2H13A

Crystal structure of wdr5/histone h3 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD-repeat protein 5
publication title Molecular recognition of histone H3 by the WD40 protein WDR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h13A00
3RN1D 2CE9A 2B5MA 2H13A 4JSPC 3EI4B 3RN0D 1JJUB 3AL9A 5IGQA 5HE0B 1XHMA 2H6QA 2PM6B 2B4EA 3OKTA 1NEXB 2OIZA 4X61B 4E5ZA 4N14A 3MXXA 2B5LA 3IIYA 2IWFA 3F3PA 5EM2A 4A11A 2H14A 2GNQA 3OW8A 3PXSD 4BH6A 3SBQA 5H1MA 3UVNA 3B7FA 1MG2A 2HKMA 4O3UB 5SXMA 2W18A 3JRPA 5HE2B 4R7AB 1SQ9A 4KFMB 2EBSA 4ESGA 3C75H 3JZHA 1JMXB 4CI1A 5CYKB 3I7LA 3SCYA 4J82A 4X60B 3PXWD 4ZOVA 4QL1A 1Q47A 4G56B 5FKSA 2PM9B 4PBYA 1MG3A 1SHYB 5FLXg 4LGNA 2H47A 4HDJA 3F3GA 4CI8A 4H5JA 4FAVD 3NVXA 5EALA 3F3FA 4J87A 4JD2C 3EG6A 3EWEA 4A09B 3JB9L 5H17A 5C2WB 3I7OA 4PBZA 2AGLA 2P9PC 3I7HA 4A08B 3RFHA 2YNPA 2CE8A 3OTTA 4FA1D 3SBRA 2P9NC 4X63B 3SXTD 3OL2B 2CN3A 2UZXB 4IMMA 1YFQA 5I5MA 1GXRA 3VGZA 1N6FA 3EI2A 4E54A 4PXWA 2P9KC 5FQDA 5HE1B 4EWRA 2HESX 3NVNA 2CN2A 5C2VB 5EARA 3N0EA 1GP2B 2YMUA 3EI3B 2P9IC 2O9KA 4L3HD 4X3EA 5HYNB 4PNKB 3SJLD 2PM7B 1VYHC 4O3TB 4YVDA 2CNXA 2QC5A 4A0AB 5CXBB 3SVWD 4CY1A 3DXMC 5IJ7E 2J57G 3EMHA 4J73A 4FA9D 1QNIA 4ZN4A 5FKTA 2MTAH 3OKYB 5IT9g 4PC0A 4LG8A 1XIPA 4J77A 5AMSA 1OLZA 2PM9A 2OVPB 2AH0A 2I0TA 5FKQA 4A2LA 5I5IA 3UKUC 3KRXB 3SHFA 5FA5B 3PSCB 4J81A 2HJ4A 4BL0A 2CO0C 4IA9A 2AQ5A 4A09A 5HQGA 2OJYA 5IGOA 3SWSD 5EAMA 1U4CA 3N0DA 3P4FA 5EAPA 2Z2OA 3AL8B 5CXCA 1FWXA 3EI1A 2YNNA 2BCJB 1ERJA 4LG9A 4A08A 4GGDA 4D6VA 3NVQA 4AEZA 5K1CC 2GC7A 3UKRC 5FXYA 3CFSB 4UI9R 4U1EI 3SMRA 3I7PA 2OVQB 4J84A 3CFVA 1JOFA 5K19A 1S4UX 4PSWB 3UR4A 2H6KA 2H9PA 2AGZA 3RSEC 4CZXA 1NR0A 2HJBA 4I79A 4E5ZB 4A7JA 3BG1A 3ULEC 4L1QD 3I7KA 5EM2B 5FKRA 2PBIB 4A11B 3MZLA 2I0SA 1TYQC 5IC7A 5GMKn 4U7AA 5I5JA 5EMMB 2YB8B 3PVWB 2IURA 2AH1A 4CI3A 2J56H 4FHLA 4ERYA 4CY2A 3UVMA 4GM8A 2OK6A 3RMZD 4ERQA 4O9DA 2HYEA 2H9MA 3RRMC 2I3SA 1GOTB 2IWKA 3EI4A 4JXMA 3MKSB 3RLMD 1PGUA 3OKYA 4GQ1A 1PBYB 3JZGA 2H6NA 3PVUB 4O1QD 5GXHA 3JZNA 2XYIA 4CZYA 2H9LA 4J8BA 4H5IA 2B5NA 2P9LC 3C5MA 4JSVC 2Z2PA 2Z2NA 3DM0A 3RFGA 4QRJA 4FB1D 3UVOA 2P9SC 2Q7QA 3FRXA 4A2MA 4GZ8A 4D0KA 5AFU3 3ODTA 4CZVA 3E0CA 4Y5RD 4ES0A 3PSLA 3PE7A 1PEVA 5TEEA 4GQ2P 2J55H 5EMLB 1SQJA 1A0RB 5CYKA 5A2Qg 3UVKA 4ZOYA 3BWSA 3GFCA 2XL2A 4A0BB 1XKSA 3EI2B 4E54B 3HFQA 1GG2B 5EMJB 2P9UC 3U4YA 4L9OA 5THAA 2H9NA 4CY5A 1N6EA 4GM9A 5H14A 1TBGA 4NSXA 4AOWA 3DWLC 4JSXC 5HE3B 4XYHA 3I8EA 3FGBA 5C9ZB 3JROA 2G99A 4XEIC 3CIKB 3C99A 2YBAA 4ZOZA 3IJ1A 3SN6B 4GM3A 3V9FA 4BUJC 3I8CA 4FA4D 1R5MA 4GMBA 3KRWB 1K32A 3IJCA 2YNOA 3OL2A 1P22A 4J86A 2H3XA 2XU7A 2TRCB 4K3ID 2IUPA 3FM0A 5TEFA 3EU7A 4CC9A 3SLED 4FAND 3A0FA 3OKWA 3W15A 5TF2A 4OWRA 3IIWA 4K3JB 3J80g 4GGCA 4PSXB 3VH0A 1N6DA 1B9YA 3EI3A 4CY3A 2IUQA 3V5WB 3DSMA 5TDHB 4CI2A 3JAMg 3SFZA 4FA5D 1RI6A 4MK0B 2OVRB 2UZYB 3ZWLB 3I7NA 2I3TA 3VA6A 2AGWA 4J8GA 4J0WA 4A0AA 5CXBA 3J81g 4XYIA 2QXVA 2AGYA 5CXCB 5B4WA 3EI1B 3MKQA 3MZKA 4JT6C 3SBPA 3IKOA 5JWZA 2HXCA 2I0RA 2OK4A 4GQBB 5KDOB 3AH8B 3AFCA 4OZUA 3L4OD 3ORVD 3C9CA 1PI6A 5EMKB 4A0BA 2G9AA 1OMWB 4ERZA 4ZOXA 1K8KC 3K27A 3JPXA 5AJAA 3IJ0A 2GC4A 3DXKC 2IUVA 2XL3A 2AGXA 4FWWA 2CO0A 5GSAA 3K26A 4Y7RA 3BG0A 4TZ4A 2IAAA 3I2NA 1U2VC 1B9XA 3MMYA 3L4MD 4GGAA 4Z8LA 3V7DB 4J0XA 4L3GD 3UVLA 2H68A 3AL8A 4QQEA 5IJ8E 4JSNC 1MDAH 3PXTD 4J79A 2BBKH 3GREA 4J78A 3I89A 1JMZB 4QT8A 2HKRA 4O45A 5GXIA 1L0QA 4JT5C
