2H13A

Crystal structure of wdr5/histone h3 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of histone H3 by the WD40 protein WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD-repeat protein 5
total genus 102
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h13A00
2HJBA 3F3FA 3SCYA 3BG1A 4EWRA 3MMYA 2HYEA 2IUQA 5HE0B 3SXTD 4TZ4A 3U4YA 1TBGA 3MZLA 4PSWB 2H9LA 1XIPA 2TRCB 3UVNA 3NVNA 4X3EA 2XL2A 2H9MA 3FRXA 5K1CC 3ODTA 1PGUA 2OJYA 3AL8B 3IJ0A 3PVWB 3IIWA 3IKOA 4J84A 3K26A 3IJ1A 3PVUB 2PM6B 4CI8A 4JD2C 4A08A 2UZYB 3KRXB 3EI2B 2HJ4A 4FAND 4X60B 1JMXB 4FHLA 4CZXA 4D6VA 4XYHA 3PE7A 4FAVD 1MG2A 3B7FA 2UZXB 3MZKA 5CXBB 5CXBA 4ERZA 3CFVA 4QQEA 4ZOVA 3W15A 4KFMB 4CY3A 4CZVA 3V7DB 2HXCA 3VGZA 2EBSA 2G99A 3MXXA 2H68A 4GQ1A 3I8CA 3AL9A 4QT8A 2I3TA 4E5ZB 5EAPA 3C99A 3SLED 2YNNA 5GXIA 4H5JA 3IJCA 1N6DA 4R7AB 2CN2A 4I79A 4IMMA 5GSAA 4ESGA 2CE8A 1U2VC 3NVQA 1OMWB 5EMLB 4FA5D 5C2WB 2CNXA 3RFGA 2PM9B 2PM9A 4O1QD 3NVXA 2P9UC 4ZOZA 3I7OA 3EI3B 5H17A 3UKUC 2O9KA 4GQBB 2OK6A 2CN3A 3PXSD 3F3PA 4J78A 4YVDA 4K3JB 4A2LA 3EG6A 3OL2A 2OK4A 4XEIC 3KRWB 2YB8B 2YBAA 3PSLA 2H6QA 4LG9A 5HE2B 5IGQA 3SMRA 4J0WA 3J80g 5EMKB 4CI3A 2BBKH 1K8KC 3L4OD 2P9KC 3C9CA 4JT5C 5FKSA 4J0XA 3VH0A 3GREA 3JZNA 1XKSA 4PBZA 5HE1B 1L0QA 3V9FA 2BCJB 5FKQA 2H47A 5EM2A 4AEZA 1GXRA 3CFSB 1Q47A 3I8EA 4A2MA 4A0AA 2Z2PA 2CO0C 3CIKB 5CYKA 3I89A 4J77A 4J87A 5EALA 1K32A 5CXCA 4BUJC 3SHFA 4J79A 3SBPA 4A7JA 4L9OA 4LG8A 4D0KA 2W18A 1JMZB 4J81A 3FGBA 1PI6A 3RN0D 4JT6C 4L3GD 3UR4A 4HDJA 2PM7B 2YNOA 5FLXg 2IAAA 2H6NA 2B5NA 3FM0A 4A08B 3GFCA 4GM9A 2AQ5A 3PXTD 2H9PA 5HE3B 1A0RB 3JZGA 3BG0A 4GGAA 4PBYA 3JROA 5CXCB 5IJ8E 4ES0A 4GGDA 3V5WB 3DM0A 4PXWA 3UVOA 3RRMC 4QL1A 5EMMB 3OKYB 4GM8A 3A0FA 4LGNA 4A0BB 3ORVD 3MKSB 4Z8LA 4ZOYA 4A0BA 3EWEA 4MK0B 5I5MA 4L1QD 1PBYB 4GGCA 4JSPC 4UI9R 3C5MA 4G56B 2AH1A 2XU7A 3SBQA 5IJ7E 5TF2A 4E54A 4E54B 4J82A 5SXMA 2QC5A 4O3UB 5KDOB 2IWFA 5A2Qg 2OVRB 3I7NA 2QXVA 5EARA 4ERYA 1VYHC 3SVWD 2J56H 1NEXB 3SN6B 2B4EA 4JXMA 2J57G 2AGZA 5IT9g 3ZWLB 3AH8B 2H6KA 2IUVA 4OWRA 1B9XA 5I5IA 5C2VB 2XYIA 5HQGA 3RSEC 5EMJB 5GMKn 1RI6A 1OLZA 2I0TA 5EAMA 2YNPA 5TEEA 3PSCB 2OVQB 3DSMA 2IUPA 4PSXB 3EI4A 4CZYA 3EI4B 4H5IA 4N14A 2CE9A 4O9DA 3F3GA 3JAMg 2J55H 3I7LA 1N6FA 5AJAA 2P9PC 2G9AA 4L3HD 2HESX 3JZHA 3DWLC 4O3TB 5AMSA 5K19A 3P4FA 2I0SA 5HYNB 2AGYA 4K3ID 1GG2B 4CI1A 2B5MA 5CYKB 2Z2OA 2OVPB 3OKWA 4ZN4A 3EI1B 4J73A 5TDHB 2I3SA 1QNIA 3RFHA 5H14A 3I7HA 2OIZA 2P9SC 5GXHA 4IA9A 4CY2A 5EM2B 2AGWA 4GZ8A 3L4MD 4GQ2P 4U1EI 3I7KA 3UVKA 5FKTA 1XHMA 4J8GA 3OL2B 4PNKB 1B9YA 4GM3A 3UVLA 3UVMA 3UKRC 3OW8A 3SFZA 2AGXA 5THAA 2P9IC 5AFU3 3RN1D 1SQ9A 3E0CA 1MG3A 5IC7A 2IWKA 2HKRA 4BH6A 3N0EA 3DXMC 1MDAH 5FXYA 4Y7RA 2H9NA 1SQJA 4FB1D 1S4UX 3I2NA 4O45A 1TYQC 4BL0A 1U4CA 2B5LA 1N6EA 3RLMD 4A11B 4JSXC 4A11A 4Y5RD 2Z2NA 3BWSA 4GMBA 4J8BA 2P9LC 4CY5A 4J86A 3OKYA 3SWSD 4FA1D 2GC4A 1SHYB 3DXKC 3C75H 1GP2B 3IIYA 3EMHA 5C9ZB 4PC0A 4JSNC 4XYIA 3VA6A 4A0AB 4OZUA 2H3XA 3OKTA 2PBIB 3AFCA 3J81g 1YFQA 5TEFA 1PEVA 4X61B 3ULEC 5I5JA 3HFQA 2CO0A 3RMZD 3SBRA 5IGOA 2YMUA 4U7AA 2AGLA 4JSVC 4CC9A 4X63B 2I0RA 4CI2A 5FQDA 4E5ZA 3EI3A 1ERJA 3JRPA 5B4WA 4CY1A 2H14A 3I7PA 1R5MA 4ERQA 4ZOXA 4AOWA 2GC7A 1JJUB 3EI1A 4FA9D 1JOFA 3N0DA 3EU7A 5FKRA 3MKQA 2XL3A 2HKMA 2MTAH 4FA4D 5FA5B 3JB9L 2Q7QA 4FWWA 3SJLD 2AH0A 3OTTA 2P9NC 1NR0A 2H13A 5JWZA 3AL8A 1GOTB 3JPXA 4NSXA 1FWXA 4A09B 1P22A 4A09A 3PXWD 3EI2A 3K27A 5H1MA 2IURA 2GNQA 4QRJA
