2H13A

Crystal structure of wdr5/histone h3 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Molecular recognition of histone H3 by the WD40 protein WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 102
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h13A00
4Z8LA 4A2MA 4CY3A 2HKMA 3EI2B 2YNPA 4YVDA 4CY5A 4HDJA 2H9NA 5EAPA 2AGWA 4CI1A 5GXIA 5JWZA 3I2NA 2Q7QA 2AGLA 3MZLA 4GQ2P 4L3GD 5GMKn 5B4WA 4CZVA 4A11B 5FKSA 3NVQA 4O3UB 2YB8B 2UZXB 3HFQA 3UR4A 5C2VB 1OMWB 4GQ1A 2B5NA 4BUJC 3IJCA 4Y7RA 4JSPC 2QXVA 4JT5C 3UVKA 2CO0C 2YNNA 2XU7A 3RN0D 4GQBB 3MMYA 4D0KA 4J0WA 3VA6A 2H9LA 3EI3A 5CXCA 2HESX 2AGYA 3SBQA 5IJ8E 4J84A 2W18A 4ERQA 4GGDA 3MKSB 1XHMA 3BG0A 3OTTA 5H14A 3MZKA 3B7FA 2OK4A 4J87A 4QQEA 3OKYA 1JJUB 2GNQA 5EARA 3PSCB 3DWLC 2G99A 4U1EI 3JPXA 2CO0A 3I7OA 5K19A 4JSXC 4A0BA 5AJAA 2J57G 1RI6A 3L4MD 5FQDA 3KRXB 3N0DA 3K27A 1JMZB 3V7DB 2OVQB 3I7PA 2YMUA 3IIWA 3DXMC 3P4FA 3PE7A 3SWSD 4ERYA 2I0SA 3GFCA 3IKOA 3VGZA 3VH0A 3SJLD 5CYKA 3CIKB 1PBYB 5EAMA 5IGOA 5GXHA 2OJYA 4OWRA 3JZHA 2OK6A 3RN1D 4QL1A 4GZ8A 3SHFA 3SFZA 3PXSD 3RMZD 2P9IC 2I0RA 2HKRA 4GMBA 1QNIA 3OKTA 2UZYB 4A0AA 3JROA 4FB1D 1SQJA 4A09A 1PGUA 5CXBA 5TEEA 4OZUA 5TDHB 2I3TA 3MKQA 2Z2OA 2G9AA 5HE0B 5A2Qg 4J86A 4PBYA 4FA1D 2H68A 3E0CA 4EWRA 4BH6A 2IURA 2OIZA 2Z2PA 5FKQA 3I8CA 1MG3A 4FWWA 2CNXA 5THAA 1U2VC 3I89A 4CC9A 5I5JA 2PM9B 3SVWD 4MK0B 4GM9A 4O3TB 3OKWA 4IA9A 2J55H 4JXMA 5EM2A 2IUQA 3EU7A 5H17A 4D6VA 4ZOXA 1NR0A 4E5ZA 3C9CA 4PSXB 1SQ9A 2AQ5A 3FRXA 3DXKC 3NVNA 5AMSA 2HJ4A 5C2WB 2AGXA 5HE2B 2P9KC 4L3HD 4L9OA 1P22A 2XL3A 4GGCA 3SN6B 4FA5D 4ZN4A 1XIPA 2B5LA 1GOTB 3I7LA 3BG1A 4CZYA 1GG2B 2HYEA 2I3SA 4FA9D 2P9UC 4I79A 3EI3B 1NEXB 3W15A 5CXCB 1GXRA 4AOWA 3UVOA 5FKRA 3SBPA 2BBKH 2GC4A 5C9ZB 4A7JA 1PEVA 2I0TA 4XEIC 4QRJA 2PBIB 3KRWB 3DM0A 3OKYB 3UKUC 2B4EA 3EWEA 4LGNA 4GGAA 4KFMB 4ZOVA 4ERZA 2H6QA 3JZNA 1JMXB 2CE8A 4E54A 4A0BB 2HJBA 2PM6B 4IMMA 5EALA 3MXXA 1N6DA 4ZOZA 2QC5A 4ZOYA 3PVWB 3I7HA 4CI3A 3RSEC 3V5WB 4CZXA 4FAVD 3AL8A 4O1QD 1U4CA 1B9XA 3RFHA 3UVLA 3FGBA 3K26A 3RLMD 5GSAA 5CYKB 3CFVA 5I5MA 1R5MA 3IJ1A 3UVNA 3OL2A 4CY1A 2H13A 4X3EA 4N14A 3AFCA 4FA4D 3ZWLB 1S4UX 4A08A 2O9KA 3JZGA 2B5MA 4J79A 1ERJA 4A0AB 3IJ0A 4A09B 4GM8A 3JAMg 5EMKB 4NSXA 2GC7A 4PSWB 5CXBB 4X63B 2IWFA 2H9MA 5HYNB 1B9YA 4AEZA 2OVPB 4JSVC 1TYQC 3F3GA 3PXWD 4J0XA 1TBGA 5EMLB 4XYHA 3EI1A 5TF2A 3EMHA 5SXMA 3J80g 3OW8A 5EMMB 3SMRA 3F3FA 1YFQA 3EI4A 2AH0A 1FWXA 4QT8A 4XYIA 3RFGA 4J8GA 2IWKA 4Y5RD 4PXWA 4CI8A 2BCJB 2J56H 2AGZA 4X61B 4UI9R 5KDOB 1K8KC 2H9PA 3AH8B 5EM2B 3I8EA 2CN2A 1Q47A 1L0QA 3EI2A 3BWSA 2H3XA 2HXCA 4E5ZB 3PXTD 2H6KA 4JD2C 3UKRC 4K3ID 4CI2A 3V9FA 1PI6A 3L4OD 5H1MA 4A11A 4ES0A 5IJ7E 3SBRA 2AH1A 3JB9L 3JRPA 2MTAH 4LG9A 2CN3A 2IUPA 4GM3A 4O9DA 3CFSB 5HE3B 3DSMA 1SHYB 4H5JA 4FAND 3C75H 2OVRB 4U7AA 4J81A 2H14A 4J73A 2PM7B 2P9SC 4J77A 3C99A 3SLED 2CE9A 4R7AB 4H5IA 3ULEC 1OLZA 2YNOA 2P9LC 3SXTD 5K1CC 2H47A 1JOFA 1GP2B 4E54B 5HQGA 4O45A 4PC0A 3RRMC 5IT9g 4J78A 2H6NA 3AL9A 5FKTA 1MG2A 3FM0A 1K32A 3AL8B 4X60B 4PBZA 4J8BA 3PSLA 4A2LA 4FHLA 1XKSA 4ESGA 1N6FA 5TEFA 4PNKB 4BL0A 1MDAH 3ORVD 2TRCB 2XYIA 5AFU3 4JT6C 3GREA 3OL2B 3EG6A 3F3PA 2Z2NA 3A0FA 5HE1B 2EBSA 4A08B 1N6EA 3N0EA 3C5MA 3IIYA 5FXYA 3I7KA 4G56B 5IC7A 3U4YA 3SCYA 2XL2A 4L1QD 4CY2A 5FA5B 3ODTA 2IAAA 1VYHC 4J82A 3EI1B 2IUVA 4LG8A 4JSNC 3PVUB 2P9PC 3UVMA 3EI4B 3I7NA 5IGQA 5FLXg 2YBAA 2PM9A 5EMJB 4K3JB 5I5IA 3J81g 2P9NC 4TZ4A 3NVXA 1A0RB
