5TDHB

The crystal structure of the dominant negative mutant g protein alpha(i)-1-beta-1-gamma-2 g203a/a326s
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
342
structure length
339
Chain Sequence
SAMSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1
publication title The structural basis of the dominant negative phenotype of the G alpha i1 beta 1 gamma 2 G203A/A326S heterotrimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 102
structure length 339
sequence length 342
chains with identical sequence J
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5tdhB00
4E54B 4O3UB 2YBAA 5IGOA 3RMZD 2QC5A 3PSCB 4GGCA 5SXMA 3OL2B 5EMKB 4E54A 5EMLB 4BUJC 4QQEA 5FQDA 2QXVA 2H14A 4JSPC 1MG2A 4JXMA 1GXRA 5H14A 3RRMC 4GGAA 4MK0B 4J84A 3VH0A 2HKMA 2P9PC 3AL8A 3C99A 3IKOA 2OJYA 2O9KA 3K26A 5KDOB 4FAND 2YNOA 1OLZA 3JB9L 3IJ1A 4J77A 2HJ4A 3RN0D 3CIKB 3I7HA 3I89A 2AH0A 3SCYA 5EARA 3F3GA 4JSVC 4QRJA 4CY3A 4G56B 4U1EI 4O3TB 4CZYA 1ERJA 4J86A 4J81A 3J81g 3DXMC 2CN2A 4CI2A 2I3SA 2YNNA 5I5IA 5I5JA 4CY1A 3UR4A 2TRCB 2EBSA 4O45A 1L0QA 1PEVA 4L3GD 4QL1A 3ODTA 2IUPA 2J57G 3EI4A 2IURA 3GREA 1SQ9A 1N6DA 4ZOXA 2YNPA 3ZWLB 3JZHA 3OKYA 3OTTA 4Z8LA 3FM0A 4X63B 1TYQC 5C2VB 3L4OD 3E0CA 5TDHB 2IWFA 3J80g 4FB1D 2PBIB 5C2WB 2UZXB 2GC7A 3AH8B 3I7LA 3IJ0A 4BH6A 3K27A 3C9CA 2IUQA 3JAMg 1MG3A 3BG0A 3SHFA 4YVDA 3V5WB 1QNIA 4A0BB 4IA9A 5CYKB 4FHLA 4CI3A 2IAAA 5TEFA 4LG8A 4ZOZA 3DWLC 4QT8A 4J73A 2HYEA 5TF2A 4CY2A 4A0BA 2PM7B 1N6EA 1GP2B 4L3HD 4A2LA 4EWRA 3MZKA 4A0AA 3I8CA 1PBYB 3MKSB 5THAA 4J79A 3L4MD 2OVRB 4LG9A 5GSAA 5GXHA 3CFVA 2BBKH 1GG2B 2H47A 4PNKB 3SN6B 2P9LC 4J8GA 5EAMA 5JWZA 3OL2A 2MTAH 2XL2A 2YMUA 4J78A 1NEXB 5CXCB 2B5LA 2HKRA 2I0RA 5K19A 4GZ8A 3F3FA 4A08B 3JROA 3JRPA 4Y5RD 3UVNA 5CXCA 1PGUA 2H9MA 3SWSD 3JZNA 1GOTB 5FKQA 1JMZB 1S4UX 1N6FA 5TEEA 3W15A 2Z2OA 1JOFA 4X3EA 4FA4D 2P9KC 1OMWB 2Q7QA 2AGXA 4ZOYA 5GXIA 5I5MA 4GM9A 3SBRA 4GQ2P 4JT6C 2HESX 3SVWD 3I8EA 2PM6B 1K32A 2H6KA 4BL0A 4PSXB 5IGQA 3C75H 3AFCA 4J8BA 4PC0A 4TZ4A 3EU7A 1SQJA 3NVXA 3EI3B 4A11B 2CO0A 4E5ZB 5EMMB 4GM3A 3I7NA 3RN1D 2H6QA 3HFQA 2IWKA 2J56H 5IT9g 3EMHA 3FRXA 4A11A 3UVMA 2H9LA 4ERZA 3VA6A 2I0TA 1TBGA 2OVQB 4ERQA 4ESGA 3OKWA 3EI1B 4K3JB 4UI9R 2CNXA 4LGNA 4JT5C 4O1QD 4I79A 4JD2C 1Q47A 5HQGA 3PXTD 4PBZA 3CFSB 3N0DA 3MMYA 3PVUB 5AFU3 1A0RB 4PXWA 4FA1D 2PM9B 4A09B 2H9PA 5C9ZB 2CE9A 4FAVD 5A2Qg 4HDJA 2IUVA 1P22A 2H6NA 5CXBB 1VYHC 3SBPA 2OVPB 4CC9A 3UKUC 1SHYB 2PM9A 4A09A 5CYKA 2H9NA 2I3TA 2W18A 3I7PA 5CXBA 2AH1A 2XYIA 5HE2B 1B9XA 4XEIC 3EI2B 1U2VC 3JPXA 2Z2NA 3MXXA 4OZUA 5FKRA 3NVQA 3I2NA 4PBYA 2P9IC 5FKSA 4GQ1A 5EMJB 1RI6A 4FA5D 3A0FA 2AGLA 1XIPA 4L9OA 5H17A 4OWRA 3U4YA 3KRXB 5FKTA 4Y7RA 4ZOVA 2OK4A 3DXKC 4U7AA 4J0XA 5IC7A 1PI6A 3JZGA 2AGZA 4CZVA 2UZYB 3OKTA 3RFHA 2BCJB 5GMKn 4A2MA 4D6VA 4ERYA 5EM2B 3RLMD 2AGYA 5H1MA 3IIYA 3I7KA 3PE7A 3C5MA 4CI8A 3V7DB 3SBQA 2Z2PA 2H68A 4K3ID 4JSXC 4ZN4A 3AL8B 2AGWA 5EM2A 4PSWB 4XYHA 3F3PA 4ES0A 4J82A 3V9FA 4GM8A 4X60B 4A08A 3UVOA 5HYNB 4FWWA 2OK6A 3P4FA 1U4CA 3SJLD 3VGZA 2P9NC 4NSXA 3RFGA 3ULEC 3UKRC 2GC4A 3SXTD 3NVNA 4FA9D 2AQ5A 3MZLA 3BWSA 5AJAA 1B9YA 4O9DA 5IJ7E 2H13A 4CZXA 1JMXB 4AEZA 4L1QD 2CE8A 4KFMB 2P9SC 3UVKA 3B7FA 2CN3A 3PSLA 5FXYA 4A7JA 2XL3A 1K8KC 2G9AA 2GNQA 5K1CC 3EWEA 3PVWB 1XKSA 3UVLA 3EI4B 2YB8B 5HE1B 2B4EA 3EI3A 4J0WA 2B5NA 5HE3B 1FWXA 5EAPA 4E5ZA 3DM0A 1XHMA 3FGBA 3OKYB 3PXWD 4IMMA 4CY5A 3SMRA 5AMSA 4X61B 3I7OA 4GQBB 3EI1A 3ORVD 4D0KA 2HXCA 2G99A 2B5MA 3RSEC 1YFQA 3OW8A 3BG1A 5FA5B 1NR0A 1JJUB 4H5JA 2OIZA 2HJBA 4JSNC 3SLED 5FLXg 3AL9A 4N14A 5EALA 4CI1A 2XU7A 4H5IA 1R5MA 3SFZA 3KRWB 2P9UC 4AOWA 3DSMA 4GMBA 5B4WA 3N0EA 5HE0B 3EI2A 4A0AB 3IJCA 2I0SA 4GGDA 4R7AB 2J55H 5IJ8E 4J87A 2H3XA 3GFCA 3EG6A 3IIWA 1MDAH 3MKQA 3PXSD 4XYIA 2CO0C
