A 3JRPA 3KRXB 4J78A 2CN2A 5IGOA 2P9PC 2AGYA 1MDAH 4IMMA 3I7PA 1JJUB 2J57G 3UVMA 4J8GA 4FAND 5JWZA 3DSMA 3A0FA 1K32A 2B4EA 5EM2A 1GOTB 2GC7A 4E54A 4L3GD 2Z2OA 4A0AB 2YMUA 2CE8A 1S4UX 3PVWB 2AH1A 2TRCB 4ZOVA 5GMKn 3SHFA 5I5JA 4U7AA 3VH0A 4TZ4A 2H6QA 2UZYB 2GNQA 2I0TA 4X61B 2OJYA 4XYIA 5IJ8E 5AMSA 2CO0A 2P9IC 4A08A 3F3PA 4LG9A 4FA1D 3DWLC 3SWSD 3I8EA 3EI3A 4PBZA 3SMRA 3HFQA 4J82A 4GGAA 5EM2B 4X60B 4E54B 4A0BA 3PXWD 2H9LA 4CY1A 3OL2A 4GM9A 5CXBA 3JPXA 4JSPC 3IIWA 3SLED 3C5MA 3P4FA 4L9OA 5IT9g 3EI2A 3EMHA 2YNOA 3MKQA 2I0RA 3EWEA 4JT5C 4PXWA 3AL8A 2XL3A 3I89A 2Z2PA 3GFCA 4D6VA 1N6FA 3EI4A 2J56H 4FHLA 5FKSA 5HE1B 4A08B 3N0EA 4PSWB 4ESGA 5A2Qg 4BH6A 4AOWA 2AGXA 3JB9L 3EI3B 3RFHA 3MKSB 4A0BB 1A0RB 3OL2B 5CXBB 2PM9A 3NVXA 5TEFA 3EI2B 5H17A 4LGNA 1GG2B 5EMLB 5HE0B 2HXCA 2AQ5A 1FWXA 1PBYB 4O3TB 3U4YA 4PBYA 2CNXA 2I3SA 1MG3A 3EI4B 1B9YA 5B4WA 4U1EI 2Q7QA 4LG8A 5HE2B 3MXXA 2H13A 2H14A 4CI3A 2EBSA 3L4OD 2AGWA 2PM9B 4CI2A 5C2VB 3VA6A 3BWSA 4JD2C 5CYKA 4PC0A 4FA5D 5I5MA 4K3ID 4GQ2P 4FA4D 2H6NA 2PBIB 2UZXB 1JOFA 3RRMC 2O9KA 4FWWA 5IC7A
chains in the Genus database with same CATH superfamily
3SBRA 4DNWA 5EMKB 3K72A 1RI6A 4HDJA 3GC3B 1UOQA 4AEZA 5KDOB 2H9PA 3EU7A 3PE7A 1YR2A 4H5IA 4G1EA 4BUJC 4QT8A 3C9CA 1VE6A 5THAA 4K3JB 4BP9A 1JTDB 3F3FA 1MG2A 2OVRB 3RMZD 4O1QD 2YNPA 4RE5A 3EQ8A 5EARA 4GGCA 3GREA 3OKYA 2XL2A 4CI1A 3ZE2A 2XE4A 4E5ZA 3OKTA 3I8CA 5EAPA 3PVUB 4R7AB 1NEXB 2W18A 5TF2A 3I7NA 4FB1D 3IULA 1E8MA 3ZDZA 4Z8LA 3IJ1A 3PSLA 4A11A 3NIDA 3UVLA 2YNNA 1SQJA 4GM8A 5HDBA 5TDHB 4ERYA 2GC4A 4J79A 3JZNA 1GP2B 3GD1I 3J81g 2QC5A 1OLZA 4MMZA 2B5MA 4NENA 5FKQA 3JZHA 3O4GA 5GXHA 1YFQA 4J84A 3SCYA 3EI1A 5FKTA 4EWRA 4GGDA 5FKRA 3MZLA 1XKSA 1OMWB 3OKYB 2IURA 5H1MA 3NVNA 1VZ2A 1E8NA 1H2YA 3I7LA 4PSXB 4ZOXA 3UVKA 4ERQA 3I7KA 3O4IA 2OVQB 5EMJB 3AH8B 2P9LC 1ERJA 4L1MA 5FXYA 4A11B 3N0DA 3SN6B 3MVDK 4DNUA 2G9AA 3ULEC 4ERZA 5EMMB 3SFZA 4CZXA 3RN1D 3O4JA 4J86A 4J81A 5C2WB 1PI6A 2VDPA 2MTAH 4J0XA 2HKRA 4OWRA 4CY2A 1H2XA 4UM8A 5I5IA 1QFMA 3F3GA 1TYQC 2I3TA 3AL8B 3DM0A 2G99A 3IJEA 4QRJA 5HQGA 5K19A 1P22A 3J80g 2P9KC 5GSAA 3ZDYA 2XDWA 2AGLA 3FM0A 3IJCA 4UI9R 3EI1B 3UVOA 3RN0D 4GQBB 4A7JA 2I0SA 5SXMA 4DNVA 1U4CA 2HJ4A 4L1QD 1K8KC 4J73A 5H14A 2VZ3A 1U2VC 1C9IA 4AN1A 5FFGA 4JSVC 2P9UC 4A0AA 5GXIA 4Y5RD 4L3HD 4J0WA 3I7OA 1VYHC 3IVMA 2AGZA 3ODTA 4GZ8A 3V7DB 2H6KA 4BCDA 3I2NA 1SQ9A 4QQEA 1JMXB 2P9NC 1H2ZA 2H9MA 4Y7RA 4YVDA 2YBAA 1UOOA 3EQ7A 4WK4A 5M61A 4A09A 2XYIA 1N6DA 4CZYA 3OW8A 2H3XA 1XHMA 2B5NA 1QFSA 3SVWD 2H68A 3JAMg 1GOGA 3KRWB 5EALA 3VI3A 2HESX 5E6SA 2PM7B 3E0CA 4KFMB 4A2LA 4ES0A 5M5SA 3ZWLB 1L0QA 2PM6B 3V5WB 5IGQA 4QL1A 5M5VA 4O45A 1GXRA 4XEIC 2OK4A 1SHYB 3OKWA 5EAMA 3RLMD 5CYKB 2CN3A 2QR5A 4J87A 4UM9A 5CXCA 4BCCA 2IUPA 3UKUC 2OIZA 3V4VA 4XYHA 1O6FA 2OVPB 2CE9A 4OZUA 4A09B 4MK0B 4GMBA 3V9FA 3CFVA 4FAVD 2AH0A 5FQDA 3K26A 1O6GA 3L4MD 2Z2NA 3OTTA 4IA9A 4JXMA 4X3EA 4CY3A 4CC9A 3FCUA 4G56B 1Q47A 3ORVD 2HYEA 2HJBA 5AFU3 3IJ0A 3K27A 2BBKH 4N14A 3AFCA 3JROA 1L5GA 3T3MA 3C75H 4J77A 3JZGA 3NVQA 3SJLD 2OK6A 4ZN4A 