chains in the Genus database with same CATH superfamily
4Z8LA 4DNWA 1GOHA 4A2MA 4CY3A 2HKMA 3EI2B 2YNPA 4YVDA 1O6FA 4CY5A 4HDJA 3ZE2A 2H9NA 5EAPA 2AGWA 4CI1A 5GXIA 5JWZA 3I2NA 2Q7QA 3EQ8A 2AGLA 3MZLA 4GQ2P 4L3GD 5GMKn 5B4WA 4CZVA 4A11B 5FKSA 3NVQA 4O3UB 2YB8B 2UZXB 3HFQA 3UR4A 5C2VB 1C9IA 1OMWB 1JV2A 4GQ1A 3IUMA 2B5NA 2VDQA 4BUJC 3IJCA 4Y7RA 4JSPC 3NIDA 2QXVA 4JT5C 3UVKA 2CO0C 2YNNA 2XU7A 3RN0D 4GQBB 3MMYA 4D0KA 1U8CA 4J0WA 3VA6A 2H9LA 3EI3A 5C86A 5CXCA 2HESX 4RE5A 2AGYA 3SBQA 5IJ8E 4J84A 2W18A 2VDMA 4ERQA 1A12A 4GGDA 3FCSA 1VE6A 3MKSB 1XHMA 3BG0A 3OTTA 5H14A 3MZKA 3B7FA 2OK4A 4J87A 4QQEA 3OKYA 1JJUB 2GNQA 5EARA 3OF7A 3PSCB 3DWLC 2G99A 4U1EI 3JPXA 2CO0A 3I7OA 4NC4A 4WK0A 4JSXC 5K19A 4A0BA 5AJAA 2J57G 1RI6A 3L4MD 5FQDA 3KRXB 3N0DA 3K27A 1JMZB 3V7DB 2OVQB 3I7PA 2YMUA 2QZPA 5M5TA 3IIWA 3ZDZA 3DXMC 3P4FA 3PE7A 3SWSD 4ERYA 2I0SA 3GFCA 3IKOA 1E5TA 3VGZA 3VH0A 3SJLD 5CYKA 5HDBA 3CIKB 1PBYB 5EAMA 2EIEA 5IGOA 5GXHA 2OJYA 4OWRA 3JZHA 2QR5A 4G55A 1O6GA 2OK6A 4QL1A 4GZ8A 3RN1D 3SHFA 5M5VA 3SFZA 3PXSD 3RMZD 2P9IC 2I0RA 2HKRA 2VDOA 3ZDYA 4GMBA 1QNIA 3OKTA 2UZYB 4A0AA 4D9SA 3JROA 4FB1D 1SQJA 4UM8A 4A09A 1PGUA 5CXBA 5TEEA 4OZUA 3IUJA 5TDHB 2I3TA 3MKQA 4WK4A 2Z2OA 2G9AA 5HE0B 5A2Qg 4J86A 4AMYA 4PBYA 4FA1D 2H68A 3E0CA 4EWRA 4BH6A 2IURA 4JHPC 2OIZA 4NAAA 3O4HA 2Z2PA 1QFMA 5FKQA 3I8CA 2HU7A 1MG3A 4Z7NA 4FWWA 2CNXA 5THAA 3K6SA 4WJKA 1U2VC 3I89A 3MUNA 4CC9A 5I5JA 2PM9B 3SVWD 4MK0B 4GM9A 4O3TB 1H2WA 2JKXA 3OKWA 4IA9A 2J55H 3MVDK 4JXMA 4UM9A 1GOGA 5EM2A 2HU8A 2IUQA 3EU7A 5H17A 4D6VA 1TYEA 4ZOXA 1NR0A 4E5ZA 3C9CA 4PSXB 4JHNA 1SQ9A 5M5UA 2AQ5A 3FRXA 3DXKC 3EQ7A 3NVNA 5AMSA 5E6RA 1QFSA 3IVMA 2HJ4A 5C2WB 2AGXA 5HE2B 1K3IA 2P9KC 4L3HD 3ZE1A 1UTCA 4L9OA 3NIGA 1P22A 2XL3A 4GGCA 3SN6B 4FA5D 4ZN4A 1XIPA 2B5LA 1GOTB 3I7LA 3BG1A 4CZYA 1GG2B 2HYEA 2I3SA 4IRZA 4FA9D 2P9UC 4I79A 3EI3B 1NEXB 3W15A 5CXCB 1GXRA 4AOWA 4L1MA 2EIDA 3UVOA 5FKRA 4BP9A 3SBPA 2BBKH 2GC4A 5C9ZB 4A7JA 3IJEA 2EIBA 4QAMA 1PEVA 2I0TA 4XEIC 5E6UA 1E8NA 2PBIB 3KRWB 3DM0A 4QRJA 2BKLA 3OKYB 3UKUC 2B4EA 3K71A 1BPOA 3EWEA 3EQ9A 4LGNA 4GGAA 4KFMB 4ZOVA 4ERZA 2H6QA 2VC2A 1UOOA 3JZNA 1JMXB 2CE8A 3O4IA 4E54A 4A0BB 2HJBA 2PM6B 4IMMA 5EALA 3MXXA 1N6DA 4ZOZA 2QC5A 4ZOYA 3PVWB 3V4PA 3I7HA 3T3PA 3RSEC 4CI3A 3V5WB 2VDLA 4CZXA 4FAVD 3AL8A 4O1QD 1U4CA 1B9XA 3RFHA 3UVLA 3FGBA 3K26A 3RLMD 5GSAA 5CYKB 3CFVA 2VZ1A 5I5MA 1R5MA 1I2MB 3IJ1A 4BCCA 3UVNA 3OL2A 4DNUA 4CY1A 2H13A 4X3EA 4N14A 3AFCA 3ZE0A 3O4GA 4FA4D 3ZWLB 1S4UX 4A08A 2O9KA 3JZGA 2B5MA 4J79A 1ERJA 4A0AB 4RE6A 3IJ0A 4A09B 4GM8A 4BCDA 5EMKB 3JAMg 4NSXA 2GC7A 4PSWB 5CXBB 4X63B 2EICA 2IWFA 2H9MA 5HYNB 1B9YA 4AEZA 2OVPB 1H2XA 4JSVC 5M5RA 1TYQC 2VDNA 3F3GA 3PXWD 4J0XA 1TBGA 3NIFA 5EMLB 4XYHA 3EI1A 5TF2A 3O4JA 3EMHA 1C9LA 5SXMA 2VDPA 3J80g 3OW8A 5EMMB 3SMRA 3F3FA 1YFQA 5FFGA 3EI4A 2AH0A 1FWXA 4QT8A 1VZ3A 4XYIA 4J8GA 2IWKA 3RFGA 4Y5RD 4G1EA 1UOQA 4PXWA 4CI8A 2BCJB 2J56H 2AGZA 3ZDXA 4X61B 4UI9R 5KDOB 1K8KC 2H9PA 3AH8B 5EM2B 3I8EA 2CN2A 1GOFA 1Q47A 1L0QA 3EI2A 2XE4A 5C92A 3BWSA 2H3XA 2HXCA 4E5ZB 3PXTD 2H6KA 4JD2C 3UKRC 1UOPA 4K3ID 2HU5A 3V9FA 4CI2A 1PI6A 3L4OD 5H1MA 4A11A 4DNVA 4ES0A 1M1XA 5IJ7E 3SBRA 2AH1A 3JB9L 3JRPA 3K72A 2MTAH 4O2WA 4LG9A 2CN3A 2IUPA 4GM3A 3IUNA 3CFSB 4O9DA 5HE3B 3DSMA 1SHYB 4H5JA 