chains in the Genus database with same CATH superfamily
3RN1D 2CE9A 4UM8A 2B5MA 4D9SA 1T2XA 2H13A 4JSPC 3EI4B 3RN0D 1JJUB 3AL9A 3MUNA 5HE0B 5IGQA 3NIGA 1XHMA 4BCDA 2H6QA 2PM6B 2B4EA 3OKTA 1NEXB 2OIZA 4X61B 4E5ZA 4N14A 3MXXA 2B5LA 3IIYA 2IWFA 3F3PA 5EM2A 4A11A 2H14A 2GNQA 3OW8A 3VI4A 3PXSD 4BH6A 3SBQA 5H1MA 3UVNA 3B7FA 2VDMA 1MG2A 2HKMA 3FCSA 4O3UB 4WJKA 2W18A 5SXMA 3JRPA 5HE2B 4R7AB 1SQ9A 4KFMB 5M5UA 2EBSA 1JTDB 4UM9A 4G1MA 4ESGA 3C75H 1L5GA 3JZHA 1JMXB 5FFGA 4CI1A 5CYKB 3EQ7A 1E8MA 4BP9A 3I7LA 3SCYA 4J82A 4X60B 3PXWD 4ZOVA 4QL1A 1Q47A 4AN1A 4BCBA 2QR5A 4G56B 5C86A 3ZE2A 5FKSA 4WK0A 2PM9B 4PBYA 3O4IA 1MG3A 4JHNA 1SHYB 5FLXg 4LGNA 2H47A 4HDJA 3F3GA 4CI8A 3ZE0A 4H5JA 4FAVD 5HDBA 1O6FA 4NBMA 3NVXA 5EALA 5M61A 3F3FA 3V4VA 4J87A 4JD2C 3EG6A 3EWEA 4A09B 1H2ZA 3JB9L 5H17A 5C2WB 3I7OA 4PBZA 2AGLA 2VDKA 2P9PC 4AMZA 1UOQA 3I7HA 4A08B 3RFHA 1E8NA 2YNPA 2CE8A 3OTTA 4FA1D 3SBRA 2P9NC 4X63B 4MMXA 3IJEA 3SXTD 3OL2B 2CN3A 2UZXB 4IMMA 1H2WA 1YFQA 5I5MA 1GXRA 4MMYA 3VGZA 1N6FA 3EI2A 4RE5A 4PXWA 4E54A 2P9KC 5FQDA 4AX4A 5HE1B 2BKLA 4EWRA 2HESX 3NVNA 2HU7A 3ZDXA 2CN2A 1M1XA 2VDQA 5C2VB 5EARA 5E6RA 3N0EA 1GP2B 2YMUA 2VZ1A 3EI3B 2P9IC 2O9KA 4L3HD 1VE7A 1C9LA 4DNWA 4X3EA 4AMYA 5HYNB 4PNKB 3SJLD 2PM7B 1VYHC 4O3TB 4YVDA 3QI0A 2CNXA 2QC5A 4A0AB 5CXBB 3SVWD 5FFOA 4CY1A 3DXMC 4G55A 5IJ7E 3VI3A 2J57G 4Z7QA 3EMHA 1GOFA 4J73A 2XDWA 4FA9D 1QNIA 4ZN4A 3T3MA 5FKTA 2MTAH 4Z7NA 3OKYB 5IT9g 4PC0A 4LG8A 1XIPA 3MVDK 4J77A 5AMSA 1OLZA 3O4HA 2PM9A 2OVPB 1H2XA 2AH0A 1O6GA 2I0TA 5FKQA 4A2LA 2VDPA 5I5IA 3UKUC 3KRXB 3SHFA 3O4JA 5FA5B 3PSCB 4J81A 2HJ4A 3FCUA 4BL0A 2CO0C 4IA9A 2AQ5A 4A09A 5HQGA 2OJYA 5IGOA 3SWSD 5EAMA 1U4CA 3N0DA 1VZ2A 3P4FA 5EAPA 2Z2OA 3AL8B 5CXCA 1FWXA 4IRZA 3EI1A 2YNNA 3T3PA 2BCJB 1ERJA 4LG9A 4A08A 4GGDA 1GOGA 4D6VA 2JKXA 3NVQA 4AEZA 5K1CC 2GC7A 3UKRC 5FXYA 1UOOA 3CFSB 4UI9R 4U1EI 1E5TA 1QFMA 3SMRA 3I7PA 2OVQB 4J84A 4DNVA 3CFVA 1JOFA 5K19A 1A12A 1S4UX 4PSWB 5M5TA 1C9IA 3UR4A 2H6KA 2H9PA 2AGZA 1TYEA 3RSEC 4CZXA 3IVMA 1NR0A 2HJBA 4I79A 4E5ZB 4A7JA 3BG1A 3ULEC 2VZ3A 4DNUA 3I7KA 4L1QD 5EM2B 5FKRA 2PBIB 4A11B 3MZLA 2I0SA 1TYQC 5IC7A 5GMKn 4U7AA 5I5JA 4WK4A 4Z7OA 1GOHA 5EMMB 2YB8B 3PVWB 2IURA 2AH1A 2EICA 4CI3A 2J56H 4FHLA 4ERYA 4CY2A 3UVMA 4GM8A 2OK6A 3RMZD 4ERQA 4O9DA 5M5RA 2HYEA 2H9MA 3RRMC 2I3SA 4O02A 1GOTB 2IWKA 3EI4A 4JXMA 3MKSB 3RLMD 1PGUA 3OKYA 4GQ1A 3QHYB 5E6SA 1PBYB 4NENA 3JZGA 2H6NA 3PVUB 4O1QD 5E6UA 3JZNA 5GXHA 2QZPA 2XYIA 4CZYA 2H9LA 3MUOA 4J8BA 4H5IA 2B5NA 2P9LC 3C5MA 4JSVC 2Z2PA 2VDNA 2Z2NA 3DM0A 3RFGA 4QRJA 1H2YA 4FB1D 3UVOA 2P9SC 2Q7QA 3ZE1A 3IUMA 3FRXA 4A2MA 4GZ8A 4D0KA 5AFU3 3ODTA 4CZVA 3E0CA 4Y5RD 4ES0A 3PSLA 3PE7A 1PEVA 5TEEA 4GQ2P 1UTCA 2J55H 1SQJA 5EMLB 2EIEA 1A0RB 5CYKA 5A2Qg 3UVKA 1K3IA 4ZOYA 4BCCA 3BWSA 3GFCA 2XL2A 4A0BB 3EQ9A 1XKSA 3EI2B 4E54B 3HFQA 1GG2B 5EMJB 2P9UC 4RE6A 3U4YA 4L9OA 5THAA 2H9NA 2HU8A 1N6EA 1VZ3A 4CY5A 4GM9A 3DDUA 5H14A 1TBGA 4NSXA 4AOWA 4AN0A 3DWLC 4JSXC 4L1MA 5HE3B 4XYHA 3I8EA 3FGBA 5C9ZB 4NAAA 3JROA 2G99A 4XEIC 3CIKB 3C99A 2YBAA 4ZOZA 3IJ1A 1VE6A 3ZDYA 3ZDZA 3SN6B 4GM3A 3V9FA 4BUJC 3I8CA 4G1EA 4FA4D 1R5MA 1BPOA 4GMBA 4QAMA 5M5VA 3K6SA 3KRWB 1K32A 4WK2A 3IJCA 2YNOA 3OL2A 1P22A 4J86A 2H3XA 2XU7A 2TRCB 4K3ID 2IUPA 3NIFA 3FM0A 5C92A 2VDRA 3OF7A 5TEFA 1I2MB 3EU7A 4CC9A 