5IJ7E 3EG6A 5FFOA 3DXMC 4J8BA 2IWKA 3PXTD 2J55H 4FA9D 2CO0C 3RSEC 4G55A 2JKXA 3VGZA 4JSNC 5CXCB 4CY5A 2IUQA 4X63B 2IAAA 1U8CA 4E5ZB 1PEVA 4A2MA 3IUNA 3C99A 3DXKC 3CIKB 4ZOZA 5K1CC 2P9SC 2H47A 4QAMA 1TBGA 3PSCB 3SBQA 2XU7A 4BL0A 4I79A 4O02A 3QI0A 4O9DA 3CFSB 5E6RA 3UR4A 1PGUA 1R5MA 2BCJB 1VE7A 3UKRC 3B7FA 3FGBA 3IIYA 4D0KA 5HE3B 2VDOA 1QNIA 5FLXg 2EIDA 1XIPA 3IKOA 2B5LA 3I7HA 3RFGA 5FA5B 4O3UB 5TEEA 4NSXA 5M5TA 3BG0A 3FRXA 1B9XA 4WK2A 3IURA 3K71A 3NIGA 2EIEA 3MZKA 1NR0A 2YB8B 3BG1A 2IUVA 5AJAA 3IUJA 4JT6C 5C9ZB 2HKMA 3MMYA 3W15A 4JSXC 3ZE1A 3SXTD 4GM3A 1N6EA 4GQ1A 5HYNB 4H5JA 1C9LA 3T3PA 3UVNA 4NBMA 4ZOYA 4AMYA 2VDRA 3SBPA 2HU7A 2QXVA 2H9NA 1JMZB 2IWFA 3AL9A 3MUOA 3PXSD 4PNKB 4CZVA 4CI8A 2HU8A 3QHYB 3JRPA 3KRXB 4J78A 2CN2A 5IGOA 1JV2A 4JHPC 4AMZA 2P9PC 3IUMA 2AGYA 4NC4A 1MDAH 4IMMA 3K6SA 2EIBA 3I7PA 1JJUB 1UOPA 2J57G 3IUQA 3UVMA 4J8GA 4FAND 5JWZA 3OF7A 2EICA 3DSMA 3A0FA 1K32A 2B4EA 5EM2A 1GOTB 2GC7A 4E54A 4L3GD 2Z2OA 4A0AB 2YMUA 2XZGA 2CE8A 1S4UX 3PVWB 2AH1A 2TRCB 3FCSA 4ZOVA 5GMKn 3SHFA 5C92A 5I5JA 1K3IA 4U7AA 4BP8A 3VH0A 4TZ4A 2H6QA 2UZYB 2GNQA 4BCBA 2I0TA 4X61B 2OJYA 4XYIA 2BKLA 5IJ8E 2WQ8A 1M1XA 5AMSA 2CO0A 2P9IC 2VDLA 2VDMA 4A08A 3VI4A 2VDQA 3F3PA 4LG9A 4FA1D 3DWLC 3SWSD 3I8EA 3EI3A 4PBZA 1UTCA 4WJKA 3SMRA 3HFQA 4J82A 4Z7QA 4GGAA 5EM2B 4X60B 4E54B 4A0BA 3PXWD 2H9LA 4CY1A 3OL2A 4GM9A 5CXBA 3JPXA 4JSPC 3IIWA 4WK0A 4Z7NA 3SLED 3C5MA 3P4FA 4L9OA 5IT9g 3EI2A 3EQ9A 3EMHA 2YNOA 3MKQA 2I0RA 3EWEA 4IRZA 3MUNA 2VZ1A 4JT5C 4PXWA 3AL8A 2XL3A 3I89A 1E5TA 1I2MB 2Z2PA 4D9SA 3GFCA 4D6VA 1N6FA 4JHNA 3EI4A 2J56H 4FHLA 5FKSA 5HE1B 5M5RA 4A08B 3N0EA 4PSWB 4ESGA 5A2Qg 4BH6A 4AOWA 2AGXA 4Z7OA 3EI3B 5M5UA 3JB9L 2VDKA 3RFHA 1GOHA 3MKSB 4O2WA 1A12A 4A0BB 3ZE0A 1A0RB 3OL2B 5CXBB 2PM9A 4G1MA 3DDUA 3NVXA 3NIFA 2VDNA 5TEFA 3EI2B 4AN0A 4NAAA 1VZ3A 5H17A 5C86A 4LGNA 1GOFA 1GG2B 1TYEA 5EMLB 5HE0B 2HXCA 2AQ5A 1FWXA 1PBYB 4O3TB 3U4YA 4PBYA 2CNXA 2I3SA 1MG3A 3V4PA 3KCIA 4MMXA 3EI4B 1BPOA 1B9YA 5B4WA 1H2WA 4U1EI 2Q7QA 2HU5A 4LG8A 5HE2B 1T2XA 3MXXA 2H13A 2H14A 4CI3A 2EBSA 2QZPA 3L4OD 2AGWA 3ZDXA 2PM9B 4MMYA 4CI2A 5C2VB 3VA6A 3BWSA 4JD2C 2VC2A 5CYKA 4PC0A 4AX4A 4FA5D 5I5MA 4K3ID 4GQ2P 5E6UA 4FA4D 2H6NA 2PBIB 2UZXB 1JOFA 3O4HA 3RRMC 2O9KA 4FWWA 4RE6A 5IC7A
chains in the Genus database with same CATH topology
3SBRA 5EMKB 1RI6A 4HDJA 4AEZA 5KDOB 2H9PA 3EU7A 3PE7A 4H5IA 4BUJC 4QT8A 3C9CA 5THAA 4K3JB 3F3FA 1MG2A 2OVRB 3RMZD 4O1QD 2YNPA 5EARA 4GGCA 3GREA 3OKYA 2XL2A 4CI1A 4E5ZA 3OKTA 3I8CA 5EAPA 3PVUB 4R7AB 1NEXB 2W18A 5TF2A 3I7NA 4FB1D 4Z8LA 3IJ1A 3PSLA 4A11A 3UVLA 2YNNA 1SQJA 4GM8A 5TDHB 4ERYA 2GC4A 4J79A 3JZNA 1GP2B 3J81g 2QC5A 1OLZA 2B5MA 5FKQA 3JZHA 5GXHA 1YFQA 4J84A 3SCYA 3EI1A 5FKTA 4EWRA 4GGDA 5FKRA 3MZLA 1XKSA 1OMWB 3OKYB 2IURA 5H1MA 3NVNA 3I7LA 4PSXB 4ZOXA 3UVKA 4ERQA 3I7KA 2OVQB 5EMJB 3AH8B 2P9LC 1ERJA 5FXYA 4A11B 3N0DA 3SN6B 2G9AA 3ULEC 4ERZA 5EMMB 3SFZA 4CZXA 3RN1D 4J86A 4J81A 5C2WB 1PI6A 4J0XA 2MTAH 4OWRA 2HKRA 4CY2A 5I5IA 3F3GA 1TYQC 2I3TA 3AL8B 3DM0A 2G99A 4QRJA 5HQGA 5K19A 1P22A 3J80g 2P9KC 