chains in the Genus database with same CATH superfamily
2HJBA 3F3FA 3SCYA 3BG1A 4EWRA 3VI3A 5C86A 3MMYA 2HYEA 2IUQA 1L5GA 1I2MB 5HE0B 1UOOA 3SXTD 3IURA 4TZ4A 4Z7QA 3U4YA 1TBGA 3MZLA 4PSWB 2H9LA 1XIPA 3MVDK 2TRCB 3UVNA 3NVNA 4X3EA 4BCBA 2XL2A 2H9MA 3FRXA 5K1CC 3ODTA 2VZ1A 3O4HA 1PGUA 4BP8A 2OJYA 3AL8B 3IJ0A 3PVWB 5M5TA 3IIWA 3IKOA 4J84A 3K26A 3IJ1A 3PVUB 2PM6B 4CI8A 3IUJA 4JD2C 2UZYB 4A08A 3KRXB 3EI2B 3MUOA 2HJ4A 4FAND 4X60B 1JMXB 4FHLA 4CZXA 4D6VA 4XYHA 3PE7A 1C9IA 4FAVD 1MG2A 3O4JA 3B7FA 3VI4A 2WQ8A 4BCDA 2UZXB 3MZKA 5CXBB 5CXBA 4ERZA 2EIEA 3CFVA 4QQEA 4ZOVA 1H2YA 3W15A 4KFMB 4CY3A 4CZVA 3EQ8A 3V7DB 2HXCA 3VGZA 4NBMA 3NIGA 2EBSA 2G99A 3MXXA 2H68A 4GQ1A 2VC2A 3I8CA 3AL9A 4QT8A 2I3TA 4E5ZB 5EAPA 1T2XA 3C99A 3T3MA 3SLED 3O4IA 3ZE1A 2YNNA 4MMYA 5GXIA 4AMYA 4H5JA 2VZ3A 3IJCA 1N6DA 4R7AB 2CN2A 4I79A 4RE6A 3O4GA 4IMMA 5FFGA 2CE8A 4ESGA 5GSAA 1U2VC 3NVQA 1OMWB 5EMLB 4FA5D 5C2WB 5E6RA 2CNXA 3RFGA 2EICA 2PM9B 2PM9A 4O1QD 3NVXA 2P9UC 4ZOZA 3I7OA 5FFOA 5E6UA 3EI3B 2JKXA 5H17A 3UKUC 2O9KA 4GQBB 2OK6A 2CN3A 3PXSD 3F3PA 3K72A 4J78A 4K3JB 4YVDA 4A2LA 3EG6A 1UOPA 3OL2A 4UM8A 2OK4A 4AN1A 3KRWB 3PSLA 2YB8B 2YBAA 4XEIC 2H6QA 4LG9A 5HE2B 5IGQA 3SMRA 4J0WA 3J80g 5M5SA 4O2WA 5EMKB 4CI3A 2BBKH 1C9LA 1K8KC 3L4OD 2P9KC 3C9CA 4JT5C 5FKSA 4J0XA 1JV2A 3VH0A 3GREA 4AN0A 3JZNA 3FCSA 3NIFA 1XKSA 4PBZA 2HU5A 5HE1B 1L0QA 3V9FA 2BCJB 5FKQA 3EQ9A 2H47A 5EM2A 4AEZA 1GXRA 3CFSB 1Q47A 1E5TA 3I8EA 4A2MA 4A0AA 2QR5A 2VDRA 2Z2PA 4NC4A 2CO0C 3CIKB 5CYKA 3I89A 4J77A 4J87A 4Z7OA 4MMZA 5EALA 1K32A 5CXCA 4BUJC 3SHFA 4J79A 3SBPA 4A7JA 4L9OA 4LG8A 4D0KA 2XE4A 2W18A 1JMZB 4J81A 4JHPC 3FGBA 3ZDXA 1PI6A 3RN0D 3V4PA 4JT6C 2VDPA 4L3GD 4HDJA 3UR4A 2PM7B 2YNOA 5FLXg 2IAAA 3IULA 2H6NA 2B5NA 3FM0A 4A08B 3GFCA 4GM9A 1H2XA 2AQ5A 3PXTD 2H9PA 5HE3B 1A0RB 3JZGA 3BG0A 4GGAA 4PBYA 3JROA 5CXCB 5IJ8E 4ES0A 4GGDA 3V5WB 3DM0A 4PXWA 3UVOA 4AX4A 3RRMC 4QL1A 5EMMB 3OKYB 4GM8A 1H2WA 1VZ3A 3A0FA 4WK0A 4LGNA 4DNWA 4A0BB 3ORVD 3MKSB 4Z8LA 4ZOYA 4A0BA 3EWEA 1O6GA 4MK0B 5I5MA 3OF7A 4L1QD 1PBYB 4GGCA 4JSPC 2VDLA 1GOGA 4UI9R 4RE5A 3FCUA 3C5MA 4G56B 2AH1A 2XU7A 3SBQA 5IJ7E 5TF2A 4E54A 1VE7A 4E54B 4J82A 5SXMA 2QC5A 4O3UB 5KDOB 2IWFA 2VDMA 5A2Qg 2OVRB 3I7NA 2QXVA 5EARA 4ERYA 1VYHC 3SVWD 1M1XA 3T3PA 2J56H 1NEXB 1JTDB 1UOQA 3SN6B 5HDBA 2B4EA 3EQ7A 4O02A 4JXMA 2J57G 2AGZA 3MUNA 5IT9g 3ZWLB 3AH8B 4WK4A 2H6KA 4NAAA 1YR2A 2IUVA 4OWRA 1B9XA 1TYEA 5I5IA 5C2VB 2XYIA 5HQGA 3RSEC 5EMJB 5GMKn 1RI6A 1VZ2A 1OLZA 2I0TA 5EAMA 2YNPA 5TEEA 3IUMA 1E8MA 3PSCB 2OVQB 3DSMA 2IUPA 4PSXB 1H2ZA 3EI4A 2VDOA 3EI4B 4CZYA 1GOHA 4H5IA 4N14A 2CE9A 3QHYB 4O9DA 3F3GA 3JAMg 2J55H 3I7LA 1N6FA 5AJAA 2P9PC 2G9AA 4L3HD 3GC3B 2HESX 3JZHA 3DWLC 4O3TB 5AMSA 5K19A 5M5VA 3NIDA 3P4FA 1GOFA 2I0SA 5HYNB 2AGYA 4K3ID 1GG2B 4CI1A 2B5MA 5CYKB 4DNUA 2BKLA 2Z2OA 2EIDA 2OVPB 3OKWA 4ZN4A 5E6SA 3EI1B 4J73A 5TDHB 2I3SA 1QNIA 3RFHA 5H14A 4G1EA 3I7HA 2OIZA 2P9SC 3ZE0A 5GXHA 4IA9A 1BPOA 4CY2A 5EM2B 1E8NA 1QFMA 2AGWA 4GZ8A 4NENA 3DDUA 1UTCA 3L4MD 4GQ2P 4U1EI 3I7KA 3UVKA 5FKTA 2VDNA 1XHMA 4J8GA 3OL2B 4PNKB 1B9YA 4GM3A 3UVLA 3UVMA 5M61A 3UKRC 3OW8A 3SFZA 2AGXA 5THAA 4BP9A 3ZDZA 2P9IC 5AFU3 3QI0A 3RN1D 4WJKA 1SQ9A 3GD1I 4BCCA 1A12A 3E0CA 1MG3A 5IC7A 2IWKA 2HKRA 4BH6A 3N0EA 5M5RA 3DXMC 1MDAH 5FXYA 