5TDHB

The crystal structure of the dominant negative mutant g protein alpha(i)-1-beta-1-gamma-2 g203a/a326s
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
342
structure length
339
Chain Sequence
SAMSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1
publication title The structural basis of the dominant negative phenotype of the G alpha i1 beta 1 gamma 2 G203A/A326S heterotrimer
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 339
sequence length 342
chains with identical sequence J
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5tdhB00
4J0XA 5CXCA 1XKSA 3L4MD 3KRWB 4UI9R 2IWKA 2J56H 1SHYB 3SBQA 5IGQA 3C99A 3OW8A 5I5IA 1NEXB 1B9XA 3VGZA 5FKTA 4J8GA 2J57G 4ZOXA 5THAA 3UVNA 2H9PA 5C2WB 3JZHA 5HQGA 4FAVD 4Y7RA 3ORVD 4IMMA 4A0AA 2YNNA 2P9IC 3EI1B 4A2MA 2BBKH 4CI2A 1GOTB 4A11A 3BWSA 3CFVA 4A0BA 4ERQA 4R7AB 2I3TA 4L1QD 5FKRA 2HESX 3EI2A 4IA9A 1GXRA 3MMYA 4CC9A 2XL3A 2PBIB 4LG8A 4BH6A 4E54B 2CE8A 1K32A 2Z2OA 3AL9A 3HFQA 4QQEA 1FWXA 4ZOZA 5EM2B 3OKTA 1R5MA 2OIZA 2PM9A 2XU7A 3DM0A 5H17A 4JSPC 4AOWA 4LGNA 3EI1A 2YB8B 4EWRA 5IT9g 2CN3A 4ZOYA 2CO0A 3K26A 3I7KA 2GC7A 4L3HD 1OLZA 3CFSB 2AGYA 5FLXg 3UVLA 2UZXB 4JXMA 4CI3A 3PXTD 3BG1A 3MKSB 3I8CA 4YVDA 2HJ4A 4E54A 2I0SA 3OL2B 4J84A 3PSLA 4A2LA 3C75H 5EAMA 3I7LA 3UVOA 4FAND 2B5MA 2B5NA 2HKMA 1YFQA 3IIYA 4JSNC 2AH0A 4K3ID 4E5ZB 3ODTA 2YBAA 3EMHA 2H9LA 3AL8A 3IKOA 4BUJC 2G9AA 4ERYA 5CXCB 4JT6C 2CNXA 1SQ9A 3EU7A 2AGLA 3EWEA 3U4YA 5FA5B 4GGDA 3NVNA 1XIPA 4CY2A 3OKYA 2PM6B 2OK4A 5HE1B 2CE9A 3P4FA 3IJ0A 3V7DB 1K8KC 4O9DA 3SFZA 4ESGA 2P9LC 3OKWA 4J86A 3EI3B 1B9YA 2H9NA 4J77A 3I89A 4O3TB 3PE7A 4LG9A 2H14A 2HJBA 4GGAA 4A0AB 2IAAA 4FHLA 4O45A 1TBGA 2I0TA 3DWLC 5EARA 5HE3B 5H1MA 5GXHA 4A11B 1U4CA 2AGXA 2Z2PA 5C2VB 4A0BB 3SWSD 2YMUA 1N6EA 5GSAA 4X61B 2OK6A 5I5MA 2MTAH 3RFGA 2O9KA 2UZYB 3EI2B 5TDHB 4CY1A 1L0QA 5EMMB 4GMBA 5AMSA 3NVXA 5I5JA 3ZWLB 3PVUB 3EI3A 3F3FA 4JSXC 4J73A 5EAPA 3J81g 2I0RA 4J82A 4QT8A 2PM9B 2CO0C 3C5MA 4X60B 2QXVA 2B5LA 1MG2A 3UVMA 3I2NA 5HYNB 3F3PA 3BG0A 3IJCA 4CZXA 4FWWA 2AH1A 4JD2C 1JOFA 5AFU3 3UVKA 3SN6B 3UKUC 5AJAA 4ZOVA 5H14A 5C9ZB 4A09B 2QC5A 4X63B 2Q7QA 3JZNA 3SBRA 3SMRA 2W18A 3JZGA 5HE0B 4L9OA 4CY5A 2OJYA 5K19A 4GQ1A 4CY3A 2P9KC 4CZYA 5CYKB 3FGBA 3JRPA 2IUPA 3SJLD 1PBYB 3N0EA 2IUVA 5EMJB 4AEZA 3RN0D 3K27A 3AL8B 1MG3A 3NVQA 5TEEA 4NSXA 2TRCB 4BL0A 5IGOA 2I3SA 4J78A 2YNPA 4A09A 4JT5C 4A08A 3OKYB 5TF2A 3RMZD 3I7HA 3I8EA 3DXKC 4FA5D 3RSEC 3FM0A 5CYKA 3PVWB 4U7AA 3IIWA 3B7FA 3SXTD 3SCYA 3AFCA 4G56B 4X3EA 4MK0B 2PM7B 4GGCA 5FQDA 3A0FA 4Y5RD 4CZVA 3GREA 3VH0A 1JJUB 4GZ8A 3SBPA 3GFCA 4PSXB 3JPXA 3MZKA 3KRXB 2P9NC 2P9PC 4OWRA 4D6VA 1JMXB 4JSVC 5FXYA 2H6QA 4ERZA 4KFMB 4PXWA 2B4EA 2AGWA 5EALA 2HXCA 2G99A 3N0DA 5GMKn 3UKRC 2CN2A 3I7OA 2Z2NA 3F3GA 4GQ2P 4PC0A 1N6FA 1ERJA 2H6NA 2OVRB 4XEIC 2GC4A 2XL2A 2P9SC 1S4UX 5IJ8E 5FKSA 1SQJA 4XYIA 2H3XA 5CXBB 3W15A 1JMZB 3EI4A 3RLMD 3CIKB 1MDAH 2YNOA 1NR0A 5HE2B 4OZUA 1PGUA 4N14A 3IJ1A 3J80g 2HKRA 5GXIA 1PEVA 4HDJA 5JWZA 3RN1D 2AQ5A 4I79A 4ES0A 4CI8A 1U2VC 3EG6A 2H68A 4H5JA 4H5IA 1N6DA 4U1EI 5EMLB 4A08B 5EMKB 5CXBA 3MKQA 2HYEA 1GP2B 2XYIA 4D0KA 5IC7A 3SVWD 3DXMC 3ULEC 1A0RB 3V9FA 4PBZA 5K1CC 4FA1D 1RI6A 4O1QD 4GM8A 5IJ7E 4L3GD 3V5WB 2IURA 2H9MA 4J79A 4QRJA 4K3JB 3JAMg 3L4OD 4PSWB 4GQBB 4FB1D 3I7NA 4J87A 3E0CA 4PBYA 4J0WA 5B4WA 4J81A 3JROA 3RRMC 2H13A 3FRXA 3PXWD 3UR4A 3PXSD 4FA4D 4CI1A 3I7PA 3AH8B 3OTTA 4GM9A 5EM2A 1XHMA 4A7JA 1P22A 1VYHC 4QL1A 2IWFA 2IUQA 3EI4B 2BCJB 1OMWB 5FKQA 5SXMA 3C9CA 5TEFA 4FA9D 3JB9L 2P9UC 4XYHA 3MZLA 2AGZA 2OVPB 4O3UB 2H47A 5KDOB 3VA6A 1Q47A 2OVQB 4GM3A 3DSMA 4ZN4A 3SLED 4J8BA 3MXXA 3OL2A 3PSCB 4PNKB 3SHFA 1PI6A 3RFHA 2H6KA 5A2Qg 1GG2B 4TZ4A 4Z8LA 2EBSA 1QNIA 1TYQC 2GNQA 4E5ZA 2J55H
