4FB1D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 60 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transfer
molecule keywords Methylamine utilization protein MauG
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fb1D00
4Y5RD 4CY1A 4IA9A 2B5NA 3L4OD 4GMBA 3VH0A 3SBPA 5H17A 4CZVA 4OZUA 2H9PA 4GGCA 3RRMC 3BG0A 4J79A 1MG3A 1R5MA 3MZKA 5SXMA 3F3FA 3RN0D 4JXMA 3AFCA 3OKTA 1L0QA 5FKRA 4QRJA 4GQBB 1K32A 3PXSD 4K3ID 4GM8A 3IIWA 1MG2A 1JMZB 3A0FA 3UKUC 3AL8B 3JZNA 5EARA 3FGBA 2XL2A 3EMHA 1OLZA 4GGAA 5EALA 2GC4A 5A2Qg 2AH1A 2BBKH 1MDAH 1N6FA 2PM9A 4GZ8A 3RFHA 3V7DB 4AEZA 3EI2B 1FWXA 2AQ5A 3B7FA 3JZHA 1SQJA 5EMLB 4FHLA 3EI4A 4J84A 4Y7RA 2YNPA 4JT5C 4A09B 2G99A 2PM6B 4O1QD 3EU7A 3C9CA 5AFU3 3JAMg 3E0CA 3GREA 1PI6A 5CXCB 3SVWD 5CXBB 3SN6B 5AJAA 2HKRA 3SBQA 4JD2C 3RFGA 1S4UX 2IUPA 4CC9A 3MKSB 4J78A 4PBYA 3RLMD 2J57G 3CFSB 5HYNB 4GM9A 3EI4B 3BG1A 3JRPA 5FXYA 2H68A 4A09A 2OVPB 4CI8A 5IC7A 4YVDA 1B9YA 2UZXB 3PSLA 5GMKn 5C2VB 5K19A 2YB8B 4ES0A 3IIYA 4L3GD 2HESX 4XYIA 5I5JA 2OK4A 5I5IA 1VYHC 1QNIA 2P9NC 4UI9R 3OKWA 3IJ1A 4A0AA 4ZOXA 3V5WB 4BUJC 2I3TA 4CI3A 1XHMA 3U4YA 3N0EA 4G56B 4E5ZA 4U7AA 1PEVA 3C5MA 4A2LA 2P9KC 4L1QD 1SQ9A 3C99A 3UVLA 3I89A 3I7LA 4J86A 4J77A 5GXHA 2EBSA 1SHYB 4X63B 4O45A 3SXTD 4FA4D 3DXKC 3IJCA 2AGXA 4O3UB 4D0KA 1Q47A 2IWFA 4AOWA 3I7KA 4TZ4A 2I0RA 1U2VC 3I7NA 4FWWA 2H9LA 4J87A 3JB9L 4J82A 3NVXA 4FAND 5IT9g 3JPXA 4A0BB 4L9OA 3L4MD 4PSWB 5JWZA 1A0RB 4QL1A 4JSPC 4OWRA 2OVQB 3MMYA 2PM9B 5C9ZB 3SFZA 2CO0C 3KRXB 3JROA 3VGZA 4ZN4A 3MXXA 3V9FA 4A08A 2O9KA 3AL9A 3SCYA 3I8CA 4PNKB 4A2MA 4EWRA 5TEFA 2P9LC 2OJYA 2HJBA 5EM2A 4PBZA 4FB1D 3RMZD 1GP2B 5IJ7E 2MTAH 3UVKA 2OK6A 2CE9A 3SJLD 4O3TB 2AGWA 4BH6A 3PXWD 2Q7QA 3CFVA 1XKSA 4IMMA 3NVNA 1JOFA 4GQ1A 2OVRB 2P9SC 5FA5B 4PXWA 2CE8A 3I8EA 2B5MA 3OKYB 5KDOB 4FA9D 5HE1B 4D6VA 1N6DA 5TF2A 4CZYA 1GOTB 4U1EI 3I7OA 2PM7B 1U4CA 1JMXB 4LG9A 4H5IA 5IGQA 4XYHA 3ZWLB 2YMUA 2H6QA 2PBIB 3AH8B 3DWLC 4A11B 5TDHB 1GXRA 4LGNA 2HKMA 4A0BA 4PC0A 2CO0A 4CY2A 2H6KA 4K3JB 1OMWB 4H5JA 3EI3A 3I2NA 5B4WA 3I7PA 1ERJA 1N6EA 3DXMC 3OL2A 2IUQA 2XYIA 4BL0A 4CY3A 2YNNA 4XEIC 4X3EA 2B4EA 2AH0A 4I79A 3K26A 5AMSA 4GQ2P 3ULEC 4JSVC 2W18A 4X60B 2I0SA 3SWSD 5FQDA 4JT6C 2CN2A 3OKYA 5IGOA 4A11A 3F3PA 4J0XA 4PSXB 4ERYA 3ORVD 3VA6A 3UVMA 3J81g 2QC5A 3EI1A 3BWSA 2HJ4A 2XL3A 1B9XA 2H47A 4E5ZB 3DSMA 4J8BA 1PBYB 2H3XA 5EMMB 4E54A 3KRWB 5IJ8E 4ESGA 3P4FA 4ZOVA 4QT8A 4JSNC 5FLXg 1TYQC 3PVUB 3CIKB 5EAMA 3SMRA 5HE3B 2QXVA 1NEXB 5FKSA 2GC7A 2H14A 4J81A 5H1MA 3SHFA 2CNXA 2YNOA 3EG6A 4CZXA 1RI6A 2YBAA 1YFQA 5GXIA 4CY5A 4CI1A 5HE0B 4CI2A 5CYKB 3I7HA 3MZLA 3PXTD 5HQGA 5THAA 2AGYA 2Z2OA 3HFQA 3IKOA 5GSAA 3FRXA 3EI2A 2B5LA 2P9PC 4X61B 3PSCB 2UZYB 2OIZA 3OW8A 5H14A 3DM0A 3EI1B 4QQEA 2BCJB 5TEEA 2J55H 5FKQA 2G9AA 2J56H 4FA1D 4E54B 5EAPA 3F3GA 2P9IC 4R7AB 5CXCA 4A7JA 4J8GA 3RSEC 2P9UC 5FKTA 5EM2B 2I0TA 2CN3A 4J0WA 4J73A 3SBRA 3N0DA 3RN1D 5I5MA 2IAAA 4A08B 4A0AB 1JJUB 1K8KC 2AGLA 3SLED 2HXCA 1GG2B 4Z8LA 5EMJB 4KFMB 2Z2NA 3AL8A 4ERQA 3W15A 2Z2PA 3PVWB 2IUVA 5C2WB 5K1CC 3JZGA 4HDJA 3FM0A 3UKRC 2IWKA 3C75H 1XIPA 2H9MA 3ODTA 2H9NA 2TRCB 2IURA 3EI3B 3EWEA 3PE7A 3J80g 4MK0B 2H6NA 4GGDA 4LG8A 3UR4A 3MKQA 4ZOYA 1PGUA 1TBGA 2I3SA 3OL2B 4NSXA 2HYEA 1P22A 4ZOZA 4FA5D 4ERZA 1NR0A 4L3HD 3K27A 5EMKB 4GM3A 4O9DA 5CXBA 3UVNA 3GFCA 4N14A 4FAVD 2H13A 2GNQA 4JSXC 3NVQA 5HE2B 3UVOA 2XU7A 3OTTA 2AGZA 5CYKA 3IJ0A