chains in the Genus database with same CATH superfamily
4E54B 4O3UB 2YBAA 2VDMA 1YR2A 5IGOA 3RMZD 2QC5A 3PSCB 4GGCA 4BP8A 5SXMA 3MUOA 3OL2B 3IUQA 5EMKB 5EMLB 4E54A 2VDPA 1U8CA 4BUJC 4QQEA 5FQDA 2QXVA 3ZE1A 2H14A 4JSPC 1MG2A 1C9IA 4JXMA 3K6SA 1GXRA 5H14A 3RRMC 4GGAA 4MK0B 4UM9A 4J84A 3VH0A 2HKMA 2P9PC 3AL8A 3C99A 3IKOA 3QHYB 2OJYA 2O9KA 3K26A 5KDOB 4FAND 2YNOA 3KCIA 1E8NA 1OLZA 4MMYA 3JB9L 3IJ1A 4J77A 4JHNA 2HJ4A 3RN0D 3CIKB 5E6UA 3I7HA 3I89A 4WK0A 2AH0A 3SCYA 5EARA 3F3GA 4JSVC 4QRJA 4CY3A 4G56B 4U1EI 4O3TB 4CZYA 1VZ3A 1ERJA 4J86A 4J81A 3ZDZA 3J81g 3DXMC 2CN2A 4CI2A 4DNUA 2I3SA 1O6FA 2YNNA 5I5IA 5I5JA 4CY1A 3UR4A 2TRCB 2EBSA 4O45A 3O4JA 1L0QA 1PEVA 4L3GD 4QL1A 3QI0A 3ODTA 3EQ8A 4MMXA 3O4GA 3VI4A 2IUPA 2J57G 3EI4A 2IURA 3GREA 1SQ9A 4NC4A 1N6DA 1UOPA 4ZOXA 4Z7NA 2YNPA 3ZWLB 1BPOA 3JZHA 1UOQA 3OKYA 3OTTA 4Z8LA 3FM0A 4X63B 4BP9A 1H2XA 1TYQC 1QFSA 5C2VB 3L4OD 3E0CA 5TDHB 2IWFA 3J80g 4FB1D 1E5TA 2PBIB 5C2WB 2HU7A 2GC7A 2UZXB 3AH8B 3T3MA 3I7LA 2VDRA 3IJ0A 4DNWA 1M1XA 4BH6A 3K27A 3C9CA 2IUQA 1O6GA 3JAMg 1MG3A 3BG0A 3SHFA 4YVDA 3V5WB 1QNIA 4A0BB 4IA9A 5CYKB 3IUNA 4FHLA 4CI3A 2IAAA 5TEFA 4LG8A 3ZE0A 4ZOZA 1GOFA 3DWLC 4QT8A 4J73A 2HYEA 5TF2A 4CY2A 4A0BA 2PM7B 2EICA 1N6EA 4O2WA 1GP2B 4L3HD 4A2LA 3ZDXA 4EWRA 3MZKA 4A0AA 3NIDA 3I8CA 1PBYB 3MKSB 1H2WA 3GC3B 2EIBA 5THAA 4J79A 3L4MD 3IURA 4G55A 2OVRB 4LG9A 5GSAA 4WK2A 1GOGA 5GXHA 3CFVA 2BBKH 1GG2B 2H47A 3MUNA 4PNKB 3SN6B 2P9LC 4J8GA 5EAMA 5JWZA 3OL2A 2MTAH 2XL2A 2YMUA 4J78A 1NEXB 5CXCB 2B5LA 2HKRA 2I0RA 4JHPC 5K19A 4GZ8A 3F3FA 4A08B 3JROA 3JRPA 4Y5RD 3UVNA 2VDNA 5CXCA 1PGUA 2H9MA 5FFGA 3JZNA 3SWSD 1VZ2A 3NIGA 1GOTB 5FKQA 1JMZB 1S4UX 3K71A 2WQ8A 3IUJA 1N6FA 5TEEA 2VZ1A 3W15A 2Z2OA 1JV2A 3K72A 1JOFA 1UOOA 4X3EA 4FA4D 1QFMA 2P9KC 1OMWB 2Q7QA 2AGXA 2VDLA 4ZOYA 5GXIA 5I5MA 2JKXA 4BCDA 4GM9A 3SBRA 4GQ2P 4AN1A 4JT6C 2EIDA 2HESX 3SVWD 3I8EA 5C86A 2PM6B 1K32A 4QAMA 2H6KA 1GOHA 4BL0A 2QZPA 4PSXB 5IGQA 3C75H 3AFCA 4J8BA 4PC0A 4TZ4A 3EU7A 1A12A 1SQJA 3NVXA 3EI3B 4A11B 2CO0A 4WK4A 1T2XA 4E5ZB 5EMMB 4GM3A 3NIFA 3I7NA 2QR5A 2VDKA 3RN1D 2H6QA 3HFQA 2IWKA 2J56H 5IT9g 3EMHA 3FRXA 3IUMA 4A11A 3UVMA 2H9LA 4ERZA 3VA6A 2I0TA 1TBGA 2OVQB 4ERQA 4ESGA 3OKWA 3EI1B 4K3JB 4UI9R 2CNXA 4LGNA 2XZGA 4JT5C 4O1QD 4I79A 4JD2C 1Q47A 5HQGA 3PXTD 2EIEA 4PBZA 3CFSB 3IULA 3MMYA 2HU8A 1TYEA 3N0DA 3PVUB 3ZE2A 4Z7OA 4RE6A 5AFU3 1A0RB 4PXWA 4UM8A 4FA1D 5M5UA 1L5GA 3FCSA 2PM9B 4A09B 2H9PA 5C9ZB 2CE9A 5E6SA 4FAVD 5A2Qg 4HDJA 2IUVA 1P22A 2H6NA 5CXBB 1VE6A 1VYHC 3SBPA 2OVPB 4CC9A 3UKUC 3FCUA 1SHYB 2PM9A 4A09A 5CYKA 4MMZA 2H9NA 2I3TA 2W18A 1VE7A 3I7PA 3OF7A 5CXBA 2AH1A 2XYIA 5HE2B 1B9XA 4XEIC 3EI2B 1U2VC 4BCBA 3VI3A 4AMYA 3JPXA 2Z2NA 3MXXA 4OZUA 5FKRA 3NVQA 1H2ZA 3I2NA 4PBYA 2P9IC 1E8MA 5FKSA 4GQ1A 5EMJB 3EQ7A 1RI6A 4FA5D 3A0FA 3DDUA 2AGLA 3ZDYA 2HU5A 1XIPA 4L9OA 5H17A 4OWRA 3U4YA 3KRXB 5M5VA 5FKTA 4BCCA 3MVDK 4Y7RA 4ZOVA 2OK4A 3DXKC 4U7AA 4D9SA 4J0XA 5IC7A 5C92A 1PI6A 3V4PA 3JZGA 2AGZA 4NENA 2BKLA 2UZYB 4CZVA 3OKTA 3RFHA 2BCJB 5GMKn 4A2MA 4D6VA 