chains in the Genus database with same CATH superfamily
4UM9A 4J0XA 5CXCA 1XKSA 3L4MD 3KRWB 4UI9R 2IWKA 2J56H 1SHYB 3SBQA 5IGQA 3C99A 3OW8A 5I5IA 1NEXB 4UM8A 1B9XA 3K6SA 3VGZA 4NC4A 5FKTA 5C86A 1E8MA 4J8GA 2J57G 3ZDXA 4ZOXA 5THAA 2VDMA 3UVNA 4JHNA 2EIEA 2H9PA 5C2WB 3JZHA 5HQGA 4FAVD 5E6UA 4Y7RA 3K72A 3ORVD 4IMMA 4A0AA 2YNNA 2P9IC 3EI1B 4A2MA 1A12A 2BBKH 4CI2A 1GOTB 4A11A 3BWSA 3CFVA 2VDOA 2VDKA 4A0BA 4ERQA 4R7AB 2I3TA 3NIDA 2VDRA 4L1QD 5FKRA 2HESX 3EI2A 4IA9A 1GXRA 3MMYA 4CC9A 2XL3A 2PBIB 1VZ3A 2XDWA 4LG8A 4BH6A 4E54B 2CE8A 1K32A 2Z2OA 5M5UA 2QZPA 3AL9A 3HFQA 4QQEA 1FWXA 4ZOZA 5EM2B 3OKTA 1R5MA 2OIZA 2PM9A 2XU7A 3DM0A 1JTDB 5H17A 2XE4A 4JSPC 4AOWA 4DNVA 4Z7QA 4LGNA 3EI1A 2YB8B 4L1MA 4EWRA 5IT9g 2CN3A 4ZOYA 2CO0A 3K26A 3I7KA 4MMXA 2GC7A 4L3HD 1OLZA 3CFSB 2AGYA 5FLXg 3UVLA 2UZXB 4JXMA 4CI3A 3PXTD 3BG1A 3MKSB 3I8CA 4YVDA 1U8CA 2HJ4A 5E6SA 3EQ7A 4DNUA 4E54A 2I0SA 3OL2B 4J84A 3PSLA 4A2LA 3C75H 5EAMA 3I7LA 3UVOA 1VE7A 2B5MA 3QHYB 4FAND 2B5NA 2HKMA 1UTCA 1YFQA 3IIYA 4JSNC 3NIFA 2AH0A 1QFSA 4K3ID 4E5ZB 3ODTA 1VZ2A 2YBAA 3EMHA 2H9LA 3AL8A 3IKOA 4BUJC 2G9AA 4ERYA 5CXCB 4JT6C 2CNXA 1SQ9A 4O02A 3EU7A 2AGLA 3EWEA 3U4YA 5FA5B 4GGDA 3NVNA 1XIPA 4CY2A 3OKYA 2PM6B 3V4VA 2OK4A 5HE1B 2CE9A 3P4FA 3IJ0A 3V7DB 1K8KC 3O4HA 4O9DA 3SFZA 4ESGA 2P9LC 3OKWA 4J86A 3EI3B 1B9YA 2H9NA 4J77A 2HU7A 3I89A 4O3TB 3PE7A 4LG9A 2H14A 2HJBA 3DDUA 4GGAA 4A0AB 2IAAA 4FHLA 4O45A 1TBGA 2I0TA 3DWLC 2EIDA 5EARA 5H1MA 5HE3B 5GXHA 4A11B 1U4CA 2AGXA 2Z2PA 5C2VB 4A0BB 3SWSD 2YMUA 1N6EA 5GSAA 2VC2A 4X61B 2OK6A 1BPOA 4NENA 5I5MA 2MTAH 5FFOA 1T2XA 3RFGA 5M5SA 2O9KA 2UZYB 3IURA 3EI2B 5TDHB 4CY1A 1L0QA 5EMMB 3K71A 4GMBA 5AMSA 3NVXA 3ZE1A 5I5JA 3ZWLB 3GD1I 3PVUB 3EI3A 3F3FA 4JSXC 4J73A 5EAPA 3KCIA 3J81g 2I0RA 4J82A 4QT8A 2PM9B 3NIGA 3VI3A 2CO0C 3C5MA 4X60B 2QXVA 3OF7A 2B5LA 3IVMA 2JKXA 1MG2A 1H2XA 3UVMA 1QFMA 3I2NA 5HYNB 3F3PA 3BG0A 3IJCA 4CZXA 4FWWA 2AH1A 4JD2C 1JOFA 5AFU3 3UVKA 3SN6B 3UKUC 5AJAA 4ZOVA 5H14A 5C9ZB 1C9LA 4A09B 2QC5A 1I2MB 4X63B 2Q7QA 3JZNA 3SBRA 3SMRA 2W18A 3JZGA 5HE0B 4L9OA 4CY5A 2OJYA 5K19A 4GQ1A 4CY3A 2P9KC 4CZYA 3ZE0A 5CYKB 3FGBA 3JRPA 2IUPA 3SJLD 1PBYB 3T3PA 1H2WA 3N0EA 4AN1A 2IUVA 5EMJB 4AEZA 2XZGA 3RN0D 4RE5A 3K27A 3AL8B 1MG3A 3NVQA 5TEEA 4IRZA 3O4IA 4NSXA 5M5TA 2VZ1A 2TRCB 4BL0A 5IGOA 2I3SA 4J78A 2YNPA 3FCSA 4A09A 4JT5C 2VDQA 3IUQA 2HU8A 4A08A 3OKYB 5TF2A 3RMZD 3I7HA 3I8EA 4WK4A 3DXKC 4AX4A 3ZDZA 4FA5D 4G1MA 3RSEC 3FM0A 5CYKA 3PVWB 5M5RA 4U7AA 3IIWA 3MUOA 3B7FA 3SXTD 3SCYA 3AFCA 4G56B 4X3EA 4MK0B 2PM7B 4GGCA 5FQDA 3A0FA 4Y5RD 4CZVA 4DNWA 3GREA 3VH0A 1O6FA 1JJUB 4GZ8A 3SBPA 1JV2A 1K3IA 4AMZA 3GFCA 3IUMA 4PSXB 4MMYA 3JPXA 4BCDA 3MZKA 3KRXB 4Z7OA 2P9NC 2P9PC 4OWRA 4D6VA 1O6GA 4G1EA 4Z7NA 1JMXB 4JSVC 2VDPA 5FXYA 2H6QA 4ERZA 4KFMB 4PXWA 2B4EA 2AGWA 5EALA 3O4JA 2HXCA 2G99A 5FFGA 1GOHA 3N0DA 5GMKn 3UKRC 4MMZA 4AMYA 3EQ9A 2CN2A 1GOGA 4O2WA 3I7OA 2Z2NA 3F3GA 4GQ2P 4PC0A 1N6FA 4WK2A 1ERJA 2H6NA 2OVRB 4XEIC 1H2ZA 2GC4A 2XL2A 2P9SC 1S4UX 4BP9A 5FKSA 1SQJA 4XYIA 2H3XA 5CXBB 3W15A 5IJ8E 1JMZB 