4FAND 3C75H 2OVRB 4AMZA 1L5GA 4U7AA 4J81A 4Z7OA 2H14A 4O02A 3GD1I 4J73A 2PM7B 2P9SC 5M5SA 4J77A 1H2YA 3QHYB 3C99A 4MMZA 3SLED 1T2XA 2CE9A 3VI3A 4R7AB 4H5IA 3ULEC 1OLZA 2YNOA 2P9LC 3SXTD 5K1CC 2H47A 2VZ3A 2WQ8A 1JOFA 2VDKA 1GP2B 5M61A 3IULA 5HQGA 4O45A 4E54B 4PC0A 3RRMC 5IT9g 4J78A 2H6NA 2XZGA 3AL9A 1VE7A 5FKTA 1MG2A 3FM0A 1K32A 3IURA 3KCIA 4AN0A 3AL8B 4X60B 4PBZA 3T3MA 4J8BA 3PSLA 4A2LA 4FHLA 1XKSA 4WK2A 4ESGA 1N6FA 5TEFA 4PNKB 4BL0A 1MDAH 3ORVD 2TRCB 2XYIA 5AFU3 3GC3B 4JT6C 3GREA 3OL2B 3EG6A 3F3PA 2Z2NA 4Z7QA 3A0FA 4MMYA 3VI4A 5HE1B 2EBSA 3DDUA 4A08B 1N6EA 3N0EA 2VDRA 3C5MA 5FFOA 3IIYA 5FXYA 3MUOA 3I7KA 2XDWA 4G56B 1E8MA 5IC7A 3U4YA 1H2ZA 3V4VA 3SCYA 3FCUA 3IUQA 4BP8A 2XL2A 4L1QD 4NBMA 4CY2A 5FA5B 3ODTA 2IAAA 1VYHC 4J82A 3QI0A 3EI1B 2IUVA 4AX4A 4AN1A 5E6SA 4LG8A 4JSNC 3PVUB 2P9PC 4G1MA 3UVMA 3EI4B 1YR2A 3I7NA 1JTDB 5IGQA 5FLXg 1VZ2A 2YBAA 2PM9A 5EMJB 4K3JB 5I5IA 3J81g 2P9NC 4MMXA 4TZ4A 3NVXA 4NENA 4BCBA 1A0RB
chains in the Genus database with same CATH topology
4Z8LA 4A2MA 4CY3A 2HKMA 3EI2B 2YNPA 4YVDA 4CY5A 4HDJA 2H9NA 5EAPA 2AGWA 4CI1A 5GXIA 5JWZA 3I2NA 2Q7QA 2AGLA 3MZLA 4GQ2P 4L3GD 5GMKn 5B4WA 4CZVA 4A11B 5FKSA 3NVQA 4O3UB 2YB8B 2UZXB 3HFQA 3UR4A 5C2VB 1OMWB 4GQ1A 2B5NA 4BUJC 3IJCA 4Y7RA 4JSPC 2QXVA 4JT5C 3UVKA 2CO0C 2YNNA 2XU7A 3RN0D 4GQBB 3MMYA 4D0KA 4J0WA 3VA6A 2H9LA 3EI3A 5CXCA 2HESX 2AGYA 3SBQA 5IJ8E 4J84A 2W18A 4ERQA 4GGDA 3MKSB 1XHMA 3BG0A 3OTTA 5H14A 3MZKA 3B7FA 2OK4A 4J87A 4QQEA 3OKYA 1JJUB 2GNQA 5EARA 3PSCB 3DWLC 2G99A 4U1EI 3JPXA 2CO0A 3I7OA 5K19A 4JSXC 4A0BA 5AJAA 2J57G 1RI6A 3L4MD 5FQDA 3KRXB 3N0DA 3K27A 1JMZB 3V7DB 2OVQB 3I7PA 2YMUA 3IIWA 3DXMC 3P4FA 3PE7A 3SWSD 4ERYA 2I0SA 3GFCA 3IKOA 3VGZA 3VH0A 3SJLD 5CYKA 3CIKB 1PBYB 5EAMA 5IGOA 5GXHA 2OJYA 4OWRA 3JZHA 2OK6A 3RN1D 4QL1A 4GZ8A 3SHFA 3SFZA 3PXSD 3RMZD 2P9IC 2I0RA 2HKRA 4GMBA 1QNIA 3OKTA 2UZYB 4A0AA 3JROA 4FB1D 1SQJA 4A09A 1PGUA 5CXBA 5TEEA 4OZUA 5TDHB 2I3TA 3MKQA 2Z2OA 2G9AA 5HE0B 5A2Qg 4J86A 4PBYA 4FA1D 2H68A 3E0CA 4EWRA 4BH6A 2IURA 2OIZA 2Z2PA 5FKQA 3I8CA 1MG3A 4FWWA 2CNXA 5THAA 1U2VC 3I89A 4CC9A 5I5JA 2PM9B 3SVWD 4MK0B 4GM9A 4O3TB 3OKWA 4IA9A 2J55H 4JXMA 5EM2A 2IUQA 3EU7A 5H17A 4D6VA 4ZOXA 1NR0A 4E5ZA 3C9CA 4PSXB 1SQ9A 2AQ5A 3FRXA 3DXKC 3NVNA 5AMSA 2HJ4A 5C2WB 2AGXA 5HE2B 2P9KC 4L3HD 4L9OA 1P22A 2XL3A 4GGCA 3SN6B 4FA5D 4ZN4A 1XIPA 2B5LA 1GOTB 3I7LA 3BG1A 4CZYA 1GG2B 2HYEA 2I3SA 4FA9D 2P9UC 4I79A 3EI3B 1NEXB 3W15A 5CXCB 1GXRA 4AOWA 3UVOA 5FKRA 3SBPA 2BBKH 2GC4A 5C9ZB 4A7JA 1PEVA 2I0TA 4XEIC 4QRJA 2PBIB 3KRWB 3DM0A 3OKYB 3UKUC 2B4EA 3EWEA 4LGNA 4GGAA 4KFMB 4ZOVA 4ERZA 2H6QA 3JZNA 1JMXB 2CE8A 4E54A 4A0BB 2HJBA 2PM6B 4IMMA 5EALA 3MXXA 1N6DA 4ZOZA 2QC5A 4ZOYA 3PVWB 3I7HA 4CI3A 3RSEC 3V5WB 4CZXA 4FAVD 3AL8A 4O1QD 1U4CA 1B9XA 3RFHA 3UVLA 3FGBA 3K26A 3RLMD 5GSAA 5CYKB 3CFVA 5I5MA 1R5MA 3IJ1A 3UVNA 3OL2A 4CY1A 2H13A 4X3EA 4N14A 3AFCA 4FA4D 3ZWLB 1S4UX 4A08A 2O9KA 3JZGA 2B5MA 4J79A 1ERJA 4A0AB 3IJ0A 4A09B 4GM8A 3JAMg 5EMKB 4NSXA 2GC7A 4PSWB 5CXBB 4X63B 2IWFA 2H9MA 5HYNB 1B9YA 4AEZA 2OVPB 4JSVC 1TYQC 3F3GA 3PXWD 4J0XA 1TBGA 5EMLB 4XYHA 3EI1A 5TF2A 3EMHA 5SXMA 3J80g 3OW8A 5EMMB 3SMRA 3F3FA 1YFQA 3EI4A 2AH0A 1FWXA 4QT8A 4XYIA 3RFGA 4J8GA 2IWKA 4Y5RD 4PXWA 4CI8A 2BCJB 2J56H 2AGZA 4X61B 4UI9R 5KDOB 1K8KC 2H9PA 3AH8B 5EM2B 3I8EA 2CN2A 1Q47A 1L0QA 3EI2A 3BWSA 2H3XA 2HXCA 4E5ZB 3PXTD 