5TDHB

The crystal structure of the dominant negative mutant g protein alpha(i)-1-beta-1-gamma-2 g203a/a326s
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
342
structure length
339
Chain Sequence
SAMSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1
publication title The structural basis of the dominant negative phenotype of the G alpha i1 beta 1 gamma 2 G203A/A326S heterotrimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 102
structure length 339
sequence length 342
chains with identical sequence J
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5tdhB00
3MZKA 3IKOA 2AQ5A 4X63B 3RSEC 4L3HD 3EI4A 1K32A 3MKQA 2P9PC 4CC9A 4FAVD 4O9DA 3JROA 4ESGA 4JD2C 5FKSA 3I7LA 3EWEA 4L9OA 5HQGA 3E0CA 5THAA 3JPXA 3N0DA 3OKTA 4GGCA 4G56B 5FXYA 4PBYA 3BWSA 4R7AB 3RLMD 4D6VA 1P22A 2Z2NA 1OMWB 3U4YA 5HE1B 1XKSA 3UVKA 4CI3A 2I0SA 2QXVA 3RN1D 4PSXB 5EALA 5CXCB 2BBKH 4ES0A 2OVRB 3NVQA 3MZLA 5SXMA 3AL9A 4TZ4A 3C5MA 4CY3A 4O3UB 4A0BB 5EM2A 3K27A 4J79A 1B9XA 3UKRC 3SHFA 3VA6A 3KRXB 4XYHA 1VYHC 5EMKB 4A08A 4L3GD 5AJAA 3IJ0A 5H17A 5HE3B 4E54B 2CE9A 2UZYB 1NR0A 4A11B 4NSXA 4JT6C 2BCJB 4GGDA 3EI4B 2IWFA 2IUVA 4ERYA 1K8KC 3RFHA 3SN6B 3IIWA 3EI3A 3JZHA 2J55H 4I79A 2AGLA 1FWXA 2P9LC 3BG0A 2AGXA 1PGUA 4U1EI 1SQ9A 2B5MA 1JMXB 2G99A 1A0RB 4GM9A 2IAAA 3I89A 4GM8A 4YVDA 3PSLA 3PXSD 4H5IA 4Y7RA 2HKRA 5HE0B 4FA9D 5K19A 4GZ8A 5EM2B 3VH0A 3I7PA 5GXHA 3K26A 1N6DA 1B9YA 4IMMA 4AOWA 2YB8B 3I7OA 2YNNA 5CXBB 4PSWB 3FRXA 4A08B 4FA1D 1N6EA 3SBPA 3F3PA 1TBGA 3MKSB 2Z2OA 3UKUC 4AEZA 4J78A 5TF2A 4A11A 3MXXA 3FM0A 4N14A 2YBAA 3UVOA 4JSXC 4GM3A 2AGZA 3AL8A 3SJLD 3PE7A 3IJ1A 3EI1B 3B7FA 2IUPA 3EI3B 2H9NA 4KFMB 4QL1A 2XL3A 1GOTB 4E5ZA 3SBRA 4UI9R 3UVLA 5EAPA 5TEEA 5KDOB 3EU7A 1GXRA 2OVPB 1L0QA 4J0WA 5HYNB 5FLXg 4JSVC 5H14A 1PI6A 2I3SA 4A7JA 1SHYB 5K1CC 2YNPA 4FHLA 3HFQA 3RFGA 3JZGA 2OIZA 2H6QA 4XEIC 2I0RA 4X61B 3PVUB 5FKRA 4IA9A 3PVWB 2EBSA 4K3ID 5CXBA 3RMZD 1MG2A 2CN3A 4FA5D 3V5WB 1JOFA 4J0XA 3V7DB 3SCYA 4XYIA 4BUJC 3A0FA 4LG9A 2IURA 5AMSA 5I5JA 1U2VC 4QQEA 3OW8A 4CZVA 2CO0C 3JRPA 3VGZA 3AL8B 2PM9A 4J8GA 5CYKA 4ZOVA 1NEXB 3EI1A 3DXKC 5FA5B 5JWZA 4Z8LA 3N0EA 5I5MA 3RN0D 4JXMA 3V9FA 1JJUB 2Z2PA 2MTAH 2B5NA 4QT8A 4E5ZB 2OK4A 3C75H 2H3XA 4J8BA 1OLZA 3AFCA 5IGQA 4PBZA 4EWRA 4JSNC 3I7KA 5C9ZB 3PSCB 3I7NA 1YFQA 4J86A 2P9NC 4Y5RD 4H5JA 3I8CA 4O45A 3GREA 1MDAH 3UVNA 2HESX 3BG1A 4J84A 3I2NA 3IJCA 3OKWA 3W15A 1XIPA 4MK0B 2PM6B 1QNIA 5IC7A 1JMZB 1Q47A 3PXWD 5GXIA 2YNOA 5FKTA 3DWLC 3KRWB 5EMMB 3NVXA 1XHMA 1N6FA 1PBYB 4O1QD 2HKMA 2PBIB 3CFSB 1R5MA 3DM0A 3EI2A 2QC5A 3DSMA 5FKQA 2H68A 3JZNA 4GGAA 2I0TA 1ERJA 4J81A 4O3TB 4X3EA 2XYIA 2AGYA 2PM7B 2PM9B 3SLED 3OL2B 5TDHB 5CYKB 5H1MA 4ZOXA 4L1QD 2OK6A 4GQ2P 3IIYA 3MMYA 4JSPC 2AH1A 4ZOZA 5TEFA 2J57G 2YMUA 4A2MA 2W18A 3C99A 3SVWD 4ERZA 2HXCA 2CNXA 2B4EA 3SMRA 3NVNA 4CI8A 4GQ1A 3SBQA 4J82A 4J77A 3ORVD 2P9IC 3F3GA 5HE2B 3GFCA 2Q7QA 3JAMg 2H9PA 2HJBA 4CY5A 2GNQA 2P9KC 2AH0A 1SQJA 2AGWA 4BL0A 2CO0A 3ULEC 3F3FA 4J73A 4CI2A 4X60B 4JT5C 4PC0A 3FGBA 2OJYA 3OKYB 3EI2B 3L4MD 4A0AA 4GQBB 2IUQA 5B4WA 2HJ4A 4GMBA 2H6NA 1S4UX 1GG2B 2I3TA 2GC7A 4D0KA 3OL2A 2CN2A 3RRMC 4A09A 1GP2B 5C2VB 4FB1D 2OVQB 2P9UC 4ZOYA 5A2Qg 1RI6A 3I8EA 5I5IA 2TRCB 3J80g 2H9MA 4CI1A 5EMLB 2H47A 2H9LA 2UZXB 2XU7A 3JB9L 3UVMA 5IJ7E 2XL2A 4J87A 5GSAA 5GMKn 3ODTA 3UR4A 5C2WB 3SXTD 4FWWA 5IJ8E 5FQDA 3EG6A 4FAND 4K3JB 4OZUA 3CIKB 4CY1A 3DXMC 2H6KA 3EMHA 4PXWA 5CXCA 4CZXA 3OKYA 3C9CA 2IWKA 5AFU3 4A0AB 4PNKB 4HDJA 1PEVA 4CZYA 3J81g 3CFVA 3AH8B 2J56H 4FA4D 4A0BA 4ERQA 4LGNA 5EARA 5IGOA 5EAMA 2O9KA 1MG3A 2H13A 2GC4A 2HYEA 1TYQC 5IT9g 3L4OD 4A09B 4LG8A 4A2LA 2G9AA 4CY2A 3SWSD 2H14A 2CE8A 2B5LA 3OTTA 3I7HA 4BH6A 2P9SC 4U7AA 4QRJA 4E54A 3SFZA 3P4FA 4ZN4A 5EMJB 4OWRA 3ZWLB 3PXTD 1U4CA