5GSAA 2AGLA 3FM0A 3IJCA 4UI9R 3EI1B 3UVOA 3RN0D 4GQBB 4A7JA 2I0SA 5SXMA 1U4CA 2HJ4A 4L1QD 1K8KC 4J73A 5H14A 1U2VC 4JSVC 2P9UC 4A0AA 5GXIA 4Y5RD 4L3HD 4J0WA 3I7OA 1VYHC 2AGZA 3ODTA 4GZ8A 3V7DB 2H6KA 3I2NA 1SQ9A 4QQEA 1JMXB 2P9NC 2H9MA 4Y7RA 4YVDA 2YBAA 4A09A 2XYIA 1N6DA 4CZYA 3OW8A 2H3XA 1XHMA 2B5NA 3SVWD 2H68A 3JAMg 3KRWB 5EALA 2HESX 2PM7B 3E0CA 4KFMB 4A2LA 4ES0A 3ZWLB 1L0QA 2PM6B 3V5WB 5IGQA 4QL1A 4O45A 1GXRA 4XEIC 2OK4A 1SHYB 3OKWA 5EAMA 3RLMD 5CYKB 2CN3A 4J87A 5CXCA 2IUPA 3UKUC 2OIZA 4XYHA 2OVPB 2CE9A 4OZUA 4A09B 4MK0B 4GMBA 3V9FA 3CFVA 4FAVD 2AH0A 5FQDA 3K26A 3L4MD 4CY3A 2Z2NA 3OTTA 4IA9A 4JXMA 4X3EA 4CC9A 4G56B 1Q47A 3ORVD 2HYEA 2HJBA 5AFU3 3IJ0A 3K27A 2BBKH 4N14A 3AFCA 3JROA 3C75H 4J77A 3JZGA 3NVQA 3SJLD 2OK6A 4ZN4A 5IJ7E 3EG6A 3DXMC 4J8BA 2IWKA 3PXTD 2J55H 4FA9D 2CO0C 3RSEC 3VGZA 4JSNC 5CXCB 4CY5A 2IUQA 4X63B 2IAAA 4E5ZB 1PEVA 4A2MA 3C99A 3DXKC 3CIKB 4ZOZA 5K1CC 2P9SC 2H47A 1TBGA 3PSCB 3SBQA 2XU7A 4BL0A 4I79A 4O9DA 3CFSB 3UR4A 1PGUA 1R5MA 2BCJB 3UKRC 3B7FA 3FGBA 3IIYA 4D0KA 5HE3B 1QNIA 5FLXg 1XIPA 3IKOA 2B5LA 3I7HA 3RFGA 5FA5B 4O3UB 5TEEA 4NSXA 3BG0A 3FRXA 1B9XA 3MZKA 1NR0A 2YB8B 3BG1A 2IUVA 5AJAA 4JT6C 5C9ZB 2HKMA 3MMYA 3W15A 4JSXC 3SXTD 4GM3A 1N6EA 4GQ1A 5HYNB 4H5JA 3UVNA 4ZOYA 3SBPA 2QXVA 2H9NA 1JMZB 2IWFA 3AL9A 3PXSD 4PNKB 4CZVA 4CI8A 3JRPA 3KRXB 4J78A 2CN2A 5IGOA 2P9PC 2AGYA 1MDAH 4IMMA 3I7PA 1JJUB 2J57G 3UVMA 4J8GA 4FAND 5JWZA 3DSMA 3A0FA 1K32A 2B4EA 5EM2A 1GOTB 2GC7A 4E54A 4L3GD 2Z2OA 4A0AB 2YMUA 2CE8A 1S4UX 3PVWB 2AH1A 2TRCB 4ZOVA 5GMKn 3SHFA 5I5JA 4U7AA 3VH0A 4TZ4A 2H6QA 2UZYB 2GNQA 2I0TA 4X61B 2OJYA 4XYIA 5IJ8E 5AMSA 2CO0A 2P9IC 4A08A 3F3PA 4LG9A 4FA1D 3DWLC 3SWSD 3I8EA 3EI3A 4PBZA 3SMRA 3HFQA 4J82A 4GGAA 5EM2B 4X60B 4E54B 4A0BA 3PXWD 2H9LA 4CY1A 3OL2A 4GM9A 5CXBA 3JPXA 4JSPC 3IIWA 3SLED 3C5MA 3P4FA 4L9OA 5IT9g 3EI2A 3EMHA 2YNOA 3MKQA 2I0RA 3EWEA 4JT5C 4PXWA 3AL8A 2XL3A 3I89A 2Z2PA 3GFCA 4D6VA 1N6FA 3EI4A 2J56H 4FHLA 5FKSA 5HE1B 4A08B 3N0EA 4PSWB 4ESGA 5A2Qg 4BH6A 4AOWA 2AGXA 3JB9L 3EI3B 3RFHA 3MKSB 4A0BB 1A0RB 3OL2B 5CXBB 2PM9A 3NVXA 5TEFA 3EI2B 5H17A 4LGNA 1GG2B 5EMLB 5HE0B 2HXCA 2AQ5A 1FWXA 1PBYB 4O3TB 3U4YA 4PBYA 2CNXA 2I3SA 1MG3A 3EI4B 1B9YA 5B4WA 4U1EI 2Q7QA 4LG8A 5HE2B 3MXXA 2H13A 2H14A 4CI3A 2EBSA 3L4OD 2AGWA 2PM9B 4CI2A 5C2VB 3VA6A 3BWSA 4JD2C 5CYKA 4PC0A 4FA5D 5I5MA 4K3ID 4GQ2P 4FA4D 2H6NA 2PBIB 2UZXB 1JOFA 3RRMC 2O9KA 4FWWA 5IC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBR A;  5EMK B;  1RI6 A;  4HDJ A;  4AEZ A;  5KDO B;  2H9P A;  3EU7 A;  3PE7 A;  4H5I A;  4BUJ C;  4QT8 A;  3C9C A;  5THA A;  4K3J B;  3F3F A;  1MG2 A;  2OVR B;  3RMZ D;  4O1Q D;  2YNP A;  5EAR A;  4GGC A;  3GRE A;  3OKY A;  2XL2 A;  4CI1 A;  4E5Z A;  3OKT A;  3I8C A;  5EAP A;  3PVU B;  4R7A B;  1NEX B;  2W18 A;  5TF2 A;  3I7N A;  4FB1 D;  4Z8L A;  3IJ1 A;  3PSL A;  4A11 A;  3UVL A;  2YNN A;  1SQJ A;  4GM8 A;  5TDH B;  4ERY A;  2GC4 A;  4J79 A;  3JZN A;  1GP2 B;  3J81 g;  2QC5 A;  1OLZ A;  2B5M A;  5FKQ A;  3JZH A;  5GXH A;  1YFQ A;  4J84 A;  3SCY A;  3EI1 A;  5FKT