4FB1D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 60 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transfer
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fb1D00
3B7FA 3I7OA 5IGQA 5EMJB 4ERYA 1TBGA 2H14A 3OKTA 5CYKB 2H9PA 5EM2A 4GQ2P 2EBSA 4FAVD 1QNIA 5GSAA 3E0CA 2IUQA 4MK0B 5IGOA 2B4EA 2XL3A 3L4OD 3JAMg 2I3TA 3RN1D 2H9NA 3I7HA 2H3XA 3EI3B 5K19A 1K8KC 5H14A 3IKOA 5FLXg 1OLZA 5GMKn 3DXMC 4N14A 4D0KA 5HE0B 4FAND 3ORVD 4JT5C 4CZVA 3RFGA 3F3PA 1N6DA 3SWSD 3J80g 2HXCA 2OVRB 5EMMB 3IIYA 2HJ4A 2AGZA 5HE3B 3RMZD 1XHMA 2PM6B 2H68A 3GREA 5C2WB 2HKRA 3PXSD 5EAMA 4FA4D 4Y5RD 2I0RA 4ZOXA 4A2LA 3ODTA 2Z2PA 5FKQA 4GZ8A 5TDHB 2P9LC 4PSXB 4CY2A 3EI4A 3SN6B 2UZXB 5EM2B 3GFCA 3NVQA 4NSXA 1SHYB 3NVNA 5H1MA 3BG1A 3F3FA 4J73A 5TEEA 2IWKA 4YVDA 3DXKC 4J8BA 2CO0C 4ZOVA 2P9PC 5EARA 3UR4A 5I5IA 4E54A 4O1QD 4XYIA 2H47A 1P22A 1Q47A 2OJYA 5THAA 3UKRC 4GGAA 3JZHA 1PEVA 5AFU3 4BUJC 5AJAA 3OKYA 4L3HD 4ZOZA 4FHLA 5TEFA 4K3JB 3MZKA 4J84A 3PVUB 1GOTB 3PSLA 3SHFA 3JB9L 3SMRA 3UVOA 2H13A 3MKSB 2YNPA 3AH8B 5I5JA 4BH6A 5IT9g 5FXYA 4JT6C 1ERJA 2YB8B 4PSWB 3AFCA 3JZNA 5GXIA 3RN0D 4CI2A 5HYNB 3EI4B 3I8CA 4FA1D 5FKRA 1U4CA 2P9UC 3I7KA 3OW8A 4A7JA 4FA9D 1A0RB 3VGZA 2P9NC 5SXMA 3F3GA 4JSPC 1GG2B 1GXRA 3HFQA 3PVWB 2H9MA 3EI2A 3EU7A 3SCYA 2I0SA 4PBYA 5IC7A 4K3ID 4E54B 4QRJA 5I5MA 5CXBA 2Z2NA 1MDAH 4BL0A 4J77A 4A09A 1MG2A 3U4YA 1JJUB 3RRMC 3V5WB 3OKYB 4JD2C 1NEXB 4X60B 2GNQA 4L3GD 4GQ1A 2J57G 4A11A 4A2MA 4HDJA 3JROA 4CY5A 3PXWD 3KRXB 4X61B 2I0TA 3I8EA 2IURA 4GM3A 4O3UB 3SJLD 4FWWA 3IIWA 3OKWA 3MMYA 2P9SC 3AL8A 4CZYA 3JRPA 4ESGA 3EI1A 3CIKB 4CI3A 2OK4A 4A08A 1PI6A 1FWXA 4PC0A 2BBKH 4ES0A 3C75H 1K32A 5C9ZB 4ERQA 2AQ5A 4J87A 3V9FA 5B4WA 4CC9A 2P9IC 3UVKA 5H17A 5EAPA 3EI2B 5FKTA 3PE7A 4O45A 5C2VB 3JZGA 2YNNA 5CXBB 2YMUA 2OIZA 2AGLA 4GM8A 3I2NA 5K1CC 4A09B 4KFMB 4A0AA 2XYIA 3BWSA 2HKMA 2OVQB 3V7DB 4UI9R 2J55H 2W18A 3N0DA 2HYEA 3OTTA 4QT8A 4A11B 2GC4A 1VYHC 5FA5B 5HE1B 