4Y7RA 2H9NA 1SQJA 4FB1D 3V4VA 1S4UX 4G1MA 3I2NA 4O45A 1TYQC 4BL0A 1U4CA 2B5LA 4WK2A 5C92A 1N6EA 3RLMD 4A11B 4JSXC 4A11A 2QZPA 4Y5RD 2Z2NA 3BWSA 4GMBA 4J8BA 2P9LC 4CY5A 4J86A 3OKYA 3SWSD 4FA1D 4L1MA 2GC4A 1SHYB 3DXKC 3C75H 1GP2B 3IIYA 3K71A 3EMHA 3IUQA 5C9ZB 4PC0A 4JSNC 4XYIA 3VA6A 1U8CA 4A0AB 1O6FA 4OZUA 4JHNA 2H3XA 3OKTA 2HU8A 2PBIB 3AFCA 3J81g 1QFSA 2XZGA 2EIBA 3IVMA 2XDWA 1YFQA 5TEFA 1PEVA 4G55A 4X61B 3ULEC 5I5JA 3HFQA 2CO0A 4AMZA 3ZE2A 3IUNA 3KCIA 3RMZD 3SBRA 5IGOA 2YMUA 4U7AA 2AGLA 4Z7NA 4JSVC 4CC9A 3ZDYA 4X63B 2I0RA 4CI2A 5FQDA 4E5ZA 3EI3A 1ERJA 3JRPA 5B4WA 4CY1A 2H14A 3I7PA 1R5MA 2HU7A 4ERQA 4QAMA 4ZOXA 4AOWA 5M5UA 2GC7A 4UM9A 1JJUB 3EI1A 4FA9D 1JOFA 3N0DA 3EU7A 2VDKA 1K3IA 4IRZA 5FKRA 3MKQA 2XL3A 2HKMA 1VE6A 4QRJA 2MTAH 3IJEA 4DNVA 4FA4D 5FA5B 3JB9L 2Q7QA 4FWWA 3SJLD 2AH0A 3OTTA 2P9NC 1NR0A 2H13A 5JWZA 3AL8A 1GOTB 3JPXA 1FWXA 2VDQA 4NSXA 1P22A 4D9SA 3PXWD 4A09B 4A09A 3EI2A 3K27A 5H1MA 2IURA 3K6SA 2GNQA 4MMXA
chains in the Genus database with same CATH topology
2HJBA 3F3FA 3SCYA 3BG1A 4EWRA 3MMYA 2HYEA 2IUQA 5HE0B 3SXTD 4TZ4A 3U4YA 1TBGA 3MZLA 4PSWB 2H9LA 1XIPA 2TRCB 3UVNA 3NVNA 4X3EA 2XL2A 2H9MA 3FRXA 5K1CC 3ODTA 1PGUA 2OJYA 3AL8B 3IJ0A 3PVWB 3IIWA 3IKOA 4J84A 3K26A 3IJ1A 3PVUB 2PM6B 4CI8A 4JD2C 4A08A 2UZYB 3KRXB 3EI2B 2HJ4A 4FAND 4X60B 1JMXB 4FHLA 4CZXA 4D6VA 4XYHA 3PE7A 4FAVD 1MG2A 3B7FA 2UZXB 3MZKA 5CXBB 5CXBA 4ERZA 3CFVA 4QQEA 4ZOVA 3W15A 4KFMB 4CY3A 4CZVA 3V7DB 2HXCA 3VGZA 2EBSA 2G99A 3MXXA 2H68A 4GQ1A 3I8CA 3AL9A 4QT8A 2I3TA 4E5ZB 5EAPA 3C99A 3SLED 2YNNA 5GXIA 4H5JA 3IJCA 1N6DA 4R7AB 2CN2A 4I79A 4IMMA 5GSAA 4ESGA 2CE8A 1U2VC 3NVQA 1OMWB 5EMLB 4FA5D 5C2WB 2CNXA 3RFGA 2PM9B 2PM9A 4O1QD 3NVXA 2P9UC 4ZOZA 3I7OA 3EI3B 5H17A 3UKUC 2O9KA 4GQBB 2OK6A 2CN3A 3PXSD 3F3PA 4J78A 4YVDA 4K3JB 4A2LA 3EG6A 3OL2A 2OK4A 4XEIC 3KRWB 2YB8B 2YBAA 3PSLA 2H6QA 4LG9A 5HE2B 5IGQA 3SMRA 4J0WA 3J80g 5EMKB 4CI3A 2BBKH 1K8KC 3L4OD 2P9KC 3C9CA 4JT5C 5FKSA 4J0XA 3VH0A 3GREA 3JZNA 1XKSA 4PBZA 5HE1B 1L0QA 3V9FA 2BCJB 5FKQA 2H47A 5EM2A 4AEZA 1GXRA 3CFSB 1Q47A 3I8EA 4A2MA 4A0AA 2Z2PA 2CO0C 3CIKB 5CYKA 3I89A 4J77A 4J87A 5EALA 1K32A 5CXCA 4BUJC 3SHFA 4J79A 3SBPA 4A7JA 4L9OA 4LG8A 4D0KA 2W18A 1JMZB 4J81A 3FGBA 1PI6A 3RN0D 4JT6C 4L3GD 3UR4A 4HDJA 2PM7B 2YNOA 5FLXg 2IAAA 2H6NA 2B5NA 3FM0A 4A08B 3GFCA 4GM9A 2AQ5A 3PXTD 2H9PA 5HE3B 1A0RB 3JZGA 3BG0A 4GGAA 4PBYA 3JROA 5CXCB 5IJ8E 4ES0A 4GGDA 3V5WB 3DM0A 4PXWA 3UVOA 3RRMC 4QL1A 5EMMB 3OKYB 4GM8A 3A0FA 4LGNA 4A0BB 3ORVD 3MKSB 4Z8LA 4ZOYA 4A0BA 3EWEA 4MK0B 5I5MA 4L1QD 1PBYB 4GGCA 4JSPC 4UI9R 3C5MA 4G56B 2AH1A 2XU7A 3SBQA 5IJ7E 5TF2A 4E54A 4E54B 4J82A 5SXMA 2QC5A 4O3UB 5KDOB 2IWFA 5A2Qg 2OVRB 3I7NA 2QXVA 5EARA 4ERYA 1VYHC 3SVWD 2J56H 1NEXB 3SN6B 2B4EA 4JXMA 2J57G 2AGZA 5IT9g 3ZWLB 3AH8B 2H6KA 2IUVA 4OWRA 1B9XA 5I5IA 5C2VB 2XYIA 5HQGA 3RSEC 5EMJB 5GMKn 1RI6A 1OLZA 2I0TA 5EAMA 2YNPA 5TEEA 3PSCB 2OVQB 3DSMA 2IUPA 4PSXB 3EI4A 4CZYA 3EI4B 4H5IA 4N14A 2CE9A 4O9DA 3F3GA 3JAMg 2J55H 3I7LA 1N6FA 5AJAA 2P9PC 2G9AA 4L3HD 2HESX 3JZHA 3DWLC 4O3TB 5AMSA 5K19A 3P4FA 2I0SA 5HYNB 2AGYA 4K3ID 1GG2B 4CI1A 2B5MA 5CYKB 2Z2OA 2OVPB 3OKWA 4ZN4A 3EI1B 4J73A 5TDHB 2I3SA 1QNIA 3RFHA 5H14A 3I7HA 2OIZA 2P9SC 5GXHA 4IA9A 4CY2A 5EM2B 2AGWA 4GZ8A 3L4MD 4GQ2P 4U1EI 3I7KA 3UVKA 5FKTA 1XHMA 4J8GA 3OL2B 4PNKB 1B9YA 4GM3A 3UVLA 3UVMA 3UKRC 3OW8A 3SFZA 2AGXA 