A;  4EWR A;  4GGD A;  5FKR A;  3MZL A;  1XKS A;  1OMW B;  3OKY B;  2IUR A;  5H1M A;  3NVN A;  3I7L A;  4PSX B;  4ZOX A;  3UVK A;  4ERQ A;  3I7K A;  2OVQ B;  5EMJ B;  3AH8 B;  2P9L C;  1ERJ A;  5FXY A;  4A11 B;  3N0D A;  3SN6 B;  2G9A A;  3ULE C;  4ERZ A;  5EMM B;  3SFZ A;  4CZX A;  3RN1 D;  4J86 A;  4J81 A;  5C2W B;  1PI6 A;  4J0X A;  2MTA H;  4OWR A;  2HKR A;  4CY2 A;  5I5I A;  3F3G A;  1TYQ C;  2I3T A;  3AL8 B;  3DM0 A;  2G99 A;  4QRJ A;  5HQG A;  5K19 A;  1P22 A;  3J80 g;  2P9K C;  5GSA A;  2AGL A;  3FM0 A;  3IJC A;  4UI9 R;  3EI1 B;  3UVO A;  3RN0 D;  4GQB B;  4A7J A;  2I0S A;  5SXM A;  1U4C A;  2HJ4 A;  4L1Q D;  1K8K C;  4J73 A;  5H14 A;  1U2V C;  4JSV C;  2P9U C;  4A0A A;  5GXI A;  4Y5R D;  4L3H D;  4J0W A;  3I7O A;  1VYH C;  2AGZ A;  3ODT A;  4GZ8 A;  3V7D B;  2H6K A;  3I2N A;  1SQ9 A;  4QQE A;  1JMX B;  2P9N C;  2H9M A;  4Y7R A;  4YVD A;  2YBA A;  4A09 A;  2XYI A;  1N6D A;  4CZY A;  3OW8 A;  2H3X A;  1XHM A;  2B5N A;  3SVW D;  2H68 A;  3JAM g;  3KRW B;  5EAL A;  2HES X;  2PM7 B;  3E0C A;  4KFM B;  4A2L A;  4ES0 A;  3ZWL B;  1L0Q A;  2PM6 B;  3V5W B;  5IGQ A;  4QL1 A;  4O45 A;  1GXR A;  4XEI C;  2OK4 A;  1SHY B;  3OKW A;  5EAM A;  3RLM D;  5CYK B;  2CN3 A;  4J87 A;  5CXC A;  2IUP A;  3UKU C;  2OIZ A;  4XYH A;  2OVP B;  2CE9 A;  4OZU A;  4A09 B;  4MK0 B;  4GMB A;  3V9F A;  3CFV A;  4FAV D;  2AH0 A;  5FQD A;  3K26 A;  3L4M D;  4CY3 A;  2Z2N A;  3OTT A;  4IA9 A;  4JXM A;  4X3E A;  4CC9 A;  4G56 B;  1Q47 A;  3ORV D;  2HYE A;  2HJB A;  5AFU 3;  3IJ0 A;  3K27 A;  2BBK H;  4N14 A;  3AFC A;  3JRO A;  3C75 H;  4J77 A;  3JZG A;  3NVQ A;  3SJL D;  2OK6 A;  4ZN4 A;  5IJ7 E;  3EG6 A;  3DXM C;  4J8B A;  2IWK A;  3PXT D;  2J55 H;  4FA9 D;  2CO0 C;  3RSE C;  3VGZ A;  4JSN C;  5CXC B;  4CY5 A;  2IUQ A;  4X63 B;  2IAA A;  4E5Z B;  1PEV A;  4A2M A;  3C99 A;  3DXK C;  3CIK B;  4ZOZ A;  5K1C C;  2P9S C;  2H47 A;  1TBG A;  3PSC B;  3SBQ A;  2XU7 A;  4BL0 A;  4I79 A;  4O9D A;  3CFS B;  3UR4 A;  1PGU A;  1R5M A;  2BCJ B;  3UKR C;  3B7F A;  3FGB A;  3IIY A;  4D0K A;  5HE3 B;  1QNI A;  5FLX g;  1XIP A;  3IKO A;  2B5L A;  3I7H A;  3RFG A;  5FA5 B;  4O3U B;  5TEE A;  4NSX A;  3BG0 A;  3FRX A;  1B9X A;  3MZK A;  1NR0 A;  2YB8 B;  3BG1 A;  2IUV A;  5AJA A;  4JT6 C;  5C9Z B;  2HKM A;  3MMY A;  3W15 A;  4JSX C;  3SXT D;  4GM3 A;  1N6E A;  4GQ1 A;  5HYN B;  4H5J A;  3UVN A;  4ZOY A;  3SBP A;  2QXV A;  2H9N A;  1JMZ B;  2IWF A;  3AL9 A;  3PXS D;  4PNK B;  4CZV A;  4CI8 A;  3JRP A;  3KRX B;  4J78 A;  2CN2 A;  5IGO A;  2P9P C;  2AGY A;  1MDA H;  4IMM A;  3I7P A;  1JJU B;  2J57 G;  3UVM A;  4J8G A;  4FAN D;  5JWZ A;  3DSM A;  3A0F A;  1K32 A;  2B4E A;  5EM2 A;  1GOT B;  2GC7 A;  4E54 A;  4L3G D;  2Z2O A;  4A0A B;  2YMU A;  2CE8 A;  1S4U X;  3PVW B;  2AH1 A;  2TRC B;  4ZOV A;  5GMK n;  3SHF A;  5I5J A;  4U7A A;  3VH0 A;  4TZ4 A;  2H6Q A;  2UZY B;  2GNQ A;  2I0T A;  4X61 B;  2OJY A;  4XYI A;  5IJ8 E;  5AMS A;  2CO0 A;  2P9I C;  4A08 A;  3F3P A;  4LG9 A;  4FA1 D;  3DWL C;  3SWS D;  3I8E A;  3EI3 