5TF2A 4IA9A 2TRCB 2CNXA 2H6QA 5EMLB 3UVMA 3KRWB 1XIPA 4PBZA 3ULEC 4A0BA 1PBYB 4GGCA 3AL8B 3MZLA 2AH0A 3EI1B 3EWEA 4A08B 3RFHA 3IJ0A 2B5NA 3ZWLB 4CI1A 2AGXA 1PGUA 3RLMD 4LGNA 2CE9A 4JXMA 3PSCB 2Z2OA 1JMZB 4Z8LA 2PM9A 2G9AA 2PM7B 4D6VA 4J79A 4CI8A 2B5MA 3EG6A 4L1QD 3IJ1A 1N6FA 4OWRA 4I79A 2AH1A 4FA5D 3FRXA 4FB1D 1B9XA 3JPXA 1S4UX 4TZ4A 5EALA 5CXCA 4CY3A 1XKSA 4JSNC 3C99A 5HQGA 1OMWB 3N0EA 4LG8A 3K26A 3A0FA 4A0AB 2QC5A 3I89A 2BCJB 4U1EI 3C5MA 5FKSA 2H6NA 2IWFA 2OVPB 2P9KC 5IJ8E 3VA6A 3SFZA 2MTAH 1YFQA 3C9CA 3P4FA 4QL1A 2CN3A 4Y7RA 2GC7A 2AGYA 3SBRA 4A0BB 1N6EA 3IJCA 5AMSA 4L9OA 1JMXB 1SQ9A 4AEZA 4XYHA 4J0WA 2HJBA 4O3TB 3I7LA 1SQJA 1U2VC 4E5ZA 1MG3A 4J78A 3UVNA 3FGBA 4ZN4A 3CFVA 4CY1A 3UVLA 4EWRA 3SLED 3UKUC 1TYQC 1L0QA 3MKQA 4OZUA 4J81A 1RI6A 2PM9B 4PXWA 5EMKB 2AGWA 3SVWD 4R7AB 4XEIC 2YNOA 2XU7A 3OL2A 5KDOB 1GP2B 4JSVC 2YBAA 3I7PA 4ERZA 5CXCB 2B5LA 4PNKB 4QQEA 3K27A 4H5IA 4G56B 3FM0A 5CYKA 5FQDA 3DM0A 3BG0A 2OK6A 2QXVA 3SXTD 2G99A 1JOFA 2UZYB 3W15A 4CZXA 3RSEC 3DSMA 3SBQA 4X63B 4J8GA 4X3EA 4GMBA 2I3SA 2J56H 4IMMA 4O9DA 2CO0A 4U7AA 1R5MA 3EI3A 4AOWA 1B9YA 4ZOYA 2Q7QA 2XL2A 4J82A 4JSXC 2IUPA 3J81g 3MXXA 2CN2A 3CFSB 5JWZA 3VH0A 2IAAA 4E5ZB 4GQBB 4LG9A 2CE8A 3L4MD 2IUVA 4H5JA 5HE2B 4J0XA 3DWLC 5A2Qg 3NVXA 3EMHA 3SBPA 2H6KA 3I7NA 4GM9A 5GXHA 2O9KA 2PBIB 4J86A 3OL2B 2H9LA 2HESX 1NR0A 5IJ7E 3AL9A 3PXTD 4GGDA
chains in the Genus database with same CATH superfamily
3B7FA 3I7OA 3IURA 3EQ8A 5IGQA 5EMJB 4WK0A 4ERYA 1TBGA 2H14A 3OKTA 3IUJA 4DNVA 3GD1I 5CYKB 2H9PA 5EM2A 4GQ2P 4DNWA 4NBMA 2EBSA 4FAVD 1QNIA 5GSAA 2VZ3A 3E0CA 3ZDZA 2IUQA 2VDOA 4MK0B 5IGOA 4Z7OA 2B4EA 2XL3A 3L4OD 3JAMg 2I3TA 3RN1D 2H9NA 3I7HA 2H3XA 1L5GA 2BKLA 3VI4A 3EI3B 3T3MA 5K19A 1K8KC 5H14A 3IKOA 5FLXg 1UTCA 3EQ7A 1OLZA 5GMKn 3DXMC 4N14A 4D0KA 5HE0B 4FAND 3ORVD 3ZE1A 4JT5C 4CZVA 5M5TA 3RFGA 3F3PA 1N6DA 3SWSD 3J80g 2HXCA 2OVRB 3MUNA 5EMMB 3IIYA 2HJ4A 2AGZA 5HE3B 3RMZD 1XHMA 2PM6B 