2EIBA 5M5SA 3SLED 4FAND 3A0FA 3OKWA 3W15A 5TF2A 4OWRA 3IIWA 4K3JB 3J80g 4GGCA 3IUNA 3O4GA 4PSXB 3VH0A 1N6DA 1B9YA 3EI3A 4JHPC 2IUQA 4CY3A 3NIDA 3V5WB 2XE4A 1YR2A 3DSMA 5TDHB 4CI2A 3JAMg 2VDLA 3SFZA 3IURA 4FA5D 1RI6A 4O2WA 4MK0B 2OVRB 2UZYB 3ZWLB 3I7NA 2I3TA 3VA6A 1JV2A 2AGWA 4J8GA 4J0WA 4A0AA 5CXBA 3J81g 2VC2A 4NC4A 4XYIA 2QXVA 2AGYA 5CXCB 5B4WA 1UOPA 3EI1B 3MKQA 3MZKA 4JT6C 3SBPA 3IKOA 5JWZA 2HXCA 2I0RA 2EIDA 2OK4A 2VDOA 4GQBB 4BP8A 5KDOB 3IUJA 3AH8B 3EQ8A 3AFCA 4OZUA 3L4OD 3ORVD 3C9CA 1PI6A 5EMKB 4A0BA 2G9AA 1OMWB 4ERZA 4ZOXA 1K8KC 3K27A 3JPXA 5AJAA 3IJ0A 2GC4A 3DXKC 2IUVA 2XL3A 2AGXA 4FWWA 3K71A 2CO0A 4MMZA 5GSAA 3K26A 4Y7RA 3BG0A 3GC3B 2IAAA 4TZ4A 3V4PA 3KCIA 3GD1I 3I2NA 1U2VC 1B9XA 3MMYA 3L4MD 1QFSA 4GGAA 4Z8LA 3V7DB 4J0XA 4L3GD 3UVLA 2H68A 3AL8A 3K72A 4QQEA 5IJ8E 2WQ8A 2XZGA 4JSNC 1MDAH 3IUQA 3PXTD 4J79A 2BBKH 2HU5A 3IULA 3GREA 4J78A 3I89A 1JMZB 4QT8A 1U8CA 2HKRA 4O45A 5GXIA 1L0QA 4JT5C
chains in the Genus database with same CATH topology
3RN1D 2CE9A 2B5MA 2H13A 4JSPC 3EI4B 3RN0D 1JJUB 3AL9A 5IGQA 5HE0B 1XHMA 2H6QA 2PM6B 2B4EA 3OKTA 1NEXB 2OIZA 4X61B 4E5ZA 4N14A 3MXXA 2B5LA 3IIYA 2IWFA 3F3PA 5EM2A 4A11A 2H14A 2GNQA 3OW8A 3PXSD 4BH6A 3SBQA 5H1MA 3UVNA 3B7FA 1MG2A 2HKMA 4O3UB 5SXMA 2W18A 3JRPA 5HE2B 4R7AB 1SQ9A 4KFMB 2EBSA 4ESGA 3C75H 3JZHA 1JMXB 4CI1A 5CYKB 3I7LA 3SCYA 4J82A 4X60B 3PXWD 4ZOVA 4QL1A 1Q47A 4G56B 5FKSA 2PM9B 4PBYA 1MG3A 1SHYB 5FLXg 4LGNA 2H47A 4HDJA 3F3GA 4CI8A 4H5JA 4FAVD 3NVXA 5EALA 3F3FA 4J87A 4JD2C 3EG6A 3EWEA 4A09B 3JB9L 5H17A 5C2WB 3I7OA 4PBZA 2AGLA 2P9PC 3I7HA 4A08B 3RFHA 2YNPA 2CE8A 3OTTA 4FA1D 3SBRA 2P9NC 4X63B 3SXTD 3OL2B 2CN3A 2UZXB 4IMMA 1YFQA 5I5MA 1GXRA 3VGZA 1N6FA 3EI2A 4E54A 4PXWA 2P9KC 5FQDA 5HE1B 4EWRA 2HESX 3NVNA 2CN2A 5C2VB 5EARA 3N0EA 1GP2B 2YMUA 3EI3B 2P9IC 2O9KA 4L3HD 4X3EA 5HYNB 4PNKB 3SJLD 2PM7B 1VYHC 4O3TB 4YVDA 2CNXA 2QC5A 4A0AB 5CXBB 3SVWD 4CY1A 3DXMC 5IJ7E 2J57G 3EMHA 4J73A 4FA9D 1QNIA 4ZN4A 5FKTA 2MTAH 3OKYB 5IT9g 4PC0A 4LG8A 1XIPA 4J77A 5AMSA 1OLZA 2PM9A 2OVPB 2AH0A 2I0TA 5FKQA 4A2LA 5I5IA 3UKUC 3KRXB 3SHFA 5FA5B 3PSCB 4J81A 2HJ4A 4BL0A 2CO0C 4IA9A 2AQ5A 4A09A 5HQGA 2OJYA 5IGOA 3SWSD 5EAMA 1U4CA 3N0DA 3P4FA 5EAPA 2Z2OA 3AL8B 5CXCA 1FWXA 3EI1A 2YNNA 2BCJB 1ERJA 4LG9A 4A08A 4GGDA 4D6VA 3NVQA 4AEZA 5K1CC 2GC7A 3UKRC 5FXYA 3CFSB 4UI9R 4U1EI 3SMRA 3I7PA 2OVQB 4J84A 3CFVA 1JOFA 5K19A 1S4UX 4PSWB 3UR4A 2H6KA 2H9PA 2AGZA 3RSEC 4CZXA 1NR0A 2HJBA 4I79A 4E5ZB 4A7JA 3BG1A 3ULEC 4L1QD 3I7KA 5EM2B 5FKRA 2PBIB 4A11B 3MZLA 2I0SA 1TYQC 5IC7A 5GMKn 4U7AA 5I5JA 5EMMB 2YB8B 3PVWB 2IURA 2AH1A 4CI3A 2J56H 4FHLA 4ERYA 4CY2A 3UVMA 4GM8A 2OK6A 3RMZD 4ERQA 4O9DA 2HYEA 2H9MA 3RRMC 2I3SA 1GOTB 2IWKA 3EI4A 4JXMA 3MKSB 3RLMD 1PGUA 3OKYA 4GQ1A 1PBYB 3JZGA 2H6NA 3PVUB 4O1QD 5GXHA 3JZNA 2XYIA 4CZYA 2H9LA 4J8BA 4H5IA 2B5NA 2P9LC 3C5MA 4JSVC 2Z2PA 2Z2NA 3DM0A 3RFGA 4QRJA 4FB1D 3UVOA 2P9SC 2Q7QA 3FRXA 4A2MA 4GZ8A 4D0KA 5AFU3 3ODTA 4CZVA 3E0CA 4Y5RD 4ES0A 3PSLA 3PE7A 1PEVA 5TEEA 4GQ2P 2J55H 5EMLB 1SQJA 1A0RB 5CYKA 5A2Qg 3UVKA 4ZOYA 3BWSA 3GFCA 2XL2A 4A0BB 1XKSA 3EI2B 4E54B 3HFQA 1GG2B 5EMJB 2P9UC 3U4YA 4L9OA 5THAA 2H9NA 4CY5A 1N6EA 4GM9A 5H14A 1TBGA 4NSXA 4AOWA 3DWLC 4JSXC 5HE3B 4XYHA 3I8EA 3FGBA 5C9ZB 3JROA 2G99A 4XEIC 3CIKB 3C99A 2YBAA 4ZOZA 3IJ1A 3SN6B 4GM3A 3V9FA 4BUJC 3I8CA 4FA4D 1R5MA 4GMBA 3KRWB 1K32A 3IJCA 2YNOA 