A;  4PBZ A;  3SMR A;  3HFQ A;  4J82 A;  4GGA A;  5EM2 B;  4X60 B;  4E54 B;  4A0B A;  3PXW D;  2H9L A;  4CY1 A;  3OL2 A;  4GM9 A;  5CXB A;  3JPX A;  4JSP C;  3IIW A;  3SLE D;  3C5M A;  3P4F A;  4L9O A;  5IT9 g;  3EI2 A;  3EMH A;  2YNO A;  3MKQ A;  2I0R A;  3EWE A;  4JT5 C;  4PXW A;  3AL8 A;  2XL3 A;  3I89 A;  2Z2P A;  3GFC A;  4D6V A;  1N6F A;  3EI4 A;  2J56 H;  4FHL A;  5FKS A;  5HE1 B;  4A08 B;  3N0E A;  4PSW B;  4ESG A;  5A2Q g;  4BH6 A;  4AOW A;  2AGX A;  3JB9 L;  3EI3 B;  3RFH A;  3MKS B;  4A0B B;  1A0R B;  3OL2 B;  5CXB B;  2PM9 A;  3NVX A;  5TEF A;  3EI2 B;  5H17 A;  4LGN A;  1GG2 B;  5EML B;  5HE0 B;  2HXC A;  2AQ5 A;  1FWX A;  1PBY B;  4O3T B;  3U4Y A;  4PBY A;  2CNX A;  2I3S A;  1MG3 A;  3EI4 B;  1B9Y A;  5B4W A;  4U1E I;  2Q7Q A;  4LG8 A;  5HE2 B;  3MXX A;  2H13 A;  2H14 A;  4CI3 A;  2EBS A;  3L4O D;  2AGW A;  2PM9 B;  4CI2 A;  5C2V B;  3VA6 A;  3BWS A;  4JD2 C;  5CYK A;  4PC0 A;  4FA5 D;  5I5M A;  4K3I D;  4GQ2 P;  4FA4 D;  2H6N A;  2PBI B;  2UZX B;  1JOF A;  3RRM C;  2O9K A;  4FWW A;  5IC7 A; 
#chains in the Genus database with same CATH topology
 3SBR A;  4DNW A;  5EMK B;  3K72 A;  1RI6 A;  4HDJ A;  3GC3 B;  1UOQ A;  4AEZ A;  5KDO B;  2H9P A;  3EU7 A;  3PE7 A;  1YR2 A;  4H5I A;  4G1E A;  4BUJ C;  4QT8 A;  3C9C A;  1VE6 A;  5THA A;  4K3J B;  4BP9 A;  1JTD B;  3F3F A;  1MG2 A;  2OVR B;  3RMZ D;  4O1Q D;  2YNP A;  4RE5 A;  3EQ8 A;  5EAR A;  4GGC A;  3GRE A;  3OKY A;  2XL2 A;  4CI1 A;  3ZE2 A;  2XE4 A;  4E5Z A;  3OKT A;  3I8C A;  5EAP A;  3PVU B;  4R7A B;  1NEX B;  2W18 A;  5TF2 A;  3I7N A;  4FB1 D;  3IUL A;  1E8M A;  3ZDZ A;  4Z8L A;  3IJ1 A;  3PSL A;  4A11 A;  3NID A;  3UVL A;  2YNN A;  1SQJ A;  4GM8 A;  5HDB A;  5TDH B;  4ERY A;  2GC4 A;  4J79 A;  3JZN A;  1GP2 B;  3GD1 I;  3J81 g;  2QC5 A;  1OLZ A;  4MMZ A;  2B5M A;  4NEN A;  5FKQ A;  3JZH A;  3O4G A;  5GXH A;  1YFQ A;  4J84 A;  3SCY A;  3EI1 A;  5FKT A;  4EWR A;  4GGD A;  5FKR A;  3MZL A;  1XKS A;  1OMW B;  3OKY B;  2IUR A;  5H1M A;  3NVN A;  1VZ2 A;  1E8N A;  1H2Y A;  3I7L A;  4PSX B;  4ZOX A;  3UVK A;  4ERQ A;  3I7K A;  3O4I A;  2OVQ B;  5EMJ B;  3AH8 B;  2P9L C;  1ERJ A;  4L1M A;  5FXY A;  4A11 B;  3N0D A;  3SN6 B;  3MVD K;  4DNU A;  2G9A A;  3ULE C;  4ERZ A;  5EMM B;  3SFZ A;  4CZX A;  3RN1 D;  3O4J A;  4J86 A;  4J81 A;  5C2W B;  1PI6 A;  2VDP A;  2MTA H;  4J0X A;  2HKR A;  4OWR A;  4CY2 A;  1H2X A;  4UM8 A;  5I5I A;  1QFM A;  3F3G A;  1TYQ C;  2I3T A;  3AL8 B;  3DM0 A;  2G99 A;  3IJE A;  4QRJ A;  5HQG A;  5K19 A;  1P22 A;  3J80 g;  2P9K C;  5GSA A;  3ZDY A;  2XDW A;  2AGL A;  3FM0 A;  3IJC A;  4UI9 R;  3EI1 B;  3UVO A;  3RN0 D;  4GQB B;  4A7J A;  2I0S A;  5SXM A;  4DNV A;  1U4C A;  2HJ4 A;  4L1Q D;  1K8K C;  4J73 A;  5H14 A;  2VZ3 A;  1U2V C;  1C9I A;  4AN1 A;  5FFG A;  4JSV C;  2P9U C;  4A0A A;  5GXI A;  4Y5R D;  4L3H D;  4J0W A;  3I7O A;  1VYH C;  3IVM A;  2AGZ A;  3ODT A;  4GZ8 A;  3V7D B;  2H6K A;  4BCD A;  3I2N A;  1SQ9 A;  4QQE A;  1JMX B;  2P9N C;  1H2Z A;  2H9M A;  4Y7R A;  4YVD A;  2YBA