3EI4A 3RLMD 3CIKB 1MDAH 1M1XA 2YNOA 3IJEA 1NR0A 3V4PA 5HE2B 4OZUA 1PGUA 4N14A 1UOPA 1E5TA 3IJ1A 3J80g 2HKRA 5GXIA 5C92A 1PEVA 4HDJA 4AN0A 5M61A 5JWZA 3RN1D 2AQ5A 4I79A 4BCBA 4ES0A 4CI8A 1U2VC 3EG6A 4RE6A 2BKLA 2EIBA 2H68A 3QI0A 4H5IA 4H5JA 5M5VA 1N6DA 4U1EI 5EMLB 4BP8A 5EMKB 4A08B 5CXBA 3O4GA 4D9SA 3MKQA 2HYEA 4NBMA 1VE6A 1GP2B 2XYIA 4D0KA 5IC7A 3SVWD 3DXMC 1UOOA 3ULEC 1A0RB 3V9FA 4PBZA 5K1CC 1YR2A 4FA1D 3VI4A 1RI6A 4O1QD 4GM8A 5E6RA 5IJ7E 3IUNA 2VZ3A 4L3GD 3V5WB 2IURA 2VDLA 1GOFA 1E8NA 2H9MA 4J79A 4QAMA 3IULA 4QRJA 4K3JB 3JAMg 3GC3B 3L4OD 4PSWB 4GQBB 1C9IA 4FB1D 3I7NA 1L5GA 4J87A 3E0CA 4PBYA 4J0WA 5B4WA 4J81A 3JROA 3RRMC 2H13A 2WQ8A 3FRXA 3PXWD 3UR4A 3PXSD 4FA4D 4CI1A 4WJKA 3I7PA 4G55A 3AH8B 3OTTA 4GM9A 5EM2A 1XHMA 4A7JA 3MUNA 5HDBA 1P22A 1VYHC 3MVDK 4QL1A 3IUJA 1H2YA 2IWFA 3EQ8A 4JHPC 2IUQA 3EI4B 2BCJB 1OMWB 5FKQA 5SXMA 3C9CA 5TEFA 4FA9D 3JB9L 3T3MA 2P9UC 4XYHA 3MZLA 2AGZA 2OVPB 4O3UB 2H47A 2QR5A 5KDOB 4NAAA 3VA6A 1Q47A 2OVQB 3FCUA 4GM3A 2VDNA 3DSMA 4ZN4A 3SLED 4J8BA 3MXXA 3OL2A 1UOQA 3PSCB 4PNKB 3SHFA 2EICA 1PI6A 3RFHA 1TYEA 2H6KA 5A2Qg 1GG2B 4TZ4A 3ZDYA 2HU5A 4Z8LA 2EBSA 1QNIA 3ZE2A 4BCCA 1TYQC 2GNQA 4E5ZA 4WK0A 2J55H
chains in the Genus database with same CATH topology
4J0XA 5CXCA 1XKSA 3L4MD 3KRWB 4UI9R 2IWKA 2J56H 1SHYB 3SBQA 5IGQA 3C99A 3OW8A 5I5IA 1NEXB 1B9XA 3VGZA 5FKTA 4J8GA 2J57G 4ZOXA 5THAA 3UVNA 2H9PA 5C2WB 3JZHA 5HQGA 4FAVD 4Y7RA 3ORVD 4IMMA 4A0AA 2YNNA 2P9IC 3EI1B 4A2MA 2BBKH 4CI2A 1GOTB 4A11A 3BWSA 3CFVA 4A0BA 4ERQA 4R7AB 2I3TA 4L1QD 5FKRA 2HESX 3EI2A 4IA9A 1GXRA 3MMYA 4CC9A 2XL3A 2PBIB 4LG8A 4BH6A 4E54B 2CE8A 1K32A 2Z2OA 3AL9A 3HFQA 4QQEA 1FWXA 4ZOZA 5EM2B 3OKTA 1R5MA 2OIZA 2PM9A 2XU7A 3DM0A 5H17A 4JSPC 4AOWA 4LGNA 3EI1A 2YB8B 4EWRA 5IT9g 2CN3A 4ZOYA 2CO0A 3K26A 3I7KA 2GC7A 4L3HD 1OLZA 3CFSB 2AGYA 5FLXg 3UVLA 2UZXB 4JXMA 4CI3A 3PXTD 3BG1A 3MKSB 3I8CA 4YVDA 2HJ4A 4E54A 2I0SA 3OL2B 4J84A 3PSLA 4A2LA 3C75H 5EAMA 3I7LA 3UVOA 4FAND 2B5MA 2B5NA 2HKMA 1YFQA 3IIYA 4JSNC 2AH0A 4K3ID 4E5ZB 3ODTA 2YBAA 3EMHA 2H9LA 3AL8A 3IKOA 4BUJC 2G9AA 4ERYA 5CXCB 4JT6C 2CNXA 1SQ9A 3EU7A 2AGLA 3EWEA 3U4YA 5FA5B 4GGDA 3NVNA 1XIPA 4CY2A 3OKYA 2PM6B 2OK4A 5HE1B 2CE9A 3P4FA 3IJ0A 3V7DB 1K8KC 4O9DA 3SFZA 4ESGA 2P9LC 3OKWA 4J86A 3EI3B 1B9YA 2H9NA 4J77A 3I89A 4O3TB 3PE7A 4LG9A 2H14A 2HJBA 4GGAA 4A0AB 2IAAA 4FHLA 4O45A 1TBGA 2I0TA 3DWLC 5EARA 5HE3B 5H1MA 5GXHA 4A11B 1U4CA 2AGXA 2Z2PA 5C2VB 4A0BB 3SWSD 2YMUA 1N6EA 5GSAA 4X61B 2OK6A 5I5MA 2MTAH 3RFGA 2O9KA 2UZYB 3EI2B 5TDHB 4CY1A 1L0QA 5EMMB 4GMBA 5AMSA 3NVXA 5I5JA 3ZWLB 3PVUB 3EI3A 3F3FA 4JSXC 4J73A 5EAPA 3J81g 2I0RA 4J82A 4QT8A 2PM9B 2CO0C 3C5MA 4X60B 2QXVA 2B5LA 1MG2A 3UVMA 3I2NA 5HYNB 3F3PA 3BG0A 3IJCA 4CZXA 4FWWA 2AH1A 4JD2C 1JOFA 5AFU3 3UVKA 3SN6B 3UKUC 5AJAA 4ZOVA 5H14A 5C9ZB 4A09B 2QC5A 4X63B 2Q7QA 3JZNA 3SBRA 3SMRA 2W18A 3JZGA 5HE0B 4L9OA 4CY5A 2OJYA 5K19A 4GQ1A 4CY3A 2P9KC 4CZYA 5CYKB 3FGBA 3JRPA 2IUPA 3SJLD 1PBYB 3N0EA 2IUVA 5EMJB 4AEZA 3RN0D 3K27A 3AL8B 1MG3A 3NVQA 5TEEA 4NSXA 2TRCB 4BL0A 5IGOA 2I3SA 4J78A 2YNPA 4A09A 4JT5C 4A08A 3OKYB 5TF2A 3RMZD 3I7HA 3I8EA 3DXKC 4FA5D 3RSEC 3FM0A 5CYKA 3PVWB 4U7AA 3IIWA 3B7FA 3SXTD 3SCYA 3AFCA 4G56B 4X3EA 4MK0B 2PM7B 4GGCA 5FQDA 3A0FA 4Y5RD 4CZVA 3GREA 3VH0A 1JJUB 4GZ8A 3SBPA 3GFCA 4PSXB 3JPXA 3MZKA 3KRXB 2P9NC 2P9PC 4OWRA 4D6VA 1JMXB 4JSVC 5FXYA 2H6QA 4ERZA 4KFMB 4PXWA 2B4EA 2AGWA 5EALA 2HXCA 