2H6KA 4JD2C 3UKRC 4K3ID 4CI2A 3V9FA 1PI6A 3L4OD 5H1MA 4A11A 4ES0A 5IJ7E 3SBRA 2AH1A 3JB9L 3JRPA 2MTAH 4LG9A 2CN3A 2IUPA 4GM3A 4O9DA 3CFSB 5HE3B 3DSMA 1SHYB 4H5JA 4FAND 3C75H 2OVRB 4U7AA 4J81A 2H14A 4J73A 2PM7B 2P9SC 4J77A 3C99A 3SLED 2CE9A 4R7AB 4H5IA 3ULEC 1OLZA 2YNOA 2P9LC 3SXTD 5K1CC 2H47A 1JOFA 1GP2B 4E54B 5HQGA 4O45A 4PC0A 3RRMC 5IT9g 4J78A 2H6NA 3AL9A 5FKTA 1MG2A 3FM0A 1K32A 3AL8B 4X60B 4PBZA 4J8BA 3PSLA 4A2LA 4FHLA 1XKSA 4ESGA 1N6FA 5TEFA 4PNKB 4BL0A 1MDAH 3ORVD 2TRCB 2XYIA 5AFU3 4JT6C 3GREA 3OL2B 3EG6A 3F3PA 2Z2NA 3A0FA 5HE1B 2EBSA 4A08B 1N6EA 3N0EA 3C5MA 3IIYA 5FXYA 3I7KA 4G56B 5IC7A 3U4YA 3SCYA 2XL2A 4L1QD 4CY2A 5FA5B 3ODTA 2IAAA 1VYHC 4J82A 3EI1B 2IUVA 4LG8A 4JSNC 3PVUB 2P9PC 3UVMA 3EI4B 3I7NA 5IGQA 5FLXg 2YBAA 2PM9A 5EMJB 4K3JB 5I5IA 3J81g 2P9NC 4TZ4A 3NVXA 1A0RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z8L A;  4A2M A;  4CY3 A;  2HKM A;  3EI2 B;  2YNP A;  4YVD A;  4CY5 A;  4HDJ A;  2H9N A;  5EAP A;  2AGW A;  4CI1 A;  5GXI A;  5JWZ A;  3I2N A;  2Q7Q A;  2AGL A;  3MZL A;  4GQ2 P;  4L3G D;  5GMK n;  5B4W A;  4CZV A;  4A11 B;  5FKS A;  3NVQ A;  4O3U B;  2YB8 B;  2UZX B;  3HFQ A;  3UR4 A;  5C2V B;  1OMW B;  4GQ1 A;  2B5N A;  4BUJ C;  3IJC A;  4Y7R A;  4JSP C;  2QXV A;  4JT5 C;  3UVK A;  2CO0 C;  2YNN A;  2XU7 A;  3RN0 D;  4GQB B;  3MMY A;  4D0K A;  4J0W A;  3VA6 A;  2H9L A;  3EI3 A;  5CXC A;  2HES X;  2AGY A;  3SBQ A;  5IJ8 E;  4J84 A;  2W18 A;  4ERQ A;  4GGD A;  3MKS B;  1XHM A;  3BG0 A;  3OTT A;  5H14 A;  3MZK A;  3B7F A;  2OK4 A;  4J87 A;  4QQE A;  3OKY A;  1JJU B;  2GNQ A;  5EAR A;  3PSC B;  3DWL C;  2G99 A;  4U1E I;  3JPX A;  2CO0 A;  3I7O A;  5K19 A;  4JSX C;  4A0B A;  5AJA A;  2J57 G;  1RI6 A;  3L4M D;  5FQD A;  3KRX B;  3N0D A;  3K27 A;  1JMZ B;  3V7D B;  2OVQ B;  3I7P A;  2YMU A;  3IIW A;  3DXM C;  3P4F A;  3PE7 A;  3SWS D;  4ERY A;  2I0S A;  3GFC A;  3IKO A;  3VGZ A;  3VH0 A;  3SJL D;  5CYK A;  3CIK B;  1PBY B;  5EAM A;  5IGO A;  5GXH A;  2OJY A;  4OWR A;  3JZH A;  2OK6 A;  3RN1 D;  4QL1 A;  4GZ8 A;  3SHF A;  3SFZ A;  3PXS D;  3RMZ D;  2P9I C;  2I0R A;  2HKR A;  4GMB A;  1QNI A;  3OKT A;  2UZY B;  4A0A A;  3JRO A;  4FB1 D;  1SQJ A;  4A09 A;  1PGU A;  5CXB A;  5TEE A;  4OZU A;  5TDH B;  2I3T A;  3MKQ A;  2Z2O A;  2G9A A;  5HE0 B;  5A2Q g;  4J86 A;  4PBY A;  4FA1 D;  2H68 A;  3E0C A;  4EWR A;  4BH6 A;  2IUR A;  2OIZ A;  2Z2P A;  5FKQ A;  3I8C A;  1MG3 A;  4FWW A;  2CNX A;  5THA A;  1U2V C;  3I89 A;  4CC9 A;  5I5J A;  2PM9 B;  3SVW D;  4MK0 B;  4GM9 A;  4O3T B;  3OKW A;  4IA9 A;  2J55 H;  4JXM A;  5EM2 A;  2IUQ A;  3EU7 A;  5H17 A;  4D6V A;  4ZOX A;  1NR0 A;  4E5Z A;  3C9C A;  4PSX B;  1SQ9 A;  2AQ5 A;  3FRX A;  3DXK C;  3NVN A;  5AMS A;  2HJ4 A;  5C2W B;  2AGX A;  5HE2 B;  2P9K C;  4L3H D;  4L9O A;  1P22 A;  2XL3 A;  4GGC A;  3SN6 B;  4FA5 D;  4ZN4 A;  1XIP A;  2B5L A;  1GOT B;  3I7L A;  3BG1 A;  4CZY A;  1GG2 B;  2HYE A;  2I3S A;  4FA9 D;  2P9U C;  4I79 A;  3EI3 B;  1NEX B;  3W15 A;  5CXC B;  1GXR A;  4AOW A;  3UVO A;  5FKR A;  3SBP A;  2BBK H;  2GC4 A;  5C9Z B;  4A7J A;  1PEV A;  2I0T A;  4XEI C;  4QRJ A;  2PBI B;  3KRW B;  3DM0 A;  3OKY B;  3UKU C;  2B4E A;  3EWE A;  4LGN A;  4GGA A;  4KFM B;  4ZOV A;  4ERZ A;  2H6Q A;  3JZN A;  1JMX B;  2CE8 A;  4E54 A;  4A0B B;  2HJB A;  2PM6 B;  4IMM A;  5EAL A;  3MXX A;  1N6D