A;  1UOO A;  3EQ7 A;  4WK4 A;  5M61 A;  4A09 A;  2XYI A;  1N6D A;  4CZY A;  3OW8 A;  2H3X A;  1XHM A;  2B5N A;  1QFS A;  3SVW D;  2H68 A;  3JAM g;  1GOG A;  3KRW B;  5EAL A;  3VI3 A;  2HES X;  5E6S A;  2PM7 B;  3E0C A;  4KFM B;  4A2L A;  4ES0 A;  5M5S A;  3ZWL B;  1L0Q A;  2PM6 B;  3V5W B;  5IGQ A;  4QL1 A;  5M5V A;  4O45 A;  1GXR A;  4XEI C;  2OK4 A;  1SHY B;  3OKW A;  5EAM A;  3RLM D;  5CYK B;  2CN3 A;  2QR5 A;  4J87 A;  4UM9 A;  5CXC A;  4BCC A;  2IUP A;  3UKU C;  2OIZ A;  3V4V A;  4XYH A;  1O6F A;  2OVP B;  2CE9 A;  4OZU A;  4A09 B;  4MK0 B;  4GMB A;  3V9F A;  3CFV A;  4FAV D;  2AH0 A;  5FQD A;  3K26 A;  1O6G A;  3L4M D;  2Z2N A;  3OTT A;  4IA9 A;  4JXM A;  4X3E A;  4CY3 A;  4CC9 A;  3FCU A;  4G56 B;  1Q47 A;  3ORV D;  2HYE A;  2HJB A;  5AFU 3;  3IJ0 A;  3K27 A;  2BBK H;  4N14 A;  3AFC A;  3JRO A;  1L5G A;  3T3M A;  3C75 H;  4J77 A;  3JZG A;  3NVQ A;  3SJL D;  2OK6 A;  4ZN4 A;  5IJ7 E;  3EG6 A;  5FFO A;  3DXM C;  4J8B A;  2IWK A;  3PXT D;  2J55 H;  4FA9 D;  2CO0 C;  3RSE C;  4G55 A;  2JKX A;  3VGZ A;  4JSN C;  5CXC B;  4CY5 A;  2IUQ A;  4X63 B;  2IAA A;  1U8C A;  4E5Z B;  1PEV A;  4A2M A;  3IUN A;  3C99 A;  3DXK C;  3CIK B;  4ZOZ A;  5K1C C;  2P9S C;  2H47 A;  4QAM A;  1TBG A;  3PSC B;  3SBQ A;  2XU7 A;  4BL0 A;  4I79 A;  4O02 A;  3QI0 A;  4O9D A;  3CFS B;  5E6R A;  3UR4 A;  1PGU A;  1R5M A;  2BCJ B;  1VE7 A;  3UKR C;  3B7F A;  3FGB A;  3IIY A;  4D0K A;  5HE3 B;  2VDO A;  1QNI A;  5FLX g;  2EID A;  1XIP A;  3IKO A;  2B5L A;  3I7H A;  3RFG A;  5FA5 B;  4O3U B;  5TEE A;  4NSX A;  5M5T A;  3BG0 A;  3FRX A;  1B9X A;  4WK2 A;  3IUR A;  3K71 A;  3NIG A;  2EIE A;  3MZK A;  1NR0 A;  2YB8 B;  3BG1 A;  2IUV A;  5AJA A;  3IUJ A;  4JT6 C;  5C9Z B;  2HKM A;  3MMY A;  3W15 A;  4JSX C;  3ZE1 A;  3SXT D;  4GM3 A;  1N6E A;  4GQ1 A;  5HYN B;  4H5J A;  1C9L A;  3T3P A;  3UVN A;  4NBM A;  4ZOY A;  4AMY A;  2VDR A;  3SBP A;  2HU7 A;  2QXV A;  2H9N A;  1JMZ B;  2IWF A;  3AL9 A;  3MUO A;  3PXS D;  4PNK B;  4CZV A;  4CI8 A;  2HU8 A;  3QHY B;  3JRP A;  3KRX B;  4J78 A;  2CN2 A;  5IGO A;  1JV2 A;  4JHP C;  4AMZ A;  2P9P C;  3IUM A;  2AGY A;  4NC4 A;  1MDA H;  4IMM A;  3K6S A;  2EIB A;  3I7P A;  1JJU B;  1UOP A;  2J57 G;  3IUQ A;  3UVM A;  4J8G A;  4FAN D;  5JWZ A;  3OF7 A;  2EIC A;  3DSM A;  3A0F A;  1K32 A;  2B4E A;  5EM2 A;  1GOT B;  2GC7 A;  4E54 A;  4L3G D;  2Z2O A;  4A0A B;  2YMU A;  2XZG A;  2CE8 A;  1S4U X;  3PVW B;  2AH1 A;  2TRC B;  3FCS A;  4ZOV A;  5GMK n;  3SHF A;  5C92 A;  5I5J A;  1K3I A;  4U7A A;  4BP8 A;  3VH0 A;  4TZ4 A;  2H6Q A;  2UZY B;  2GNQ A;  4BCB A;  2I0T A;  4X61 B;  2OJY A;  4XYI A;  2BKL A;  5IJ8 E;  2WQ8 A;  1M1X A;  5AMS A;  2CO0 A;  2P9I C;  2VDL A;  2VDM A;  4A08 A;  3VI4 A;  2VDQ A;  3F3P A;  4LG9 A;  4FA1 D;  3DWL C;  3SWS D;  3I8E A;  3EI3 A;  4PBZ A;  1UTC A;  4WJK A;  3SMR A;  3HFQ A;  4J82 A;  4Z7Q A;  4GGA A;  5EM2 B;  4X60 B;  4E54 B;  4A0B A;  3PXW D;  2H9L A;  4CY1 A;  3OL2 A;  4GM9 A;  5CXB A;  3JPX A;  4JSP C;  3IIW A;  4WK0 A;  4Z7N A;  3SLE