3OL2A 1P22A 4J86A 2H3XA 2XU7A 2TRCB 4K3ID 2IUPA 3FM0A 5TEFA 3EU7A 4CC9A 3SLED 4FAND 3A0FA 3OKWA 3W15A 5TF2A 4OWRA 3IIWA 4K3JB 3J80g 4GGCA 4PSXB 3VH0A 1N6DA 1B9YA 3EI3A 4CY3A 2IUQA 3V5WB 3DSMA 5TDHB 4CI2A 3JAMg 3SFZA 4FA5D 1RI6A 4MK0B 2OVRB 2UZYB 3ZWLB 3I7NA 2I3TA 3VA6A 2AGWA 4J8GA 4J0WA 4A0AA 5CXBA 3J81g 4XYIA 2QXVA 2AGYA 5CXCB 5B4WA 3EI1B 3MKQA 3MZKA 4JT6C 3SBPA 3IKOA 5JWZA 2HXCA 2I0RA 2OK4A 4GQBB 5KDOB 3AH8B 3AFCA 4OZUA 3L4OD 3ORVD 3C9CA 1PI6A 5EMKB 4A0BA 2G9AA 1OMWB 4ERZA 4ZOXA 1K8KC 3K27A 3JPXA 5AJAA 3IJ0A 2GC4A 3DXKC 2IUVA 2XL3A 2AGXA 4FWWA 2CO0A 5GSAA 3K26A 4Y7RA 3BG0A 4TZ4A 2IAAA 3I2NA 1U2VC 1B9XA 3MMYA 3L4MD 4GGAA 4Z8LA 3V7DB 4J0XA 4L3GD 3UVLA 2H68A 3AL8A 4QQEA 5IJ8E 4JSNC 1MDAH 3PXTD 4J79A 2BBKH 3GREA 4J78A 3I89A 1JMZB 4QT8A 2HKRA 4O45A 5GXIA 1L0QA 4JT5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN1 D;  2CE9 A;  2B5M A;  2H13 A;  4JSP C;  3EI4 B;  3RN0 D;  1JJU B;  3AL9 A;  5IGQ A;  5HE0 B;  1XHM A;  2H6Q A;  2PM6 B;  2B4E A;  3OKT A;  1NEX B;  2OIZ A;  4X61 B;  4E5Z A;  4N14 A;  3MXX A;  2B5L A;  3IIY A;  2IWF A;  3F3P A;  5EM2 A;  4A11 A;  2H14 A;  2GNQ A;  3OW8 A;  3PXS D;  4BH6 A;  3SBQ A;  5H1M A;  3UVN A;  3B7F A;  1MG2 A;  2HKM A;  4O3U B;  5SXM A;  2W18 A;  3JRP A;  5HE2 B;  4R7A B;  1SQ9 A;  4KFM B;  2EBS A;  4ESG A;  3C75 H;  3JZH A;  1JMX B;  4CI1 A;  5CYK B;  3I7L A;  3SCY A;  4J82 A;  4X60 B;  3PXW D;  4ZOV A;  4QL1 A;  1Q47 A;  4G56 B;  5FKS A;  2PM9 B;  4PBY A;  1MG3 A;  1SHY B;  5FLX g;  4LGN A;  2H47 A;  4HDJ A;  3F3G A;  4CI8 A;  4H5J A;  4FAV D;  3NVX A;  5EAL A;  3F3F A;  4J87 A;  4JD2 C;  3EG6 A;  3EWE A;  4A09 B;  3JB9 L;  5H17 A;  5C2W B;  3I7O A;  4PBZ A;  2AGL A;  2P9P C;  3I7H A;  4A08 B;  3RFH A;  2YNP A;  2CE8 A;  3OTT A;  4FA1 D;  3SBR A;  2P9N C;  4X63 B;  3SXT D;  3OL2 B;  2CN3 A;  2UZX B;  4IMM A;  1YFQ A;  5I5M A;  1GXR A;  3VGZ A;  1N6F A;  3EI2 A;  4E54 A;  4PXW A;  2P9K C;  5FQD A;  5HE1 B;  4EWR A;  2HES X;  3NVN A;  2CN2 A;  5C2V B;  5EAR A;  3N0E A;  1GP2 B;  2YMU A;  3EI3 B;  2P9I C;  2O9K A;  4L3H D;  4X3E A;  5HYN B;  4PNK B;  3SJL D;  2PM7 B;  1VYH C;  4O3T B;  4YVD A;  2CNX A;  2QC5 A;  4A0A B;  5CXB B;  3SVW D;  4CY1 A;  3DXM C;  5IJ7 E;  2J57 G;  3EMH A;  4J73 A;  4FA9 D;  1QNI A;  4ZN4 A;  5FKT A;  2MTA H;  3OKY B;  5IT9 g;  4PC0 A;  4LG8 A;  1XIP A;  4J77 A;  5AMS A;  1OLZ A;  2PM9 A;  2OVP B;  2AH0 A;  2I0T A;  5FKQ A;  4A2L A;  5I5I A;  3UKU C;  3KRX B;  3SHF A;  5FA5 B;  3PSC B;  4J81 A;  2HJ4 A;  4BL0 A;  2CO0 C;  4IA9 A;  2AQ5 A;  4A09 A;  5HQG A;  2OJY A;  5IGO A;  3SWS D;  5EAM A;  1U4C A;  3N0D A;  3P4F A;  5EAP A;  2Z2O A;  3AL8 B;  5CXC A;  1FWX A;  3EI1 A;  2YNN A;  2BCJ B;  1ERJ A;  4LG9 A;  4A08 A;  4GGD A;  4D6V A;  3NVQ A;  4AEZ A;  5K1C C;  2GC7 A;  3UKR C;  5FXY A;  3CFS B;  4UI9 R;  4U1E I;  3SMR A;  3I7P A;  2OVQ B;  4J84 A;  3CFV A;  1JOF A;  5K19 A;  1S4U X;  4PSW B;  3UR4 A;  2H6K A;  2H9P A;  2AGZ A;  3RSE C;  4CZX A;  1NR0 A;  2HJB A;  4I79 A;  4E5Z B;  4A7J A;  3BG1 A;  3ULE C;  4L1Q D;  3I7K A;  5EM2 B;  5FKR A;  2PBI B;  4A11 B;  3MZL A;  2I0S A;  1TYQ C;  5IC7 A;  5GMK n;  4U7A A;  5I5J A;  5EMM B;  2YB8 B;  3PVW B;  2IUR A;  2AH1 A;  4CI3 A;  2J56 H;  4FHL A;  4ERY A;  4CY2 A;  3UVM A;  4GM8 A;  2OK6 A;  3RMZ D;  4ERQ A;  4O9D A;  2HYE A;  2H9M