2H68A 1H2YA 3GREA 5C2WB 3NIFA 2HKRA 5C92A 3PXSD 2XE4A 5EAMA 4FA4D 4Y5RD 5M61A 2I0RA 4ZOXA 4A2LA 4MMXA 1VZ3A 3O4GA 2Z2PA 3ODTA 4GZ8A 5FKQA 5TDHB 2P9LC 4PSXB 4AN1A 3EI4A 4CY2A 3IUMA 3SN6B 2UZXB 5EM2B 3GFCA 3NVQA 4NSXA 1SHYB 3NVNA 5H1MA 3BG1A 3F3FA 1VZ2A 4J73A 5TEEA 3OF7A 2IWKA 4YVDA 3DXKC 4J8BA 2CO0C 4ZOVA 2P9PC 4AN0A 5EARA 1O6FA 3UR4A 5I5IA 4E54A 1M1XA 4MMZA 4O1QD 2H47A 4XYIA 1A12A 1P22A 1Q47A 4UM8A 5M5RA 2OJYA 5THAA 3UKRC 1UOPA 4GGAA 3K72A 3JZHA 3IUQA 1PEVA 5AFU3 4BUJC 5AJAA 1GOGA 2XZGA 3OKYA 4L3HD 4ZOZA 4FHLA 4O2WA 5TEFA 2HU8A 4K3JB 3MZKA 4J84A 3PVUB 4NC4A 1GOTB 1H2WA 3PSLA 3SHFA 3JB9L 3SMRA 3UVOA 2H13A 3MKSB 2YNPA 3AH8B 5I5JA 4BH6A 5IT9g 5FXYA 4JT6C 1ERJA 3IULA 2YB8B 4PSWB 3V4VA 3AFCA 4BP9A 3JZNA 5GXIA 2WQ8A 4QAMA 3RN0D 4CI2A 3QI0A 5HYNB 1BPOA 2QZPA 4G1MA 3EI4B 3I8CA 5C86A 4FA1D 5FKRA 1U4CA 2P9UC 3I7KA 3OW8A 4A7JA 4FA9D 1A0RB 2VC2A 3VGZA 2P9NC 5SXMA 3F3GA 1GOFA 4JSPC 1GG2B 1GXRA 3HFQA 3PVWB 2H9MA 3EI2A 3EU7A 3SCYA 2I0SA 1JTDB 3FCUA 1H2XA 4PBYA 5IC7A 4K3ID 4E54B 1I2MB 4QRJA 5I5MA 4G1EA 5CXBA 2Z2NA 1MDAH 2EIBA 4BL0A 4J77A 2VDRA 4A09A 1QFMA 4Z7NA 1MG2A 3U4YA 1JJUB 3RRMC 3V5WB 3OKYB 4JD2C 1NEXB 4X60B 2GNQA 4L3GD 4GQ1A 4AMYA 2J57G 4A11A 4A2MA 1VE6A 4HDJA 3JROA 5FFGA 3PXWD 4CY5A 3KRXB 1C9IA 4X61B 2I0TA 3I8EA 2IURA 4G55A 4GM3A 4O3UB 4RE5A 4L1MA 3SJLD 4FWWA 3IIWA 3OKWA 3MMYA 2P9SC 1C9LA 3AL8A 4CZYA 1U8CA 3JRPA 2VZ1A 4ESGA 3EI1A 3CIKB 4CI3A 4Z7QA 2OK4A 4A08A 1TYEA 1PI6A 1FWXA 1E5TA 4PC0A 2BBKH 5M5SA 3IJEA 4ES0A 3KCIA 3C75H 1K32A 5C9ZB 4ERQA 4WK4A 3V4PA 2AQ5A 5HDBA 4J87A 4BCBA 3V9FA 5B4WA 4CC9A 4IRZA 1VE7A 2P9IC 1K3IA 3UVKA 5H17A 5EAPA 3EI2B 3ZE0A 5FKTA 3PE7A 4O45A 5C2VB 3JZGA 2YNNA 5CXBB 2YMUA 5M5VA 3K71A 2OIZA 2AGLA 4GM8A 3I2NA 5K1CC 4A09B 4KFMB 4A0AA 1QFSA 2XYIA 3BWSA 2VDQA 2HKMA 2OVQB 4WK2A 3V7DB 4UI9R 4NENA 4JHNA 2J55H 2W18A 3N0DA 3T3PA 2HYEA 3OTTA 4QT8A 4A11B 2GC4A 1VYHC 5FA5B 5HE1B 5TF2A 3ZDYA 4IA9A 2TRCB 2CNXA 2H6QA 2VDLA 5EMLB 3UVMA 3KRWB 