D;  3C5M A;  3P4F A;  4L9O A;  5IT9 g;  3EI2 A;  3EQ9 A;  3EMH A;  2YNO A;  3MKQ A;  2I0R A;  3EWE A;  4IRZ A;  3MUN A;  2VZ1 A;  4JT5 C;  4PXW A;  3AL8 A;  2XL3 A;  3I89 A;  1E5T A;  1I2M B;  2Z2P A;  4D9S A;  3GFC A;  4D6V A;  1N6F A;  4JHN A;  3EI4 A;  2J56 H;  4FHL A;  5FKS A;  5HE1 B;  5M5R A;  4A08 B;  3N0E A;  4PSW B;  4ESG A;  5A2Q g;  4BH6 A;  4AOW A;  2AGX A;  4Z7O A;  3EI3 B;  5M5U A;  3JB9 L;  2VDK A;  3RFH A;  1GOH A;  3MKS B;  4O2W A;  1A12 A;  4A0B B;  3ZE0 A;  1A0R B;  3OL2 B;  5CXB B;  2PM9 A;  4G1M A;  3DDU A;  3NVX A;  3NIF A;  2VDN A;  5TEF A;  3EI2 B;  4AN0 A;  4NAA A;  1VZ3 A;  5H17 A;  5C86 A;  4LGN A;  1GOF A;  1GG2 B;  1TYE A;  5EML B;  5HE0 B;  2HXC A;  2AQ5 A;  1FWX A;  1PBY B;  4O3T B;  3U4Y A;  4PBY A;  2CNX A;  2I3S A;  1MG3 A;  3V4P A;  3KCI A;  4MMX A;  3EI4 B;  1BPO A;  1B9Y A;  5B4W A;  1H2W A;  4U1E I;  2Q7Q A;  2HU5 A;  4LG8 A;  5HE2 B;  1T2X A;  3MXX A;  2H13 A;  2H14 A;  4CI3 A;  2EBS A;  2QZP A;  3L4O D;  2AGW A;  3ZDX A;  2PM9 B;  4MMY A;  4CI2 A;  5C2V B;  3VA6 A;  3BWS A;  4JD2 C;  2VC2 A;  5CYK A;  4PC0 A;  4AX4 A;  4FA5 D;  5I5M A;  4K3I D;  4GQ2 P;  5E6U A;  4FA4 D;  2H6N A;  2PBI B;  2UZX B;  1JOF A;  3O4H A;  3RRM C;  2O9K A;  4FWW A;  4RE6 A;  5IC7 A; 
#chains in the Genus database with same CATH homology
 3SBR A;  5EMK B;  1RI6 A;  4HDJ A;  4AEZ A;  5KDO B;  2H9P A;  3EU7 A;  3PE7 A;  4H5I A;  4BUJ C;  4QT8 A;  3C9C A;  5THA A;  4K3J B;  3F3F A;  1MG2 A;  2OVR B;  3RMZ D;  4O1Q D;  2YNP A;  5EAR A;  4GGC A;  3GRE A;  3OKY A;  2XL2 A;  4CI1 A;  4E5Z A;  3OKT A;  3I8C A;  5EAP A;  3PVU B;  4R7A B;  1NEX B;  2W18 A;  5TF2 A;  3I7N A;  4FB1 D;  4Z8L A;  3IJ1 A;  3PSL A;  4A11 A;  3UVL A;  2YNN A;  1SQJ A;  4GM8 A;  5TDH B;  4ERY A;  2GC4 A;  4J79 A;  3JZN A;  1GP2 B;  3J81 g;  2QC5 A;  1OLZ A;  2B5M A;  5FKQ A;  3JZH A;  5GXH A;  1YFQ A;  4J84 A;  3SCY A;  3EI1 A;  5FKT A;  4EWR A;  4GGD A;  5FKR A;  3MZL A;  1XKS A;  1OMW B;  3OKY B;  2IUR A;  5H1M A;  3NVN A;  3I7L A;  4PSX B;  4ZOX A;  3UVK A;  4ERQ A;  3I7K A;  2OVQ B;  5EMJ B;  3AH8 B;  2P9L C;  1ERJ A;  5FXY A;  4A11 B;  3N0D A;  3SN6 B;  2G9A A;  3ULE C;  4ERZ A;  5EMM B;  3SFZ A;  4CZX A;  3RN1 D;  4J86 A;  4J81 A;  5C2W B;  1PI6 A;  4J0X A;  2MTA H;  4OWR A;  2HKR A;  4CY2 A;  5I5I A;  3F3G A;  1TYQ C;  2I3T A;  3AL8 B;  3DM0 A;  2G99 A;  4QRJ A;  5HQG A;  5K19 A;  1P22 A;  3J80 g;  2P9K C;  5GSA A;  2AGL A;  3FM0 A;  3IJC A;  4UI9 R;  3EI1 B;  3UVO A;  3RN0 D;  4GQB B;  4A7J A;  2I0S A;  5SXM A;  1U4C A;  2HJ4 A;  4L1Q D;  1K8K C;  4J73 A;  5H14 A;  1U2V C;  4JSV C;  2P9U C;  4A0A A;  5GXI A;  4Y5R D;  4L3H D;  4J0W A;  3I7O A;  1VYH C;  2AGZ A;  3ODT A;  4GZ8 A;  3V7D B;  2H6K A;  3I2N A;  1SQ9 A;  4QQE A;  1JMX B;  2P9N C;  2H9M A;  4Y7R A;  4YVD A;  2YBA A;  4A09 A;  2XYI A;  1N6D A;  4CZY A;  3OW8 A;  2H3X A;  1XHM A;  2B5N A;  3SVW D;  2H68 A;  3JAM g;  3KRW B;  5EAL A;  2HES X;  2PM7 B;  3E0C A;  4KFM B;  4A2L A;  4ES0 A;  3ZWL B;  1L0Q A;  2PM6 B;  3V5W