5THAA 2P9IC 5AFU3 3RN1D 1SQ9A 3E0CA 1MG3A 5IC7A 2IWKA 2HKRA 4BH6A 3N0EA 3DXMC 1MDAH 5FXYA 4Y7RA 2H9NA 1SQJA 4FB1D 1S4UX 3I2NA 4O45A 1TYQC 4BL0A 1U4CA 2B5LA 1N6EA 3RLMD 4A11B 4JSXC 4A11A 4Y5RD 2Z2NA 3BWSA 4GMBA 4J8BA 2P9LC 4CY5A 4J86A 3OKYA 3SWSD 4FA1D 2GC4A 1SHYB 3DXKC 3C75H 1GP2B 3IIYA 3EMHA 5C9ZB 4PC0A 4JSNC 4XYIA 3VA6A 4A0AB 4OZUA 2H3XA 3OKTA 2PBIB 3AFCA 3J81g 1YFQA 5TEFA 1PEVA 4X61B 3ULEC 5I5JA 3HFQA 2CO0A 3RMZD 3SBRA 5IGOA 2YMUA 4U7AA 2AGLA 4JSVC 4CC9A 4X63B 2I0RA 4CI2A 5FQDA 4E5ZA 3EI3A 1ERJA 3JRPA 5B4WA 4CY1A 2H14A 3I7PA 1R5MA 4ERQA 4ZOXA 4AOWA 2GC7A 1JJUB 3EI1A 4FA9D 1JOFA 3N0DA 3EU7A 5FKRA 3MKQA 2XL3A 2HKMA 2MTAH 4FA4D 5FA5B 3JB9L 2Q7QA 4FWWA 3SJLD 2AH0A 3OTTA 2P9NC 1NR0A 2H13A 5JWZA 3AL8A 1GOTB 3JPXA 4NSXA 1FWXA 4A09B 1P22A 4A09A 3PXWD 3EI2A 3K27A 5H1MA 2IURA 2GNQA 4QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJB A;  3F3F A;  3SCY A;  3BG1 A;  4EWR A;  3MMY A;  2HYE A;  2IUQ A;  5HE0 B;  3SXT D;  4TZ4 A;  3U4Y A;  1TBG A;  3MZL A;  4PSW B;  2H9L A;  1XIP A;  2TRC B;  3UVN A;  3NVN A;  4X3E A;  2XL2 A;  2H9M A;  3FRX A;  5K1C C;  3ODT A;  1PGU A;  2OJY A;  3AL8 B;  3IJ0 A;  3PVW B;  3IIW A;  3IKO A;  4J84 A;  3K26 A;  3IJ1 A;  3PVU B;  2PM6 B;  4CI8 A;  4JD2 C;  4A08 A;  2UZY B;  3KRX B;  3EI2 B;  2HJ4 A;  4FAN D;  4X60 B;  1JMX B;  4FHL A;  4CZX A;  4D6V A;  4XYH A;  3PE7 A;  4FAV D;  1MG2 A;  3B7F A;  2UZX B;  3MZK A;  5CXB B;  5CXB A;  4ERZ A;  3CFV A;  4QQE A;  4ZOV A;  3W15 A;  4KFM B;  4CY3 A;  4CZV A;  3V7D B;  2HXC A;  3VGZ A;  2EBS A;  2G99 A;  3MXX A;  2H68 A;  4GQ1 A;  3I8C A;  3AL9 A;  4QT8 A;  2I3T A;  4E5Z B;  5EAP A;  3C99 A;  3SLE D;  2YNN A;  5GXI A;  4H5J A;  3IJC A;  1N6D A;  4R7A B;  2CN2 A;  4I79 A;  4IMM A;  5GSA A;  4ESG A;  2CE8 A;  1U2V C;  3NVQ A;  1OMW B;  5EML B;  4FA5 D;  5C2W B;  2CNX A;  3RFG A;  2PM9 B;  2PM9 A;  4O1Q D;  3NVX A;  2P9U C;  4ZOZ A;  3I7O A;  3EI3 B;  5H17 A;  3UKU C;  2O9K A;  4GQB B;  2OK6 A;  2CN3 A;  3PXS D;  3F3P A;  4J78 A;  4YVD A;  4K3J B;  4A2L A;  3EG6 A;  3OL2 A;  2OK4 A;  4XEI C;  3KRW B;  2YB8 B;  2YBA A;  3PSL A;  2H6Q A;  4LG9 A;  5HE2 B;  5IGQ A;  3SMR A;  4J0W A;  3J80 g;  5EMK B;  4CI3 A;  2BBK H;  1K8K C;  3L4O D;  2P9K C;  3C9C A;  4JT5 C;  5FKS A;  4J0X A;  3VH0 A;  3GRE A;  3JZN A;  1XKS A;  4PBZ A;  5HE1 B;  1L0Q A;  3V9F A;  2BCJ B;  5FKQ A;  2H47 A;  5EM2 A;  4AEZ A;  1GXR A;  3CFS B;  1Q47 A;  3I8E A;  4A2M A;  4A0A A;  2Z2P A;  2CO0 C;  3CIK B;  5CYK A;  3I89 A;  4J77 A;  4J87 A;  5EAL A;  1K32 A;  5CXC A;  4BUJ C;  3SHF A;  4J79 A;  3SBP A;  4A7J A;  4L9O A;  4LG8 A;  4D0K A;  2W18 A;  1JMZ B;  4J81 A;  3FGB A;  1PI6 A;  3RN0 D;  4JT6 C;  4L3G D;  3UR4 A;  4HDJ A;  2PM7 B;  2YNO A;  5FLX g;  2IAA A;  2H6N A;  2B5N A;  3FM0 A;  4A08 B;  3GFC A;  4GM9 A;  2AQ5 A;  3PXT D;  2H9P A;  5HE3 B;  1A0R B;  3JZG A;  3BG0 A;  4GGA A;  4PBY A;  3JRO A;  5CXC B;  5IJ8 E;  4ES0 A;  4GGD A;  3V5W B;  3DM0 A;  4PXW A;  3UVO A;  3RRM C;  4QL1 A;  5EMM B;  3OKY B;  4GM8 A;  3A0F A;  4LGN A;  4A0B B;  3ORV D;  3MKS B;  4Z8L A;  4ZOY A;  4A0B A;  3EWE A;  4MK0 B;  5I5M A;  4L1Q D;  1PBY B;  4GGC A;  4JSP C;  4UI9 R;  3C5M A;  4G56 B;  2AH1 A;  2XU7 A;  3SBQ A;  5IJ7 E;  5TF2 A;  4E54 A;  4E54 B;  4J82 A;  5SXM A;  2QC5 A;  4O3U B;  5KDO B;  2IWF A;  5A2Q g;  2OVR B;  