4ERYA 5EM2B 2XDWA 3RLMD 2AGYA 5H1MA 1I2MB 3IIYA 3I7KA 3PE7A 2VC2A 2XE4A 4O02A 3C5MA 4CI8A 3V7DB 3SBQA 4AN0A 2Z2PA 2H68A 4K3ID 4JSXC 4ZN4A 3AL8B 2AGWA 3IVMA 5EM2A 4PSWB 4XYHA 3F3PA 4ES0A 4J82A 3V9FA 4GM8A 4X60B 4A08A 4NAAA 3UVOA 5HYNB 4FWWA 2OK6A 4Z7QA 3P4FA 1U4CA 3SJLD 3VGZA 4L1MA 2P9NC 4NSXA 3RFGA 3ULEC 3UKRC 1C9LA 2GC4A 3SXTD 3NVNA 4FA9D 2AQ5A 3MZLA 3BWSA 5AJAA 5FFOA 1B9YA 4O9DA 5IJ7E 2H13A 4CZXA 1JMXB 5M5TA 4AEZA 2VDOA 2CE8A 4L1QD 4KFMB 3V4VA 2VDQA 2P9SC 3UVKA 3B7FA 2CN3A 3PSLA 5E6RA 5FXYA 4A7JA 2XL3A 1K8KC 4AX4A 2G9AA 2GNQA 5K1CC 3EWEA 3PVWB 1XKSA 3UVLA 4DNVA 3EI4B 2YB8B 5HE1B 2B4EA 4IRZA 3EI3A 4J0WA 2B5NA 5HE3B 1FWXA 5HDBA 5EAPA 3IJEA 3DM0A 4E5ZA 1XHMA 3FGBA 3OKYB 3PXWD 4IMMA 4CY5A 3SMRA 1JTDB 5AMSA 4X61B 3I7OA 4GQBB 3EI1A 3ORVD 3O4HA 2HXCA 4D0KA 2G99A 3O4IA 2B5MA 3RSEC 1YFQA 3OW8A 3BG1A 5FA5B 4AMZA 1NR0A 1K3IA 1JJUB 4H5JA 2OIZA 4RE5A 2HJBA 4G1EA 4JSNC 3SLED 5FLXg 4G1MA 3AL9A 4N14A 5EALA 3GD1I 1H2YA 4CI1A 2VZ3A 2XU7A 1UTCA 4H5IA 5M5SA 1R5MA 3SFZA 3KRWB 2P9UC 4AOWA 3DSMA 4GMBA 5M61A 5B4WA 3EQ9A 3N0EA 5HE0B 3EI2A 4A0AB 3IJCA 2I0SA 4GGDA 4R7AB 2J55H 5IJ8E 4WJKA 4J87A 2H3XA 3GFCA 3EG6A 4NBMA 3IIWA 1MDAH 5M5RA 3T3PA 3MKQA 3PXSD 4XYIA 2CO0C
chains in the Genus database with same CATH topology
4E54B 4O3UB 2YBAA 5IGOA 3RMZD 2QC5A 3PSCB 4GGCA 5SXMA 3OL2B 5EMKB 4E54A 5EMLB 4BUJC 4QQEA 5FQDA 2QXVA 2H14A 4JSPC 1MG2A 4JXMA 1GXRA 5H14A 3RRMC 4GGAA 4MK0B 4J84A 3VH0A 2HKMA 2P9PC 3AL8A 3C99A 3IKOA 2OJYA 2O9KA 3K26A 5KDOB 4FAND 2YNOA 1OLZA 3JB9L 3IJ1A 4J77A 2HJ4A 3RN0D 3CIKB 3I7HA 3I89A 2AH0A 3SCYA 5EARA 3F3GA 4JSVC 4QRJA 4CY3A 4G56B 4U1EI 4O3TB 4CZYA 1ERJA 4J86A 4J81A 3J81g 3DXMC 2CN2A 4CI2A 2I3SA 2YNNA 5I5IA 5I5JA 4CY1A 3UR4A 2TRCB 2EBSA 4O45A 1L0QA 1PEVA 4L3GD 4QL1A 3ODTA 2IUPA 2J57G 3EI4A 2IURA 3GREA 1SQ9A 1N6DA 4ZOXA 2YNPA 3ZWLB 3JZHA 3OKYA 3OTTA 4Z8LA 3FM0A 4X63B 1TYQC 5C2VB 3L4OD 3E0CA 5TDHB 2IWFA 3J80g 4FB1D 2PBIB 5C2WB 2UZXB 2GC7A 3AH8B 3I7LA 3IJ0A 4BH6A 3K27A 3C9CA 2IUQA 3JAMg 1MG3A 3BG0A 3SHFA 4YVDA 3V5WB 1QNIA 4A0BB 4IA9A 5CYKB 4FHLA 4CI3A 2IAAA 5TEFA 4LG8A 4ZOZA 3DWLC 4QT8A 4J73A 2HYEA 5TF2A 4CY2A 4A0BA 2PM7B 1N6EA 1GP2B 4L3HD 4A2LA 4EWRA 3MZKA 4A0AA 3I8CA 1PBYB 3MKSB 5THAA 4J79A 3L4MD 2OVRB 4LG9A 5GSAA 5GXHA 3CFVA 2BBKH 1GG2B 2H47A 4PNKB 3SN6B 2P9LC 4J8GA 5EAMA 5JWZA 3OL2A 2MTAH 2XL2A 2YMUA 4J78A 1NEXB 5CXCB 2B5LA 2HKRA 2I0RA 5K19A 4GZ8A 3F3FA 4A08B 3JROA 3JRPA 4Y5RD 3UVNA 5CXCA 1PGUA 2H9MA 3SWSD 3JZNA 1GOTB 5FKQA 1JMZB 1S4UX 1N6FA 5TEEA 3W15A 2Z2OA 1JOFA 4X3EA 4FA4D 2P9KC 1OMWB 2Q7QA 2AGXA 4ZOYA 5GXIA 5I5MA 4GM9A 3SBRA 4GQ2P 4JT6C 2HESX 3SVWD 3I8EA 2PM6B 1K32A 2H6KA 4BL0A 4PSXB 5IGQA 3C75H 3AFCA 4J8BA 4PC0A 4TZ4A 3EU7A 1SQJA 3NVXA 3EI3B 4A11B 2CO0A 4E5ZB 5EMMB 4GM3A 3I7NA 3RN1D 2H6QA 3HFQA 2IWKA 2J56H 5IT9g 3EMHA 3FRXA 4A11A 3UVMA 2H9LA 4ERZA 3VA6A 2I0TA 1TBGA 2OVQB 4ERQA 4ESGA 3OKWA 3EI1B 4K3JB 4UI9R 2CNXA 4LGNA 4JT5C 4O1QD 4I79A 4JD2C 1Q47A 5HQGA 3PXTD 4PBZA 3CFSB 3N0DA 3MMYA 3PVUB 5AFU3 1A0RB 4PXWA 4FA1D 2PM9B 4A09B 2H9PA 5C9ZB 2CE9A 4FAVD 5A2Qg 4HDJA 2IUVA 1P22A 2H6NA 5CXBB 1VYHC 3SBPA 2OVPB 4CC9A 3UKUC 1SHYB 2PM9A 4A09A 5CYKA 2H9NA 2I3TA 2W18A 3I7PA 5CXBA 2AH1A 2XYIA 5HE2B 1B9XA 4XEIC 3EI2B 1U2VC 3JPXA 2Z2NA 3MXXA 4OZUA 5FKRA 3NVQA 3I2NA 4PBYA 2P9IC 5FKSA 4GQ1A 5EMJB 1RI6A 4FA5D 3A0FA 2AGLA 1XIPA 4L9OA 5H17A 4OWRA 3U4YA 3KRXB 5FKTA 4Y7RA 4ZOVA 2OK4A 3DXKC 4U7AA 4J0XA 5IC7A 