A;  4ZOZ A;  2QC5 A;  4ZOY A;  3PVW B;  3I7H A;  4CI3 A;  3RSE C;  3V5W B;  4CZX A;  4FAV D;  3AL8 A;  4O1Q D;  1U4C A;  1B9X A;  3RFH A;  3UVL A;  3FGB A;  3K26 A;  3RLM D;  5GSA A;  5CYK B;  3CFV A;  5I5M A;  1R5M A;  3IJ1 A;  3UVN A;  3OL2 A;  4CY1 A;  2H13 A;  4X3E A;  4N14 A;  3AFC A;  4FA4 D;  3ZWL B;  1S4U X;  4A08 A;  2O9K A;  3JZG A;  2B5M A;  4J79 A;  1ERJ A;  4A0A B;  3IJ0 A;  4A09 B;  4GM8 A;  3JAM g;  5EMK B;  4NSX A;  2GC7 A;  4PSW B;  5CXB B;  4X63 B;  2IWF A;  2H9M A;  5HYN B;  1B9Y A;  4AEZ A;  2OVP B;  4JSV C;  1TYQ C;  3F3G A;  3PXW D;  4J0X A;  1TBG A;  5EML B;  4XYH A;  3EI1 A;  5TF2 A;  3EMH A;  5SXM A;  3J80 g;  3OW8 A;  5EMM B;  3SMR A;  3F3F A;  1YFQ A;  3EI4 A;  2AH0 A;  1FWX A;  4QT8 A;  4XYI A;  3RFG A;  4J8G A;  2IWK A;  4Y5R D;  4PXW A;  4CI8 A;  2BCJ B;  2J56 H;  2AGZ A;  4X61 B;  4UI9 R;  5KDO B;  1K8K C;  2H9P A;  3AH8 B;  5EM2 B;  3I8E A;  2CN2 A;  1Q47 A;  1L0Q A;  3EI2 A;  3BWS A;  2H3X A;  2HXC A;  4E5Z B;  3PXT D;  2H6K A;  4JD2 C;  3UKR C;  4K3I D;  4CI2 A;  3V9F A;  1PI6 A;  3L4O D;  5H1M A;  4A11 A;  4ES0 A;  5IJ7 E;  3SBR A;  2AH1 A;  3JB9 L;  3JRP A;  2MTA H;  4LG9 A;  2CN3 A;  2IUP A;  4GM3 A;  4O9D A;  3CFS B;  5HE3 B;  3DSM A;  1SHY B;  4H5J A;  4FAN D;  3C75 H;  2OVR B;  4U7A A;  4J81 A;  2H14 A;  4J73 A;  2PM7 B;  2P9S C;  4J77 A;  3C99 A;  3SLE D;  2CE9 A;  4R7A B;  4H5I A;  3ULE C;  1OLZ A;  2YNO A;  2P9L C;  3SXT D;  5K1C C;  2H47 A;  1JOF A;  1GP2 B;  4E54 B;  5HQG A;  4O45 A;  4PC0 A;  3RRM C;  5IT9 g;  4J78 A;  2H6N A;  3AL9 A;  5FKT A;  1MG2 A;  3FM0 A;  1K32 A;  3AL8 B;  4X60 B;  4PBZ A;  4J8B A;  3PSL A;  4A2L A;  4FHL A;  1XKS A;  4ESG A;  1N6F A;  5TEF A;  4PNK B;  4BL0 A;  1MDA H;  3ORV D;  2TRC B;  2XYI A;  5AFU 3;  4JT6 C;  3GRE A;  3OL2 B;  3EG6 A;  3F3P A;  2Z2N A;  3A0F A;  5HE1 B;  2EBS A;  4A08 B;  1N6E A;  3N0E A;  3C5M A;  3IIY A;  5FXY A;  3I7K A;  4G56 B;  5IC7 A;  3U4Y A;  3SCY A;  2XL2 A;  4L1Q D;  4CY2 A;  5FA5 B;  3ODT A;  2IAA A;  1VYH C;  4J82 A;  3EI1 B;  2IUV A;  4LG8 A;  4JSN C;  3PVU B;  2P9P C;  3UVM A;  3EI4 B;  3I7N A;  5IGQ A;  5FLX g;  2YBA A;  2PM9 A;  5EMJ B;  4K3J B;  5I5I A;  3J81 g;  2P9N C;  4TZ4 A;  3NVX A;  1A0R B; 
#chains in the Genus database with same CATH topology
 4Z8L A;  4DNW A;  1GOH A;  4A2M A;  4CY3 A;  2HKM A;  3EI2 B;  2YNP A;  4YVD A;  1O6F A;  4CY5 A;  4HDJ A;  3ZE2 A;  2H9N A;  5EAP A;  2AGW A;  4CI1 A;  5GXI A;  5JWZ A;  3I2N A;  2Q7Q A;  3EQ8 A;  2AGL A;  3MZL A;  4GQ2 P;  4L3G D;  5GMK n;  5B4W A;  4CZV A;  4A11 B;  5FKS A;  3NVQ A;  4O3U B;  2YB8 B;  2UZX B;  3HFQ A;  3UR4 A;  5C2V B;  1C9I A;  1OMW B;  1JV2 A;  4GQ1 A;  3IUM A;  2B5N A;  2VDQ A;  4BUJ C;  3IJC A;  4Y7R A;  4JSP C;  3NID A;  2QXV A;  4JT5 C;  3UVK A;  2CO0 C;  2YNN A;  2XU7 A;  3RN0 D;  4GQB B;  3MMY A;  4D0K A;  1U8C A;  4J0W A;  3VA6 A;  2H9L A;  3EI3 A;  5C86 A;  5CXC A;  2HES X;  4RE5 A;  2AGY A;  3SBQ A;  5IJ8 E;  4J84 A;  2W18 A;  2VDM A;  4ERQ A;  1A12 A;  4GGD A;  3FCS A;  1VE6 A;  3MKS B;  1XHM A;  3BG0 A;  3OTT A;  5H14 A;  3MZK A;  3B7F A;  2OK4 A;  4J87 A;  4QQE A;  3OKY A;  1JJU B;  2GNQ A;  5EAR A;  3OF7 A;  3PSC B;  3DWL C;  2G99 A;  4U1E I;  3JPX A;  2CO0 A;  3I7O A;  4NC4 A;  4WK0 A;  4JSX C;  5K19 A;  4A0B A;  5AJA A;  2J57 G;  1RI6 A;  3L4M D;  