2G99A 3N0DA 5GMKn 3UKRC 2CN2A 3I7OA 2Z2NA 3F3GA 4GQ2P 4PC0A 1N6FA 1ERJA 2H6NA 2OVRB 4XEIC 2GC4A 2XL2A 2P9SC 1S4UX 5IJ8E 5FKSA 1SQJA 4XYIA 2H3XA 5CXBB 3W15A 1JMZB 3EI4A 3RLMD 3CIKB 1MDAH 2YNOA 1NR0A 5HE2B 4OZUA 1PGUA 4N14A 3IJ1A 3J80g 2HKRA 5GXIA 1PEVA 4HDJA 5JWZA 3RN1D 2AQ5A 4I79A 4ES0A 4CI8A 1U2VC 3EG6A 2H68A 4H5JA 4H5IA 1N6DA 4U1EI 5EMLB 4A08B 5EMKB 5CXBA 3MKQA 2HYEA 1GP2B 2XYIA 4D0KA 5IC7A 3SVWD 3DXMC 3ULEC 1A0RB 3V9FA 4PBZA 5K1CC 4FA1D 1RI6A 4O1QD 4GM8A 5IJ7E 4L3GD 3V5WB 2IURA 2H9MA 4J79A 4QRJA 4K3JB 3JAMg 3L4OD 4PSWB 4GQBB 4FB1D 3I7NA 4J87A 3E0CA 4PBYA 4J0WA 5B4WA 4J81A 3JROA 3RRMC 2H13A 3FRXA 3PXWD 3UR4A 3PXSD 4FA4D 4CI1A 3I7PA 3AH8B 3OTTA 4GM9A 5EM2A 1XHMA 4A7JA 1P22A 1VYHC 4QL1A 2IWFA 2IUQA 3EI4B 2BCJB 1OMWB 5FKQA 5SXMA 3C9CA 5TEFA 4FA9D 3JB9L 2P9UC 4XYHA 3MZLA 2AGZA 2OVPB 4O3UB 2H47A 5KDOB 3VA6A 1Q47A 2OVQB 4GM3A 3DSMA 4ZN4A 3SLED 4J8BA 3MXXA 3OL2A 3PSCB 4PNKB 3SHFA 1PI6A 3RFHA 2H6KA 5A2Qg 1GG2B 4TZ4A 4Z8LA 2EBSA 1QNIA 1TYQC 2GNQA 4E5ZA 2J55H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0X A;  5CXC A;  1XKS A;  3L4M D;  3KRW B;  4UI9 R;  2IWK A;  2J56 H;  1SHY B;  3SBQ A;  5IGQ A;  3C99 A;  3OW8 A;  5I5I A;  1NEX B;  1B9X A;  3VGZ A;  5FKT A;  4J8G A;  2J57 G;  4ZOX A;  5THA A;  3UVN A;  2H9P A;  5C2W B;  3JZH A;  5HQG A;  4FAV D;  4Y7R A;  3ORV D;  4IMM A;  4A0A A;  2YNN A;  2P9I C;  3EI1 B;  4A2M A;  2BBK H;  4CI2 A;  1GOT B;  4A11 A;  3BWS A;  3CFV A;  4A0B A;  4ERQ A;  4R7A B;  2I3T A;  4L1Q D;  5FKR A;  2HES X;  3EI2 A;  4IA9 A;  1GXR A;  3MMY A;  4CC9 A;  2XL3 A;  2PBI B;  4LG8 A;  4BH6 A;  4E54 B;  2CE8 A;  1K32 A;  2Z2O A;  3AL9 A;  3HFQ A;  4QQE A;  1FWX A;  4ZOZ A;  5EM2 B;  3OKT A;  1R5M A;  2OIZ A;  2PM9 A;  2XU7 A;  3DM0 A;  5H17 A;  4JSP C;  4AOW A;  4LGN A;  3EI1 A;  2YB8 B;  4EWR A;  5IT9 g;  2CN3 A;  4ZOY A;  2CO0 A;  3K26 A;  3I7K A;  2GC7 A;  4L3H D;  1OLZ A;  3CFS B;  2AGY A;  5FLX g;  3UVL A;  2UZX B;  4JXM A;  4CI3 A;  3PXT D;  3BG1 A;  3MKS B;  3I8C A;  4YVD A;  2HJ4 A;  4E54 A;  2I0S A;  3OL2 B;  4J84 A;  3PSL A;  4A2L A;  3C75 H;  5EAM A;  3I7L A;  3UVO A;  4FAN D;  2B5M A;  2B5N A;  2HKM A;  1YFQ A;  3IIY A;  4JSN C;  2AH0 A;  4K3I D;  4E5Z B;  3ODT A;  2YBA A;  3EMH A;  2H9L A;  3AL8 A;  3IKO A;  4BUJ C;  2G9A A;  4ERY A;  5CXC B;  4JT6 C;  2CNX A;  1SQ9 A;  3EU7 A;  2AGL A;  3EWE A;  3U4Y A;  5FA5 B;  4GGD A;  3NVN A;  1XIP A;  4CY2 A;  3OKY A;  2PM6 B;  2OK4 A;  5HE1 B;  2CE9 A;  3P4F A;  3IJ0 A;  3V7D B;  1K8K C;  4O9D A;  3SFZ A;  4ESG A;  2P9L C;  3OKW A;  4J86 A;  3EI3 B;  1B9Y A;  2H9N A;  4J77 A;  3I89 A;  4O3T B;  3PE7 A;  4LG9 A;  2H14 A;  2HJB A;  4GGA A;  4A0A B;  2IAA A;  4FHL A;  4O45 A;  1TBG A;  2I0T A;  3DWL C;  5EAR A;  5HE3 B;  5H1M A;  5GXH A;  4A11 B;  1U4C A;  2AGX A;  2Z2P A;  5C2V B;  4A0B B;  3SWS D;  2YMU A;  1N6E A;  5GSA A;  4X61 B;  2OK6 A;  5I5M A;  2MTA H;  3RFG A;  2O9K A;  2UZY B;  3EI2 B;  5TDH B;  4CY1 A;  1L0Q A;  5EMM B;  4GMB A;  5AMS A;  3NVX A;  5I5J A;  3ZWL B;  3PVU B;  3EI3 A;  3F3F A;  4JSX C;  4J73 A;  5EAP A;  3J81 g;  2I0R A;  4J82 A;  4QT8 A;  2PM9 B;  2CO0 C;  3C5M A;  4X60 B;  2QXV A;  2B5L A;  1MG2 A;  3UVM A;  3I2N A;  5HYN B;  3F3P A;  3BG0 A;  3IJC A;  4CZX A;  4FWW A;  2AH1 A;  4JD2 C;  1JOF A;  5AFU 3;  3UVK A;  3SN6 B;  3UKU C;  5AJA A;  4ZOV A;  5H14 A;  5C9Z B;  4A09 B;  2QC5 