chains in the Genus database with same CATH superfamily
4Y5RD 4CY1A 4IA9A 2B5NA 3L4OD 1O6FA 4GMBA 3VH0A 3SBPA 5H17A 4CZVA 3O4JA 4OZUA 2H9PA 4GGCA 3ZE0A 3RRMC 3BG0A 4J79A 1MG3A 3K71A 2BKLA 1R5MA 3MZKA 5SXMA 5M5SA 5HDBA 5M5UA 3F3FA 3RN0D 4JXMA 3AFCA 3OKTA 1L0QA 5FKRA 4QRJA 4GQBB 1K32A 3PXSD 4K3ID 4GM8A 3IIWA 1MG2A 1JMZB 3A0FA 3UKUC 4L1MA 5M61A 5E6SA 3AL8B 3JZNA 5EARA 3FGBA 2XL2A 3EMHA 1OLZA 4GGAA 5EALA 1K3IA 3IUJA 2GC4A 5A2Qg 2AH1A 2EIEA 2BBKH 1MDAH 1N6FA 2PM9A 3MVDK 4GZ8A 3RFHA 3V7DB 4AEZA 3EI2B 1FWXA 2AQ5A 3B7FA 3JZHA 1SQJA 5EMLB 4FHLA 4WK0A 3EI4A 2JKXA 4J84A 4DNUA 3T3PA 4Y7RA 2YNPA 4JT5C 4O02A 4A09B 2G99A 2PM6B 4O1QD 3EU7A 3C9CA 3NIFA 5AFU3 3JAMg 3E0CA 5E6RA 3GREA 1PI6A 4D9SA 5CXCB 3SVWD 5CXBB 3SN6B 5AJAA 2HKRA 3SBQA 4JD2C 3RFGA 4WK4A 1S4UX 2IUPA 4CC9A 3MKSB 2EICA 3NIDA 4J78A 1H2WA 2HU5A 4PBYA 3RLMD 2J57G 3DDUA 3CFSB 5HYNB 4GM9A 4DNWA 1UOPA 3EQ7A 3EI4B 3BG1A 5FFOA 3JRPA 5FXYA 4UM8A 2H68A 4JHNA 4A09A 2OVPB 4CI8A 3EQ9A 5IC7A 3NIGA 3FCSA 4YVDA 1B9YA 2UZXB 3PSLA 5GMKn 3K72A 5C2VB 5K19A 2YB8B 4ES0A 3IIYA 2VZ3A 4L3GD 2HESX 1O6GA 1U8CA 4XYIA 5I5JA 2OK4A 1QFMA 5I5IA 1VYHC 3GC3B 1QNIA 2P9NC 3V4PA 4UI9R 3OKWA 2VDQA 3ZE2A 4DNVA 3IJ1A 4NC4A 4A0AA 4ZOXA 3V5WB 4BUJC 3KCIA 2I3TA 4CI3A 1XHMA 1VE6A 2VDRA 3U4YA 3N0EA 4G56B 4E5ZA 3VI4A 4U7AA 1PEVA 2HU8A 4JHPC 3C5MA 4A2LA 5FFGA 1VZ3A 2P9KC 4L1QD 4IRZA 3IURA 1SQ9A 3C99A 2VZ1A 3UVLA 5M5VA 4Z7NA 4G1MA 2XZGA 3I89A 5M5RA 3I7LA 4J86A 4J77A 5GXHA 2EBSA 1SHYB 1JTDB 4O45A 4X63B 3SXTD 2EIDA 1E8MA 4FA4D 3DXKC 3IJCA 5M5TA 2AGXA 4O3UB 1QFSA 4D0KA 1Q47A 2IWFA 2QZPA 4AOWA 3I7KA 4TZ4A 2I0RA 1U2VC 3I7NA 4FWWA 2H9LA 4J87A 3JB9L 2QR5A 4J82A 3NVXA 4FAND 5IT9g 3JPXA 4A0BB 4L9OA 3L4MD 4PSWB 4MMXA 4NBMA 3ZDXA 5JWZA 1A0RB 4QL1A 4JSPC 4OWRA 2OVQB 3MMYA 2PM9B 5C9ZB 3SFZA 2CO0C 3KRXB 3JROA 2VDLA 3VGZA 4AMYA 4ZN4A 3MXXA 3V9FA 4A08A 4AN0A 1VZ2A 2O9KA 3AL9A 3SCYA 3I8CA 4PNKB 4A2MA 4EWRA 3T3MA 5TEFA 2P9LC 2OJYA 2HJBA 5EM2A 1UTCA 4PBZA 1UOQA 4AN1A 4FB1D 3RMZD 1GP2B 1H2XA 1L5GA 5IJ7E 2MTAH 4MMZA 3UVKA 2OK6A 2CE9A 3SJLD 1H2ZA 4O3TB 2AGWA 4BH6A 3PXWD 2Q7QA 3CFVA 1XKSA 4IMMA 3NVNA 1JOFA 4GQ1A 2OVRB 2P9SC 5FA5B 1I2MB 4PXWA 2CE8A 3I8EA 2B5MA 3OKYB 5KDOB 3GD1I 4FA9D 5HE1B 3VI3A 4D6VA 1N6DA 5TF2A 4CZYA 1GOHA 1GOTB 4U1EI 3I7OA 4WK2A 2PM7B 1U4CA 1JMXB 3IUNA 1YR2A 2HU7A 4H5IA 4LG9A 1C9IA 1H2YA 4XYHA 3ZWLB 5IGQA 2YMUA 2H6QA 2PBIB 3AH8B 3DWLC 4A11B 5TDHB 1GXRA 3O4GA 1TYEA 1E8NA 4BP8A 4LGNA 2HKMA 4A0BA 1M1XA 2WQ8A 4PC0A 2CO0A 4CY2A 2H6KA 4K3JB 1OMWB 4H5JA 4Z7OA 3O4IA 3EI3A 3I2NA 1T2XA 5B4WA 2VDPA 3I7PA 1ERJA 1N6EA 3DXMC 3OL2A 1JV2A 2IUQA 2XYIA 3ZE1A 4BL0A 4CY3A 2YNNA 4XEIC 4X3EA 2B4EA 2AH0A 4I79A 3K26A 5AMSA 4GQ2P 3ULEC 4JSVC 2W18A 4X60B 2I0SA 3SWSD 5FQDA 4JT6C 2CN2A 3EQ8A 3OKYA 5IGOA 4A11A 1VE7A 3F3PA 4J0XA 4PSXB 4ERYA 3ORVD 3VA6A 3UVMA 3J81g 2QC5A 3EI1A 3BWSA 2HJ4A 3OF7A 2XL3A 4BCDA 1B9XA 3MUOA 2H47A 4E5ZB 3DSMA 4J8BA 1PBYB 2H3XA 5EMMB 4E54A 3KRWB 5IJ8E 4WJKA 4ESGA 3P4FA 5C86A 3IUQA 4ZOVA 1C9LA 4QT8A 4RE5A 3ZDYA 4JSNC 5FLXg 1TYQC 3PVUB 4UM9A 1A12A 3CIKB 3IVMA 5EAMA 3SMRA 5HE3B 2QXVA 1NEXB 5FKSA 2GC7A 2H14A 4J81A 5H1MA 4AMZA 3SHFA 3ZDZA 3QHYB 4BCCA 2CNXA 2YNOA 3EG6A 4CZXA 1RI6A 2YBAA 1YFQA 3QI0A 5GXIA 4CY5A 4CI1A 5HE0B 2XE4A 4CI2A 5CYKB 3I7HA 3MZLA 3PXTD 5HQGA 3K6SA 4NAAA 5THAA 2AGYA 2Z2OA 3HFQA 