5FQD A;  3KRX B;  3N0D A;  3K27 A;  1JMZ B;  3V7D B;  2OVQ B;  3I7P A;  2YMU A;  2QZP A;  5M5T A;  3IIW A;  3ZDZ A;  3DXM C;  3P4F A;  3PE7 A;  3SWS D;  4ERY A;  2I0S A;  3GFC A;  3IKO A;  1E5T A;  3VGZ A;  3VH0 A;  3SJL D;  5CYK A;  5HDB A;  3CIK B;  1PBY B;  5EAM A;  2EIE A;  5IGO A;  5GXH A;  2OJY A;  4OWR A;  3JZH A;  2QR5 A;  4G55 A;  1O6G A;  2OK6 A;  4QL1 A;  4GZ8 A;  3RN1 D;  3SHF A;  5M5V A;  3SFZ A;  3PXS D;  3RMZ D;  2P9I C;  2I0R A;  2HKR A;  2VDO A;  3ZDY A;  4GMB A;  1QNI A;  3OKT A;  2UZY B;  4A0A A;  4D9S A;  3JRO A;  4FB1 D;  1SQJ A;  4UM8 A;  4A09 A;  1PGU A;  5CXB A;  5TEE A;  4OZU A;  3IUJ A;  5TDH B;  2I3T A;  3MKQ A;  4WK4 A;  2Z2O A;  2G9A A;  5HE0 B;  5A2Q g;  4J86 A;  4AMY A;  4PBY A;  4FA1 D;  2H68 A;  3E0C A;  4EWR A;  4BH6 A;  2IUR A;  4JHP C;  2OIZ A;  4NAA A;  3O4H A;  2Z2P A;  1QFM A;  5FKQ A;  3I8C A;  2HU7 A;  1MG3 A;  4Z7N A;  4FWW A;  2CNX A;  5THA A;  3K6S A;  4WJK A;  1U2V C;  3I89 A;  3MUN A;  4CC9 A;  5I5J A;  2PM9 B;  3SVW D;  4MK0 B;  4GM9 A;  4O3T B;  1H2W A;  2JKX A;  3OKW A;  4IA9 A;  2J55 H;  3MVD K;  4JXM A;  4UM9 A;  1GOG A;  5EM2 A;  2HU8 A;  2IUQ A;  3EU7 A;  5H17 A;  4D6V A;  1TYE A;  4ZOX A;  1NR0 A;  4E5Z A;  3C9C A;  4PSX B;  4JHN A;  1SQ9 A;  5M5U A;  2AQ5 A;  3FRX A;  3DXK C;  3EQ7 A;  3NVN A;  5AMS A;  5E6R A;  1QFS A;  3IVM A;  2HJ4 A;  5C2W B;  2AGX A;  5HE2 B;  1K3I A;  2P9K C;  4L3H D;  3ZE1 A;  1UTC A;  4L9O A;  3NIG A;  1P22 A;  2XL3 A;  4GGC A;  3SN6 B;  4FA5 D;  4ZN4 A;  1XIP A;  2B5L A;  1GOT B;  3I7L A;  3BG1 A;  4CZY A;  1GG2 B;  2HYE A;  2I3S A;  4IRZ A;  4FA9 D;  2P9U C;  4I79 A;  3EI3 B;  1NEX B;  3W15 A;  5CXC B;  1GXR A;  4AOW A;  4L1M A;  2EID A;  3UVO A;  5FKR A;  4BP9 A;  3SBP A;  2BBK H;  2GC4 A;  5C9Z B;  4A7J A;  3IJE A;  2EIB A;  4QAM A;  1PEV A;  2I0T A;  4XEI C;  5E6U A;  1E8N A;  2PBI B;  3KRW B;  3DM0 A;  4QRJ A;  2BKL A;  3OKY B;  3UKU C;  2B4E A;  3K71 A;  1BPO A;  3EWE A;  3EQ9 A;  4LGN A;  4GGA A;  4KFM B;  4ZOV A;  4ERZ A;  2H6Q A;  2VC2 A;  1UOO A;  3JZN A;  1JMX B;  2CE8 A;  3O4I A;  4E54 A;  4A0B B;  2HJB A;  2PM6 B;  4IMM A;  5EAL A;  3MXX A;  1N6D A;  4ZOZ A;  2QC5 A;  4ZOY A;  3PVW B;  3V4P A;  3I7H A;  3T3P A;  3RSE C;  4CI3 A;  3V5W B;  2VDL A;  4CZX A;  4FAV D;  3AL8 A;  4O1Q D;  1U4C A;  1B9X A;  3RFH A;  3UVL A;  3FGB A;  3K26 A;  3RLM D;  5GSA A;  5CYK B;  3CFV A;  2VZ1 A;  5I5M A;  1R5M A;  1I2M B;  3IJ1 A;  4BCC A;  3UVN A;  3OL2 A;  4DNU A;  4CY1 A;  2H13 A;  4X3E A;  4N14 A;  3AFC A;  3ZE0 A;  3O4G A;  4FA4 D;  3ZWL B;  1S4U X;  4A08 A;  2O9K A;  3JZG A;  2B5M A;  4J79 A;  1ERJ A;  4A0A B;  4RE6 A;  3IJ0 A;  4A09 B;  4GM8 A;  4BCD A;  5EMK B;  3JAM g;  4NSX A;  2GC7 A;  4PSW B;  5CXB B;  4X63 B;  2EIC A;  2IWF A;  2H9M A;  5HYN B;  1B9Y A;  4AEZ A;  2OVP B;  1H2X A;  4JSV C;  5M5R A;  1TYQ C;  2VDN A;  3F3G A;  3PXW D;  4J0X A;  1TBG A;  3NIF A;  5EML B;  4XYH A;  3EI1 A;  5TF2 A;  3O4J A;  3EMH A;  1C9L A;  5SXM A;  2VDP A;  3J80 g;  3OW8 A;  5EMM B;  3SMR A;  3F3F A;  1YFQ A;  5FFG A;  3EI4 A;  2AH0 A;  1FWX A;  4QT8 A;  1VZ3 A;  4XYI A;  4J8G A;  2IWK A;  3RFG A;  4Y5R D;  4G1E A;  1UOQ A;  4PXW A;  4CI8 A;  2BCJ B;  2J56 H;  2AGZ A;  3ZDX A;  4X61 B;  4UI9 R;  5KDO B;  1K8K C;  2H9P A;  3AH8 B;  5EM2 B;  3I8E A;  2CN2 A;  1GOF A;  