A;  4X63 B;  2Q7Q A;  3JZN A;  3SBR A;  3SMR A;  2W18 A;  3JZG A;  5HE0 B;  4L9O A;  4CY5 A;  2OJY A;  5K19 A;  4GQ1 A;  4CY3 A;  2P9K C;  4CZY A;  5CYK B;  3FGB A;  3JRP A;  2IUP A;  3SJL D;  1PBY B;  3N0E A;  2IUV A;  5EMJ B;  4AEZ A;  3RN0 D;  3K27 A;  3AL8 B;  1MG3 A;  3NVQ A;  5TEE A;  4NSX A;  2TRC B;  4BL0 A;  5IGO A;  2I3S A;  4J78 A;  2YNP A;  4A09 A;  4JT5 C;  4A08 A;  3OKY B;  5TF2 A;  3RMZ D;  3I7H A;  3I8E A;  3DXK C;  4FA5 D;  3RSE C;  3FM0 A;  5CYK A;  3PVW B;  4U7A A;  3IIW A;  3B7F A;  3SXT D;  3SCY A;  3AFC A;  4G56 B;  4X3E A;  4MK0 B;  2PM7 B;  4GGC A;  5FQD A;  3A0F A;  4Y5R D;  4CZV A;  3GRE A;  3VH0 A;  1JJU B;  4GZ8 A;  3SBP A;  3GFC A;  4PSX B;  3JPX A;  3MZK A;  3KRX B;  2P9N C;  2P9P C;  4OWR A;  4D6V A;  1JMX B;  4JSV C;  5FXY A;  2H6Q A;  4ERZ A;  4KFM B;  4PXW A;  2B4E A;  2AGW A;  5EAL A;  2HXC A;  2G99 A;  3N0D A;  5GMK n;  3UKR C;  2CN2 A;  3I7O A;  2Z2N A;  3F3G A;  4GQ2 P;  4PC0 A;  1N6F A;  1ERJ A;  2H6N A;  2OVR B;  4XEI C;  2GC4 A;  2XL2 A;  2P9S C;  1S4U X;  5IJ8 E;  5FKS A;  1SQJ A;  4XYI A;  2H3X A;  5CXB B;  3W15 A;  1JMZ B;  3EI4 A;  3RLM D;  3CIK B;  1MDA H;  2YNO A;  1NR0 A;  5HE2 B;  4OZU A;  1PGU A;  4N14 A;  3IJ1 A;  3J80 g;  2HKR A;  5GXI A;  1PEV A;  4HDJ A;  5JWZ A;  3RN1 D;  2AQ5 A;  4I79 A;  4ES0 A;  4CI8 A;  1U2V C;  3EG6 A;  2H68 A;  4H5J A;  4H5I A;  1N6D A;  4U1E I;  5EML B;  4A08 B;  5EMK B;  5CXB A;  3MKQ A;  2HYE A;  1GP2 B;  2XYI A;  4D0K A;  5IC7 A;  3SVW D;  3DXM C;  3ULE C;  1A0R B;  3V9F A;  4PBZ A;  5K1C C;  4FA1 D;  1RI6 A;  4O1Q D;  4GM8 A;  5IJ7 E;  4L3G D;  3V5W B;  2IUR A;  2H9M A;  4J79 A;  4QRJ A;  4K3J B;  3JAM g;  3L4O D;  4PSW B;  4GQB B;  4FB1 D;  3I7N A;  4J87 A;  3E0C A;  4PBY A;  4J0W A;  5B4W A;  4J81 A;  3JRO A;  3RRM C;  2H13 A;  3FRX A;  3PXW D;  3UR4 A;  3PXS D;  4FA4 D;  4CI1 A;  3I7P A;  3AH8 B;  3OTT A;  4GM9 A;  5EM2 A;  1XHM A;  4A7J A;  1P22 A;  1VYH C;  4QL1 A;  2IWF A;  2IUQ A;  3EI4 B;  2BCJ B;  1OMW B;  5FKQ A;  5SXM A;  3C9C A;  5TEF A;  4FA9 D;  3JB9 L;  2P9U C;  4XYH A;  3MZL A;  2AGZ A;  2OVP B;  4O3U B;  2H47 A;  5KDO B;  3VA6 A;  1Q47 A;  2OVQ B;  4GM3 A;  3DSM A;  4ZN4 A;  3SLE D;  4J8B A;  3MXX A;  3OL2 A;  3PSC B;  4PNK B;  3SHF A;  1PI6 A;  3RFH A;  2H6K A;  5A2Q g;  1GG2 B;  4TZ4 A;  4Z8L A;  2EBS A;  1QNI A;  1TYQ C;  2GNQ A;  4E5Z A;  2J55 H; 
#chains in the Genus database with same CATH topology
 4UM9 A;  4J0X A;  5CXC A;  1XKS A;  3L4M D;  3KRW B;  4UI9 R;  2IWK A;  2J56 H;  1SHY B;  3SBQ A;  5IGQ A;  3C99 A;  3OW8 A;  5I5I A;  1NEX B;  4UM8 A;  1B9X A;  3K6S A;  3VGZ A;  4NC4 A;  5FKT A;  5C86 A;  1E8M A;  4J8G A;  2J57 G;  3ZDX A;  4ZOX A;  5THA A;  2VDM A;  3UVN A;  4JHN A;  2EIE A;  2H9P A;  5C2W B;  3JZH A;  5HQG A;  4FAV D;  5E6U A;  4Y7R A;  3K72 A;  3ORV D;  4IMM A;  4A0A A;  2YNN A;  2P9I C;  3EI1 B;  4A2M A;  1A12 A;  2BBK H;  4CI2 A;  1GOT B;  4A11 A;  3BWS A;  3CFV A;  2VDO A;  2VDK A;  4A0B A;  4ERQ A;  4R7A B;  2I3T A;  3NID A;  2VDR A;  4L1Q D;  5FKR A;  2HES X;  3EI2 A;  4IA9 A;  1GXR A;  3MMY A;  4CC9 A;  2XL3 A;  2PBI B;  1VZ3 A;  2XDW A;  4LG8 A;  4BH6 A;  4E54 B;  2CE8 A;  1K32 A;  2Z2O A;  5M5U A;  2QZP A;  3AL9 A;  3HFQ A;  4QQE A;  1FWX A;  4ZOZ A;  5EM2 B;  3OKT A;  1R5M A;  2OIZ A;  2PM9 A;  2XU7 A;  3DM0 A;  1JTD B;  5H17 A;  2XE4 A;  4JSP