3IKOA 2XDWA 1UOOA 5GSAA 3FRXA 3EI2A 2B5LA 2P9PC 4MMYA 4X61B 3PSCB 2UZYB 2OIZA 3MUNA 4BP9A 3OW8A 5H14A 3DM0A 3EI1B 4QQEA 2BCJB 5TEEA 2J55H 3O4HA 5FKQA 2VDOA 2G9AA 2J56H 4FA1D 4E54B 5EAPA 2VDKA 3IUMA 3F3GA 2P9IC 4R7AB 5CXCA 4A7JA 4J8GA 3RSEC 2P9UC 5E6UA 5FKTA 4O2WA 5EM2B 2I0TA 2CN3A 4J0WA 4J73A 3SBRA 3N0DA 3RN1D 1E5TA 1GOFA 4G55A 5I5MA 2IAAA 4A08B 4A0AB 1JJUB 3FCUA 1GOGA 1K8KC 2AGLA 4G1EA 4QAMA 3V4VA 3SLED 2HXCA 4NENA 1GG2B 4Z8LA 5EMJB 4KFMB 2Z2NA 2VC2A 3AL8A 4ERQA 3W15A 2Z2PA 3PVWB 2IUVA 5C2WB 5K1CC 3JZGA 4HDJA 3FM0A 3UKRC 2IWKA 3C75H 1XIPA 2H9MA 3IULA 3ODTA 2VDNA 2H9NA 1BPOA 2TRCB 4RE6A 2IURA 3EI3B 3EWEA 3PE7A 3J80g 4MK0B 2H6NA 4GGDA 4LG8A 3UR4A 3MKQA 4ZOYA 1PGUA 1TBGA 2I3SA 3OL2B 4NSXA 2HYEA 1P22A 5C92A 4AX4A 4BCBA 4ZOZA 4FA5D 2VDMA 4ERZA 2EIBA 1NR0A 3IJEA 4L3HD 3K27A 5EMKB 4GM3A 4O9DA 5CXBA 3UVNA 3GFCA 4N14A 4FAVD 2H13A 2GNQA 4JSXC 3NVQA 5HE2B 3UVOA 2XU7A 3OTTA 2AGZA 5CYKA 3IJ0A 4Z7QA
chains in the Genus database with same CATH topology
4Y5RD 4CY1A 4IA9A 2B5NA 3L4OD 4GMBA 3VH0A 3SBPA 5H17A 4CZVA 4OZUA 2H9PA 4GGCA 3RRMC 3BG0A 4J79A 1MG3A 1R5MA 3MZKA 5SXMA 3F3FA 3RN0D 4JXMA 3AFCA 3OKTA 1L0QA 5FKRA 4QRJA 4GQBB 1K32A 3PXSD 4K3ID 4GM8A 3IIWA 1MG2A 1JMZB 3A0FA 3UKUC 3AL8B 3JZNA 5EARA 3FGBA 2XL2A 3EMHA 1OLZA 4GGAA 5EALA 2GC4A 5A2Qg 2AH1A 2BBKH 1MDAH 1N6FA 2PM9A 4GZ8A 3RFHA 3V7DB 4AEZA 3EI2B 1FWXA 2AQ5A 3B7FA 3JZHA 1SQJA 5EMLB 4FHLA 3EI4A 4J84A 4Y7RA 2YNPA 4JT5C 4A09B 2G99A 2PM6B 4O1QD 3EU7A 3C9CA 5AFU3 3JAMg 3E0CA 3GREA 1PI6A 5CXCB 3SVWD 5CXBB 3SN6B 5AJAA 2HKRA 3SBQA 4JD2C 3RFGA 1S4UX 2IUPA 4CC9A 3MKSB 4J78A 4PBYA 3RLMD 2J57G 3CFSB 5HYNB 4GM9A 3EI4B 3BG1A 3JRPA 5FXYA 2H68A 4A09A 2OVPB 4CI8A 5IC7A 4YVDA 1B9YA 2UZXB 3PSLA 5GMKn 5C2VB 5K19A 2YB8B 4ES0A 3IIYA 4L3GD 2HESX 4XYIA 5I5JA 2OK4A 5I5IA 1VYHC 1QNIA 2P9NC 4UI9R 3OKWA 3IJ1A 4A0AA 4ZOXA 3V5WB 4BUJC 2I3TA 4CI3A 1XHMA 3U4YA 3N0EA 4G56B 4E5ZA 4U7AA 1PEVA 3C5MA 4A2LA 2P9KC 4L1QD 1SQ9A 3C99A 3UVLA 3I89A 3I7LA 4J86A 4J77A 5GXHA 2EBSA 1SHYB 4X63B 4O45A 3SXTD 4FA4D 3DXKC 3IJCA 2AGXA 4O3UB 4D0KA 1Q47A 2IWFA 4AOWA 3I7KA 4TZ4A 2I0RA 1U2VC 3I7NA 4FWWA 2H9LA 4J87A 3JB9L 4J82A 3NVXA 4FAND 5IT9g 3JPXA 4A0BB 4L9OA 3L4MD 4PSWB 5JWZA 1A0RB 4QL1A 4JSPC 4OWRA 2OVQB 3MMYA 2PM9B 5C9ZB 3SFZA 2CO0C 3KRXB 3JROA 3VGZA 4ZN4A 3MXXA 3V9FA 4A08A 2O9KA 3AL9A 3SCYA 3I8CA 4PNKB 4A2MA 4EWRA 5TEFA 2P9LC 2OJYA 2HJBA 5EM2A 4PBZA 4FB1D 3RMZD 1GP2B 5IJ7E 2MTAH 3UVKA 2OK6A 2CE9A 3SJLD 4O3TB 2AGWA 4BH6A 3PXWD 2Q7QA 3CFVA 1XKSA 4IMMA 3NVNA 1JOFA 4GQ1A 2OVRB 2P9SC 5FA5B 4PXWA 2CE8A 3I8EA 2B5MA 3OKYB 5KDOB 4FA9D 5HE1B 4D6VA 1N6DA 5TF2A 4CZYA 1GOTB 4U1EI 3I7OA 2PM7B 1U4CA 1JMXB 4LG9A 4H5IA 5IGQA 4XYHA 3ZWLB 2YMUA 2H6QA 2PBIB 3AH8B 3DWLC 4A11B 5TDHB 1GXRA 4LGNA 2HKMA 4A0BA 4PC0A 2CO0A 4CY2A 2H6KA 4K3JB 1OMWB 4H5JA 3EI3A 3I2NA 5B4WA 3I7PA 1ERJA 1N6EA 3DXMC 3OL2A 2IUQA 2XYIA 4BL0A 4CY3A 2YNNA 4XEIC 4X3EA 2B4EA 2AH0A 4I79A 3K26A 5AMSA 4GQ2P 3ULEC 4JSVC 2W18A 4X60B 2I0SA 3SWSD 5FQDA 4JT6C 2CN2A 3OKYA 5IGOA 4A11A 3F3PA 4J0XA 4PSXB 4ERYA 3ORVD 3VA6A 3UVMA 3J81g 2QC5A 3EI1A 3BWSA 2HJ4A 2XL3A 1B9XA 2H47A 4E5ZB 3DSMA 4J8BA 1PBYB 2H3XA 5EMMB 4E54A 3KRWB 5IJ8E 4ESGA 3P4FA 4ZOVA 4QT8A 4JSNC 5FLXg 1TYQC 3PVUB 3CIKB 5EAMA 3SMRA 5HE3B 2QXVA 1NEXB 5FKSA 2GC7A 2H14A 4J81A 5H1MA 3SHFA 2CNXA 2YNOA 3EG6A 4CZXA 1RI6A 2YBAA 1YFQA 5GXIA 4CY5A 4CI1A 5HE0B 4CI2A 