3I7N A;  2QXV A;  5EAR A;  4ERY A;  1VYH C;  3SVW D;  2J56 H;  1NEX B;  3SN6 B;  2B4E A;  4JXM A;  2J57 G;  2AGZ A;  5IT9 g;  3ZWL B;  3AH8 B;  2H6K A;  2IUV A;  4OWR A;  1B9X A;  5I5I A;  5C2V B;  2XYI A;  5HQG A;  3RSE C;  5EMJ B;  5GMK n;  1RI6 A;  1OLZ A;  2I0T A;  5EAM A;  2YNP A;  5TEE A;  3PSC B;  2OVQ B;  3DSM A;  2IUP A;  4PSX B;  3EI4 A;  4CZY A;  3EI4 B;  4H5I A;  4N14 A;  2CE9 A;  4O9D A;  3F3G A;  3JAM g;  2J55 H;  3I7L A;  1N6F A;  5AJA A;  2P9P C;  2G9A A;  4L3H D;  2HES X;  3JZH A;  3DWL C;  4O3T B;  5AMS A;  5K19 A;  3P4F A;  2I0S A;  5HYN B;  2AGY A;  4K3I D;  1GG2 B;  4CI1 A;  2B5M A;  5CYK B;  2Z2O A;  2OVP B;  3OKW A;  4ZN4 A;  3EI1 B;  4J73 A;  5TDH B;  2I3S A;  1QNI A;  3RFH A;  5H14 A;  3I7H A;  2OIZ A;  2P9S C;  5GXH A;  4IA9 A;  4CY2 A;  5EM2 B;  2AGW A;  4GZ8 A;  3L4M D;  4GQ2 P;  4U1E I;  3I7K A;  3UVK A;  5FKT A;  1XHM A;  4J8G A;  3OL2 B;  4PNK B;  1B9Y A;  4GM3 A;  3UVL A;  3UVM A;  3UKR C;  3OW8 A;  3SFZ A;  2AGX A;  5THA A;  2P9I C;  5AFU 3;  3RN1 D;  1SQ9 A;  3E0C A;  1MG3 A;  5IC7 A;  2IWK A;  2HKR A;  4BH6 A;  3N0E A;  3DXM C;  1MDA H;  5FXY A;  4Y7R A;  2H9N A;  1SQJ A;  4FB1 D;  1S4U X;  3I2N A;  4O45 A;  1TYQ C;  4BL0 A;  1U4C A;  2B5L A;  1N6E A;  3RLM D;  4A11 B;  4JSX C;  4A11 A;  4Y5R D;  2Z2N A;  3BWS A;  4GMB A;  4J8B A;  2P9L C;  4CY5 A;  4J86 A;  3OKY A;  3SWS D;  4FA1 D;  2GC4 A;  1SHY B;  3DXK C;  3C75 H;  1GP2 B;  3IIY A;  3EMH A;  5C9Z B;  4PC0 A;  4JSN C;  4XYI A;  3VA6 A;  4A0A B;  4OZU A;  2H3X A;  3OKT A;  2PBI B;  3AFC A;  3J81 g;  1YFQ A;  5TEF A;  1PEV A;  4X61 B;  3ULE C;  5I5J A;  3HFQ A;  2CO0 A;  3RMZ D;  3SBR A;  5IGO A;  2YMU A;  4U7A A;  2AGL A;  4JSV C;  4CC9 A;  4X63 B;  2I0R A;  4CI2 A;  5FQD A;  4E5Z A;  3EI3 A;  1ERJ A;  3JRP A;  5B4W A;  4CY1 A;  2H14 A;  3I7P A;  1R5M A;  4ERQ A;  4ZOX A;  4AOW A;  2GC7 A;  1JJU B;  3EI1 A;  4FA9 D;  1JOF A;  3N0D A;  3EU7 A;  5FKR A;  3MKQ A;  2XL3 A;  2HKM A;  2MTA H;  4FA4 D;  5FA5 B;  3JB9 L;  2Q7Q A;  4FWW A;  3SJL D;  2AH0 A;  3OTT A;  2P9N C;  1NR0 A;  2H13 A;  5JWZ A;  3AL8 A;  1GOT B;  3JPX A;  4NSX A;  1FWX A;  4A09 B;  1P22 A;  4A09 A;  3PXW D;  3EI2 A;  3K27 A;  5H1M A;  2IUR A;  2GNQ A;  4QRJ A; 
#chains in the Genus database with same CATH topology
 2HJB A;  3F3F A;  3SCY A;  3BG1 A;  4EWR A;  3VI3 A;  5C86 A;  3MMY A;  2HYE A;  2IUQ A;  1L5G A;  1I2M B;  5HE0 B;  1UOO A;  3SXT D;  3IUR A;  4TZ4 A;  4Z7Q A;  3U4Y A;  1TBG A;  3MZL A;  4PSW B;  2H9L A;  1XIP A;  3MVD K;  2TRC B;  3UVN A;  3NVN A;  4X3E A;  4BCB A;  2XL2 A;  2H9M A;  3FRX A;  5K1C C;  3ODT A;  2VZ1 A;  3O4H A;  1PGU A;  4BP8 A;  2OJY A;  3AL8 B;  3IJ0 A;  3PVW B;  5M5T A;  3IIW A;  3IKO A;  4J84 A;  3K26 A;  3IJ1 A;  3PVU B;  2PM6 B;  4CI8 A;  3IUJ A;  4JD2 C;  2UZY B;  4A08 A;  3KRX B;  3EI2 B;  3MUO A;  2HJ4 A;  4FAN D;  4X60 B;  1JMX B;  4FHL A;  4CZX A;  4D6V A;  4XYH A;  3PE7 A;  1C9I A;  4FAV D;  1MG2 A;  3O4J A;  3B7F A;  3VI4 A;  2WQ8 A;  4BCD A;  2UZX B;  3MZK A;  5CXB B;  5CXB A;  4ERZ A;  2EIE A;  3CFV A;  4QQE A;  4ZOV A;  1H2Y A;  3W15 A;  4KFM B;  4CY3 A;  4CZV A;  3EQ8 A;  3V7D B;  2HXC A;  3VGZ A;  4NBM A;  3NIG A;  2EBS A;  2G99 A;  3MXX A;  2H68 A;  4GQ1 A;  2VC2 A;  3I8C A;  3AL9 A;  4QT8 A;  2I3T A;  4E5Z B;  5EAP A;  1T2X A;  3C99 A;  3T3M