chains in the Genus database with same CATH superfamily
3MZKA 4MMYA 3IKOA 2AQ5A 4X63B 3RSEC 4L3HD 3EI4A 1K32A 3MKQA 2P9PC 2VDQA 4CC9A 4FAVD 4O9DA 3JROA 4ESGA 4JD2C 5FKSA 3I7LA 3EWEA 4L9OA 1UOQA 5HQGA 3VI3A 3E0CA 3NIDA 5THAA 3JPXA 3K6SA 3N0DA 3OKTA 4GGCA 4G56B 5FXYA 1O6FA 3K72A 4WK0A 4PBYA 3BWSA 3GD1I 4R7AB 3RLMD 4D6VA 1P22A 2Z2NA 1OMWB 3U4YA 5HE1B 1H2XA 1XKSA 3UVKA 4CI3A 2I0SA 2QXVA 3RN1D 4PSXB 5EALA 5CXCB 2BBKH 4WK4A 4ES0A 2OVRB 3NVQA 3MZLA 4BP8A 5SXMA 3AL9A 1UOPA 4TZ4A 3C5MA 4CY3A 4O3UB 4A0BB 5EM2A 3K27A 4NC4A 1GOGA 4J79A 1B9XA 3UKRC 3SHFA 3EQ8A 3VA6A 3KRXB 4XYHA 1VYHC 5EMKB 3IJEA 4A08A 3ZE0A 5M5TA 2VDRA 4L3GD 1C9LA 5AJAA 4RE5A 3IJ0A 5H17A 5HE3B 4E54B 2CE9A 2UZYB 1NR0A 4A11B 4NSXA 3ZDXA 4JT6C 2BCJB 4GGDA 3EI4B 2IWFA 2IUVA 4ERYA 5FFOA 1QFSA 1K8KC 3RFHA 3SN6B 3IIWA 3NIGA 3EI3A 3EQ7A 3IULA 3JZHA 1JTDB 2J55H 4I79A 2AGLA 1FWXA 2P9LC 3QI0A 3BG0A 2AGXA 1PGUA 5FFGA 4U1EI 1SQ9A 2B5MA 1JMXB 2G99A 1A0RB 1I2MB 4GM9A 2IAAA 3I89A 4GM8A 3ZE1A 4YVDA 3PSLA 3PXSD 4H5IA 4Y7RA 2HKRA 5HE0B 4FA9D 5K19A 3EQ9A 4GZ8A 5EM2B 3VH0A 3IUMA 3I7PA 5GXHA 3K26A 1N6DA 1B9YA 4IMMA 4AOWA 2YB8B 3I7OA 2YNNA 5CXBB 4PSWB 3FRXA 1GOFA 4A08B 2XE4A 4FA1D 5HDBA 1N6EA 3SBPA 5M61A 3F3PA 1TBGA 3MKSB 2Z2OA 4QAMA 1T2XA 1K3IA 3UKUC 4AEZA 2QZPA 4J78A 5TF2A 4A11A 3MXXA 3FM0A 4N14A 2YBAA 4BCDA 3UVOA 4JSXC 4GM3A 2AGZA 3AL8A 3SJLD 3PE7A 3IJ1A 3EI1B 3B7FA 2IUPA 3EI3B 3O4JA 5C86A 2H9NA 1U8CA 4KFMB 4UM9A 4QL1A 1VZ2A 2XL3A 1YR2A 1GOTB 4E5ZA 3SBRA 4UI9R 3UVLA 5EAPA 5TEEA 5KDOB 3EU7A 1GXRA 2OVPB 1L0QA 3O4HA 1UTCA 4J0WA 5HYNB 4DNWA 5FLXg 4MMZA 4JSVC 5H14A 1PI6A 2XZGA 2I3SA 4A7JA 1SHYB 5K1CC 2YNPA 4FHLA 3FCUA 3HFQA 3RFGA 3JZGA 2OIZA 2H6QA 2QR5A 2I0RA 4X61B 4XEIC 3PVUB 5FKRA 4IA9A 3PVWB 2HU5A 2EBSA 4K3ID 5CXBA 3RMZD 1MG2A 2CN3A 2HU7A 4FA5D 3V5WB 1JOFA 4J0XA 4JHPC 3V7DB 3SCYA 4XYIA 3IURA 3V4VA 4BUJC 4NAAA 3A0FA 4LG9A 2IURA 4NENA 5AMSA 1U2VC 1BPOA 5I5JA 4QQEA 3OW8A 4CZVA 2CO0C 3JRPA 4JHNA 3VGZA 3AL8B 1VE7A 2PM9A 4J8GA 4AMZA 4IRZA 5CYKA 4ZOVA 1NEXB 2VZ1A 3EI1A 3DXKC 5FA5B 3ZDYA 5JWZA 5M5UA 4Z8LA 4BP9A 3N0EA 5I5MA 3RN0D 4JXMA 3V9FA 1JJUB 2Z2PA 2MTAH 2B5NA 4QT8A 1H2YA 4E5ZB 2OK4A 3IUJA 3C75H 2H3XA 4J8BA 4WJKA 3ZDZA 1OLZA 3AFCA 5IGQA 4PBZA 4EWRA 4JSNC 3I7KA 5C9ZB 3PSCB 3I7NA 1YFQA 4J86A 2P9NC 4Y5RD 4H5JA 3I8CA 3IUQA 3GREA 4O45A 1MDAH 3UVNA 2HESX 2VDPA 3BG1A 2EIDA 4J84A 3I2NA 2VZ3A 1C9IA 3IJCA 3OKWA 3W15A 1XIPA 4Z7NA 3IUNA 4MK0B 2PM6B 1QNIA 5IC7A 1JMZB 1Q47A 3PXWD 5GXIA 3IVMA 2YNOA 5FKTA 3DWLC 3KRWB 5EMMB 3NVXA 1XHMA 1N6FA 3O4GA 1PBYB 4O1QD 2XDWA 2HKMA 2PBIB 3CFSB 1R5MA 3DM0A 3EI2A 4L1MA 2QC5A 3DSMA 5FKQA 2H68A 3JZNA 4DNVA 4GGAA 2I0TA 3KCIA 1ERJA 4J81A 4O3TB 4X3EA 2XYIA 4D9SA 2AGYA 2PM7B 2PM9B 3SLED 3OL2B 5TDHB 2WQ8A 5CYKB 5H1MA 4ZOXA 4L1QD 2OK6A 4GQ2P 3IIYA 3MMYA 4JSPC 4WK2A 2AH1A 4ZOZA 4O02A 5TEFA 2J57G 2YMUA 4A2MA 1H2ZA 2W18A 3C99A 3SVWD 3GC3B 4ERZA 2VDNA 2HXCA 2VDKA 2HU8A 4RE6A 4BCCA 1O6GA 3T3PA 2CNXA 2B4EA 3SMRA 3NVNA 4CI8A 4GQ1A 3O4IA 3SBQA 4J82A 3ORVD 4J77A 2P9IC 3F3GA 5HE2B 3GFCA 2Q7QA 4Z7OA 