C;  4AOW A;  4DNV A;  4Z7Q A;  4LGN A;  3EI1 A;  2YB8 B;  4L1M A;  4EWR A;  5IT9 g;  2CN3 A;  4ZOY A;  2CO0 A;  3K26 A;  3I7K A;  4MMX A;  2GC7 A;  4L3H D;  1OLZ A;  3CFS B;  2AGY A;  5FLX g;  3UVL A;  2UZX B;  4JXM A;  4CI3 A;  3PXT D;  3BG1 A;  3MKS B;  3I8C A;  4YVD A;  1U8C A;  2HJ4 A;  5E6S A;  3EQ7 A;  4DNU A;  4E54 A;  2I0S A;  3OL2 B;  4J84 A;  3PSL A;  4A2L A;  3C75 H;  5EAM A;  3I7L A;  3UVO A;  1VE7 A;  2B5M A;  3QHY B;  4FAN D;  2B5N A;  2HKM A;  1UTC A;  1YFQ A;  3IIY A;  4JSN C;  3NIF A;  2AH0 A;  1QFS A;  4K3I D;  4E5Z B;  3ODT A;  1VZ2 A;  2YBA A;  3EMH A;  2H9L A;  3AL8 A;  3IKO A;  4BUJ C;  2G9A A;  4ERY A;  5CXC B;  4JT6 C;  2CNX A;  1SQ9 A;  4O02 A;  3EU7 A;  2AGL A;  3EWE A;  3U4Y A;  5FA5 B;  4GGD A;  3NVN A;  1XIP A;  4CY2 A;  3OKY A;  2PM6 B;  3V4V A;  2OK4 A;  5HE1 B;  2CE9 A;  3P4F A;  3IJ0 A;  3V7D B;  1K8K C;  3O4H A;  4O9D A;  3SFZ A;  4ESG A;  2P9L C;  3OKW A;  4J86 A;  3EI3 B;  1B9Y A;  2H9N A;  4J77 A;  2HU7 A;  3I89 A;  4O3T B;  3PE7 A;  4LG9 A;  2H14 A;  2HJB A;  3DDU A;  4GGA A;  4A0A B;  2IAA A;  4FHL A;  4O45 A;  1TBG A;  2I0T A;  3DWL C;  2EID A;  5EAR A;  5H1M A;  5HE3 B;  5GXH A;  4A11 B;  1U4C A;  2AGX A;  2Z2P A;  5C2V B;  4A0B B;  3SWS D;  2YMU A;  1N6E A;  5GSA A;  2VC2 A;  4X61 B;  2OK6 A;  1BPO A;  4NEN A;  5I5M A;  2MTA H;  5FFO A;  1T2X A;  3RFG A;  5M5S A;  2O9K A;  2UZY B;  3IUR A;  3EI2 B;  5TDH B;  4CY1 A;  1L0Q A;  5EMM B;  3K71 A;  4GMB A;  5AMS A;  3NVX A;  3ZE1 A;  5I5J A;  3ZWL B;  3GD1 I;  3PVU B;  3EI3 A;  3F3F A;  4JSX C;  4J73 A;  5EAP A;  3KCI A;  3J81 g;  2I0R A;  4J82 A;  4QT8 A;  2PM9 B;  3NIG A;  3VI3 A;  2CO0 C;  3C5M A;  4X60 B;  2QXV A;  3OF7 A;  2B5L A;  3IVM A;  2JKX A;  1MG2 A;  1H2X A;  3UVM A;  1QFM A;  3I2N A;  5HYN B;  3F3P A;  3BG0 A;  3IJC A;  4CZX A;  4FWW A;  2AH1 A;  4JD2 C;  1JOF A;  5AFU 3;  3UVK A;  3SN6 B;  3UKU C;  5AJA A;  4ZOV A;  5H14 A;  5C9Z B;  1C9L A;  4A09 B;  2QC5 A;  1I2M B;  4X63 B;  2Q7Q A;  3JZN A;  3SBR A;  3SMR A;  2W18 A;  3JZG A;  5HE0 B;  4L9O A;  4CY5 A;  2OJY A;  5K19 A;  4GQ1 A;  4CY3 A;  2P9K C;  4CZY A;  3ZE0 A;  5CYK B;  3FGB A;  3JRP A;  2IUP A;  3SJL D;  1PBY B;  3T3P A;  1H2W A;  3N0E A;  4AN1 A;  2IUV A;  5EMJ B;  4AEZ A;  2XZG A;  3RN0 D;  4RE5 A;  3K27 A;  3AL8 B;  1MG3 A;  3NVQ A;  5TEE A;  4IRZ A;  3O4I A;  4NSX A;  5M5T A;  2VZ1 A;  2TRC B;  4BL0 A;  5IGO A;  2I3S A;  4J78 A;  2YNP A;  3FCS A;  4A09 A;  4JT5 C;  2VDQ A;  3IUQ A;  2HU8 A;  4A08 A;  3OKY B;  5TF2 A;  3RMZ D;  3I7H A;  3I8E A;  4WK4 A;  3DXK C;  4AX4 A;  3ZDZ A;  4FA5 D;  4G1M A;  3RSE C;  3FM0 A;  5CYK A;  3PVW B;  5M5R A;  4U7A A;  3IIW A;  3MUO A;  3B7F A;  3SXT D;  3SCY A;  3AFC A;  4G56 B;  4X3E A;  4MK0 B;  2PM7 B;  4GGC A;  5FQD A;  3A0F A;  4Y5R D;  4CZV A;  4DNW A;  3GRE A;  3VH0 A;  1O6F A;  1JJU B;  4GZ8 A;  3SBP A;  1JV2 A;  1K3I A;  4AMZ A;  3GFC A;  3IUM A;  4PSX B;  4MMY A;  3JPX A;  4BCD A;  3MZK A;  3KRX B;  4Z7O A;  2P9N C;  2P9P C;  4OWR A;  4D6V A;  1O6G A;  4G1E A;  4Z7N A;  1JMX B;  4JSV C;  2VDP A;  5FXY A;  2H6Q A;  4ERZ A;  4KFM B;  4PXW A;  2B4E A;  2AGW A;  5EAL A;  3O4J A;  2HXC A;  2G99 A;  5FFG A;  1GOH A;  3N0D A;  5GMK n;  3UKR C;  4MMZ A;  4AMY A;  3EQ9 A;  2CN2 A;  1GOG A;  4O2W A;  3I7O A;  2Z2N A;  3F3G A;  4GQ2 P;  4PC0 A;  1N6F A;  4WK2 A;  1ERJ A;  2H6N A;  