A;  3SLE D;  3O4I A;  3ZE1 A;  2YNN A;  4MMY A;  5GXI A;  4AMY A;  4H5J A;  2VZ3 A;  3IJC A;  1N6D A;  4R7A B;  2CN2 A;  4I79 A;  4RE6 A;  3O4G A;  4IMM A;  5FFG A;  2CE8 A;  4ESG A;  5GSA A;  1U2V C;  3NVQ A;  1OMW B;  5EML B;  4FA5 D;  5C2W B;  5E6R A;  2CNX A;  3RFG A;  2EIC A;  2PM9 B;  2PM9 A;  4O1Q D;  3NVX A;  2P9U C;  4ZOZ A;  3I7O A;  5FFO A;  5E6U A;  3EI3 B;  2JKX A;  5H17 A;  3UKU C;  2O9K A;  4GQB B;  2OK6 A;  2CN3 A;  3PXS D;  3F3P A;  3K72 A;  4J78 A;  4K3J B;  4YVD A;  4A2L A;  3EG6 A;  1UOP A;  3OL2 A;  4UM8 A;  2OK4 A;  4AN1 A;  3KRW B;  3PSL A;  2YB8 B;  2YBA A;  4XEI C;  2H6Q A;  4LG9 A;  5HE2 B;  5IGQ A;  3SMR A;  4J0W A;  3J80 g;  5M5S A;  4O2W A;  5EMK B;  4CI3 A;  2BBK H;  1C9L A;  1K8K C;  3L4O D;  2P9K C;  3C9C A;  4JT5 C;  5FKS A;  4J0X A;  1JV2 A;  3VH0 A;  3GRE A;  4AN0 A;  3JZN A;  3FCS A;  3NIF A;  1XKS A;  4PBZ A;  2HU5 A;  5HE1 B;  1L0Q A;  3V9F A;  2BCJ B;  5FKQ A;  3EQ9 A;  2H47 A;  5EM2 A;  4AEZ A;  1GXR A;  3CFS B;  1Q47 A;  1E5T A;  3I8E A;  4A2M A;  4A0A A;  2QR5 A;  2VDR A;  2Z2P A;  4NC4 A;  2CO0 C;  3CIK B;  5CYK A;  3I89 A;  4J77 A;  4J87 A;  4Z7O A;  4MMZ A;  5EAL A;  1K32 A;  5CXC A;  4BUJ C;  3SHF A;  4J79 A;  3SBP A;  4A7J A;  4L9O A;  4LG8 A;  4D0K A;  2XE4 A;  2W18 A;  1JMZ B;  4J81 A;  4JHP C;  3FGB A;  3ZDX A;  1PI6 A;  3RN0 D;  3V4P A;  4JT6 C;  2VDP A;  4L3G D;  4HDJ A;  3UR4 A;  2PM7 B;  2YNO A;  5FLX g;  2IAA A;  3IUL A;  2H6N A;  2B5N A;  3FM0 A;  4A08 B;  3GFC A;  4GM9 A;  1H2X A;  2AQ5 A;  3PXT D;  2H9P A;  5HE3 B;  1A0R B;  3JZG A;  3BG0 A;  4GGA A;  4PBY A;  3JRO A;  5CXC B;  5IJ8 E;  4ES0 A;  4GGD A;  3V5W B;  3DM0 A;  4PXW A;  3UVO A;  4AX4 A;  3RRM C;  4QL1 A;  5EMM B;  3OKY B;  4GM8 A;  1H2W A;  1VZ3 A;  3A0F A;  4WK0 A;  4LGN A;  4DNW A;  4A0B B;  3ORV D;  3MKS B;  4Z8L A;  4ZOY A;  4A0B A;  3EWE A;  1O6G A;  4MK0 B;  5I5M A;  3OF7 A;  4L1Q D;  1PBY B;  4GGC A;  4JSP C;  2VDL A;  1GOG A;  4UI9 R;  4RE5 A;  3FCU A;  3C5M A;  4G56 B;  2AH1 A;  2XU7 A;  3SBQ A;  5IJ7 E;  5TF2 A;  4E54 A;  1VE7 A;  4E54 B;  4J82 A;  5SXM A;  2QC5 A;  4O3U B;  5KDO B;  2IWF A;  2VDM A;  5A2Q g;  2OVR B;  3I7N A;  2QXV A;  5EAR A;  4ERY A;  1VYH C;  3SVW D;  1M1X A;  3T3P A;  2J56 H;  1NEX B;  1JTD B;  1UOQ A;  3SN6 B;  5HDB A;  2B4E A;  3EQ7 A;  4O02 A;  4JXM A;  2J57 G;  2AGZ A;  3MUN A;  5IT9 g;  3ZWL B;  3AH8 B;  4WK4 A;  2H6K A;  4NAA A;  1YR2 A;  2IUV A;  4OWR A;  1B9X A;  1TYE A;  5I5I A;  5C2V B;  2XYI A;  5HQG A;  3RSE C;  5EMJ B;  5GMK n;  1RI6 A;  1VZ2 A;  1OLZ A;  2I0T A;  5EAM A;  2YNP A;  5TEE A;  3IUM A;  1E8M A;  3PSC B;  2OVQ B;  3DSM A;  2IUP A;  4PSX B;  1H2Z A;  3EI4 A;  2VDO A;  3EI4 B;  4CZY A;  1GOH A;  4H5I A;  4N14 A;  2CE9 A;  3QHY B;  4O9D A;  3F3G A;  3JAM g;  2J55 H;  3I7L A;  1N6F A;  5AJA A;  2P9P C;  2G9A A;  4L3H D;  3GC3 B;  2HES X;  3JZH A;  3DWL C;  4O3T B;  5AMS A;  5K19 A;  5M5V A;  3NID A;  3P4F A;  1GOF A;  2I0S A;  5HYN B;  2AGY A;  4K3I D;  1GG2 B;  4CI1 A;  2B5M A;  5CYK B;  4DNU A;  2BKL A;  2Z2O A;  2EID A;  2OVP B;  3OKW A;  4ZN4 A;  5E6S A;  3EI1 B;  4J73 A;  5TDH B;  2I3S A;  1QNI A;  3RFH A;  5H14 A;  4G1E A;  3I7H A;  2OIZ A;  2P9S C;  3ZE0 A;  5GXH A;  4IA9 A;  1BPO A;  4CY2 A;  5EM2 B;  1E8N A;  1QFM A;  2AGW A;  4GZ8 A;  4NEN A;  3DDU A;  1UTC A;  