5M5VA 3JAMg 3NIFA 2H9PA 2HJBA 4CY5A 2VDLA 1E8NA 3ZE2A 2EICA 1E5TA 5C92A 1VZ3A 1L5GA 2GNQA 1QFMA 3FCSA 2P9KC 5E6RA 4AX4A 2AH0A 1SQJA 2AGWA 4BL0A 2CO0A 2VC2A 3ULEC 3MVDK 3F3FA 4J73A 4CI2A 4X60B 4JT5C 3MUNA 1VE6A 4PC0A 3FGBA 2OJYA 5M5SA 3OKYB 1A12A 3EI2B 3DDUA 3L4MD 4A0AA 2VDOA 4GQBB 2IUQA 5B4WA 2HJ4A 4GMBA 2H6NA 4AMYA 5M5RA 1S4UX 1GG2B 3MUOA 4AN0A 2BKLA 1E8MA 2I3TA 2EIEA 2GC7A 5E6SA 4D0KA 3OL2A 2CN2A 3RRMC 4A09A 4DNUA 1M1XA 5E6UA 4AN1A 1GP2B 5C2VB 3QHYB 4FB1D 2OVQB 2P9UC 4ZOYA 5A2Qg 1RI6A 3I8EA 5I5IA 1UOOA 3OF7A 2TRCB 3J80g 2H9MA 3V4PA 4CI1A 5EMLB 2H47A 4UM8A 2H9LA 2UZXB 2XU7A 4NBMA 3UVMA 3JB9L 5IJ7E 2XL2A 4J87A 5GSAA 5GMKn 3ODTA 3UR4A 5C2WB 2VDMA 2JKXA 4FWWA 3SXTD 2EIBA 5IJ8E 5FQDA 3EG6A 4FAND 4K3JB 4OZUA 4G1MA 3CIKB 4MMXA 4CY1A 3DXMC 2H6KA 3EMHA 4PXWA 4G1EA 5CXCA 4CZXA 3OKYA 3C9CA 2IWKA 5AFU3 4A0AB 4PNKB 4HDJA 1PEVA 4CZYA 3J81g 4O2WA 4Z7QA 3CFVA 4G55A 3AH8B 2J56H 4FA4D 4A0BA 4ERQA 4LGNA 5EARA 5IGOA 5EAMA 2O9KA 1MG3A 2H13A 2GC4A 2HYEA 1TYEA 1H2WA 1GOHA 1TYQC 5IT9g 3L4OD 3VI4A 4A09B 4LG8A 4A2LA 2G9AA 4CY2A 3K71A 3SWSD 2H14A 4BCBA 2CE8A 2B5LA 3OTTA 3I7HA 4BH6A 2P9SC 4U7AA 1JV2A 4QRJA 4E54A 3SFZA 3P4FA 4ZN4A 5EMJB 3T3MA 4OWRA 3ZWLB 3PXTD 1U4CA
chains in the Genus database with same CATH topology
3MZKA 3IKOA 2AQ5A 4X63B 3RSEC 4L3HD 3EI4A 1K32A 3MKQA 2P9PC 4CC9A 4FAVD 4O9DA 3JROA 4ESGA 4JD2C 5FKSA 3I7LA 3EWEA 4L9OA 5HQGA 3E0CA 5THAA 3JPXA 3N0DA 3OKTA 4GGCA 4G56B 5FXYA 4PBYA 3BWSA 4R7AB 3RLMD 4D6VA 1P22A 2Z2NA 1OMWB 3U4YA 5HE1B 1XKSA 3UVKA 4CI3A 2I0SA 2QXVA 3RN1D 4PSXB 5EALA 5CXCB 2BBKH 4ES0A 2OVRB 3NVQA 3MZLA 5SXMA 3AL9A 4TZ4A 3C5MA 4CY3A 4O3UB 4A0BB 5EM2A 3K27A 4J79A 1B9XA 3UKRC 3SHFA 3VA6A 3KRXB 4XYHA 1VYHC 5EMKB 4A08A 4L3GD 5AJAA 3IJ0A 5H17A 5HE3B 4E54B 2CE9A 2UZYB 1NR0A 4A11B 4NSXA 4JT6C 2BCJB 4GGDA 3EI4B 2IWFA 2IUVA 4ERYA 1K8KC 3RFHA 3SN6B 3IIWA 3EI3A 3JZHA 2J55H 4I79A 2AGLA 1FWXA 2P9LC 3BG0A 2AGXA 1PGUA 4U1EI 1SQ9A 2B5MA 1JMXB 2G99A 1A0RB 4GM9A 2IAAA 3I89A 4GM8A 4YVDA 3PSLA 3PXSD 4H5IA 4Y7RA 2HKRA 5HE0B 4FA9D 5K19A 4GZ8A 5EM2B 3VH0A 3I7PA 5GXHA 3K26A 1N6DA 1B9YA 4IMMA 4AOWA 2YB8B 3I7OA 2YNNA 5CXBB 4PSWB 3FRXA 4A08B 4FA1D 1N6EA 3SBPA 3F3PA 1TBGA 3MKSB 2Z2OA 3UKUC 4AEZA 4J78A 5TF2A 4A11A 3MXXA 3FM0A 4N14A 2YBAA 3UVOA 4JSXC 4GM3A 2AGZA 3AL8A 3SJLD 3PE7A 3IJ1A 3EI1B 3B7FA 2IUPA 3EI3B 2H9NA 4KFMB 4QL1A 2XL3A 1GOTB 4E5ZA 3SBRA 4UI9R 3UVLA 5EAPA 5TEEA 5KDOB 3EU7A 1GXRA 2OVPB 1L0QA 4J0WA 5HYNB 5FLXg 4JSVC 5H14A 1PI6A 2I3SA 4A7JA 1SHYB 5K1CC 2YNPA 4FHLA 3HFQA 3RFGA 3JZGA 2OIZA 2H6QA 4XEIC 2I0RA 4X61B 3PVUB 5FKRA 4IA9A 3PVWB 2EBSA 4K3ID 5CXBA 3RMZD 1MG2A 2CN3A 4FA5D 3V5WB 1JOFA 4J0XA 3V7DB 3SCYA 4XYIA 4BUJC 3A0FA 4LG9A 2IURA 5AMSA 5I5JA 1U2VC 4QQEA 3OW8A 4CZVA 2CO0C 3JRPA 3VGZA 3AL8B 2PM9A 4J8GA 5CYKA 4ZOVA 1NEXB 3EI1A 3DXKC 5FA5B 5JWZA 4Z8LA 3N0EA 5I5MA 3RN0D 4JXMA 3V9FA 1JJUB 2Z2PA 2MTAH 2B5NA 4QT8A 4E5ZB 2OK4A 3C75H 2H3XA 4J8BA 1OLZA 3AFCA 5IGQA 4PBZA 4EWRA 4JSNC 3I7KA 5C9ZB 3PSCB 3I7NA 1YFQA 4J86A 2P9NC 4Y5RD 4H5JA 3I8CA 4O45A 3GREA 1MDAH 3UVNA 2HESX 3BG1A 4J84A 3I2NA 3IJCA 3OKWA 3W15A 1XIPA 4MK0B 2PM6B 1QNIA 5IC7A 1JMZB 1Q47A 3PXWD 5GXIA 2YNOA 5FKTA 3DWLC 3KRWB 5EMMB 3NVXA 1XHMA 1N6FA 1PBYB 4O1QD 2HKMA 2PBIB 3CFSB 1R5MA 3DM0A 3EI2A 2QC5A 3DSMA 5FKQA 2H68A 3JZNA 4GGAA 2I0TA 1ERJA 4J81A 4O3TB 4X3EA 2XYIA 2AGYA 2PM7B 2PM9B 3SLED 3OL2B 5TDHB 5CYKB 5H1MA 4ZOXA 4L1QD 2OK6A 4GQ2P 3IIYA 3MMYA 