1Q47 A;  1L0Q A;  3EI2 A;  2XE4 A;  5C92 A;  3BWS A;  2H3X A;  2HXC A;  4E5Z B;  3PXT D;  2H6K A;  4JD2 C;  3UKR C;  1UOP A;  4K3I D;  2HU5 A;  3V9F A;  4CI2 A;  1PI6 A;  3L4O D;  5H1M A;  4A11 A;  4DNV A;  4ES0 A;  1M1X A;  5IJ7 E;  3SBR A;  2AH1 A;  3JB9 L;  3JRP A;  3K72 A;  2MTA H;  4O2W A;  4LG9 A;  2CN3 A;  2IUP A;  4GM3 A;  3IUN A;  3CFS B;  4O9D A;  5HE3 B;  3DSM A;  1SHY B;  4H5J A;  4FAN D;  3C75 H;  2OVR B;  4AMZ A;  1L5G A;  4U7A A;  4J81 A;  4Z7O A;  2H14 A;  4O02 A;  3GD1 I;  4J73 A;  2PM7 B;  2P9S C;  5M5S A;  4J77 A;  1H2Y A;  3QHY B;  3C99 A;  4MMZ A;  3SLE D;  1T2X A;  2CE9 A;  3VI3 A;  4R7A B;  4H5I A;  3ULE C;  1OLZ A;  2YNO A;  2P9L C;  3SXT D;  5K1C C;  2H47 A;  2VZ3 A;  2WQ8 A;  1JOF A;  2VDK A;  1GP2 B;  5M61 A;  3IUL A;  5HQG A;  4O45 A;  4E54 B;  4PC0 A;  3RRM C;  5IT9 g;  4J78 A;  2H6N A;  2XZG A;  3AL9 A;  1VE7 A;  5FKT A;  1MG2 A;  3FM0 A;  1K32 A;  3IUR A;  3KCI A;  4AN0 A;  3AL8 B;  4X60 B;  4PBZ A;  3T3M A;  4J8B A;  3PSL A;  4A2L A;  4FHL A;  1XKS A;  4WK2 A;  4ESG A;  1N6F A;  5TEF A;  4PNK B;  4BL0 A;  1MDA H;  3ORV D;  2TRC B;  2XYI A;  5AFU 3;  3GC3 B;  4JT6 C;  3GRE A;  3OL2 B;  3EG6 A;  3F3P A;  2Z2N A;  4Z7Q A;  3A0F A;  4MMY A;  3VI4 A;  5HE1 B;  2EBS A;  3DDU A;  4A08 B;  1N6E A;  3N0E A;  2VDR A;  3C5M A;  5FFO A;  3IIY A;  5FXY A;  3MUO A;  3I7K A;  2XDW A;  4G56 B;  1E8M A;  5IC7 A;  3U4Y A;  1H2Z A;  3V4V A;  3SCY A;  3FCU A;  3IUQ A;  4BP8 A;  2XL2 A;  4L1Q D;  4NBM A;  4CY2 A;  5FA5 B;  3ODT A;  2IAA A;  1VYH C;  4J82 A;  3QI0 A;  3EI1 B;  2IUV A;  4AX4 A;  4AN1 A;  5E6S A;  4LG8 A;  4JSN C;  3PVU B;  2P9P C;  4G1M A;  3UVM A;  3EI4 B;  1YR2 A;  3I7N A;  1JTD B;  5IGQ A;  5FLX g;  1VZ2 A;  2YBA A;  2PM9 A;  5EMJ B;  4K3J B;  5I5I A;  3J81 g;  2P9N C;  4MMX A;  4TZ4 A;  3NVX A;  4NEN A;  4BCB A;  1A0R B; 
#chains in the Genus database with same CATH homology
 4Z8L A;  4A2M A;  4CY3 A;  2HKM A;  3EI2 B;  2YNP A;  4YVD A;  4CY5 A;  4HDJ A;  2H9N A;  5EAP A;  2AGW A;  4CI1 A;  5GXI A;  5JWZ A;  3I2N A;  2Q7Q A;  2AGL A;  3MZL A;  4GQ2 P;  4L3G D;  5GMK n;  5B4W A;  4CZV A;  4A11 B;  5FKS A;  3NVQ A;  4O3U B;  2YB8 B;  2UZX B;  3HFQ A;  3UR4 A;  5C2V B;  1OMW B;  4GQ1 A;  2B5N A;  4BUJ C;  3IJC A;  4Y7R A;  4JSP C;  2QXV A;  4JT5 C;  3UVK A;  2CO0 C;  2YNN A;  2XU7 A;  3RN0 D;  4GQB B;  3MMY A;  4D0K A;  4J0W A;  3VA6 A;  2H9L A;  3EI3 A;  5CXC A;  2HES X;  2AGY A;  3SBQ A;  5IJ8 E;  4J84 A;  2W18 A;  4ERQ A;  4GGD A;  3MKS B;  1XHM A;  3BG0 A;  3OTT A;  5H14 A;  3MZK A;  3B7F A;  2OK4 A;  4J87 A;  4QQE A;  3OKY A;  1JJU B;  2GNQ A;  5EAR A;  3PSC B;  3DWL C;  2G99 A;  4U1E I;  3JPX A;  2CO0 A;  3I7O A;  5K19 A;  4JSX C;  4A0B A;  5AJA A;  2J57 G;  1RI6 A;  3L4M D;  5FQD A;  3KRX B;  3N0D A;  3K27 A;  1JMZ B;  3V7D B;  2OVQ B;  3I7P A;  2YMU A;  3IIW A;  3DXM C;  3P4F A;  3PE7 A;  3SWS D;  4ERY A;  2I0S A;  3GFC A;  3IKO A;  3VGZ A;  3VH0 A;  3SJL D;  5CYK A;  3CIK B;  1PBY B;  5EAM A;  5IGO A;  5GXH A;  2OJY A;  4OWR A;  3JZH A;  2OK6 A;  3RN1 D;  4QL1 A;  4GZ8 A;  3SHF A;  3SFZ A;  3PXS D;  3RMZ D;  2P9I C;  2I0R A;  2HKR A;  4GMB A;  1QNI A;  3OKT A;  2UZY B;  4A0A A;  3JRO A;  4FB1 D;  1SQJ A;  4A09 A;  1PGU A;  5CXB A;  5TEE A;  4OZU A;  5TDH B;  2I3T A;  3MKQ A;  2Z2O A;  2G9A A;  5HE0 B;  5A2Q