5CYKB 3I7HA 3MZLA 3PXTD 5HQGA 5THAA 2AGYA 2Z2OA 3HFQA 3IKOA 5GSAA 3FRXA 3EI2A 2B5LA 2P9PC 4X61B 3PSCB 2UZYB 2OIZA 3OW8A 5H14A 3DM0A 3EI1B 4QQEA 2BCJB 5TEEA 2J55H 5FKQA 2G9AA 2J56H 4FA1D 4E54B 5EAPA 3F3GA 2P9IC 4R7AB 5CXCA 4A7JA 4J8GA 3RSEC 2P9UC 5FKTA 5EM2B 2I0TA 2CN3A 4J0WA 4J73A 3SBRA 3N0DA 3RN1D 5I5MA 2IAAA 4A08B 4A0AB 1JJUB 1K8KC 2AGLA 3SLED 2HXCA 1GG2B 4Z8LA 5EMJB 4KFMB 2Z2NA 3AL8A 4ERQA 3W15A 2Z2PA 3PVWB 2IUVA 5C2WB 5K1CC 3JZGA 4HDJA 3FM0A 3UKRC 2IWKA 3C75H 1XIPA 2H9MA 3ODTA 2H9NA 2TRCB 2IURA 3EI3B 3EWEA 3PE7A 3J80g 4MK0B 2H6NA 4GGDA 4LG8A 3UR4A 3MKQA 4ZOYA 1PGUA 1TBGA 2I3SA 3OL2B 4NSXA 2HYEA 1P22A 4ZOZA 4FA5D 4ERZA 1NR0A 4L3HD 3K27A 5EMKB 4GM3A 4O9DA 5CXBA 3UVNA 3GFCA 4N14A 4FAVD 2H13A 2GNQA 4JSXC 3NVQA 5HE2B 3UVOA 2XU7A 3OTTA 2AGZA 5CYKA 3IJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5R D;  4CY1 A;  4IA9 A;  2B5N A;  3L4O D;  4GMB A;  3VH0 A;  3SBP A;  5H17 A;  4CZV A;  4OZU A;  2H9P A;  4GGC A;  3RRM C;  3BG0 A;  4J79 A;  1MG3 A;  1R5M A;  3MZK A;  5SXM A;  3F3F A;  3RN0 D;  4JXM A;  3AFC A;  3OKT A;  1L0Q A;  5FKR A;  4QRJ A;  4GQB B;  1K32 A;  3PXS D;  4K3I D;  4GM8 A;  3IIW A;  1MG2 A;  1JMZ B;  3A0F A;  3UKU C;  3AL8 B;  3JZN A;  5EAR A;  3FGB A;  2XL2 A;  3EMH A;  1OLZ A;  4GGA A;  5EAL A;  2GC4 A;  5A2Q g;  2AH1 A;  2BBK H;  1MDA H;  1N6F A;  2PM9 A;  4GZ8 A;  3RFH A;  3V7D B;  4AEZ A;  3EI2 B;  1FWX A;  2AQ5 A;  3B7F A;  3JZH A;  1SQJ A;  5EML B;  4FHL A;  3EI4 A;  4J84 A;  4Y7R A;  2YNP A;  4JT5 C;  4A09 B;  2G99 A;  2PM6 B;  4O1Q D;  3EU7 A;  3C9C A;  5AFU 3;  3JAM g;  3E0C A;  3GRE A;  1PI6 A;  5CXC B;  3SVW D;  5CXB B;  3SN6 B;  5AJA A;  2HKR A;  3SBQ A;  4JD2 C;  3RFG A;  1S4U X;  2IUP A;  4CC9 A;  3MKS B;  4J78 A;  4PBY A;  3RLM D;  2J57 G;  3CFS B;  5HYN B;  4GM9 A;  3EI4 B;  3BG1 A;  3JRP A;  5FXY A;  2H68 A;  4A09 A;  2OVP B;  4CI8 A;  5IC7 A;  4YVD A;  1B9Y A;  2UZX B;  3PSL A;  5GMK n;  5C2V B;  5K19 A;  2YB8 B;  4ES0 A;  3IIY A;  4L3G D;  2HES X;  4XYI A;  5I5J A;  2OK4 A;  5I5I A;  1VYH C;  1QNI A;  2P9N C;  4UI9 R;  3OKW A;  3IJ1 A;  4A0A A;  4ZOX A;  3V5W B;  4BUJ C;  2I3T A;  4CI3 A;  1XHM A;  3U4Y A;  3N0E A;  4G56 B;  4E5Z A;  4U7A A;  1PEV A;  3C5M A;  4A2L A;  2P9K C;  4L1Q D;  1SQ9 A;  3C99 A;  3UVL A;  3I89 A;  3I7L A;  4J86 A;  4J77 A;  5GXH A;  2EBS A;  1SHY B;  4X63 B;  4O45 A;  3SXT D;  4FA4 D;  3DXK C;  3IJC A;  2AGX A;  4O3U B;  4D0K A;  1Q47 A;  2IWF A;  4AOW A;  3I7K A;  4TZ4 A;  2I0R A;  1U2V C;  3I7N A;  4FWW A;  2H9L A;  4J87 A;  3JB9 L;  4J82 A;  3NVX A;  4FAN D;  5IT9 g;  3JPX A;  4A0B B;  4L9O A;  3L4M D;  4PSW B;  5JWZ A;  1A0R B;  4QL1 A;  4JSP C;  4OWR A;  2OVQ B;  3MMY A;  2PM9 B;  5C9Z B;  3SFZ A;  2CO0 C;  3KRX B;  3JRO A;  3VGZ A;  4ZN4 A;  3MXX A;  3V9F A;  4A08 A;  2O9K A;  3AL9 A;  3SCY A;  3I8C A;  4PNK B;  4A2M A;  4EWR A;  5TEF A;  2P9L C;  2OJY A;  2HJB A;  5EM2 A;  4PBZ A;  4FB1 D;  3RMZ D;  1GP2 B;  5IJ7 E;  2MTA H;  3UVK A;  2OK6 A;  2CE9 A;  3SJL D;  4O3T B;  2AGW A;  4BH6 A;  3PXW D;  2Q7Q A;  3CFV A;  1XKS A;  4IMM A;  3NVN A;  1JOF A;  4GQ1 A;  2OVR B;  2P9S C;  5FA5 B;  4PXW A;  2CE8 A;  3I8E A;  2B5M A;  3OKY B;  5KDO B;  4FA9 D;  5HE1 B;  4D6V A;  1N6D A;  5TF2 A;  4CZY A;  1GOT B;  4U1E I;  3I7O A;  2PM7 B;  1U4C A;  1JMX B;  4LG9 A;  4H5I A;  5IGQ A;  4XYH A;  3ZWL B;  2YMU A;  2H6Q A;  2PBI B;  3AH8 B;  3DWL C;  4A11 B;  5TDH B;  1GXR A;  4LGN A;  2HKM A;  4A0B A;  4PC0 A;  2CO0 A;  4CY2 A;  2H6K A;  4K3J B;  1OMW B;  4H5J A;  3EI3 A;  3I2N A;  5B4W A;  3I7P A;  1ERJ A;  1N6E A;  3DXM C;  3OL2 A;  2IUQ A;  2XYI A;  4BL0 A;  4CY3 A;  2YNN A;  4XEI C;  4X3E A;  2B4E A;  2AH0 A;  4I79 A;  3K26 A;  5AMS A;  4GQ2 P;  3ULE C;  4JSV C;  2W18 A;  4X60 B;  2I0S A;  3SWS D;  5FQD A;  4JT6 C;  2CN2 A;  3OKY A;  5IGO A;  4A11 A;  3F3P A;  4J0X A;  4PSX B;  4ERY A;  3ORV D;  3VA6 A;  3UVM A;  3J81 g;  2QC5 A;  3EI1 A;  3BWS A;  2HJ4 A;  2XL3 A;  1B9X A;  2H47 A;  4E5Z B;  3DSM A;  4J8B A;  1PBY B;  2H3X A;  5EMM B;  4E54 A;  3KRW B;  5IJ8 E;  4ESG A;  3P4F A;  4ZOV A;  4QT8 A;  4JSN C;  5FLX g;  1TYQ C;  3PVU B;  3CIK B;  5EAM A;  3SMR A;  5HE3 B;  2QXV A;  1NEX B;  5FKS A;  2GC7 A;  2H14 A;  4J81 A;  5H1M A;  3SHF A;  2CNX A;  2YNO A;  3EG6 A;  4CZX A;  1RI6 A;  2YBA A;  1YFQ A;  5GXI A;  4CY5 A;  4CI1 A;  5HE0 B;  4CI2 A;  5CYK B;  3I7H A;  3MZL A;  3PXT D;  5HQG A;  5THA A;  2AGY A;  2Z2O A;  3HFQ A;  3IKO A;  5GSA A;  3FRX A;  3EI2 A;  2B5L A;  2P9P C;  4X61 B;  3PSC B;  2UZY B;  2OIZ A;  3OW8 A;  5H14 A;  3DM0 A;  3EI1 B;  4QQE A;  2BCJ B;  5TEE A;  2J55 H;  5FKQ A;  2G9A A;  2J56 H;  4FA1 D;  4E54 B;  5EAP A;  3F3G A;  2P9I C;  4R7A B;  5CXC A;  4A7J A;  4J8G A;  3RSE C;  2P9U C;  5FKT A;  5EM2 B;  2I0T A;  2CN3 A;  4J0W A;  4J73 A;  3SBR A;  3N0D A;  3RN1 D;  5I5M A;  2IAA A;  4A08 B;  4A0A B;  1JJU B;  1K8K C;  2AGL A;  3SLE D;  2HXC A;  1GG2 B;  4Z8L A;  5EMJ B;  4KFM B;  2Z2N A;  3AL8 A;  4ERQ A;  3W15 A;  2Z2P A;  3PVW B;  2IUV A;  5C2W B;  5K1C C;  3JZG A;  4HDJ A;  3FM0 A;  3UKR C;  2IWK A;  3C75 H;  1XIP A;  2H9M A;  3ODT A;  2H9N A;  2TRC B;  2IUR A;  3EI3 B;  3EWE A;  3PE7 A;  3J80 g;  4MK0 B;  2H6N A;  4GGD A;  4LG8 A;  3UR4 A;  3MKQ A;  4ZOY A;  1PGU A;  1TBG A;  2I3S A;  3OL2 B;  4NSX A;  2HYE A;  1P22 A;  4ZOZ A;  4FA5 D;  4ERZ A;  1NR0 A;  4L3H D;  3K27 A;  5EMK B;  4GM3 A;  4O9D A;  5CXB A;  3UVN A;  3GFC A;  4N14 A;  4FAV D;  2H13 A;  2GNQ A;  4JSX C;  3NVQ A;  5HE2 B;  3UVO A;  2XU7 A;  3OTT A;  2AGZ A;  5CYK A;  3IJ0 A; 
#chains in the Genus database with same CATH topology
 4Y5R D;  4CY1 A;  4IA9 A;  2B5N A;  3L4O D;  1O6F A;  4GMB A;  3VH0 A;  3SBP A;  5H17 A;  4CZV A;  3O4J A;  4OZU A;  2H9P A;  4GGC A;  3ZE0 A;  3RRM C;  3BG0 A;  4J79 A;  1MG3 A;  3K71 A;  2BKL A;  1R5M A;  3MZK A;  5SXM A;  5M5S A;  5HDB A;  5M5U A;  3F3F A;  3RN0 D;  4JXM A;  3AFC A;  3OKT A;  1L0Q A;  5FKR A;  4QRJ A;  4GQB B;  1K32 A;  3PXS D;  4K3I D;  4GM8 A;  3IIW A;  1MG2 A;  1JMZ B;  3A0F A;  3UKU C;  4L1M A;  5M61 A;  5E6S A;  3AL8 B;  3JZN A;  5EAR A;  3FGB A;  2XL2 A;  3EMH A;  1OLZ A;  4GGA A;  5EAL A;  1K3I A;  3IUJ A;  2GC4 A;  5A2Q g;  2AH1 A;  2EIE A;  2BBK H;  1MDA H;  1N6F A;  2PM9 A;  3MVD K;  4GZ8 A;  3RFH A;  3V7D B;  4AEZ A;  3EI2 B;  1FWX A;  2AQ5 A;  3B7F A;  3JZH A;  1SQJ A;  5EML B;  4FHL A;  4WK0 A;  3EI4 A;  2JKX A;  4J84 A;  4DNU A;  3T3P A;  4Y7R A;  2YNP A;  4JT5 C;  4O02 A;  4A09 B;  2G99 A;  2PM6 B;  4O1Q D;  3EU7 A;  3C9C A;  3NIF A;  5AFU 3;  3JAM g;  3E0C A;  5E6R A;  3GRE A;  1PI6 A;  4D9S A;  5CXC B;  3SVW D;  5CXB B;  3SN6 B;  5AJA A;  2HKR A;  3SBQ A;  