1PI6A 3JZGA 2AGZA 4CZVA 2UZYB 3OKTA 3RFHA 2BCJB 5GMKn 4A2MA 4D6VA 4ERYA 5EM2B 3RLMD 2AGYA 5H1MA 3IIYA 3I7KA 3PE7A 3C5MA 4CI8A 3V7DB 3SBQA 2Z2PA 2H68A 4K3ID 4JSXC 4ZN4A 3AL8B 2AGWA 5EM2A 4PSWB 4XYHA 3F3PA 4ES0A 4J82A 3V9FA 4GM8A 4X60B 4A08A 3UVOA 5HYNB 4FWWA 2OK6A 3P4FA 1U4CA 3SJLD 3VGZA 2P9NC 4NSXA 3RFGA 3ULEC 3UKRC 2GC4A 3SXTD 3NVNA 4FA9D 2AQ5A 3MZLA 3BWSA 5AJAA 1B9YA 4O9DA 5IJ7E 2H13A 4CZXA 1JMXB 4AEZA 4L1QD 2CE8A 4KFMB 2P9SC 3UVKA 3B7FA 2CN3A 3PSLA 5FXYA 4A7JA 2XL3A 1K8KC 2G9AA 2GNQA 5K1CC 3EWEA 3PVWB 1XKSA 3UVLA 3EI4B 2YB8B 5HE1B 2B4EA 3EI3A 4J0WA 2B5NA 5HE3B 1FWXA 5EAPA 4E5ZA 3DM0A 1XHMA 3FGBA 3OKYB 3PXWD 4IMMA 4CY5A 3SMRA 5AMSA 4X61B 3I7OA 4GQBB 3EI1A 3ORVD 4D0KA 2HXCA 2G99A 2B5MA 3RSEC 1YFQA 3OW8A 3BG1A 5FA5B 1NR0A 1JJUB 4H5JA 2OIZA 2HJBA 4JSNC 3SLED 5FLXg 3AL9A 4N14A 5EALA 4CI1A 2XU7A 4H5IA 1R5MA 3SFZA 3KRWB 2P9UC 4AOWA 3DSMA 4GMBA 5B4WA 3N0EA 5HE0B 3EI2A 4A0AB 3IJCA 2I0SA 4GGDA 4R7AB 2J55H 5IJ8E 4J87A 2H3XA 3GFCA 3EG6A 3IIWA 1MDAH 3MKQA 3PXSD 4XYIA 2CO0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E54 B;  4O3U B;  2YBA A;  5IGO A;  3RMZ D;  2QC5 A;  3PSC B;  4GGC A;  5SXM A;  3OL2 B;  5EMK B;  4E54 A;  5EML B;  4BUJ C;  4QQE A;  5FQD A;  2QXV A;  2H14 A;  4JSP C;  1MG2 A;  4JXM A;  1GXR A;  5H14 A;  3RRM C;  4GGA A;  4MK0 B;  4J84 A;  3VH0 A;  2HKM A;  2P9P C;  3AL8 A;  3C99 A;  3IKO A;  2OJY A;  2O9K A;  3K26 A;  5KDO B;  4FAN D;  2YNO A;  1OLZ A;  3JB9 L;  3IJ1 A;  4J77 A;  2HJ4 A;  3RN0 D;  3CIK B;  3I7H A;  3I89 A;  2AH0 A;  3SCY A;  5EAR A;  3F3G A;  4JSV C;  4QRJ A;  4CY3 A;  4G56 B;  4U1E I;  4O3T B;  4CZY A;  1ERJ A;  4J86 A;  4J81 A;  3J81 g;  3DXM C;  2CN2 A;  4CI2 A;  2I3S A;  2YNN A;  5I5I A;  5I5J A;  4CY1 A;  3UR4 A;  2TRC B;  2EBS A;  4O45 A;  1L0Q A;  1PEV A;  4L3G D;  4QL1 A;  3ODT A;  2IUP A;  2J57 G;  3EI4 A;  2IUR A;  3GRE A;  1SQ9 A;  1N6D A;  4ZOX A;  2YNP A;  3ZWL B;  3JZH A;  3OKY A;  3OTT A;  4Z8L A;  3FM0 A;  4X63 B;  1TYQ C;  5C2V B;  3L4O D;  3E0C A;  5TDH B;  2IWF A;  3J80 g;  4FB1 D;  2PBI B;  5C2W B;  2UZX B;  2GC7 A;  3AH8 B;  3I7L A;  3IJ0 A;  4BH6 A;  3K27 A;  3C9C A;  2IUQ A;  3JAM g;  1MG3 A;  3BG0 A;  3SHF A;  4YVD A;  3V5W B;  1QNI A;  4A0B B;  4IA9 A;  5CYK B;  4FHL A;  4CI3 A;  2IAA A;  5TEF A;  4LG8 A;  4ZOZ A;  3DWL C;  4QT8 A;  4J73 A;  2HYE A;  5TF2 A;  4CY2 A;  4A0B A;  2PM7 B;  1N6E A;  1GP2 B;  4L3H D;  4A2L A;  4EWR A;  3MZK A;  4A0A A;  3I8C A;  1PBY B;  3MKS B;  5THA A;  4J79 A;  3L4M D;  2OVR B;  4LG9 A;  5GSA A;  5GXH A;  3CFV A;  2BBK H;  1GG2 B;  2H47 A;  4PNK B;  3SN6 B;  2P9L C;  4J8G A;  5EAM A;  5JWZ A;  3OL2 A;  2MTA H;  2XL2 A;  2YMU A;  4J78 A;  1NEX B;  5CXC B;  2B5L A;  2HKR A;  2I0R A;  5K19 A;  4GZ8 A;  3F3F A;  4A08 B;  3JRO A;  3JRP A;  4Y5R D;  3UVN A;  5CXC A;  1PGU A;  2H9M A;  3SWS D;  3JZN A;  1GOT B;  5FKQ A;  1JMZ B;  1S4U X;  1N6F A;  5TEE A;  3W15 A;  2Z2O A;  1JOF A;  4X3E A;  4FA4 D;  2P9K C;  1OMW B;  2Q7Q A;  2AGX A;  4ZOY A;  5GXI A;  5I5M A;  4GM9 A;  3SBR A;  4GQ2 P;  4JT6 C;  2HES X;  3SVW D;  3I8E A;  2PM6 B;  1K32 A;  2H6K A;  4BL0 A;  4PSX B;  5IGQ A;  3C75 H;  3AFC A;  4J8B A;  4PC0 A;  4TZ4 A;  3EU7 A;  1SQJ A;  3NVX A;  3EI3 B;  4A11 B;  2CO0 A;  4E5Z B;  5EMM B;  4GM3 A;  3I7N A;  3RN1 D;  2H6Q A;  3HFQ A;  2IWK A;  2J56 H;  5IT9 g;  3EMH A;  3FRX A;  4A11 A;  3UVM A;  2H9L A;  4ERZ A;  3VA6 A;  2I0T A;  1TBG A;  2OVQ B;  4ERQ A;  4ESG A;  3OKW A;  3EI1 B;  4K3J B;  4UI9 R;  2CNX A;  4LGN A;  4JT5 C;  4O1Q D;  4I79 A;  4JD2 C;  1Q47 A;  5HQG A;  3PXT D;  4PBZ A;  3CFS B;  3N0D A;  3MMY A;  3PVU B;  5AFU 3;  1A0R B;  4PXW A;  4FA1 D;  2PM9 B;  4A09 B;  2H9P A;  5C9Z B;  2CE9 A;  4FAV D;  5A2Q g;  4HDJ A;  2IUV A;  1P22 A;  2H6N A;  5CXB B;  1VYH C;  3SBP A;  2OVP B;  4CC9 A;  3UKU C;  1SHY B;  2PM9 A;  4A09 A;  5CYK A;  2H9N A;  2I3T A;  2W18 A;  3I7P A;  5CXB A;  2AH1 A;  2XYI A;  5HE2 B;  1B9X A;  4XEI C;  3EI2 B;  1U2V C;  3JPX A;  2Z2N A;  3MXX A;  4OZU A;  5FKR A;  3NVQ A;  3I2N A;  4PBY A;  2P9I C;  5FKS A;  4GQ1 A;  5EMJ B;  1RI6 A;  4FA5 D;  3A0F A;  2AGL A;  1XIP A;  4L9O A;  5H17 A;  4OWR A;  3U4Y A;  3KRX B;  5FKT A;  4Y7R A;  4ZOV A;  2OK4 A;  3DXK C;  4U7A A;  4J0X A;  5IC7 A;  1PI6 A;  3JZG A;  2AGZ A;  4CZV A;  2UZY B;  3OKT A;  3RFH A;  2BCJ B;  5GMK n;  4A2M A;  4D6V A;  4ERY A;  5EM2 B;  3RLM D;  2AGY A;  5H1M A;  3IIY A;  3I7K A;  3PE7 A;  3C5M A;  4CI8 A;  3V7D B;  3SBQ A;  2Z2P A;  2H68 A;  4K3I D;  4JSX C;  4ZN4 A;  3AL8 B;  2AGW A;  5EM2 A;  4PSW B;  4XYH A;  3F3P A;  4ES0 A;  4J82 A;  3V9F A;  4GM8 A;  4X60 B;  4A08 A;  3UVO A;  5HYN B;  4FWW A;  2OK6 A;  3P4F A;  1U4C A;  3SJL D;  3VGZ A;  2P9N C;  4NSX A;  3RFG A;  3ULE C;  3UKR C;  2GC4 A;  3SXT D;  3NVN A;  4FA9 D;  2AQ5 A;  3MZL A;  3BWS A;  5AJA A;  1B9Y A;  4O9D A;  5IJ7 E;  2H13 A;  4CZX A;  1JMX B;  4AEZ A;  4L1Q D;  2CE8 A;  4KFM B;  2P9S C;  3UVK A;  3B7F A;  2CN3 A;  3PSL A;  5FXY A;  4A7J A;  2XL3 A;  1K8K C;  2G9A A;  2GNQ A;  5K1C C;  3EWE A;  3PVW B;  1XKS A;  3UVL A;  3EI4 B;  2YB8 B;  5HE1 B;  2B4E A;  3EI3 A;  4J0W A;  2B5N A;  5HE3 B;  1FWX A;  5EAP A;  4E5Z A;  3DM0 A;  1XHM A;  3FGB A;  3OKY B;  3PXW D;  4IMM A;  4CY5 A;  3SMR A;  5AMS A;  4X61 B;  3I7O A;  4GQB B;  3EI1 A;  3ORV D;  4D0K A;  2HXC A;  2G99 A;  2B5M A;  3RSE C;  1YFQ A;  3OW8 A;  3BG1 A;  5FA5 B;  1NR0 A;  1JJU B;  4H5J A;  2OIZ A;  2HJB A;  4JSN C;  3SLE D;  5FLX g;  3AL9 A;  4N14 A;  5EAL A;  4CI1 A;  2XU7 A;  4H5I A;  1R5M A;  3SFZ A;  3KRW B;  2P9U C;  4AOW A;  3DSM A;  4GMB A;  5B4W A;  3N0E A;  5HE0 B;  3EI2 A;  4A0A B;  3IJC A;  2I0S A;  4GGD A;  4R7A B;  2J55 H;  5IJ8 E;  4J87 A;  2H3X A;  3GFC A;  3EG6 A;  3IIW A;  1MDA H;  3MKQ A;  3PXS D;  4XYI A;  2CO0 C; 
#chains in the Genus database with same CATH topology
 4E54 B;  4O3U B;  2YBA A;  2VDM A;  1YR2 A;  5IGO A;  3RMZ D;  2QC5 A;  3PSC B;  4GGC A;  4BP8 A;  5SXM A;  3MUO A;  3OL2 B;  3IUQ A;  5EMK B;  5EML B;  4E54 A;  2VDP A;  1U8C A;  4BUJ C;  4QQE A;  5FQD A;  2QXV A;  3ZE1 A;  2H14 A;  4JSP C;  1MG2 A;  1C9I A;  4JXM A;  3K6S A;  1GXR A;  5H14 A;  3RRM C;  4GGA A;  4MK0 B;  4UM9 A;  4J84 A;  3VH0 A;  2HKM A;  2P9P C;  3AL8 A;  3C99 A;  3IKO A;  3QHY B;  2OJY A;  2O9K A;  3K26 A;  5KDO B;  4FAN D;  2YNO A;  3KCI A;  1E8N A;  1OLZ A;  4MMY A;  3JB9 L;  3IJ1 A;  4J77 A;  4JHN A;  2HJ4 A;  3RN0 D;  3CIK B;  5E6U A;  3I7H A;  3I89 A;  4WK0 A;  2AH0 A;  3SCY A;  5EAR A;  3F3G A;  4JSV C;  4QRJ A;  4CY3 A;  4G56 B;  4U1E I;  4O3T B;  4CZY A;  1VZ3 A;  1ERJ A;  4J86 A;  4J81 A;  3ZDZ A;  3J81 g;  3DXM C;  2CN2 A;  4CI2 A;  4DNU A;  2I3S A;  1O6F A;  2YNN A;  5I5I A;  5I5J A;  4CY1 A;  3UR4 A;  2TRC B;  2EBS A;  4O45 A;  3O4J A;  