A;  3RRM C;  2I3S A;  1GOT B;  2IWK A;  3EI4 A;  4JXM A;  3MKS B;  3RLM D;  1PGU A;  3OKY A;  4GQ1 A;  1PBY B;  3JZG A;  2H6N A;  3PVU B;  4O1Q D;  5GXH A;  3JZN A;  2XYI A;  4CZY A;  2H9L A;  4J8B A;  4H5I A;  2B5N A;  2P9L C;  3C5M A;  4JSV C;  2Z2P A;  2Z2N A;  3DM0 A;  3RFG A;  4QRJ A;  4FB1 D;  3UVO A;  2P9S C;  2Q7Q A;  3FRX A;  4A2M A;  4GZ8 A;  4D0K A;  5AFU 3;  3ODT A;  4CZV A;  3E0C A;  4Y5R D;  4ES0 A;  3PSL A;  3PE7 A;  1PEV A;  5TEE A;  4GQ2 P;  2J55 H;  5EML B;  1SQJ A;  1A0R B;  5CYK A;  5A2Q g;  3UVK A;  4ZOY A;  3BWS A;  3GFC A;  2XL2 A;  4A0B B;  1XKS A;  3EI2 B;  4E54 B;  3HFQ A;  1GG2 B;  5EMJ B;  2P9U C;  3U4Y A;  4L9O A;  5THA A;  2H9N A;  4CY5 A;  1N6E A;  4GM9 A;  5H14 A;  1TBG A;  4NSX A;  4AOW A;  3DWL C;  4JSX C;  5HE3 B;  4XYH A;  3I8E A;  3FGB A;  5C9Z B;  3JRO A;  2G99 A;  4XEI C;  3CIK B;  3C99 A;  2YBA A;  4ZOZ A;  3IJ1 A;  3SN6 B;  4GM3 A;  3V9F A;  4BUJ C;  3I8C A;  4FA4 D;  1R5M A;  4GMB A;  3KRW B;  1K32 A;  3IJC A;  2YNO A;  3OL2 A;  1P22 A;  4J86 A;  2H3X A;  2XU7 A;  2TRC B;  4K3I D;  2IUP A;  3FM0 A;  5TEF A;  3EU7 A;  4CC9 A;  3SLE D;  4FAN D;  3A0F A;  3OKW A;  3W15 A;  5TF2 A;  4OWR A;  3IIW A;  4K3J B;  3J80 g;  4GGC A;  4PSX B;  3VH0 A;  1N6D A;  1B9Y A;  3EI3 A;  4CY3 A;  2IUQ A;  3V5W B;  3DSM A;  5TDH B;  4CI2 A;  3JAM g;  3SFZ A;  4FA5 D;  1RI6 A;  4MK0 B;  2OVR B;  2UZY B;  3ZWL B;  3I7N A;  2I3T A;  3VA6 A;  2AGW A;  4J8G A;  4J0W A;  4A0A A;  5CXB A;  3J81 g;  4XYI A;  2QXV A;  2AGY A;  5CXC B;  5B4W A;  3EI1 B;  3MKQ A;  3MZK A;  4JT6 C;  3SBP A;  3IKO A;  5JWZ A;  2HXC A;  2I0R A;  2OK4 A;  4GQB B;  5KDO B;  3AH8 B;  3AFC A;  4OZU A;  3L4O D;  3ORV D;  3C9C A;  1PI6 A;  5EMK B;  4A0B A;  2G9A A;  1OMW B;  4ERZ A;  4ZOX A;  1K8K C;  3K27 A;  3JPX A;  5AJA A;  3IJ0 A;  2GC4 A;  3DXK C;  2IUV A;  2XL3 A;  2AGX A;  4FWW A;  2CO0 A;  5GSA A;  3K26 A;  4Y7R A;  3BG0 A;  4TZ4 A;  2IAA A;  3I2N A;  1U2V C;  1B9X A;  3MMY A;  3L4M D;  4GGA A;  4Z8L A;  3V7D B;  4J0X A;  4L3G D;  3UVL A;  2H68 A;  3AL8 A;  4QQE A;  5IJ8 E;  4JSN C;  1MDA H;  3PXT D;  4J79 A;  2BBK H;  3GRE A;  4J78 A;  3I89 A;  1JMZ B;  4QT8 A;  2HKR A;  4O45 A;  5GXI A;  1L0Q A;  4JT5 C; 
#chains in the Genus database with same CATH topology
 3RN1 D;  2CE9 A;  4UM8 A;  2B5M A;  4D9S A;  1T2X A;  2H13 A;  4JSP C;  3EI4 B;  3RN0 D;  1JJU B;  3AL9 A;  3MUN A;  5HE0 B;  5IGQ A;  3NIG A;  1XHM A;  4BCD A;  2H6Q A;  2PM6 B;  2B4E A;  3OKT A;  1NEX B;  2OIZ A;  4X61 B;  4E5Z A;  4N14 A;  3MXX A;  2B5L A;  3IIY A;  2IWF A;  3F3P A;  5EM2 A;  4A11 A;  2H14 A;  2GNQ A;  3OW8 A;  3VI4 A;  3PXS D;  4BH6 A;  3SBQ A;  5H1M A;  3UVN A;  3B7F A;  2VDM A;  1MG2 A;  2HKM A;  3FCS A;  4O3U B;  4WJK A;  2W18 A;  5SXM A;  3JRP A;  5HE2 B;  4R7A B;  1SQ9 A;  4KFM B;  5M5U A;  2EBS A;  1JTD B;  4UM9 A;  4G1M A;  4ESG A;  3C75 H;  1L5G A;  3JZH A;  1JMX B;  5FFG A;  4CI1 A;  5CYK B;  3EQ7 A;  1E8M A;  4BP9 A;  3I7L A;  3SCY A;  4J82 A;  4X60 B;  3PXW D;  4ZOV A;  4QL1 A;  1Q47 A;  4AN1 A;  4BCB A;  2QR5 A;  4G56 B;  5C86 A;  3ZE2 A;  5FKS A;  4WK0 A;  2PM9 B;  4PBY A;  3O4I A;  1MG3 A;  4JHN A;  1SHY B;  5FLX g;  4LGN A;  2H47 A;  4HDJ A;  3F3G A;  4CI8 A;  3ZE0 A;  4H5J A;  4FAV D;  5HDB A;  1O6F A;  4NBM A;  3NVX A;  5EAL A;  5M61 A;  3F3F A;  3V4V