2OVR B;  4XEI C;  1H2Z A;  2GC4 A;  2XL2 A;  2P9S C;  1S4U X;  4BP9 A;  5FKS A;  1SQJ A;  4XYI A;  2H3X A;  5CXB B;  3W15 A;  5IJ8 E;  1JMZ B;  3EI4 A;  3RLM D;  3CIK B;  1MDA H;  1M1X A;  2YNO A;  3IJE A;  1NR0 A;  3V4P A;  5HE2 B;  4OZU A;  1PGU A;  4N14 A;  1UOP A;  1E5T A;  3IJ1 A;  3J80 g;  2HKR A;  5GXI A;  5C92 A;  1PEV A;  4HDJ A;  4AN0 A;  5M61 A;  5JWZ A;  3RN1 D;  2AQ5 A;  4I79 A;  4BCB A;  4ES0 A;  4CI8 A;  1U2V C;  3EG6 A;  4RE6 A;  2BKL A;  2EIB A;  2H68 A;  3QI0 A;  4H5I A;  4H5J A;  5M5V A;  1N6D A;  4U1E I;  5EML B;  4BP8 A;  5EMK B;  4A08 B;  5CXB A;  3O4G A;  4D9S A;  3MKQ A;  2HYE A;  4NBM A;  1VE6 A;  1GP2 B;  2XYI A;  4D0K A;  5IC7 A;  3SVW D;  3DXM C;  1UOO A;  3ULE C;  1A0R B;  3V9F A;  4PBZ A;  5K1C C;  1YR2 A;  4FA1 D;  3VI4 A;  1RI6 A;  4O1Q D;  4GM8 A;  5E6R A;  5IJ7 E;  3IUN A;  2VZ3 A;  4L3G D;  3V5W B;  2IUR A;  2VDL A;  1GOF A;  1E8N A;  2H9M A;  4J79 A;  4QAM A;  3IUL A;  4QRJ A;  4K3J B;  3JAM g;  3GC3 B;  3L4O D;  4PSW B;  4GQB B;  1C9I A;  4FB1 D;  3I7N A;  1L5G A;  4J87 A;  3E0C A;  4PBY A;  4J0W A;  5B4W A;  4J81 A;  3JRO A;  3RRM C;  2H13 A;  2WQ8 A;  3FRX A;  3PXW D;  3UR4 A;  3PXS D;  4FA4 D;  4CI1 A;  4WJK A;  3I7P A;  4G55 A;  3AH8 B;  3OTT A;  4GM9 A;  5EM2 A;  1XHM A;  4A7J A;  3MUN A;  5HDB A;  1P22 A;  1VYH C;  3MVD K;  4QL1 A;  3IUJ A;  1H2Y A;  2IWF A;  3EQ8 A;  4JHP C;  2IUQ A;  3EI4 B;  2BCJ B;  1OMW B;  5FKQ A;  5SXM A;  3C9C A;  5TEF A;  4FA9 D;  3JB9 L;  3T3M A;  2P9U C;  4XYH A;  3MZL A;  2AGZ A;  2OVP B;  4O3U B;  2H47 A;  2QR5 A;  5KDO B;  4NAA A;  3VA6 A;  1Q47 A;  2OVQ B;  3FCU A;  4GM3 A;  2VDN A;  3DSM A;  4ZN4 A;  3SLE D;  4J8B A;  3MXX A;  3OL2 A;  1UOQ A;  3PSC B;  4PNK B;  3SHF A;  2EIC A;  1PI6 A;  3RFH A;  1TYE A;  2H6K A;  5A2Q g;  1GG2 B;  4TZ4 A;  3ZDY A;  2HU5 A;  4Z8L A;  2EBS A;  1QNI A;  3ZE2 A;  4BCC A;  1TYQ C;  2GNQ A;  4E5Z A;  4WK0 A;  2J55 H; 
#chains in the Genus database with same CATH homology
 4J0X A;  5CXC A;  1XKS A;  3L4M D;  3KRW B;  4UI9 R;  2IWK A;  2J56 H;  1SHY B;  3SBQ A;  5IGQ A;  3C99 A;  3OW8 A;  5I5I A;  1NEX B;  1B9X A;  3VGZ A;  5FKT A;  4J8G A;  2J57 G;  4ZOX A;  5THA A;  3UVN A;  2H9P A;  5C2W B;  3JZH A;  5HQG A;  4FAV D;  4Y7R A;  3ORV D;  4IMM A;  4A0A A;  2YNN A;  2P9I C;  3EI1 B;  4A2M A;  2BBK H;  4CI2 A;  1GOT B;  4A11 A;  3BWS A;  3CFV A;  4A0B A;  4ERQ A;  4R7A B;  2I3T A;  4L1Q D;  5FKR A;  2HES X;  3EI2 A;  4IA9 A;  1GXR A;  3MMY A;  4CC9 A;  2XL3 A;  2PBI B;  4LG8 A;  4BH6 A;  4E54 B;  2CE8 A;  1K32 A;  2Z2O A;  3AL9 A;  3HFQ A;  4QQE A;  1FWX A;  4ZOZ A;  5EM2 B;  3OKT A;  1R5M A;  2OIZ A;  2PM9 A;  2XU7 A;  3DM0 A;  5H17 A;  4JSP C;  4AOW A;  4LGN A;  3EI1 A;  2YB8 B;  4EWR A;  5IT9 g;  2CN3 A;  4ZOY A;  2CO0 A;  3K26 A;  3I7K A;  2GC7 A;  4L3H D;  1OLZ A;  3CFS B;  2AGY A;  5FLX g;  3UVL A;  2UZX B;  4JXM A;  4CI3 A;  3PXT D;  3BG1 A;  3MKS B;  3I8C A;  4YVD A;  2HJ4 A;  4E54 A;  2I0S A;  3OL2 B;  4J84 A;  3PSL A;  4A2L A;  3C75 H;  5EAM A;  3I7L A;  3UVO A;  4FAN D;  2B5M A;  2B5N A;  2HKM A;  1YFQ A;  3IIY A;  4JSN C;  2AH0 A;  4K3I D;  4E5Z B;  3ODT A;  2YBA A;  3EMH A;  2H9L A;  3AL8 A;  3IKO A;  4BUJ C;  2G9A A;  4ERY A;  5CXC B;  4JT6 C;  2CNX A;  1SQ9 A;  3EU7 A;  2AGL A;  3EWE A;  3U4Y A;  5FA5 B;  4GGD A;  3NVN A;  1XIP A;  4CY2 A;  3OKY A;  2PM6 B;  2OK4 