4JSPC 2AH1A 4ZOZA 5TEFA 2J57G 2YMUA 4A2MA 2W18A 3C99A 3SVWD 4ERZA 2HXCA 2CNXA 2B4EA 3SMRA 3NVNA 4CI8A 4GQ1A 3SBQA 4J82A 4J77A 3ORVD 2P9IC 3F3GA 5HE2B 3GFCA 2Q7QA 3JAMg 2H9PA 2HJBA 4CY5A 2GNQA 2P9KC 2AH0A 1SQJA 2AGWA 4BL0A 2CO0A 3ULEC 3F3FA 4J73A 4CI2A 4X60B 4JT5C 4PC0A 3FGBA 2OJYA 3OKYB 3EI2B 3L4MD 4A0AA 4GQBB 2IUQA 5B4WA 2HJ4A 4GMBA 2H6NA 1S4UX 1GG2B 2I3TA 2GC7A 4D0KA 3OL2A 2CN2A 3RRMC 4A09A 1GP2B 5C2VB 4FB1D 2OVQB 2P9UC 4ZOYA 5A2Qg 1RI6A 3I8EA 5I5IA 2TRCB 3J80g 2H9MA 4CI1A 5EMLB 2H47A 2H9LA 2UZXB 2XU7A 3JB9L 3UVMA 5IJ7E 2XL2A 4J87A 5GSAA 5GMKn 3ODTA 3UR4A 5C2WB 3SXTD 4FWWA 5IJ8E 5FQDA 3EG6A 4FAND 4K3JB 4OZUA 3CIKB 4CY1A 3DXMC 2H6KA 3EMHA 4PXWA 5CXCA 4CZXA 3OKYA 3C9CA 2IWKA 5AFU3 4A0AB 4PNKB 4HDJA 1PEVA 4CZYA 3J81g 3CFVA 3AH8B 2J56H 4FA4D 4A0BA 4ERQA 4LGNA 5EARA 5IGOA 5EAMA 2O9KA 1MG3A 2H13A 2GC4A 2HYEA 1TYQC 5IT9g 3L4OD 4A09B 4LG8A 4A2LA 2G9AA 4CY2A 3SWSD 2H14A 2CE8A 2B5LA 3OTTA 3I7HA 4BH6A 2P9SC 4U7AA 4QRJA 4E54A 3SFZA 3P4FA 4ZN4A 5EMJB 4OWRA 3ZWLB 3PXTD 1U4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZK A;  3IKO A;  2AQ5 A;  4X63 B;  3RSE C;  4L3H D;  3EI4 A;  1K32 A;  3MKQ A;  2P9P C;  4CC9 A;  4FAV D;  4O9D A;  3JRO A;  4ESG A;  4JD2 C;  5FKS A;  3I7L A;  3EWE A;  4L9O A;  5HQG A;  3E0C A;  5THA A;  3JPX A;  3N0D A;  3OKT A;  4GGC A;  4G56 B;  5FXY A;  4PBY A;  3BWS A;  4R7A B;  3RLM D;  4D6V A;  1P22 A;  2Z2N A;  1OMW B;  3U4Y A;  5HE1 B;  1XKS A;  3UVK A;  4CI3 A;  2I0S A;  2QXV A;  3RN1 D;  4PSX B;  5EAL A;  5CXC B;  2BBK H;  4ES0 A;  2OVR B;  3NVQ A;  3MZL A;  5SXM A;  3AL9 A;  4TZ4 A;  3C5M A;  4CY3 A;  4O3U B;  4A0B B;  5EM2 A;  3K27 A;  4J79 A;  1B9X A;  3UKR C;  3SHF A;  3VA6 A;  3KRX B;  4XYH A;  1VYH C;  5EMK B;  4A08 A;  4L3G D;  5AJA A;  3IJ0 A;  5H17 A;  5HE3 B;  4E54 B;  2CE9 A;  2UZY B;  1NR0 A;  4A11 B;  4NSX A;  4JT6 C;  2BCJ B;  4GGD A;  3EI4 B;  2IWF A;  2IUV A;  4ERY A;  1K8K C;  3RFH A;  3SN6 B;  3IIW A;  3EI3 A;  3JZH A;  2J55 H;  4I79 A;  2AGL A;  1FWX A;  2P9L C;  3BG0 A;  2AGX A;  1PGU A;  4U1E I;  1SQ9 A;  2B5M A;  1JMX B;  2G99 A;  1A0R B;  4GM9 A;  2IAA A;  3I89 A;  4GM8 A;  4YVD A;  3PSL A;  3PXS D;  4H5I A;  4Y7R A;  2HKR A;  5HE0 B;  4FA9 D;  5K19 A;  4GZ8 A;  5EM2 B;  3VH0 A;  3I7P A;  5GXH A;  3K26 A;  1N6D A;  1B9Y A;  4IMM A;  4AOW A;  2YB8 B;  3I7O A;  2YNN A;  5CXB B;  4PSW B;  3FRX A;  4A08 B;  4FA1 D;  1N6E A;  3SBP A;  3F3P A;  1TBG A;  3MKS B;  2Z2O A;  3UKU C;  4AEZ A;  4J78 A;  5TF2 A;  4A11 A;  3MXX A;  3FM0 A;  4N14 A;  2YBA A;  3UVO A;  4JSX C;  4GM3 A;  2AGZ A;  3AL8 A;  3SJL D;  3PE7 A;  3IJ1 A;  3EI1 B;  3B7F A;  2IUP A;  3EI3 B;  2H9N A;  4KFM B;  4QL1 A;  2XL3 A;  1GOT B;  4E5Z A;  3SBR A;  4UI9 R;  3UVL A;  5EAP A;  5TEE A;  5KDO B;  3EU7 A;  1GXR A;  2OVP B;  1L0Q A;  4J0W A;  5HYN B;  5FLX g;  4JSV C;  5H14 A;  1PI6 A;  2I3S A;  4A7J A;  1SHY B;  5K1C C;  2YNP A;  4FHL A;  3HFQ A;  3RFG A;  3JZG A;  2OIZ A;  2H6Q A;  4XEI C;  2I0R A;  4X61 B;  3PVU B;  5FKR A;  4IA9 A;  3PVW B;  2EBS A;  4K3I D;  5CXB A;  3RMZ D;  1MG2 A;  2CN3 A;  4FA5 D;  3V5W B;  1JOF A;  4J0X A;  3V7D B;  3SCY A;  4XYI A;  4BUJ C;  3A0F A;  4LG9 A;  2IUR A;  5AMS A;  5I5J A;  1U2V C;  4QQE A;  3OW8 A;  4CZV A;  2CO0 C;  3JRP A;  3VGZ A;  3AL8 B;  2PM9 A;  4J8G A;  5CYK A;  4ZOV A;  1NEX B;  3EI1 A;  3DXK C;  5FA5 B;  5JWZ A;  4Z8L A;  3N0E