A;  4J87 A;  4JD2 C;  3EG6 A;  3EWE A;  4A09 B;  1H2Z A;  3JB9 L;  5H17 A;  5C2W B;  3I7O A;  4PBZ A;  2AGL A;  2VDK A;  2P9P C;  4AMZ A;  1UOQ A;  3I7H A;  4A08 B;  3RFH A;  1E8N A;  2YNP A;  2CE8 A;  3OTT A;  4FA1 D;  3SBR A;  2P9N C;  4X63 B;  4MMX A;  3IJE A;  3SXT D;  3OL2 B;  2CN3 A;  2UZX B;  4IMM A;  1H2W A;  1YFQ A;  5I5M A;  1GXR A;  4MMY A;  3VGZ A;  1N6F A;  3EI2 A;  4RE5 A;  4PXW A;  4E54 A;  2P9K C;  5FQD A;  4AX4 A;  5HE1 B;  2BKL A;  4EWR A;  2HES X;  3NVN A;  2HU7 A;  3ZDX A;  2CN2 A;  1M1X A;  2VDQ A;  5C2V B;  5EAR A;  5E6R A;  3N0E A;  1GP2 B;  2YMU A;  2VZ1 A;  3EI3 B;  2P9I C;  2O9K A;  4L3H D;  1VE7 A;  1C9L A;  4DNW A;  4X3E A;  4AMY A;  5HYN B;  4PNK B;  3SJL D;  2PM7 B;  1VYH C;  4O3T B;  4YVD A;  3QI0 A;  2CNX A;  2QC5 A;  4A0A B;  5CXB B;  3SVW D;  5FFO A;  4CY1 A;  3DXM C;  4G55 A;  5IJ7 E;  3VI3 A;  2J57 G;  4Z7Q A;  3EMH A;  1GOF A;  4J73 A;  2XDW A;  4FA9 D;  1QNI A;  4ZN4 A;  3T3M A;  5FKT A;  2MTA H;  4Z7N A;  3OKY B;  5IT9 g;  4PC0 A;  4LG8 A;  1XIP A;  3MVD K;  4J77 A;  5AMS A;  1OLZ A;  3O4H A;  2PM9 A;  2OVP B;  1H2X A;  2AH0 A;  1O6G A;  2I0T A;  5FKQ A;  4A2L A;  2VDP A;  5I5I A;  3UKU C;  3KRX B;  3SHF A;  3O4J A;  5FA5 B;  3PSC B;  4J81 A;  2HJ4 A;  3FCU A;  4BL0 A;  2CO0 C;  4IA9 A;  2AQ5 A;  4A09 A;  5HQG A;  2OJY A;  5IGO A;  3SWS D;  5EAM A;  1U4C A;  3N0D A;  1VZ2 A;  3P4F A;  5EAP A;  2Z2O A;  3AL8 B;  5CXC A;  1FWX A;  4IRZ A;  3EI1 A;  2YNN A;  3T3P A;  2BCJ B;  1ERJ A;  4LG9 A;  4A08 A;  4GGD A;  1GOG A;  4D6V A;  2JKX A;  3NVQ A;  4AEZ A;  5K1C C;  2GC7 A;  3UKR C;  5FXY A;  1UOO A;  3CFS B;  4UI9 R;  4U1E I;  1E5T A;  1QFM A;  3SMR A;  3I7P A;  2OVQ B;  4J84 A;  4DNV A;  3CFV A;  1JOF A;  5K19 A;  1A12 A;  1S4U X;  4PSW B;  5M5T A;  1C9I A;  3UR4 A;  2H6K A;  2H9P A;  2AGZ A;  1TYE A;  3RSE C;  4CZX A;  3IVM A;  1NR0 A;  2HJB A;  4I79 A;  4E5Z B;  4A7J A;  3BG1 A;  3ULE C;  2VZ3 A;  4DNU A;  3I7K A;  4L1Q D;  5EM2 B;  5FKR A;  2PBI B;  4A11 B;  3MZL A;  2I0S A;  1TYQ C;  5IC7 A;  5GMK n;  4U7A A;  5I5J A;  4WK4 A;  4Z7O A;  1GOH A;  5EMM B;  2YB8 B;  3PVW B;  2IUR A;  2AH1 A;  2EIC A;  4CI3 A;  2J56 H;  4FHL A;  4ERY A;  4CY2 A;  3UVM A;  4GM8 A;  2OK6 A;  3RMZ D;  4ERQ A;  4O9D A;  5M5R A;  2HYE A;  2H9M A;  3RRM C;  2I3S A;  4O02 A;  1GOT B;  2IWK A;  3EI4 A;  4JXM A;  3MKS B;  3RLM D;  1PGU A;  3OKY A;  4GQ1 A;  3QHY B;  5E6S A;  1PBY B;  4NEN A;  3JZG A;  2H6N A;  3PVU B;  4O1Q D;  5E6U A;  3JZN A;  5GXH A;  2QZP A;  2XYI A;  4CZY A;  2H9L A;  3MUO A;  4J8B A;  4H5I A;  2B5N A;  2P9L C;  3C5M A;  4JSV C;  2Z2P A;  2VDN A;  2Z2N A;  3DM0 A;  3RFG A;  4QRJ A;  1H2Y A;  4FB1 D;  3UVO A;  2P9S C;  2Q7Q A;  3ZE1 A;  3IUM A;  3FRX A;  4A2M A;  4GZ8 A;  4D0K A;  5AFU 3;  3ODT A;  4CZV A;  3E0C A;  4Y5R D;  4ES0 A;  3PSL A;  3PE7 A;  1PEV A;  5TEE A;  4GQ2 P;  1UTC A;  2J55 H;  1SQJ A;  5EML B;  2EIE A;  1A0R B;  5CYK A;  5A2Q g;  3UVK A;  1K3I A;  4ZOY A;  4BCC A;  3BWS A;  3GFC A;  2XL2 A;  4A0B B;  3EQ9 A;  1XKS A;  3EI2 B;  4E54 B;  3HFQ A;  1GG2 B;  5EMJ B;  2P9U C;  4RE6 A;  3U4Y A;  4L9O A;  5THA A;  2H9N A;  2HU8 A;  1N6E A;  1VZ3 A;  4CY5 A;  4GM9 A;  3DDU A;  5H14 A;  1TBG A;  4NSX A;  4AOW A;  4AN0 A;  3DWL C;  4JSX C;  4L1M A;  5HE3 B;  4XYH A;  3I8E A;  3FGB A;  5C9Z B;  4NAA