3L4M D;  4GQ2 P;  4U1E I;  3I7K A;  3UVK A;  5FKT A;  2VDN A;  1XHM A;  4J8G A;  3OL2 B;  4PNK B;  1B9Y A;  4GM3 A;  3UVL A;  3UVM A;  5M61 A;  3UKR C;  3OW8 A;  3SFZ A;  2AGX A;  5THA A;  4BP9 A;  3ZDZ A;  2P9I C;  5AFU 3;  3QI0 A;  3RN1 D;  4WJK A;  1SQ9 A;  3GD1 I;  4BCC A;  1A12 A;  3E0C A;  1MG3 A;  5IC7 A;  2IWK A;  2HKR A;  4BH6 A;  3N0E A;  5M5R A;  3DXM C;  1MDA H;  5FXY A;  4Y7R A;  2H9N A;  1SQJ A;  4FB1 D;  3V4V A;  1S4U X;  4G1M A;  3I2N A;  4O45 A;  1TYQ C;  4BL0 A;  1U4C A;  2B5L A;  4WK2 A;  5C92 A;  1N6E A;  3RLM D;  4A11 B;  4JSX C;  4A11 A;  2QZP A;  4Y5R D;  2Z2N A;  3BWS A;  4GMB A;  4J8B A;  2P9L C;  4CY5 A;  4J86 A;  3OKY A;  3SWS D;  4FA1 D;  4L1M A;  2GC4 A;  1SHY B;  3DXK C;  3C75 H;  1GP2 B;  3IIY A;  3K71 A;  3EMH A;  3IUQ A;  5C9Z B;  4PC0 A;  4JSN C;  4XYI A;  3VA6 A;  1U8C A;  4A0A B;  1O6F A;  4OZU A;  4JHN A;  2H3X A;  3OKT A;  2HU8 A;  2PBI B;  3AFC A;  3J81 g;  1QFS A;  2XZG A;  2EIB A;  3IVM A;  2XDW A;  1YFQ A;  5TEF A;  1PEV A;  4G55 A;  4X61 B;  3ULE C;  5I5J A;  3HFQ A;  2CO0 A;  4AMZ A;  3ZE2 A;  3IUN A;  3KCI A;  3RMZ D;  3SBR A;  5IGO A;  2YMU A;  4U7A A;  2AGL A;  4Z7N A;  4JSV C;  4CC9 A;  3ZDY A;  4X63 B;  2I0R A;  4CI2 A;  5FQD A;  4E5Z A;  3EI3 A;  1ERJ A;  3JRP A;  5B4W A;  4CY1 A;  2H14 A;  3I7P A;  1R5M A;  2HU7 A;  4ERQ A;  4QAM A;  4ZOX A;  4AOW A;  5M5U A;  2GC7 A;  4UM9 A;  1JJU B;  3EI1 A;  4FA9 D;  1JOF A;  3N0D A;  3EU7 A;  2VDK A;  1K3I A;  4IRZ A;  5FKR A;  3MKQ A;  2XL3 A;  2HKM A;  1VE6 A;  4QRJ A;  2MTA H;  3IJE A;  4DNV A;  4FA4 D;  5FA5 B;  3JB9 L;  2Q7Q A;  4FWW A;  3SJL D;  2AH0 A;  3OTT A;  2P9N C;  1NR0 A;  2H13 A;  5JWZ A;  3AL8 A;  1GOT B;  3JPX A;  1FWX A;  2VDQ A;  4NSX A;  1P22 A;  4D9S A;  3PXW D;  4A09 B;  4A09 A;  3EI2 A;  3K27 A;  5H1M A;  2IUR A;  3K6S A;  2GNQ A;  4MMX A; 
#chains in the Genus database with same CATH homology
 2HJB A;  3F3F A;  3SCY A;  3BG1 A;  4EWR A;  3MMY A;  2HYE A;  2IUQ A;  5HE0 B;  3SXT D;  4TZ4 A;  3U4Y A;  1TBG A;  3MZL A;  4PSW B;  2H9L A;  1XIP A;  2TRC B;  3UVN A;  3NVN A;  4X3E A;  2XL2 A;  2H9M A;  3FRX A;  5K1C C;  3ODT A;  1PGU A;  2OJY A;  3AL8 B;  3IJ0 A;  3PVW B;  3IIW A;  3IKO A;  4J84 A;  3K26 A;  3IJ1 A;  3PVU B;  2PM6 B;  4CI8 A;  4JD2 C;  4A08 A;  2UZY B;  3KRX B;  3EI2 B;  2HJ4 A;  4FAN D;  4X60 B;  1JMX B;  4FHL A;  4CZX A;  4D6V A;  4XYH A;  3PE7 A;  4FAV D;  1MG2 A;  3B7F A;  2UZX B;  3MZK A;  5CXB B;  5CXB A;  4ERZ A;  3CFV A;  4QQE A;  4ZOV A;  3W15 A;  4KFM B;  4CY3 A;  4CZV A;  3V7D B;  2HXC A;  3VGZ A;  2EBS A;  2G99 A;  3MXX A;  2H68 A;  4GQ1 A;  3I8C A;  3AL9 A;  4QT8 A;  2I3T A;  4E5Z B;  5EAP A;  3C99 A;  3SLE D;  2YNN A;  5GXI A;  4H5J A;  3IJC A;  1N6D A;  4R7A B;  2CN2 A;  4I79 A;  4IMM A;  5GSA A;  4ESG A;  2CE8 A;  1U2V C;  3NVQ A;  1OMW B;  5EML B;  4FA5 D;  5C2W B;  2CNX A;  3RFG A;  2PM9 B;  2PM9 A;  4O1Q D;  3NVX A;  2P9U C;  4ZOZ A;  3I7O A;  3EI3 B;  5H17 A;  3UKU C;  2O9K A;  4GQB B;  2OK6 A;  2CN3 A;  3PXS D;  3F3P A;  4J78 A;  4YVD A;  4K3J B;  4A2L A;  3EG6 A;  3OL2 A;  2OK4 A;  4XEI C;  3KRW B;  2YB8 B;  2YBA A;  3PSL A;  2H6Q A;  4LG9 A;  5HE2 B;  5IGQ A;  3SMR A;  4J0W A;  3J80 g;  5EMK B;  4CI3 A;  2BBK H;  1K8K C;  3L4O D;  2P9K C;  3C9C A;  4JT5 C;  5FKS A;  4J0X A;  3VH0 A;  3GRE A;  