A;  5I5M A;  3RN0 D;  4JXM A;  3V9F A;  1JJU B;  2Z2P A;  2MTA H;  2B5N A;  4QT8 A;  4E5Z B;  2OK4 A;  3C75 H;  2H3X A;  4J8B A;  1OLZ A;  3AFC A;  5IGQ A;  4PBZ A;  4EWR A;  4JSN C;  3I7K A;  5C9Z B;  3PSC B;  3I7N A;  1YFQ A;  4J86 A;  2P9N C;  4Y5R D;  4H5J A;  3I8C A;  4O45 A;  3GRE A;  1MDA H;  3UVN A;  2HES X;  3BG1 A;  4J84 A;  3I2N A;  3IJC A;  3OKW A;  3W15 A;  1XIP A;  4MK0 B;  2PM6 B;  1QNI A;  5IC7 A;  1JMZ B;  1Q47 A;  3PXW D;  5GXI A;  2YNO A;  5FKT A;  3DWL C;  3KRW B;  5EMM B;  3NVX A;  1XHM A;  1N6F A;  1PBY B;  4O1Q D;  2HKM A;  2PBI B;  3CFS B;  1R5M A;  3DM0 A;  3EI2 A;  2QC5 A;  3DSM A;  5FKQ A;  2H68 A;  3JZN A;  4GGA A;  2I0T A;  1ERJ A;  4J81 A;  4O3T B;  4X3E A;  2XYI A;  2AGY A;  2PM7 B;  2PM9 B;  3SLE D;  3OL2 B;  5TDH B;  5CYK B;  5H1M A;  4ZOX A;  4L1Q D;  2OK6 A;  4GQ2 P;  3IIY A;  3MMY A;  4JSP C;  2AH1 A;  4ZOZ A;  5TEF A;  2J57 G;  2YMU A;  4A2M A;  2W18 A;  3C99 A;  3SVW D;  4ERZ A;  2HXC A;  2CNX A;  2B4E A;  3SMR A;  3NVN A;  4CI8 A;  4GQ1 A;  3SBQ A;  4J82 A;  4J77 A;  3ORV D;  2P9I C;  3F3G A;  5HE2 B;  3GFC A;  2Q7Q A;  3JAM g;  2H9P A;  2HJB A;  4CY5 A;  2GNQ A;  2P9K C;  2AH0 A;  1SQJ A;  2AGW A;  4BL0 A;  2CO0 A;  3ULE C;  3F3F A;  4J73 A;  4CI2 A;  4X60 B;  4JT5 C;  4PC0 A;  3FGB A;  2OJY A;  3OKY B;  3EI2 B;  3L4M D;  4A0A A;  4GQB B;  2IUQ A;  5B4W A;  2HJ4 A;  4GMB A;  2H6N A;  1S4U X;  1GG2 B;  2I3T A;  2GC7 A;  4D0K A;  3OL2 A;  2CN2 A;  3RRM C;  4A09 A;  1GP2 B;  5C2V B;  4FB1 D;  2OVQ B;  2P9U C;  4ZOY A;  5A2Q g;  1RI6 A;  3I8E A;  5I5I A;  2TRC B;  3J80 g;  2H9M A;  4CI1 A;  5EML B;  2H47 A;  2H9L A;  2UZX B;  2XU7 A;  3JB9 L;  3UVM A;  5IJ7 E;  2XL2 A;  4J87 A;  5GSA A;  5GMK n;  3ODT A;  3UR4 A;  5C2W B;  3SXT D;  4FWW A;  5IJ8 E;  5FQD A;  3EG6 A;  4FAN D;  4K3J B;  4OZU A;  3CIK B;  4CY1 A;  3DXM C;  2H6K A;  3EMH A;  4PXW A;  5CXC A;  4CZX A;  3OKY A;  3C9C A;  2IWK A;  5AFU 3;  4A0A B;  4PNK B;  4HDJ A;  1PEV A;  4CZY A;  3J81 g;  3CFV A;  3AH8 B;  2J56 H;  4FA4 D;  4A0B A;  4ERQ A;  4LGN A;  5EAR A;  5IGO A;  5EAM A;  2O9K A;  1MG3 A;  2H13 A;  2GC4 A;  2HYE A;  1TYQ C;  5IT9 g;  3L4O D;  4A09 B;  4LG8 A;  4A2L A;  2G9A A;  4CY2 A;  3SWS D;  2H14 A;  2CE8 A;  2B5L A;  3OTT A;  3I7H A;  4BH6 A;  2P9S C;  4U7A A;  4QRJ A;  4E54 A;  3SFZ A;  3P4F A;  4ZN4 A;  5EMJ B;  4OWR A;  3ZWL B;  3PXT D;  1U4C A; 
#chains in the Genus database with same CATH topology
 3MZK A;  4MMY A;  3IKO A;  2AQ5 A;  4X63 B;  3RSE C;  4L3H D;  3EI4 A;  1K32 A;  3MKQ A;  2P9P C;  2VDQ A;  4CC9 A;  4FAV D;  4O9D A;  3JRO A;  4ESG A;  4JD2 C;  5FKS A;  3I7L A;  3EWE A;  4L9O A;  1UOQ A;  5HQG A;  3VI3 A;  3E0C A;  3NID A;  5THA A;  3JPX A;  3K6S A;  3N0D A;  3OKT A;  4GGC A;  4G56 B;  5FXY A;  1O6F A;  3K72 A;  4WK0 A;  4PBY A;  3BWS A;  3GD1 I;  4R7A B;  3RLM D;  4D6V A;  1P22 A;  2Z2N A;  1OMW B;  3U4Y A;  5HE1 B;  1H2X A;  1XKS A;  3UVK A;  4CI3 A;  2I0S A;  2QXV A;  3RN1 D;  4PSX B;  5EAL A;  5CXC B;  2BBK H;  4WK4 A;  4ES0 A;  2OVR B;  3NVQ A;  3MZL A;  4BP8 A;  5SXM A;  3AL9 A;  1UOP A;  4TZ4 A;  3C5M A;  4CY3 A;  4O3U B;  4A0B B;  5EM2 A;  3K27 A;  4NC4 A;  1GOG A;  4J79 A;  1B9X A;  3UKR C;  3SHF A;  3EQ8 A;  3VA6 A;  3KRX B;  4XYH A;  1VYH C;  5EMK B;  3IJE A;  4A08 A;  3ZE0 A;  5M5T A;  2VDR A;  4L3G D;  1C9L A;  5AJA A;  4RE5 A;  3IJ0 A;  