A;  3JRO A;  2G99 A;  4XEI C;  3CIK B;  3C99 A;  2YBA A;  4ZOZ A;  3IJ1 A;  1VE6 A;  3ZDY A;  3ZDZ A;  3SN6 B;  4GM3 A;  3V9F A;  4BUJ C;  3I8C A;  4G1E A;  4FA4 D;  1R5M A;  1BPO A;  4GMB A;  4QAM A;  5M5V A;  3K6S A;  3KRW B;  1K32 A;  4WK2 A;  3IJC A;  2YNO A;  3OL2 A;  1P22 A;  4J86 A;  2H3X A;  2XU7 A;  2TRC B;  4K3I D;  2IUP A;  3NIF A;  3FM0 A;  5C92 A;  2VDR A;  3OF7 A;  5TEF A;  1I2M B;  3EU7 A;  4CC9 A;  2EIB A;  5M5S A;  3SLE D;  4FAN D;  3A0F A;  3OKW A;  3W15 A;  5TF2 A;  4OWR A;  3IIW A;  4K3J B;  3J80 g;  4GGC A;  3IUN A;  3O4G A;  4PSX B;  3VH0 A;  1N6D A;  1B9Y A;  3EI3 A;  4JHP C;  2IUQ A;  4CY3 A;  3NID A;  3V5W B;  2XE4 A;  1YR2 A;  3DSM A;  5TDH B;  4CI2 A;  3JAM g;  2VDL A;  3SFZ A;  3IUR A;  4FA5 D;  1RI6 A;  4O2W A;  4MK0 B;  2OVR B;  2UZY B;  3ZWL B;  3I7N A;  2I3T A;  3VA6 A;  1JV2 A;  2AGW A;  4J8G A;  4J0W A;  4A0A A;  5CXB A;  3J81 g;  2VC2 A;  4NC4 A;  4XYI A;  2QXV A;  2AGY A;  5CXC B;  5B4W A;  1UOP A;  3EI1 B;  3MKQ A;  3MZK A;  4JT6 C;  3SBP A;  3IKO A;  5JWZ A;  2HXC A;  2I0R A;  2EID A;  2OK4 A;  2VDO A;  4GQB B;  4BP8 A;  5KDO B;  3IUJ A;  3AH8 B;  3EQ8 A;  3AFC A;  4OZU A;  3L4O D;  3ORV D;  3C9C A;  1PI6 A;  5EMK B;  4A0B A;  2G9A A;  1OMW B;  4ERZ A;  4ZOX A;  1K8K C;  3K27 A;  3JPX A;  5AJA A;  3IJ0 A;  2GC4 A;  3DXK C;  2IUV A;  2XL3 A;  2AGX A;  4FWW A;  3K71 A;  2CO0 A;  4MMZ A;  5GSA A;  3K26 A;  4Y7R A;  3BG0 A;  3GC3 B;  2IAA A;  4TZ4 A;  3V4P A;  3KCI A;  3GD1 I;  3I2N A;  1U2V C;  1B9X A;  3MMY A;  3L4M D;  1QFS A;  4GGA A;  4Z8L A;  3V7D B;  4J0X A;  4L3G D;  3UVL A;  2H68 A;  3AL8 A;  3K72 A;  4QQE A;  5IJ8 E;  2WQ8 A;  2XZG A;  4JSN C;  1MDA H;  3IUQ A;  3PXT D;  4J79 A;  2BBK H;  2HU5 A;  3IUL A;  3GRE A;  4J78 A;  3I89 A;  1JMZ B;  4QT8 A;  1U8C A;  2HKR A;  4O45 A;  5GXI A;  1L0Q A;  4JT5 C; 
#chains in the Genus database with same CATH homology
 3RN1 D;  2CE9 A;  2B5M A;  2H13 A;  4JSP C;  3EI4 B;  3RN0 D;  1JJU B;  3AL9 A;  5IGQ A;  5HE0 B;  1XHM A;  2H6Q A;  2PM6 B;  2B4E A;  3OKT A;  1NEX B;  2OIZ A;  4X61 B;  4E5Z A;  4N14 A;  3MXX A;  2B5L A;  3IIY A;  2IWF A;  3F3P A;  5EM2 A;  4A11 A;  2H14 A;  2GNQ A;  3OW8 A;  3PXS D;  4BH6 A;  3SBQ A;  5H1M A;  3UVN A;  3B7F A;  1MG2 A;  2HKM A;  4O3U B;  5SXM A;  2W18 A;  3JRP A;  5HE2 B;  4R7A B;  1SQ9 A;  4KFM B;  2EBS A;  4ESG A;  3C75 H;  3JZH A;  1JMX B;  4CI1 A;  5CYK B;  3I7L A;  3SCY A;  4J82 A;  4X60 B;  3PXW D;  4ZOV A;  4QL1 A;  1Q47 A;  4G56 B;  5FKS A;  2PM9 B;  4PBY A;  1MG3 A;  1SHY B;  5FLX g;  4LGN A;  2H47 A;  4HDJ A;  3F3G A;  4CI8 A;  4H5J A;  4FAV D;  3NVX A;  5EAL A;  3F3F A;  4J87 A;  4JD2 C;  3EG6 A;  3EWE A;  4A09 B;  3JB9 L;  5H17 A;  5C2W B;  3I7O A;  4PBZ A;  2AGL A;  2P9P C;  3I7H A;  4A08 B;  3RFH A;  2YNP A;  2CE8 A;  3OTT A;  4FA1 D;  3SBR A;  2P9N C;  4X63 B;  3SXT D;  3OL2 B;  2CN3 A;  2UZX B;  4IMM A;  1YFQ A;  5I5M A;  1GXR A;  3VGZ A;  1N6F A;  3EI2 A;  4E54 A;  4PXW A;  2P9K C;  5FQD A;  5HE1 B;  4EWR A;  2HES X;  3NVN A;  2CN2 A;  5C2V B;  5EAR A;  3N0E A;  1GP2 B;  2YMU A;  3EI3 B;  2P9I C;  2O9K A;  4L3H D;  4X3E A;  5HYN B;  4PNK B;  3SJL D;  2PM7 B;  1VYH C;  4O3T B;  4YVD A;  2CNX A;  2QC5 A;  4A0A B;  5CXB B;  3SVW D;  4CY1 A;  3DXM C;  5IJ7 E;  2J57 G;  3EMH A;  4J73 A;  4FA9 D;  1QNI A;  4ZN4 