4JD2 C;  3RFG A;  4WK4 A;  1S4U X;  2IUP A;  4CC9 A;  3MKS B;  2EIC A;  3NID A;  4J78 A;  1H2W A;  2HU5 A;  4PBY A;  3RLM D;  2J57 G;  3DDU A;  3CFS B;  5HYN B;  4GM9 A;  4DNW A;  1UOP A;  3EQ7 A;  3EI4 B;  3BG1 A;  5FFO A;  3JRP A;  5FXY A;  4UM8 A;  2H68 A;  4JHN A;  4A09 A;  2OVP B;  4CI8 A;  3EQ9 A;  5IC7 A;  3NIG A;  3FCS A;  4YVD A;  1B9Y A;  2UZX B;  3PSL A;  5GMK n;  3K72 A;  5C2V B;  5K19 A;  2YB8 B;  4ES0 A;  3IIY A;  2VZ3 A;  4L3G D;  2HES X;  1O6G A;  1U8C A;  4XYI A;  5I5J A;  2OK4 A;  1QFM A;  5I5I A;  1VYH C;  3GC3 B;  1QNI A;  2P9N C;  3V4P A;  4UI9 R;  3OKW A;  2VDQ A;  3ZE2 A;  4DNV A;  3IJ1 A;  4NC4 A;  4A0A A;  4ZOX A;  3V5W B;  4BUJ C;  3KCI A;  2I3T A;  4CI3 A;  1XHM A;  1VE6 A;  2VDR A;  3U4Y A;  3N0E A;  4G56 B;  4E5Z A;  3VI4 A;  4U7A A;  1PEV A;  2HU8 A;  4JHP C;  3C5M A;  4A2L A;  5FFG A;  1VZ3 A;  2P9K C;  4L1Q D;  4IRZ A;  3IUR A;  1SQ9 A;  3C99 A;  2VZ1 A;  3UVL A;  5M5V A;  4Z7N A;  4G1M A;  2XZG A;  3I89 A;  5M5R A;  3I7L A;  4J86 A;  4J77 A;  5GXH A;  2EBS A;  1SHY B;  1JTD B;  4O45 A;  4X63 B;  3SXT D;  2EID A;  1E8M A;  4FA4 D;  3DXK C;  3IJC A;  5M5T A;  2AGX A;  4O3U B;  1QFS A;  4D0K A;  1Q47 A;  2IWF A;  2QZP A;  4AOW A;  3I7K A;  4TZ4 A;  2I0R A;  1U2V C;  3I7N A;  4FWW A;  2H9L A;  4J87 A;  3JB9 L;  2QR5 A;  4J82 A;  3NVX A;  4FAN D;  5IT9 g;  3JPX A;  4A0B B;  4L9O A;  3L4M D;  4PSW B;  4MMX A;  4NBM A;  3ZDX A;  5JWZ A;  1A0R B;  4QL1 A;  4JSP C;  4OWR A;  2OVQ B;  3MMY A;  2PM9 B;  5C9Z B;  3SFZ A;  2CO0 C;  3KRX B;  3JRO A;  2VDL A;  3VGZ A;  4AMY A;  4ZN4 A;  3MXX A;  3V9F A;  4A08 A;  4AN0 A;  1VZ2 A;  2O9K A;  3AL9 A;  3SCY A;  3I8C A;  4PNK B;  4A2M A;  4EWR A;  3T3M A;  5TEF A;  2P9L C;  2OJY A;  2HJB A;  5EM2 A;  1UTC A;  4PBZ A;  1UOQ A;  4AN1 A;  4FB1 D;  3RMZ D;  1GP2 B;  1H2X A;  1L5G A;  5IJ7 E;  2MTA H;  4MMZ A;  3UVK A;  2OK6 A;  2CE9 A;  3SJL D;  1H2Z A;  4O3T B;  2AGW A;  4BH6 A;  3PXW D;  2Q7Q A;  3CFV A;  1XKS A;  4IMM A;  3NVN A;  1JOF A;  4GQ1 A;  2OVR B;  2P9S C;  5FA5 B;  1I2M B;  4PXW A;  2CE8 A;  3I8E A;  2B5M A;  3OKY B;  5KDO B;  3GD1 I;  4FA9 D;  5HE1 B;  3VI3 A;  4D6V A;  1N6D A;  5TF2 A;  4CZY A;  1GOH A;  1GOT B;  4U1E I;  3I7O A;  4WK2 A;  2PM7 B;  1U4C A;  1JMX B;  3IUN A;  1YR2 A;  2HU7 A;  4H5I A;  4LG9 A;  1C9I A;  1H2Y A;  4XYH A;  3ZWL B;  5IGQ A;  2YMU A;  2H6Q A;  2PBI B;  3AH8 B;  3DWL C;  4A11 B;  5TDH B;  1GXR A;  3O4G A;  1TYE A;  1E8N A;  4BP8 A;  4LGN A;  2HKM A;  4A0B A;  1M1X A;  2WQ8 A;  4PC0 A;  2CO0 A;  4CY2 A;  2H6K A;  4K3J B;  1OMW B;  4H5J A;  4Z7O A;  3O4I A;  3EI3 A;  3I2N A;  1T2X A;  5B4W A;  2VDP A;  3I7P A;  1ERJ A;  1N6E A;  3DXM C;  3OL2 A;  1JV2 A;  2IUQ A;  2XYI A;  3ZE1 A;  4BL0 A;  4CY3 A;  2YNN A;  4XEI C;  4X3E A;  2B4E A;  2AH0 A;  4I79 A;  3K26 A;  5AMS A;  4GQ2 P;  3ULE C;  4JSV C;  2W18 A;  4X60 B;  2I0S A;  3SWS D;  5FQD A;  4JT6 C;  2CN2 A;  3EQ8 A;  3OKY A;  5IGO A;  4A11 A;  1VE7 A;  3F3P A;  4J0X A;  4PSX B;  4ERY A;  3ORV D;  3VA6 A;  3UVM A;  3J81 g;  2QC5 A;  3EI1 A;  3BWS A;  2HJ4 A;  3OF7 A;  2XL3 A;  4BCD A;  1B9X A;  3MUO A;  2H47 A;  4E5Z B;  3DSM A;  4J8B A;  1PBY B;  2H3X A;  5EMM B;  4E54 A;  3KRW B;  5IJ8 E;  4WJK A;  4ESG A;  3P4F A;  5C86 A;  3IUQ A;  4ZOV A;  1C9L A;  4QT8 A;  4RE5 A;  3ZDY A;  4JSN C;  