5H17 A;  5HE3 B;  4E54 B;  2CE9 A;  2UZY B;  1NR0 A;  4A11 B;  4NSX A;  3ZDX A;  4JT6 C;  2BCJ B;  4GGD A;  3EI4 B;  2IWF A;  2IUV A;  4ERY A;  5FFO A;  1QFS A;  1K8K C;  3RFH A;  3SN6 B;  3IIW A;  3NIG A;  3EI3 A;  3EQ7 A;  3IUL A;  3JZH A;  1JTD B;  2J55 H;  4I79 A;  2AGL A;  1FWX A;  2P9L C;  3QI0 A;  3BG0 A;  2AGX A;  1PGU A;  5FFG A;  4U1E I;  1SQ9 A;  2B5M A;  1JMX B;  2G99 A;  1A0R B;  1I2M B;  4GM9 A;  2IAA A;  3I89 A;  4GM8 A;  3ZE1 A;  4YVD A;  3PSL A;  3PXS D;  4H5I A;  4Y7R A;  2HKR A;  5HE0 B;  4FA9 D;  5K19 A;  3EQ9 A;  4GZ8 A;  5EM2 B;  3VH0 A;  3IUM A;  3I7P A;  5GXH A;  3K26 A;  1N6D A;  1B9Y A;  4IMM A;  4AOW A;  2YB8 B;  3I7O A;  2YNN A;  5CXB B;  4PSW B;  3FRX A;  1GOF A;  4A08 B;  2XE4 A;  4FA1 D;  5HDB A;  1N6E A;  3SBP A;  5M61 A;  3F3P A;  1TBG A;  3MKS B;  2Z2O A;  4QAM A;  1T2X A;  1K3I A;  3UKU C;  4AEZ A;  2QZP A;  4J78 A;  5TF2 A;  4A11 A;  3MXX A;  3FM0 A;  4N14 A;  2YBA A;  4BCD A;  3UVO A;  4JSX C;  4GM3 A;  2AGZ A;  3AL8 A;  3SJL D;  3PE7 A;  3IJ1 A;  3EI1 B;  3B7F A;  2IUP A;  3EI3 B;  3O4J A;  5C86 A;  2H9N A;  1U8C A;  4KFM B;  4UM9 A;  4QL1 A;  1VZ2 A;  2XL3 A;  1YR2 A;  1GOT B;  4E5Z A;  3SBR A;  4UI9 R;  3UVL A;  5EAP A;  5TEE A;  5KDO B;  3EU7 A;  1GXR A;  2OVP B;  1L0Q A;  3O4H A;  1UTC A;  4J0W A;  5HYN B;  4DNW A;  5FLX g;  4MMZ A;  4JSV C;  5H14 A;  1PI6 A;  2XZG A;  2I3S A;  4A7J A;  1SHY B;  5K1C C;  2YNP A;  4FHL A;  3FCU A;  3HFQ A;  3RFG A;  3JZG A;  2OIZ A;  2H6Q A;  2QR5 A;  2I0R A;  4X61 B;  4XEI C;  3PVU B;  5FKR A;  4IA9 A;  3PVW B;  2HU5 A;  2EBS A;  4K3I D;  5CXB A;  3RMZ D;  1MG2 A;  2CN3 A;  2HU7 A;  4FA5 D;  3V5W B;  1JOF A;  4J0X A;  4JHP C;  3V7D B;  3SCY A;  4XYI A;  3IUR A;  3V4V A;  4BUJ C;  4NAA A;  3A0F A;  4LG9 A;  2IUR A;  4NEN A;  5AMS A;  1U2V C;  1BPO A;  5I5J A;  4QQE A;  3OW8 A;  4CZV A;  2CO0 C;  3JRP A;  4JHN A;  3VGZ A;  3AL8 B;  1VE7 A;  2PM9 A;  4J8G A;  4AMZ A;  4IRZ A;  5CYK A;  4ZOV A;  1NEX B;  2VZ1 A;  3EI1 A;  3DXK C;  5FA5 B;  3ZDY A;  5JWZ A;  5M5U A;  4Z8L A;  4BP9 A;  3N0E A;  5I5M A;  3RN0 D;  4JXM A;  3V9F A;  1JJU B;  2Z2P A;  2MTA H;  2B5N A;  4QT8 A;  1H2Y A;  4E5Z B;  2OK4 A;  3IUJ A;  3C75 H;  2H3X A;  4J8B A;  4WJK A;  3ZDZ A;  1OLZ A;  3AFC A;  5IGQ A;  4PBZ A;  4EWR A;  4JSN C;  3I7K A;  5C9Z B;  3PSC B;  3I7N A;  1YFQ A;  4J86 A;  2P9N C;  4Y5R D;  4H5J A;  3I8C A;  3IUQ A;  3GRE A;  4O45 A;  1MDA H;  3UVN A;  2HES X;  2VDP A;  3BG1 A;  2EID A;  4J84 A;  3I2N A;  2VZ3 A;  1C9I A;  3IJC A;  3OKW A;  3W15 A;  1XIP A;  4Z7N A;  3IUN A;  4MK0 B;  2PM6 B;  1QNI A;  5IC7 A;  1JMZ B;  1Q47 A;  3PXW D;  5GXI A;  3IVM A;  2YNO A;  5FKT A;  3DWL C;  3KRW B;  5EMM B;  3NVX A;  1XHM A;  1N6F A;  3O4G A;  1PBY B;  4O1Q D;  2XDW A;  2HKM A;  2PBI B;  3CFS B;  1R5M A;  3DM0 A;  3EI2 A;  4L1M A;  2QC5 A;  3DSM A;  5FKQ A;  2H68 A;  3JZN A;  4DNV A;  4GGA A;  2I0T A;  3KCI A;  1ERJ A;  4J81 A;  4O3T B;  4X3E A;  2XYI A;  4D9S A;  2AGY A;  2PM7 B;  2PM9 B;  3SLE D;  3OL2 B;  5TDH B;  2WQ8 A;  5CYK B;  5H1M A;  4ZOX A;  4L1Q D;  2OK6 A;  4GQ2 P;  3IIY A;  3MMY A;  4JSP C;  4WK2 A;  2AH1 A;  4ZOZ A;  4O02 A;  5TEF A;  2J57 G;  2YMU A;  4A2M A;  1H2Z A;  2W18 A;  3C99 A;  3SVW D;  3GC3 B;  4ERZ A;  2VDN A;  2HXC A;  2VDK A;  2HU8 A;  4RE6 A;  4BCC A;  1O6G A;  3T3P A;  2CNX A;  2B4E A;  3SMR A;  3NVN