A;  5FKT A;  2MTA H;  3OKY B;  5IT9 g;  4PC0 A;  4LG8 A;  1XIP A;  4J77 A;  5AMS A;  1OLZ A;  2PM9 A;  2OVP B;  2AH0 A;  2I0T A;  5FKQ A;  4A2L A;  5I5I A;  3UKU C;  3KRX B;  3SHF A;  5FA5 B;  3PSC B;  4J81 A;  2HJ4 A;  4BL0 A;  2CO0 C;  4IA9 A;  2AQ5 A;  4A09 A;  5HQG A;  2OJY A;  5IGO A;  3SWS D;  5EAM A;  1U4C A;  3N0D A;  3P4F A;  5EAP A;  2Z2O A;  3AL8 B;  5CXC A;  1FWX A;  3EI1 A;  2YNN A;  2BCJ B;  1ERJ A;  4LG9 A;  4A08 A;  4GGD A;  4D6V A;  3NVQ A;  4AEZ A;  5K1C C;  2GC7 A;  3UKR C;  5FXY A;  3CFS B;  4UI9 R;  4U1E I;  3SMR A;  3I7P A;  2OVQ B;  4J84 A;  3CFV A;  1JOF A;  5K19 A;  1S4U X;  4PSW B;  3UR4 A;  2H6K A;  2H9P A;  2AGZ A;  3RSE C;  4CZX A;  1NR0 A;  2HJB A;  4I79 A;  4E5Z B;  4A7J A;  3BG1 A;  3ULE C;  4L1Q D;  3I7K A;  5EM2 B;  5FKR A;  2PBI B;  4A11 B;  3MZL A;  2I0S A;  1TYQ C;  5IC7 A;  5GMK n;  4U7A A;  5I5J A;  5EMM B;  2YB8 B;  3PVW B;  2IUR A;  2AH1 A;  4CI3 A;  2J56 H;  4FHL A;  4ERY A;  4CY2 A;  3UVM A;  4GM8 A;  2OK6 A;  3RMZ D;  4ERQ A;  4O9D A;  2HYE A;  2H9M A;  3RRM C;  2I3S A;  1GOT B;  2IWK A;  3EI4 A;  4JXM A;  3MKS B;  3RLM D;  1PGU A;  3OKY A;  4GQ1 A;  1PBY B;  3JZG A;  2H6N A;  3PVU B;  4O1Q D;  5GXH A;  3JZN A;  2XYI A;  4CZY A;  2H9L A;  4J8B A;  4H5I A;  2B5N A;  2P9L C;  3C5M A;  4JSV C;  2Z2P A;  2Z2N A;  3DM0 A;  3RFG A;  4QRJ A;  4FB1 D;  3UVO A;  2P9S C;  2Q7Q A;  3FRX A;  4A2M A;  4GZ8 A;  4D0K A;  5AFU 3;  3ODT A;  4CZV A;  3E0C A;  4Y5R D;  4ES0 A;  3PSL A;  3PE7 A;  1PEV A;  5TEE A;  4GQ2 P;  2J55 H;  5EML B;  1SQJ A;  1A0R B;  5CYK A;  5A2Q g;  3UVK A;  4ZOY A;  3BWS A;  3GFC A;  2XL2 A;  4A0B B;  1XKS A;  3EI2 B;  4E54 B;  3HFQ A;  1GG2 B;  5EMJ B;  2P9U C;  3U4Y A;  4L9O A;  5THA A;  2H9N A;  4CY5 A;  1N6E A;  4GM9 A;  5H14 A;  1TBG A;  4NSX A;  4AOW A;  3DWL C;  4JSX C;  5HE3 B;  4XYH A;  3I8E A;  3FGB A;  5C9Z B;  3JRO A;  2G99 A;  4XEI C;  3CIK B;  3C99 A;  2YBA A;  4ZOZ A;  3IJ1 A;  3SN6 B;  4GM3 A;  3V9F A;  4BUJ C;  3I8C A;  4FA4 D;  1R5M A;  4GMB A;  3KRW B;  1K32 A;  3IJC A;  2YNO A;  3OL2 A;  1P22 A;  4J86 A;  2H3X A;  2XU7 A;  2TRC B;  4K3I D;  2IUP A;  3FM0 A;  5TEF A;  3EU7 A;  4CC9 A;  3SLE D;  4FAN D;  3A0F A;  3OKW A;  3W15 A;  5TF2 A;  4OWR A;  3IIW A;  4K3J B;  3J80 g;  4GGC A;  4PSX B;  3VH0 A;  1N6D A;  1B9Y A;  3EI3 A;  4CY3 A;  2IUQ A;  3V5W B;  3DSM A;  5TDH B;  4CI2 A;  3JAM g;  3SFZ A;  4FA5 D;  1RI6 A;  4MK0 B;  2OVR B;  2UZY B;  3ZWL B;  3I7N A;  2I3T A;  3VA6 A;  2AGW A;  4J8G A;  4J0W A;  4A0A A;  5CXB A;  3J81 g;  4XYI A;  2QXV A;  2AGY A;  5CXC B;  5B4W A;  3EI1 B;  3MKQ A;  3MZK A;  4JT6 C;  3SBP A;  3IKO A;  5JWZ A;  2HXC A;  2I0R A;  2OK4 A;  4GQB B;  5KDO B;  3AH8 B;  3AFC A;  4OZU A;  3L4O D;  3ORV D;  3C9C A;  1PI6 A;  5EMK B;  4A0B A;  2G9A A;  1OMW B;  4ERZ A;  4ZOX A;  1K8K C;  3K27 A;  3JPX A;  5AJA A;  3IJ0 A;  2GC4 A;  3DXK C;  2IUV A;  2XL3 A;  2AGX A;  4FWW A;  2CO0 A;  5GSA A;  3K26 A;  4Y7R A;  3BG0 A;  4TZ4 A;  2IAA A;  3I2N A;  1U2V C;  1B9X A;  3MMY A;  3L4M D;  4GGA A;  4Z8L A;  3V7D B;  4J0X A;  4L3G D;  3UVL A;  2H68 A;  3AL8 A;  4QQE A;  5IJ8 E;  4JSN C;  1MDA H;  3PXT D;  4J79 A;  2BBK H;  3GRE A;  4J78 A;  3I89 A;  1JMZ B;  4QT8 A;  2HKR A;  4O45 A;  5GXI A;  1L0Q A;  4JT5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...