5FLX g;  1TYQ C;  3PVU B;  4UM9 A;  1A12 A;  3CIK B;  3IVM A;  5EAM A;  3SMR A;  5HE3 B;  2QXV A;  1NEX B;  5FKS A;  2GC7 A;  2H14 A;  4J81 A;  5H1M A;  4AMZ A;  3SHF A;  3ZDZ A;  3QHY B;  4BCC A;  2CNX A;  2YNO A;  3EG6 A;  4CZX A;  1RI6 A;  2YBA A;  1YFQ A;  3QI0 A;  5GXI A;  4CY5 A;  4CI1 A;  5HE0 B;  2XE4 A;  4CI2 A;  5CYK B;  3I7H A;  3MZL A;  3PXT D;  5HQG A;  3K6S A;  4NAA A;  5THA A;  2AGY A;  2Z2O A;  3HFQ A;  3IKO A;  2XDW A;  1UOO A;  5GSA A;  3FRX A;  3EI2 A;  2B5L A;  2P9P C;  4MMY A;  4X61 B;  3PSC B;  2UZY B;  2OIZ A;  3MUN A;  4BP9 A;  3OW8 A;  5H14 A;  3DM0 A;  3EI1 B;  4QQE A;  2BCJ B;  5TEE A;  2J55 H;  3O4H A;  5FKQ A;  2VDO A;  2G9A A;  2J56 H;  4FA1 D;  4E54 B;  5EAP A;  2VDK A;  3IUM A;  3F3G A;  2P9I C;  4R7A B;  5CXC A;  4A7J A;  4J8G A;  3RSE C;  2P9U C;  5E6U A;  5FKT A;  4O2W A;  5EM2 B;  2I0T A;  2CN3 A;  4J0W A;  4J73 A;  3SBR A;  3N0D A;  3RN1 D;  1E5T A;  1GOF A;  4G55 A;  5I5M A;  2IAA A;  4A08 B;  4A0A B;  1JJU B;  3FCU A;  1GOG A;  1K8K C;  2AGL A;  4G1E A;  4QAM A;  3V4V A;  3SLE D;  2HXC A;  4NEN A;  1GG2 B;  4Z8L A;  5EMJ B;  4KFM B;  2Z2N A;  2VC2 A;  3AL8 A;  4ERQ A;  3W15 A;  2Z2P A;  3PVW B;  2IUV A;  5C2W B;  5K1C C;  3JZG A;  4HDJ A;  3FM0 A;  3UKR C;  2IWK A;  3C75 H;  1XIP A;  2H9M A;  3IUL A;  3ODT A;  2VDN A;  2H9N A;  1BPO A;  2TRC B;  4RE6 A;  2IUR A;  3EI3 B;  3EWE A;  3PE7 A;  3J80 g;  4MK0 B;  2H6N A;  4GGD A;  4LG8 A;  3UR4 A;  3MKQ A;  4ZOY A;  1PGU A;  1TBG A;  2I3S A;  3OL2 B;  4NSX A;  2HYE A;  1P22 A;  5C92 A;  4AX4 A;  4BCB A;  4ZOZ A;  4FA5 D;  2VDM A;  4ERZ A;  2EIB A;  1NR0 A;  3IJE A;  4L3H D;  3K27 A;  5EMK B;  4GM3 A;  4O9D A;  5CXB A;  3UVN A;  3GFC A;  4N14 A;  4FAV D;  2H13 A;  2GNQ A;  4JSX C;  3NVQ A;  5HE2 B;  3UVO A;  2XU7 A;  3OTT A;  2AGZ A;  5CYK A;  3IJ0 A;  4Z7Q A; 
#chains in the Genus database with same CATH homology
 4Y5R D;  4CY1 A;  4IA9 A;  2B5N A;  3L4O D;  4GMB A;  3VH0 A;  3SBP A;  5H17 A;  4CZV A;  4OZU A;  2H9P A;  4GGC A;  3RRM C;  3BG0 A;  4J79 A;  1MG3 A;  1R5M A;  3MZK A;  5SXM A;  3F3F A;  3RN0 D;  4JXM A;  3AFC A;  3OKT A;  1L0Q A;  5FKR A;  4QRJ A;  4GQB B;  1K32 A;  3PXS D;  4K3I D;  4GM8 A;  3IIW A;  1MG2 A;  1JMZ B;  3A0F A;  3UKU C;  3AL8 B;  3JZN A;  5EAR A;  3FGB A;  2XL2 A;  3EMH A;  1OLZ A;  4GGA A;  5EAL A;  2GC4 A;  5A2Q g;  2AH1 A;  2BBK H;  1MDA H;  1N6F A;  2PM9 A;  4GZ8 A;  3RFH A;  3V7D B;  4AEZ A;  3EI2 B;  1FWX A;  2AQ5 A;  3B7F A;  3JZH A;  1SQJ A;  5EML B;  4FHL A;  3EI4 A;  4J84 A;  4Y7R A;  2YNP A;  4JT5 C;  4A09 B;  2G99 A;  2PM6 B;  4O1Q D;  3EU7 A;  3C9C A;  5AFU 3;  3JAM g;  3E0C A;  3GRE A;  1PI6 A;  5CXC B;  3SVW D;  5CXB B;  3SN6 B;  5AJA A;  2HKR A;  3SBQ A;  4JD2 C;  3RFG A;  1S4U X;  2IUP A;  4CC9 A;  3MKS B;  4J78 A;  4PBY A;  3RLM D;  2J57 G;  3CFS B;  5HYN B;  4GM9 A;  3EI4 B;  3BG1 A;  3JRP A;  5FXY A;  2H68 A;  4A09 A;  2OVP B;  4CI8 A;  5IC7 A;  4YVD A;  1B9Y A;  2UZX B;  3PSL A;  5GMK n;  5C2V B;  5K19 A;  2YB8 B;  4ES0 A;  3IIY A;  4L3G D;  2HES X;  4XYI A;  5I5J A;  2OK4 A;  5I5I A;  1VYH C;  1QNI A;  2P9N C;  4UI9 R;  3OKW A;  3IJ1 A;  4A0A A;  4ZOX A;  3V5W B;  4BUJ C;  2I3T A;  4CI3 A;  1XHM A;  3U4Y A;  3N0E A;  4G56 B;  4E5Z A;  4U7A A;  1PEV A;  3C5M A;  4A2L A;  2P9K C;  4L1Q D;  1SQ9 A;  3C99 