A;  4CI8 A;  4GQ1 A;  3O4I A;  3SBQ A;  4J82 A;  3ORV D;  4J77 A;  2P9I C;  3F3G A;  5HE2 B;  3GFC A;  2Q7Q A;  4Z7O A;  5M5V A;  3JAM g;  3NIF A;  2H9P A;  2HJB A;  4CY5 A;  2VDL A;  1E8N A;  3ZE2 A;  2EIC A;  1E5T A;  5C92 A;  1VZ3 A;  1L5G A;  2GNQ A;  1QFM A;  3FCS A;  2P9K C;  5E6R A;  4AX4 A;  2AH0 A;  1SQJ A;  2AGW A;  4BL0 A;  2CO0 A;  2VC2 A;  3ULE C;  3MVD K;  3F3F A;  4J73 A;  4CI2 A;  4X60 B;  4JT5 C;  3MUN A;  1VE6 A;  4PC0 A;  3FGB A;  2OJY A;  5M5S A;  3OKY B;  1A12 A;  3EI2 B;  3DDU A;  3L4M D;  4A0A A;  2VDO A;  4GQB B;  2IUQ A;  5B4W A;  2HJ4 A;  4GMB A;  2H6N A;  4AMY A;  5M5R A;  1S4U X;  1GG2 B;  3MUO A;  4AN0 A;  2BKL A;  1E8M A;  2I3T A;  2EIE A;  2GC7 A;  5E6S A;  4D0K A;  3OL2 A;  2CN2 A;  3RRM C;  4A09 A;  4DNU A;  1M1X A;  5E6U A;  4AN1 A;  1GP2 B;  5C2V B;  3QHY B;  4FB1 D;  2OVQ B;  2P9U C;  4ZOY A;  5A2Q g;  1RI6 A;  3I8E A;  5I5I A;  1UOO A;  3OF7 A;  2TRC B;  3J80 g;  2H9M A;  3V4P A;  4CI1 A;  5EML B;  2H47 A;  4UM8 A;  2H9L A;  2UZX B;  2XU7 A;  4NBM A;  3UVM A;  3JB9 L;  5IJ7 E;  2XL2 A;  4J87 A;  5GSA A;  5GMK n;  3ODT A;  3UR4 A;  5C2W B;  2VDM A;  2JKX A;  4FWW A;  3SXT D;  2EIB A;  5IJ8 E;  5FQD A;  3EG6 A;  4FAN D;  4K3J B;  4OZU A;  4G1M A;  3CIK B;  4MMX A;  4CY1 A;  3DXM C;  2H6K A;  3EMH A;  4PXW A;  4G1E A;  5CXC A;  4CZX A;  3OKY A;  3C9C A;  2IWK A;  5AFU 3;  4A0A B;  4PNK B;  4HDJ A;  1PEV A;  4CZY A;  3J81 g;  4O2W A;  4Z7Q A;  3CFV A;  4G55 A;  3AH8 B;  2J56 H;  4FA4 D;  4A0B A;  4ERQ A;  4LGN A;  5EAR A;  5IGO A;  5EAM A;  2O9K A;  1MG3 A;  2H13 A;  2GC4 A;  2HYE A;  1TYE A;  1H2W A;  1GOH A;  1TYQ C;  5IT9 g;  3L4O D;  3VI4 A;  4A09 B;  4LG8 A;  4A2L A;  2G9A A;  4CY2 A;  3K71 A;  3SWS D;  2H14 A;  4BCB A;  2CE8 A;  2B5L A;  3OTT A;  3I7H A;  4BH6 A;  2P9S C;  4U7A A;  1JV2 A;  4QRJ A;  4E54 A;  3SFZ A;  3P4F A;  4ZN4 A;  5EMJ B;  3T3M A;  4OWR A;  3ZWL B;  3PXT D;  1U4C A; 
#chains in the Genus database with same CATH homology
 3MZK A;  3IKO A;  2AQ5 A;  4X63 B;  3RSE C;  4L3H D;  3EI4 A;  1K32 A;  3MKQ A;  2P9P C;  4CC9 A;  4FAV D;  4O9D A;  3JRO A;  4ESG A;  4JD2 C;  5FKS A;  3I7L A;  3EWE A;  4L9O A;  5HQG A;  3E0C A;  5THA A;  3JPX A;  3N0D A;  3OKT A;  4GGC A;  4G56 B;  5FXY A;  4PBY A;  3BWS A;  4R7A B;  3RLM D;  4D6V A;  1P22 A;  2Z2N A;  1OMW B;  3U4Y A;  5HE1 B;  1XKS A;  3UVK A;  4CI3 A;  2I0S A;  2QXV A;  3RN1 D;  4PSX B;  5EAL A;  5CXC B;  2BBK H;  4ES0 A;  2OVR B;  3NVQ A;  3MZL A;  5SXM A;  3AL9 A;  4TZ4 A;  3C5M A;  4CY3 A;  4O3U B;  4A0B B;  5EM2 A;  3K27 A;  4J79 A;  1B9X A;  3UKR C;  3SHF A;  3VA6 A;  3KRX B;  4XYH A;  1VYH C;  5EMK B;  4A08 A;  4L3G D;  5AJA A;  3IJ0 A;  5H17 A;  5HE3 B;  4E54 B;  2CE9 A;  2UZY B;  1NR0 A;  4A11 B;  4NSX A;  4JT6 C;  2BCJ B;  4GGD A;  3EI4 B;  2IWF A;  2IUV A;  4ERY A;  1K8K C;  3RFH A;  3SN6 B;  3IIW A;  3EI3 A;  3JZH A;  2J55 H;  4I79 A;  2AGL A;  1FWX A;  2P9L C;  3BG0 A;  2AGX A;  1PGU A;  4U1E I;  1SQ9 A;  2B5M A;  1JMX B;  2G99 A;  1A0R B;  4GM9 A;  2IAA A;  3I89 A;  4GM8 A;  4YVD A;  3PSL A;  3PXS D;  4H5I A;  4Y7R A;  2HKR A;  5HE0 B;  4FA9 D;  5K19 A;  4GZ8 A;  5EM2 B;  3VH0 A;  3I7P A;  5GXH A;  3K26 A;  1N6D A;  1B9Y A;  4IMM A;  4AOW A;  2YB8 B;  3I7O A;  2YNN A;  5CXB B;  4PSW B;  3FRX A;  4A08 B;  4FA1 D;  1N6E A;  3SBP A;  3F3P A;  1TBG A;  3MKS B;  2Z2O A;  