1L0Q A;  1PEV A;  4L3G D;  4QL1 A;  3QI0 A;  3ODT A;  3EQ8 A;  4MMX A;  3O4G A;  3VI4 A;  2IUP A;  2J57 G;  3EI4 A;  2IUR A;  3GRE A;  1SQ9 A;  4NC4 A;  1N6D A;  1UOP A;  4ZOX A;  4Z7N A;  2YNP A;  3ZWL B;  1BPO A;  3JZH A;  1UOQ A;  3OKY A;  3OTT A;  4Z8L A;  3FM0 A;  4X63 B;  4BP9 A;  1H2X A;  1TYQ C;  1QFS A;  5C2V B;  3L4O D;  3E0C A;  5TDH B;  2IWF A;  3J80 g;  4FB1 D;  1E5T A;  2PBI B;  5C2W B;  2HU7 A;  2GC7 A;  2UZX B;  3AH8 B;  3T3M A;  3I7L A;  2VDR A;  3IJ0 A;  4DNW A;  1M1X A;  4BH6 A;  3K27 A;  3C9C A;  2IUQ A;  1O6G A;  3JAM g;  1MG3 A;  3BG0 A;  3SHF A;  4YVD A;  3V5W B;  1QNI A;  4A0B B;  4IA9 A;  5CYK B;  3IUN A;  4FHL A;  4CI3 A;  2IAA A;  5TEF A;  4LG8 A;  3ZE0 A;  4ZOZ A;  1GOF A;  3DWL C;  4QT8 A;  4J73 A;  2HYE A;  5TF2 A;  4CY2 A;  4A0B A;  2PM7 B;  2EIC A;  1N6E A;  4O2W A;  1GP2 B;  4L3H D;  4A2L A;  3ZDX A;  4EWR A;  3MZK A;  4A0A A;  3NID A;  3I8C A;  1PBY B;  3MKS B;  1H2W A;  3GC3 B;  2EIB A;  5THA A;  4J79 A;  3L4M D;  3IUR A;  4G55 A;  2OVR B;  4LG9 A;  5GSA A;  4WK2 A;  1GOG A;  5GXH A;  3CFV A;  2BBK H;  1GG2 B;  2H47 A;  3MUN A;  4PNK B;  3SN6 B;  2P9L C;  4J8G A;  5EAM A;  5JWZ A;  3OL2 A;  2MTA H;  2XL2 A;  2YMU A;  4J78 A;  1NEX B;  5CXC B;  2B5L A;  2HKR A;  2I0R A;  4JHP C;  5K19 A;  4GZ8 A;  3F3F A;  4A08 B;  3JRO A;  3JRP A;  4Y5R D;  3UVN A;  2VDN A;  5CXC A;  1PGU A;  2H9M A;  5FFG A;  3JZN A;  3SWS D;  1VZ2 A;  3NIG A;  1GOT B;  5FKQ A;  1JMZ B;  1S4U X;  3K71 A;  2WQ8 A;  3IUJ A;  1N6F A;  5TEE A;  2VZ1 A;  3W15 A;  2Z2O A;  1JV2 A;  3K72 A;  1JOF A;  1UOO A;  4X3E A;  4FA4 D;  1QFM A;  2P9K C;  1OMW B;  2Q7Q A;  2AGX A;  2VDL A;  4ZOY A;  5GXI A;  5I5M A;  2JKX A;  4BCD A;  4GM9 A;  3SBR A;  4GQ2 P;  4AN1 A;  4JT6 C;  2EID A;  2HES X;  3SVW D;  3I8E A;  5C86 A;  2PM6 B;  1K32 A;  4QAM A;  2H6K A;  1GOH A;  4BL0 A;  2QZP A;  4PSX B;  5IGQ A;  3C75 H;  3AFC A;  4J8B A;  4PC0 A;  4TZ4 A;  3EU7 A;  1A12 A;  1SQJ A;  3NVX A;  3EI3 B;  4A11 B;  2CO0 A;  4WK4 A;  1T2X A;  4E5Z B;  5EMM B;  4GM3 A;  3NIF A;  3I7N A;  2QR5 A;  2VDK A;  3RN1 D;  2H6Q A;  3HFQ A;  2IWK A;  2J56 H;  5IT9 g;  3EMH A;  3FRX A;  3IUM A;  4A11 A;  3UVM A;  2H9L A;  4ERZ A;  3VA6 A;  2I0T A;  1TBG A;  2OVQ B;  4ERQ A;  4ESG A;  3OKW A;  3EI1 B;  4K3J B;  4UI9 R;  2CNX A;  4LGN A;  2XZG A;  4JT5 C;  4O1Q D;  4I79 A;  4JD2 C;  1Q47 A;  5HQG A;  3PXT D;  2EIE A;  4PBZ A;  3CFS B;  3IUL A;  3MMY A;  2HU8 A;  1TYE A;  3N0D A;  3PVU B;  3ZE2 A;  4Z7O A;  4RE6 A;  5AFU 3;  1A0R B;  4PXW A;  4UM8 A;  4FA1 D;  5M5U A;  1L5G A;  3FCS A;  2PM9 B;  4A09 B;  2H9P A;  5C9Z B;  2CE9 A;  5E6S A;  4FAV D;  5A2Q g;  4HDJ A;  2IUV A;  1P22 A;  2H6N A;  5CXB B;  1VE6 A;  1VYH C;  3SBP A;  2OVP B;  4CC9 A;  3UKU C;  3FCU A;  1SHY B;  2PM9 A;  4A09 A;  5CYK A;  4MMZ A;  2H9N A;  2I3T A;  2W18 A;  1VE7 A;  3I7P A;  3OF7 A;  5CXB A;  2AH1 A;  2XYI A;  5HE2 B;  1B9X A;  4XEI C;  3EI2 B;  1U2V C;  4BCB A;  3VI3 A;  4AMY A;  3JPX A;  2Z2N A;  3MXX A;  4OZU A;  5FKR A;  3NVQ A;  1H2Z A;  3I2N A;  4PBY A;  2P9I C;  1E8M A;  5FKS A;  4GQ1 A;  5EMJ B;  3EQ7 A;  1RI6 A;  4FA5 D;  3A0F A;  3DDU A;  2AGL A;  3ZDY A;  2HU5 A;  1XIP A;  4L9O A;  5H17 A;  4OWR A;  3U4Y A;  3KRX B;  5M5V A;  5FKT A;  4BCC A;  3MVD K;  4Y7R A;  4ZOV A;  2OK4 A;  3DXK C;  4U7A A;  4D9S A;  4J0X A;  5IC7 A;  5C92 A;  1PI6 