g;  4J86 A;  4PBY A;  4FA1 D;  2H68 A;  3E0C A;  4EWR A;  4BH6 A;  2IUR A;  2OIZ A;  2Z2P A;  5FKQ A;  3I8C A;  1MG3 A;  4FWW A;  2CNX A;  5THA A;  1U2V C;  3I89 A;  4CC9 A;  5I5J A;  2PM9 B;  3SVW D;  4MK0 B;  4GM9 A;  4O3T B;  3OKW A;  4IA9 A;  2J55 H;  4JXM A;  5EM2 A;  2IUQ A;  3EU7 A;  5H17 A;  4D6V A;  4ZOX A;  1NR0 A;  4E5Z A;  3C9C A;  4PSX B;  1SQ9 A;  2AQ5 A;  3FRX A;  3DXK C;  3NVN A;  5AMS A;  2HJ4 A;  5C2W B;  2AGX A;  5HE2 B;  2P9K C;  4L3H D;  4L9O A;  1P22 A;  2XL3 A;  4GGC A;  3SN6 B;  4FA5 D;  4ZN4 A;  1XIP A;  2B5L A;  1GOT B;  3I7L A;  3BG1 A;  4CZY A;  1GG2 B;  2HYE A;  2I3S A;  4FA9 D;  2P9U C;  4I79 A;  3EI3 B;  1NEX B;  3W15 A;  5CXC B;  1GXR A;  4AOW A;  3UVO A;  5FKR A;  3SBP A;  2BBK H;  2GC4 A;  5C9Z B;  4A7J A;  1PEV A;  2I0T A;  4XEI C;  4QRJ A;  2PBI B;  3KRW B;  3DM0 A;  3OKY B;  3UKU C;  2B4E A;  3EWE A;  4LGN A;  4GGA A;  4KFM B;  4ZOV A;  4ERZ A;  2H6Q A;  3JZN A;  1JMX B;  2CE8 A;  4E54 A;  4A0B B;  2HJB A;  2PM6 B;  4IMM A;  5EAL A;  3MXX A;  1N6D A;  4ZOZ A;  2QC5 A;  4ZOY A;  3PVW B;  3I7H A;  4CI3 A;  3RSE C;  3V5W B;  4CZX A;  4FAV D;  3AL8 A;  4O1Q D;  1U4C A;  1B9X A;  3RFH A;  3UVL A;  3FGB A;  3K26 A;  3RLM D;  5GSA A;  5CYK B;  3CFV A;  5I5M A;  1R5M A;  3IJ1 A;  3UVN A;  3OL2 A;  4CY1 A;  2H13 A;  4X3E A;  4N14 A;  3AFC A;  4FA4 D;  3ZWL B;  1S4U X;  4A08 A;  2O9K A;  3JZG A;  2B5M A;  4J79 A;  1ERJ A;  4A0A B;  3IJ0 A;  4A09 B;  4GM8 A;  3JAM g;  5EMK B;  4NSX A;  2GC7 A;  4PSW B;  5CXB B;  4X63 B;  2IWF A;  2H9M A;  5HYN B;  1B9Y A;  4AEZ A;  2OVP B;  4JSV C;  1TYQ C;  3F3G A;  3PXW D;  4J0X A;  1TBG A;  5EML B;  4XYH A;  3EI1 A;  5TF2 A;  3EMH A;  5SXM A;  3J80 g;  3OW8 A;  5EMM B;  3SMR A;  3F3F A;  1YFQ A;  3EI4 A;  2AH0 A;  1FWX A;  4QT8 A;  4XYI A;  3RFG A;  4J8G A;  2IWK A;  4Y5R D;  4PXW A;  4CI8 A;  2BCJ B;  2J56 H;  2AGZ A;  4X61 B;  4UI9 R;  5KDO B;  1K8K C;  2H9P A;  3AH8 B;  5EM2 B;  3I8E A;  2CN2 A;  1Q47 A;  1L0Q A;  3EI2 A;  3BWS A;  2H3X A;  2HXC A;  4E5Z B;  3PXT D;  2H6K A;  4JD2 C;  3UKR C;  4K3I D;  4CI2 A;  3V9F A;  1PI6 A;  3L4O D;  5H1M A;  4A11 A;  4ES0 A;  5IJ7 E;  3SBR A;  2AH1 A;  3JB9 L;  3JRP A;  2MTA H;  4LG9 A;  2CN3 A;  2IUP A;  4GM3 A;  4O9D A;  3CFS B;  5HE3 B;  3DSM A;  1SHY B;  4H5J A;  4FAN D;  3C75 H;  2OVR B;  4U7A A;  4J81 A;  2H14 A;  4J73 A;  2PM7 B;  2P9S C;  4J77 A;  3C99 A;  3SLE D;  2CE9 A;  4R7A B;  4H5I A;  3ULE C;  1OLZ A;  2YNO A;  2P9L C;  3SXT D;  5K1C C;  2H47 A;  1JOF A;  1GP2 B;  4E54 B;  5HQG A;  4O45 A;  4PC0 A;  3RRM C;  5IT9 g;  4J78 A;  2H6N A;  3AL9 A;  5FKT A;  1MG2 A;  3FM0 A;  1K32 A;  3AL8 B;  4X60 B;  4PBZ A;  4J8B A;  3PSL A;  4A2L A;  4FHL A;  1XKS A;  4ESG A;  1N6F A;  5TEF A;  4PNK B;  4BL0 A;  1MDA H;  3ORV D;  2TRC B;  2XYI A;  5AFU 3;  4JT6 C;  3GRE A;  3OL2 B;  3EG6 A;  3F3P A;  2Z2N A;  3A0F A;  5HE1 B;  2EBS A;  4A08 B;  1N6E A;  3N0E A;  3C5M A;  3IIY A;  5FXY A;  3I7K A;  4G56 B;  5IC7 A;  3U4Y A;  3SCY A;  2XL2 A;  4L1Q D;  4CY2 A;  5FA5 B;  3ODT A;  2IAA A;  1VYH C;  4J82 A;  3EI1 B;  2IUV A;  4LG8 A;  4JSN C;  3PVU B;  2P9P C;  3UVM A;  3EI4 B;  3I7N A;  5IGQ A;  5FLX g;  2YBA A;  2PM9 A;  5EMJ B;  4K3J B;  5I5I A;  3J81 g;  2P9N C;  4TZ4 A;  3NVX A;  1A0R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...