3UKU C;  4AEZ A;  4J78 A;  5TF2 A;  4A11 A;  3MXX A;  3FM0 A;  4N14 A;  2YBA A;  3UVO A;  4JSX C;  4GM3 A;  2AGZ A;  3AL8 A;  3SJL D;  3PE7 A;  3IJ1 A;  3EI1 B;  3B7F A;  2IUP A;  3EI3 B;  2H9N A;  4KFM B;  4QL1 A;  2XL3 A;  1GOT B;  4E5Z A;  3SBR A;  4UI9 R;  3UVL A;  5EAP A;  5TEE A;  5KDO B;  3EU7 A;  1GXR A;  2OVP B;  1L0Q A;  4J0W A;  5HYN B;  5FLX g;  4JSV C;  5H14 A;  1PI6 A;  2I3S A;  4A7J A;  1SHY B;  5K1C C;  2YNP A;  4FHL A;  3HFQ A;  3RFG A;  3JZG A;  2OIZ A;  2H6Q A;  4XEI C;  2I0R A;  4X61 B;  3PVU B;  5FKR A;  4IA9 A;  3PVW B;  2EBS A;  4K3I D;  5CXB A;  3RMZ D;  1MG2 A;  2CN3 A;  4FA5 D;  3V5W B;  1JOF A;  4J0X A;  3V7D B;  3SCY A;  4XYI A;  4BUJ C;  3A0F A;  4LG9 A;  2IUR A;  5AMS A;  5I5J A;  1U2V C;  4QQE A;  3OW8 A;  4CZV A;  2CO0 C;  3JRP A;  3VGZ A;  3AL8 B;  2PM9 A;  4J8G A;  5CYK A;  4ZOV A;  1NEX B;  3EI1 A;  3DXK C;  5FA5 B;  5JWZ A;  4Z8L A;  3N0E A;  5I5M A;  3RN0 D;  4JXM A;  3V9F A;  1JJU B;  2Z2P A;  2MTA H;  2B5N A;  4QT8 A;  4E5Z B;  2OK4 A;  3C75 H;  2H3X A;  4J8B A;  1OLZ A;  3AFC A;  5IGQ A;  4PBZ A;  4EWR A;  4JSN C;  3I7K A;  5C9Z B;  3PSC B;  3I7N A;  1YFQ A;  4J86 A;  2P9N C;  4Y5R D;  4H5J A;  3I8C A;  4O45 A;  3GRE A;  1MDA H;  3UVN A;  2HES X;  3BG1 A;  4J84 A;  3I2N A;  3IJC A;  3OKW A;  3W15 A;  1XIP A;  4MK0 B;  2PM6 B;  1QNI A;  5IC7 A;  1JMZ B;  1Q47 A;  3PXW D;  5GXI A;  2YNO A;  5FKT A;  3DWL C;  3KRW B;  5EMM B;  3NVX A;  1XHM A;  1N6F A;  1PBY B;  4O1Q D;  2HKM A;  2PBI B;  3CFS B;  1R5M A;  3DM0 A;  3EI2 A;  2QC5 A;  3DSM A;  5FKQ A;  2H68 A;  3JZN A;  4GGA A;  2I0T A;  1ERJ A;  4J81 A;  4O3T B;  4X3E A;  2XYI A;  2AGY A;  2PM7 B;  2PM9 B;  3SLE D;  3OL2 B;  5TDH B;  5CYK B;  5H1M A;  4ZOX A;  4L1Q D;  2OK6 A;  4GQ2 P;  3IIY A;  3MMY A;  4JSP C;  2AH1 A;  4ZOZ A;  5TEF A;  2J57 G;  2YMU A;  4A2M A;  2W18 A;  3C99 A;  3SVW D;  4ERZ A;  2HXC A;  2CNX A;  2B4E A;  3SMR A;  3NVN A;  4CI8 A;  4GQ1 A;  3SBQ A;  4J82 A;  4J77 A;  3ORV D;  2P9I C;  3F3G A;  5HE2 B;  3GFC A;  2Q7Q A;  3JAM g;  2H9P A;  2HJB A;  4CY5 A;  2GNQ A;  2P9K C;  2AH0 A;  1SQJ A;  2AGW A;  4BL0 A;  2CO0 A;  3ULE C;  3F3F A;  4J73 A;  4CI2 A;  4X60 B;  4JT5 C;  4PC0 A;  3FGB A;  2OJY A;  3OKY B;  3EI2 B;  3L4M D;  4A0A A;  4GQB B;  2IUQ A;  5B4W A;  2HJ4 A;  4GMB A;  2H6N A;  1S4U X;  1GG2 B;  2I3T A;  2GC7 A;  4D0K A;  3OL2 A;  2CN2 A;  3RRM C;  4A09 A;  1GP2 B;  5C2V B;  4FB1 D;  2OVQ B;  2P9U C;  4ZOY A;  5A2Q g;  1RI6 A;  3I8E A;  5I5I A;  2TRC B;  3J80 g;  2H9M A;  4CI1 A;  5EML B;  2H47 A;  2H9L A;  2UZX B;  2XU7 A;  3JB9 L;  3UVM A;  5IJ7 E;  2XL2 A;  4J87 A;  5GSA A;  5GMK n;  3ODT A;  3UR4 A;  5C2W B;  3SXT D;  4FWW A;  5IJ8 E;  5FQD A;  3EG6 A;  4FAN D;  4K3J B;  4OZU A;  3CIK B;  4CY1 A;  3DXM C;  2H6K A;  3EMH A;  4PXW A;  5CXC A;  4CZX A;  3OKY A;  3C9C A;  2IWK A;  5AFU 3;  4A0A B;  4PNK B;  4HDJ A;  1PEV A;  4CZY A;  3J81 g;  3CFV A;  3AH8 B;  2J56 H;  4FA4 D;  4A0B A;  4ERQ A;  4LGN A;  5EAR A;  5IGO A;  5EAM A;  2O9K A;  1MG3 A;  2H13 A;  2GC4 A;  2HYE A;  1TYQ C;  5IT9 g;  3L4O D;  4A09 B;  4LG8 A;  4A2L A;  2G9A A;  4CY2 A;  3SWS D;  2H14 A;  2CE8 A;  2B5L A;  3OTT A;  3I7H A;  4BH6 A;  2P9S C;  4U7A A;  4QRJ A;  4E54 A;  3SFZ A;  3P4F A;  4ZN4 A;  5EMJ B;  4OWR A;  3ZWL B;  3PXT D;  1U4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...