A;  3UVL A;  3I89 A;  3I7L A;  4J86 A;  4J77 A;  5GXH A;  2EBS A;  1SHY B;  4X63 B;  4O45 A;  3SXT D;  4FA4 D;  3DXK C;  3IJC A;  2AGX A;  4O3U B;  4D0K A;  1Q47 A;  2IWF A;  4AOW A;  3I7K A;  4TZ4 A;  2I0R A;  1U2V C;  3I7N A;  4FWW A;  2H9L A;  4J87 A;  3JB9 L;  4J82 A;  3NVX A;  4FAN D;  5IT9 g;  3JPX A;  4A0B B;  4L9O A;  3L4M D;  4PSW B;  5JWZ A;  1A0R B;  4QL1 A;  4JSP C;  4OWR A;  2OVQ B;  3MMY A;  2PM9 B;  5C9Z B;  3SFZ A;  2CO0 C;  3KRX B;  3JRO A;  3VGZ A;  4ZN4 A;  3MXX A;  3V9F A;  4A08 A;  2O9K A;  3AL9 A;  3SCY A;  3I8C A;  4PNK B;  4A2M A;  4EWR A;  5TEF A;  2P9L C;  2OJY A;  2HJB A;  5EM2 A;  4PBZ A;  4FB1 D;  3RMZ D;  1GP2 B;  5IJ7 E;  2MTA H;  3UVK A;  2OK6 A;  2CE9 A;  3SJL D;  4O3T B;  2AGW A;  4BH6 A;  3PXW D;  2Q7Q A;  3CFV A;  1XKS A;  4IMM A;  3NVN A;  1JOF A;  4GQ1 A;  2OVR B;  2P9S C;  5FA5 B;  4PXW A;  2CE8 A;  3I8E A;  2B5M A;  3OKY B;  5KDO B;  4FA9 D;  5HE1 B;  4D6V A;  1N6D A;  5TF2 A;  4CZY A;  1GOT B;  4U1E I;  3I7O A;  2PM7 B;  1U4C A;  1JMX B;  4LG9 A;  4H5I A;  5IGQ A;  4XYH A;  3ZWL B;  2YMU A;  2H6Q A;  2PBI B;  3AH8 B;  3DWL C;  4A11 B;  5TDH B;  1GXR A;  4LGN A;  2HKM A;  4A0B A;  4PC0 A;  2CO0 A;  4CY2 A;  2H6K A;  4K3J B;  1OMW B;  4H5J A;  3EI3 A;  3I2N A;  5B4W A;  3I7P A;  1ERJ A;  1N6E A;  3DXM C;  3OL2 A;  2IUQ A;  2XYI A;  4BL0 A;  4CY3 A;  2YNN A;  4XEI C;  4X3E A;  2B4E A;  2AH0 A;  4I79 A;  3K26 A;  5AMS A;  4GQ2 P;  3ULE C;  4JSV C;  2W18 A;  4X60 B;  2I0S A;  3SWS D;  5FQD A;  4JT6 C;  2CN2 A;  3OKY A;  5IGO A;  4A11 A;  3F3P A;  4J0X A;  4PSX B;  4ERY A;  3ORV D;  3VA6 A;  3UVM A;  3J81 g;  2QC5 A;  3EI1 A;  3BWS A;  2HJ4 A;  2XL3 A;  1B9X A;  2H47 A;  4E5Z B;  3DSM A;  4J8B A;  1PBY B;  2H3X A;  5EMM B;  4E54 A;  3KRW B;  5IJ8 E;  4ESG A;  3P4F A;  4ZOV A;  4QT8 A;  4JSN C;  5FLX g;  1TYQ C;  3PVU B;  3CIK B;  5EAM A;  3SMR A;  5HE3 B;  2QXV A;  1NEX B;  5FKS A;  2GC7 A;  2H14 A;  4J81 A;  5H1M A;  3SHF A;  2CNX A;  2YNO A;  3EG6 A;  4CZX A;  1RI6 A;  2YBA A;  1YFQ A;  5GXI A;  4CY5 A;  4CI1 A;  5HE0 B;  4CI2 A;  5CYK B;  3I7H A;  3MZL A;  3PXT D;  5HQG A;  5THA A;  2AGY A;  2Z2O A;  3HFQ A;  3IKO A;  5GSA A;  3FRX A;  3EI2 A;  2B5L A;  2P9P C;  4X61 B;  3PSC B;  2UZY B;  2OIZ A;  3OW8 A;  5H14 A;  3DM0 A;  3EI1 B;  4QQE A;  2BCJ B;  5TEE A;  2J55 H;  5FKQ A;  2G9A A;  2J56 H;  4FA1 D;  4E54 B;  5EAP A;  3F3G A;  2P9I C;  4R7A B;  5CXC A;  4A7J A;  4J8G A;  3RSE C;  2P9U C;  5FKT A;  5EM2 B;  2I0T A;  2CN3 A;  4J0W A;  4J73 A;  3SBR A;  3N0D A;  3RN1 D;  5I5M A;  2IAA A;  4A08 B;  4A0A B;  1JJU B;  1K8K C;  2AGL A;  3SLE D;  2HXC A;  1GG2 B;  4Z8L A;  5EMJ B;  4KFM B;  2Z2N A;  3AL8 A;  4ERQ A;  3W15 A;  2Z2P A;  3PVW B;  2IUV A;  5C2W B;  5K1C C;  3JZG A;  4HDJ A;  3FM0 A;  3UKR C;  2IWK A;  3C75 H;  1XIP A;  2H9M A;  3ODT A;  2H9N A;  2TRC B;  2IUR A;  3EI3 B;  3EWE A;  3PE7 A;  3J80 g;  4MK0 B;  2H6N A;  4GGD A;  4LG8 A;  3UR4 A;  3MKQ A;  4ZOY A;  1PGU A;  1TBG A;  2I3S A;  3OL2 B;  4NSX A;  2HYE A;  1P22 A;  4ZOZ A;  4FA5 D;  4ERZ A;  1NR0 A;  4L3H D;  3K27 A;  5EMK B;  4GM3 A;  4O9D A;  5CXB A;  3UVN A;  3GFC A;  4N14 A;  4FAV D;  2H13 A;  2GNQ A;  4JSX C;  3NVQ A;  5HE2 B;  3UVO A;  2XU7 A;  3OTT A;  2AGZ A;  5CYK A;  3IJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...