3JZN A;  1XKS A;  4PBZ A;  5HE1 B;  1L0Q A;  3V9F A;  2BCJ B;  5FKQ A;  2H47 A;  5EM2 A;  4AEZ A;  1GXR A;  3CFS B;  1Q47 A;  3I8E A;  4A2M A;  4A0A A;  2Z2P A;  2CO0 C;  3CIK B;  5CYK A;  3I89 A;  4J77 A;  4J87 A;  5EAL A;  1K32 A;  5CXC A;  4BUJ C;  3SHF A;  4J79 A;  3SBP A;  4A7J A;  4L9O A;  4LG8 A;  4D0K A;  2W18 A;  1JMZ B;  4J81 A;  3FGB A;  1PI6 A;  3RN0 D;  4JT6 C;  4L3G D;  3UR4 A;  4HDJ A;  2PM7 B;  2YNO A;  5FLX g;  2IAA A;  2H6N A;  2B5N A;  3FM0 A;  4A08 B;  3GFC A;  4GM9 A;  2AQ5 A;  3PXT D;  2H9P A;  5HE3 B;  1A0R B;  3JZG A;  3BG0 A;  4GGA A;  4PBY A;  3JRO A;  5CXC B;  5IJ8 E;  4ES0 A;  4GGD A;  3V5W B;  3DM0 A;  4PXW A;  3UVO A;  3RRM C;  4QL1 A;  5EMM B;  3OKY B;  4GM8 A;  3A0F A;  4LGN A;  4A0B B;  3ORV D;  3MKS B;  4Z8L A;  4ZOY A;  4A0B A;  3EWE A;  4MK0 B;  5I5M A;  4L1Q D;  1PBY B;  4GGC A;  4JSP C;  4UI9 R;  3C5M A;  4G56 B;  2AH1 A;  2XU7 A;  3SBQ A;  5IJ7 E;  5TF2 A;  4E54 A;  4E54 B;  4J82 A;  5SXM A;  2QC5 A;  4O3U B;  5KDO B;  2IWF A;  5A2Q g;  2OVR B;  3I7N A;  2QXV A;  5EAR A;  4ERY A;  1VYH C;  3SVW D;  2J56 H;  1NEX B;  3SN6 B;  2B4E A;  4JXM A;  2J57 G;  2AGZ A;  5IT9 g;  3ZWL B;  3AH8 B;  2H6K A;  2IUV A;  4OWR A;  1B9X A;  5I5I A;  5C2V B;  2XYI A;  5HQG A;  3RSE C;  5EMJ B;  5GMK n;  1RI6 A;  1OLZ A;  2I0T A;  5EAM A;  2YNP A;  5TEE A;  3PSC B;  2OVQ B;  3DSM A;  2IUP A;  4PSX B;  3EI4 A;  4CZY A;  3EI4 B;  4H5I A;  4N14 A;  2CE9 A;  4O9D A;  3F3G A;  3JAM g;  2J55 H;  3I7L A;  1N6F A;  5AJA A;  2P9P C;  2G9A A;  4L3H D;  2HES X;  3JZH A;  3DWL C;  4O3T B;  5AMS A;  5K19 A;  3P4F A;  2I0S A;  5HYN B;  2AGY A;  4K3I D;  1GG2 B;  4CI1 A;  2B5M A;  5CYK B;  2Z2O A;  2OVP B;  3OKW A;  4ZN4 A;  3EI1 B;  4J73 A;  5TDH B;  2I3S A;  1QNI A;  3RFH A;  5H14 A;  3I7H A;  2OIZ A;  2P9S C;  5GXH A;  4IA9 A;  4CY2 A;  5EM2 B;  2AGW A;  4GZ8 A;  3L4M D;  4GQ2 P;  4U1E I;  3I7K A;  3UVK A;  5FKT A;  1XHM A;  4J8G A;  3OL2 B;  4PNK B;  1B9Y A;  4GM3 A;  3UVL A;  3UVM A;  3UKR C;  3OW8 A;  3SFZ A;  2AGX A;  5THA A;  2P9I C;  5AFU 3;  3RN1 D;  1SQ9 A;  3E0C A;  1MG3 A;  5IC7 A;  2IWK A;  2HKR A;  4BH6 A;  3N0E A;  3DXM C;  1MDA H;  5FXY A;  4Y7R A;  2H9N A;  1SQJ A;  4FB1 D;  1S4U X;  3I2N A;  4O45 A;  1TYQ C;  4BL0 A;  1U4C A;  2B5L A;  1N6E A;  3RLM D;  4A11 B;  4JSX C;  4A11 A;  4Y5R D;  2Z2N A;  3BWS A;  4GMB A;  4J8B A;  2P9L C;  4CY5 A;  4J86 A;  3OKY A;  3SWS D;  4FA1 D;  2GC4 A;  1SHY B;  3DXK C;  3C75 H;  1GP2 B;  3IIY A;  3EMH A;  5C9Z B;  4PC0 A;  4JSN C;  4XYI A;  3VA6 A;  4A0A B;  4OZU A;  2H3X A;  3OKT A;  2PBI B;  3AFC A;  3J81 g;  1YFQ A;  5TEF A;  1PEV A;  4X61 B;  3ULE C;  5I5J A;  3HFQ A;  2CO0 A;  3RMZ D;  3SBR A;  5IGO A;  2YMU A;  4U7A A;  2AGL A;  4JSV C;  4CC9 A;  4X63 B;  2I0R A;  4CI2 A;  5FQD A;  4E5Z A;  3EI3 A;  1ERJ A;  3JRP A;  5B4W A;  4CY1 A;  2H14 A;  3I7P A;  1R5M A;  4ERQ A;  4ZOX A;  4AOW A;  2GC7 A;  1JJU B;  3EI1 A;  4FA9 D;  1JOF A;  3N0D A;  3EU7 A;  5FKR A;  3MKQ A;  2XL3 A;  2HKM A;  2MTA H;  4FA4 D;  5FA5 B;  3JB9 L;  2Q7Q A;  4FWW A;  3SJL D;  2AH0 A;  3OTT A;  2P9N C;  1NR0 A;  2H13 A;  5JWZ A;  3AL8 A;  1GOT B;  3JPX A;  4NSX A;  1FWX A;  4A09 B;  1P22 A;  4A09 A;  3PXW D;  3EI2 A;  3K27 A;  5H1M A;  2IUR A;  2GNQ A;  4QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...