B;  5IGQ A;  4QL1 A;  4O45 A;  1GXR A;  4XEI C;  2OK4 A;  1SHY B;  3OKW A;  5EAM A;  3RLM D;  5CYK B;  2CN3 A;  4J87 A;  5CXC A;  2IUP A;  3UKU C;  2OIZ A;  4XYH A;  2OVP B;  2CE9 A;  4OZU A;  4A09 B;  4MK0 B;  4GMB A;  3V9F A;  3CFV A;  4FAV D;  2AH0 A;  5FQD A;  3K26 A;  3L4M D;  4CY3 A;  2Z2N A;  3OTT A;  4IA9 A;  4JXM A;  4X3E A;  4CC9 A;  4G56 B;  1Q47 A;  3ORV D;  2HYE A;  2HJB A;  5AFU 3;  3IJ0 A;  3K27 A;  2BBK H;  4N14 A;  3AFC A;  3JRO A;  3C75 H;  4J77 A;  3JZG A;  3NVQ A;  3SJL D;  2OK6 A;  4ZN4 A;  5IJ7 E;  3EG6 A;  3DXM C;  4J8B A;  2IWK A;  3PXT D;  2J55 H;  4FA9 D;  2CO0 C;  3RSE C;  3VGZ A;  4JSN C;  5CXC B;  4CY5 A;  2IUQ A;  4X63 B;  2IAA A;  4E5Z B;  1PEV A;  4A2M A;  3C99 A;  3DXK C;  3CIK B;  4ZOZ A;  5K1C C;  2P9S C;  2H47 A;  1TBG A;  3PSC B;  3SBQ A;  2XU7 A;  4BL0 A;  4I79 A;  4O9D A;  3CFS B;  3UR4 A;  1PGU A;  1R5M A;  2BCJ B;  3UKR C;  3B7F A;  3FGB A;  3IIY A;  4D0K A;  5HE3 B;  1QNI A;  5FLX g;  1XIP A;  3IKO A;  2B5L A;  3I7H A;  3RFG A;  5FA5 B;  4O3U B;  5TEE A;  4NSX A;  3BG0 A;  3FRX A;  1B9X A;  3MZK A;  1NR0 A;  2YB8 B;  3BG1 A;  2IUV A;  5AJA A;  4JT6 C;  5C9Z B;  2HKM A;  3MMY A;  3W15 A;  4JSX C;  3SXT D;  4GM3 A;  1N6E A;  4GQ1 A;  5HYN B;  4H5J A;  3UVN A;  4ZOY A;  3SBP A;  2QXV A;  2H9N A;  1JMZ B;  2IWF A;  3AL9 A;  3PXS D;  4PNK B;  4CZV A;  4CI8 A;  3JRP A;  3KRX B;  4J78 A;  2CN2 A;  5IGO A;  2P9P C;  2AGY A;  1MDA H;  4IMM A;  3I7P A;  1JJU B;  2J57 G;  3UVM A;  4J8G A;  4FAN D;  5JWZ A;  3DSM A;  3A0F A;  1K32 A;  2B4E A;  5EM2 A;  1GOT B;  2GC7 A;  4E54 A;  4L3G D;  2Z2O A;  4A0A B;  2YMU A;  2CE8 A;  1S4U X;  3PVW B;  2AH1 A;  2TRC B;  4ZOV A;  5GMK n;  3SHF A;  5I5J A;  4U7A A;  3VH0 A;  4TZ4 A;  2H6Q A;  2UZY B;  2GNQ A;  2I0T A;  4X61 B;  2OJY A;  4XYI A;  5IJ8 E;  5AMS A;  2CO0 A;  2P9I C;  4A08 A;  3F3P A;  4LG9 A;  4FA1 D;  3DWL C;  3SWS D;  3I8E A;  3EI3 A;  4PBZ A;  3SMR A;  3HFQ A;  4J82 A;  4GGA A;  5EM2 B;  4X60 B;  4E54 B;  4A0B A;  3PXW D;  2H9L A;  4CY1 A;  3OL2 A;  4GM9 A;  5CXB A;  3JPX A;  4JSP C;  3IIW A;  3SLE D;  3C5M A;  3P4F A;  4L9O A;  5IT9 g;  3EI2 A;  3EMH A;  2YNO A;  3MKQ A;  2I0R A;  3EWE A;  4JT5 C;  4PXW A;  3AL8 A;  2XL3 A;  3I89 A;  2Z2P A;  3GFC A;  4D6V A;  1N6F A;  3EI4 A;  2J56 H;  4FHL A;  5FKS A;  5HE1 B;  4A08 B;  3N0E A;  4PSW B;  4ESG A;  5A2Q g;  4BH6 A;  4AOW A;  2AGX A;  3JB9 L;  3EI3 B;  3RFH A;  3MKS B;  4A0B B;  1A0R B;  3OL2 B;  5CXB B;  2PM9 A;  3NVX A;  5TEF A;  3EI2 B;  5H17 A;  4LGN A;  1GG2 B;  5EML B;  5HE0 B;  2HXC A;  2AQ5 A;  1FWX A;  1PBY B;  4O3T B;  3U4Y A;  4PBY A;  2CNX A;  2I3S A;  1MG3 A;  3EI4 B;  1B9Y A;  5B4W A;  4U1E I;  2Q7Q A;  4LG8 A;  5HE2 B;  3MXX A;  2H13 A;  2H14 A;  4CI3 A;  2EBS A;  3L4O D;  2AGW A;  2PM9 B;  4CI2 A;  5C2V B;  3VA6 A;  3BWS A;  4JD2 C;  5CYK A;  4PC0 A;  4FA5 D;  5I5M A;  4K3I D;  4GQ2 P;  4FA4 D;  2H6N A;  2PBI B;  2UZX B;  1JOF A;  3RRM C;  2O9K A;  4FWW A;  5IC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...