A;  5HE1 B;  2CE9 A;  3P4F A;  3IJ0 A;  3V7D B;  1K8K C;  4O9D A;  3SFZ A;  4ESG A;  2P9L C;  3OKW A;  4J86 A;  3EI3 B;  1B9Y A;  2H9N A;  4J77 A;  3I89 A;  4O3T B;  3PE7 A;  4LG9 A;  2H14 A;  2HJB A;  4GGA A;  4A0A B;  2IAA A;  4FHL A;  4O45 A;  1TBG A;  2I0T A;  3DWL C;  5EAR A;  5HE3 B;  5H1M A;  5GXH A;  4A11 B;  1U4C A;  2AGX A;  2Z2P A;  5C2V B;  4A0B B;  3SWS D;  2YMU A;  1N6E A;  5GSA A;  4X61 B;  2OK6 A;  5I5M A;  2MTA H;  3RFG A;  2O9K A;  2UZY B;  3EI2 B;  5TDH B;  4CY1 A;  1L0Q A;  5EMM B;  4GMB A;  5AMS A;  3NVX A;  5I5J A;  3ZWL B;  3PVU B;  3EI3 A;  3F3F A;  4JSX C;  4J73 A;  5EAP A;  3J81 g;  2I0R A;  4J82 A;  4QT8 A;  2PM9 B;  2CO0 C;  3C5M A;  4X60 B;  2QXV A;  2B5L A;  1MG2 A;  3UVM A;  3I2N A;  5HYN B;  3F3P A;  3BG0 A;  3IJC A;  4CZX A;  4FWW A;  2AH1 A;  4JD2 C;  1JOF A;  5AFU 3;  3UVK A;  3SN6 B;  3UKU C;  5AJA A;  4ZOV A;  5H14 A;  5C9Z B;  4A09 B;  2QC5 A;  4X63 B;  2Q7Q A;  3JZN A;  3SBR A;  3SMR A;  2W18 A;  3JZG A;  5HE0 B;  4L9O A;  4CY5 A;  2OJY A;  5K19 A;  4GQ1 A;  4CY3 A;  2P9K C;  4CZY A;  5CYK B;  3FGB A;  3JRP A;  2IUP A;  3SJL D;  1PBY B;  3N0E A;  2IUV A;  5EMJ B;  4AEZ A;  3RN0 D;  3K27 A;  3AL8 B;  1MG3 A;  3NVQ A;  5TEE A;  4NSX A;  2TRC B;  4BL0 A;  5IGO A;  2I3S A;  4J78 A;  2YNP A;  4A09 A;  4JT5 C;  4A08 A;  3OKY B;  5TF2 A;  3RMZ D;  3I7H A;  3I8E A;  3DXK C;  4FA5 D;  3RSE C;  3FM0 A;  5CYK A;  3PVW B;  4U7A A;  3IIW A;  3B7F A;  3SXT D;  3SCY A;  3AFC A;  4G56 B;  4X3E A;  4MK0 B;  2PM7 B;  4GGC A;  5FQD A;  3A0F A;  4Y5R D;  4CZV A;  3GRE A;  3VH0 A;  1JJU B;  4GZ8 A;  3SBP A;  3GFC A;  4PSX B;  3JPX A;  3MZK A;  3KRX B;  2P9N C;  2P9P C;  4OWR A;  4D6V A;  1JMX B;  4JSV C;  5FXY A;  2H6Q A;  4ERZ A;  4KFM B;  4PXW A;  2B4E A;  2AGW A;  5EAL A;  2HXC A;  2G99 A;  3N0D A;  5GMK n;  3UKR C;  2CN2 A;  3I7O A;  2Z2N A;  3F3G A;  4GQ2 P;  4PC0 A;  1N6F A;  1ERJ A;  2H6N A;  2OVR B;  4XEI C;  2GC4 A;  2XL2 A;  2P9S C;  1S4U X;  5IJ8 E;  5FKS A;  1SQJ A;  4XYI A;  2H3X A;  5CXB B;  3W15 A;  1JMZ B;  3EI4 A;  3RLM D;  3CIK B;  1MDA H;  2YNO A;  1NR0 A;  5HE2 B;  4OZU A;  1PGU A;  4N14 A;  3IJ1 A;  3J80 g;  2HKR A;  5GXI A;  1PEV A;  4HDJ A;  5JWZ A;  3RN1 D;  2AQ5 A;  4I79 A;  4ES0 A;  4CI8 A;  1U2V C;  3EG6 A;  2H68 A;  4H5J A;  4H5I A;  1N6D A;  4U1E I;  5EML B;  4A08 B;  5EMK B;  5CXB A;  3MKQ A;  2HYE A;  1GP2 B;  2XYI A;  4D0K A;  5IC7 A;  3SVW D;  3DXM C;  3ULE C;  1A0R B;  3V9F A;  4PBZ A;  5K1C C;  4FA1 D;  1RI6 A;  4O1Q D;  4GM8 A;  5IJ7 E;  4L3G D;  3V5W B;  2IUR A;  2H9M A;  4J79 A;  4QRJ A;  4K3J B;  3JAM g;  3L4O D;  4PSW B;  4GQB B;  4FB1 D;  3I7N A;  4J87 A;  3E0C A;  4PBY A;  4J0W A;  5B4W A;  4J81 A;  3JRO A;  3RRM C;  2H13 A;  3FRX A;  3PXW D;  3UR4 A;  3PXS D;  4FA4 D;  4CI1 A;  3I7P A;  3AH8 B;  3OTT A;  4GM9 A;  5EM2 A;  1XHM A;  4A7J A;  1P22 A;  1VYH C;  4QL1 A;  2IWF A;  2IUQ A;  3EI4 B;  2BCJ B;  1OMW B;  5FKQ A;  5SXM A;  3C9C A;  5TEF A;  4FA9 D;  3JB9 L;  2P9U C;  4XYH A;  3MZL A;  2AGZ A;  2OVP B;  4O3U B;  2H47 A;  5KDO B;  3VA6 A;  1Q47 A;  2OVQ B;  4GM3 A;  3DSM A;  4ZN4 A;  3SLE D;  4J8B A;  3MXX A;  3OL2 A;  3PSC B;  4PNK B;  3SHF A;  1PI6 A;  3RFH A;  2H6K A;  5A2Q g;  1GG2 B;  4TZ4 A;  4Z8L A;  2EBS A;  1QNI A;  1TYQ C;  2GNQ A;  4E5Z A;  2J55 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...