A;  3V4P A;  3JZG A;  2AGZ A;  4NEN A;  2BKL A;  2UZY B;  4CZV A;  3OKT A;  3RFH A;  2BCJ B;  5GMK n;  4A2M A;  4D6V A;  4ERY A;  5EM2 B;  2XDW A;  3RLM D;  2AGY A;  5H1M A;  1I2M B;  3IIY A;  3I7K A;  3PE7 A;  2VC2 A;  2XE4 A;  4O02 A;  3C5M A;  4CI8 A;  3V7D B;  3SBQ A;  4AN0 A;  2Z2P A;  2H68 A;  4K3I D;  4JSX C;  4ZN4 A;  3AL8 B;  2AGW A;  3IVM A;  5EM2 A;  4PSW B;  4XYH A;  3F3P A;  4ES0 A;  4J82 A;  3V9F A;  4GM8 A;  4X60 B;  4A08 A;  4NAA A;  3UVO A;  5HYN B;  4FWW A;  2OK6 A;  4Z7Q A;  3P4F A;  1U4C A;  3SJL D;  3VGZ A;  4L1M A;  2P9N C;  4NSX A;  3RFG A;  3ULE C;  3UKR C;  1C9L A;  2GC4 A;  3SXT D;  3NVN A;  4FA9 D;  2AQ5 A;  3MZL A;  3BWS A;  5AJA A;  5FFO A;  1B9Y A;  4O9D A;  5IJ7 E;  2H13 A;  4CZX A;  1JMX B;  5M5T A;  4AEZ A;  2VDO A;  2CE8 A;  4L1Q D;  4KFM B;  3V4V A;  2VDQ A;  2P9S C;  3UVK A;  3B7F A;  2CN3 A;  3PSL A;  5E6R A;  5FXY A;  4A7J A;  2XL3 A;  1K8K C;  4AX4 A;  2G9A A;  2GNQ A;  5K1C C;  3EWE A;  3PVW B;  1XKS A;  3UVL A;  4DNV A;  3EI4 B;  2YB8 B;  5HE1 B;  2B4E A;  4IRZ A;  3EI3 A;  4J0W A;  2B5N A;  5HE3 B;  1FWX A;  5HDB A;  5EAP A;  3IJE A;  3DM0 A;  4E5Z A;  1XHM A;  3FGB A;  3OKY B;  3PXW D;  4IMM A;  4CY5 A;  3SMR A;  1JTD B;  5AMS A;  4X61 B;  3I7O A;  4GQB B;  3EI1 A;  3ORV D;  3O4H A;  2HXC A;  4D0K A;  2G99 A;  3O4I A;  2B5M A;  3RSE C;  1YFQ A;  3OW8 A;  3BG1 A;  5FA5 B;  4AMZ A;  1NR0 A;  1K3I A;  1JJU B;  4H5J A;  2OIZ A;  4RE5 A;  2HJB A;  4G1E A;  4JSN C;  3SLE D;  5FLX g;  4G1M A;  3AL9 A;  4N14 A;  5EAL A;  3GD1 I;  1H2Y A;  4CI1 A;  2VZ3 A;  2XU7 A;  1UTC A;  4H5I A;  5M5S A;  1R5M A;  3SFZ A;  3KRW B;  2P9U C;  4AOW A;  3DSM A;  4GMB A;  5M61 A;  5B4W A;  3EQ9 A;  3N0E A;  5HE0 B;  3EI2 A;  4A0A B;  3IJC A;  2I0S A;  4GGD A;  4R7A B;  2J55 H;  5IJ8 E;  4WJK A;  4J87 A;  2H3X A;  3GFC A;  3EG6 A;  4NBM A;  3IIW A;  1MDA H;  5M5R A;  3T3P A;  3MKQ A;  3PXS D;  4XYI A;  2CO0 C; 
#chains in the Genus database with same CATH homology
 4E54 B;  4O3U B;  2YBA A;  5IGO A;  3RMZ D;  2QC5 A;  3PSC B;  4GGC A;  5SXM A;  3OL2 B;  5EMK B;  4E54 A;  5EML B;  4BUJ C;  4QQE A;  5FQD A;  2QXV A;  2H14 A;  4JSP C;  1MG2 A;  4JXM A;  1GXR A;  5H14 A;  3RRM C;  4GGA A;  4MK0 B;  4J84 A;  3VH0 A;  2HKM A;  2P9P C;  3AL8 A;  3C99 A;  3IKO A;  2OJY A;  2O9K A;  3K26 A;  5KDO B;  4FAN D;  2YNO A;  1OLZ A;  3JB9 L;  3IJ1 A;  4J77 A;  2HJ4 A;  3RN0 D;  3CIK B;  3I7H A;  3I89 A;  2AH0 A;  3SCY A;  5EAR A;  3F3G A;  4JSV C;  4QRJ A;  4CY3 A;  4G56 B;  4U1E I;  4O3T B;  4CZY A;  1ERJ A;  4J86 A;  4J81 A;  3J81 g;  3DXM C;  2CN2 A;  4CI2 A;  2I3S A;  2YNN A;  5I5I A;  5I5J A;  4CY1 A;  3UR4 A;  2TRC B;  2EBS A;  4O45 A;  1L0Q A;  1PEV A;  4L3G D;  4QL1 A;  3ODT A;  2IUP A;  2J57 G;  3EI4 A;  2IUR A;  3GRE A;  1SQ9 A;  1N6D A;  4ZOX A;  2YNP A;  3ZWL B;  3JZH A;  3OKY A;  3OTT A;  4Z8L A;  3FM0 A;  4X63 B;  1TYQ C;  5C2V B;  3L4O D;  3E0C A;  5TDH B;  2IWF A;  3J80 g;  4FB1 D;  2PBI B;  5C2W B;  2UZX B;  2GC7 A;  3AH8 B;  3I7L A;  3IJ0 A;  4BH6 A;  3K27 A;  3C9C A;  2IUQ A;  3JAM g;  1MG3 A;  3BG0 A;  3SHF A;  4YVD A;  3V5W B;  1QNI A;  4A0B B;  4IA9 A;  5CYK B;  4FHL A;  4CI3 A;  2IAA A;  5TEF A;  4LG8 A;  4ZOZ A;  3DWL C;  4QT8 A;  4J73 A;  2HYE A;  5TF2 A;  4CY2 A;  4A0B A;  2PM7 B;  1N6E A;  1GP2 B;  4L3H D;  4A2L A;  4EWR A;  3MZK A;  4A0A A;  3I8C A;  1PBY B;  3MKS B;  5THA A;  4J79 A;  3L4M D;  2OVR B;  4LG9 A;  5GSA A;  5GXH A;  3CFV A;  2BBK H;  1GG2 B;  2H47 A;  4PNK B;  3SN6 B;  2P9L C;  4J8G A;  5EAM A;  5JWZ A;  3OL2 A;  2MTA H;  2XL2 A;  2YMU A;  4J78 A;  1NEX B;  5CXC B;  2B5L A;  2HKR A;  2I0R A;  5K19 A;  4GZ8 A;  3F3F A;  4A08 B;  3JRO A;  3JRP A;  4Y5R D;  3UVN A;  5CXC A;  1PGU A;  2H9M A;  3SWS D;  3JZN A;  1GOT B;  5FKQ A;  1JMZ B;  1S4U X;  1N6F A;  5TEE A;  3W15 A;  2Z2O A;  1JOF A;  4X3E A;  4FA4 D;  2P9K C;  1OMW B;  2Q7Q A;  2AGX A;  4ZOY A;  5GXI A;  5I5M A;  4GM9 A;  3SBR A;  4GQ2 P;  4JT6 C;  2HES X;  3SVW D;  3I8E A;  2PM6 B;  1K32 A;  2H6K A;  4BL0 A;  4PSX B;  5IGQ A;  3C75 H;  3AFC A;  4J8B A;  4PC0 A;  4TZ4 A;  3EU7 A;  1SQJ A;  3NVX A;  3EI3 B;  4A11 B;  2CO0 A;  4E5Z B;  5EMM B;  4GM3 A;  3I7N A;  3RN1 D;  2H6Q A;  3HFQ A;  2IWK A;  2J56 H;  5IT9 g;  3EMH A;  3FRX A;  4A11 A;  3UVM A;  2H9L A;  4ERZ A;  3VA6 A;  2I0T A;  1TBG A;  2OVQ B;  4ERQ A;  4ESG A;  3OKW A;  3EI1 B;  4K3J B;  4UI9 R;  2CNX A;  4LGN A;  4JT5 C;  4O1Q D;  4I79 A;  4JD2 C;  1Q47 A;  5HQG A;  3PXT D;  4PBZ A;  3CFS B;  3N0D A;  3MMY A;  3PVU B;  5AFU 3;  1A0R B;  4PXW A;  4FA1 D;  2PM9 B;  4A09 B;  2H9P A;  5C9Z B;  2CE9 A;  4FAV D;  5A2Q g;  4HDJ A;  2IUV A;  1P22 A;  2H6N A;  5CXB B;  1VYH C;  3SBP A;  2OVP B;  4CC9 A;  3UKU C;  1SHY B;  2PM9 A;  4A09 A;  5CYK A;  2H9N A;  2I3T A;  2W18 A;  3I7P A;  5CXB A;  2AH1 A;  2XYI A;  5HE2 B;  1B9X A;  4XEI C;  3EI2 B;  1U2V C;  3JPX A;  2Z2N A;  3MXX A;  4OZU A;  5FKR A;  3NVQ A;  3I2N A;  4PBY A;  2P9I C;  5FKS A;  4GQ1 A;  5EMJ B;  1RI6 A;  4FA5 D;  3A0F A;  2AGL A;  1XIP A;  4L9O A;  5H17 A;  4OWR A;  3U4Y A;  3KRX B;  5FKT A;  4Y7R A;  4ZOV A;  2OK4 A;  3DXK C;  4U7A A;  4J0X A;  5IC7 A;  1PI6 A;  3JZG A;  2AGZ A;  4CZV A;  2UZY B;  3OKT A;  3RFH A;  2BCJ B;  5GMK n;  4A2M A;  4D6V A;  4ERY A;  5EM2 B;  3RLM D;  2AGY A;  5H1M A;  3IIY A;  3I7K A;  3PE7 A;  3C5M A;  4CI8 A;  3V7D B;  3SBQ A;  2Z2P A;  2H68 A;  4K3I D;  4JSX C;  4ZN4 A;  3AL8 B;  2AGW A;  5EM2 A;  4PSW B;  4XYH A;  3F3P A;  4ES0 A;  4J82 A;  3V9F A;  4GM8 A;  4X60 B;  4A08 A;  3UVO A;  5HYN B;  4FWW A;  2OK6 A;  3P4F A;  1U4C A;  3SJL D;  3VGZ A;  2P9N C;  4NSX A;  3RFG A;  3ULE C;  3UKR C;  2GC4 A;  3SXT D;  3NVN A;  4FA9 D;  2AQ5 A;  3MZL A;  3BWS A;  5AJA A;  1B9Y A;  4O9D A;  5IJ7 E;  2H13 A;  4CZX A;  1JMX B;  4AEZ A;  4L1Q D;  2CE8 A;  4KFM B;  2P9S C;  3UVK A;  3B7F A;  2CN3 A;  3PSL A;  5FXY A;  4A7J A;  2XL3 A;  1K8K C;  2G9A A;  2GNQ A;  5K1C C;  3EWE A;  3PVW B;  1XKS A;  3UVL A;  3EI4 B;  2YB8 B;  5HE1 B;  2B4E A;  3EI3 A;  4J0W A;  2B5N A;  5HE3 B;  1FWX A;  5EAP A;  4E5Z A;  3DM0 A;  1XHM A;  3FGB A;  3OKY B;  3PXW D;  4IMM A;  4CY5 A;  3SMR A;  5AMS A;  4X61 B;  3I7O A;  4GQB B;  3EI1 A;  3ORV D;  4D0K A;  2HXC A;  2G99 A;  2B5M A;  3RSE C;  1YFQ A;  3OW8 A;  3BG1 A;  5FA5 B;  1NR0 A;  1JJU B;  4H5J A;  2OIZ A;  2HJB A;  4JSN C;  3SLE D;  5FLX g;  3AL9 A;  4N14 A;  5EAL A;  4CI1 A;  2XU7 A;  4H5I A;  1R5M A;  3SFZ A;  3KRW B;  2P9U C;  4AOW A;  3DSM A;  4GMB A;  5B4W A;  3N0E A;  5HE0 B;  3EI2 A;  4A0A B;  3IJC A;  2I0S A;  4GGD A;  4R7A B;  2J55 H;  5IJ8 E;  4J87 A;  2H3X A;  3GFC A;  3EG6 A;  3IIW A;  1MDA H;  3MKQ A;  3PXS D;  4XYI A;  2CO0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...