2XDWA 1XIPA 4PBZA 3ULEC 4A0BA 1PBYB 4GGCA 3AL8B 1UOQA 3MZLA 4AX4A 2AH0A 3O4IA 3EI1B 3EWEA 4A08B 3RFHA 3IJ0A 4BCCA 2B5NA 3ZWLB 4CI1A 1YR2A 2AGXA 1PGUA 3RLMD 2QR5A 2HU7A 4LGNA 2CE9A 4JXMA 3PSCB 2Z2OA 1JMZB 4Z8LA 2PM9A 2G9AA 2PM7B 4D6VA 4J79A 4CI8A 2B5MA 3EG6A 4L1QD 3IJ1A 3IVMA 1N6FA 4DNUA 4OWRA 4I79A 2AH1A 4FA5D 3FRXA 2HU5A 4D9SA 4FB1D 1B9XA 3JPXA 1S4UX 4TZ4A 5EALA 5CXCA 3NIGA 4CY3A 1XKSA 4JSNC 4JHPC 3C99A 5HQGA 1OMWB 3N0EA 4LG8A 3K26A 3A0FA 4A0AB 3NIDA 2QC5A 3I89A 2BCJB 4U1EI 2EIDA 3C5MA 5FKSA 2H6NA 2IWFA 2OVPB 2P9KC 5IJ8E 3VA6A 3SFZA 2MTAH 1YFQA 3C9CA 3P4FA 4QL1A 4RE6A 4WJKA 2CN3A 4Y7RA 2GC7A 2AGYA 3SBRA 4A0BB 1N6EA 3IJCA 5AMSA 4L9OA 3QHYB 1JMXB 1SQ9A 4AEZA 4XYHA 4J0WA 2HJBA 4O3TB 3I7LA 3ZDXA 1SQJA 1U2VC 4E5ZA 1MG3A 4J78A 3UVNA 4O02A 3FGBA 4ZN4A 3CFVA 4CY1A 3UVLA 4EWRA 2VDPA 3SLED 3UKUC 1L0QA 1TYQC 2VDMA 3MKQA 1JV2A 4J81A 1RI6A 2PM9B 2JKXA 3EQ9A 4OZUA 2AGWA 4PXWA 5EMKB 3ZE2A 3SVWD 4R7AB 4XEIC 2YNOA 2XU7A 3OL2A 1E8MA 5KDOB 4MMYA 1GP2B 4JSVC 2YBAA 3I7PA 3O4JA 4AMZA 4ERZA 5CXCB 2B5LA 4PNKB 4QQEA 3IUNA 3K27A 4H5IA 4G56B 3FM0A 5CYKA 5FQDA 3DM0A 3BG0A 2OK6A 2QXVA 3SXTD 2G99A 4NAAA 1JOFA 2UZYB 2EIEA 3W15A 4CZXA 3RSEC 3DSMA 3SBQA 4X63B 4J8GA 3VI3A 1O6GA 4X3EA 4GMBA 2I3SA 2J56H 4IMMA 1UOOA 4O9DA 3O4HA 2CO0A 4U7AA 1T2XA 1R5MA 3EI3A 5M5UA 1E8NA 4AOWA 1B9YA 4ZOYA 2Q7QA 2XL2A 4J82A 4JSXC 5E6SA 2IUPA 3J81g 5FFOA 3MXXA 2VDNA 2CN2A 3CFSB 4BP8A 5JWZA 3VH0A 3MVDK 2IAAA 4E5ZB 4GQBB 4LG9A 2CE8A 3L4MD 2IUVA 4H5JA 5HE2B 4J0XA 3DWLC 5A2Qg 3NVXA 3EMHA 3SBPA 3FCSA 2H6KA 3DDUA 3I7NA 4GM9A 4UM9A 5GXHA 2O9KA 3MUOA 2PBIB 4J86A 3GC3B 1H2ZA 3OL2B 1GOHA 4BCDA 5E6UA 2H9LA 3K6SA 2HESX 1NR0A 2EICA 5IJ7E 3AL9A 3PXTD 2VDKA 5E6RA 4GGDA
chains in the Genus database with same CATH topology
3B7FA 3I7OA 5IGQA 5EMJB 4ERYA 1TBGA 2H14A 3OKTA 5CYKB 2H9PA 5EM2A 4GQ2P 2EBSA 4FAVD 1QNIA 5GSAA 3E0CA 2IUQA 4MK0B 5IGOA 2B4EA 2XL3A 3L4OD 3JAMg 2I3TA 3RN1D 2H9NA 3I7HA 2H3XA 3EI3B 5K19A 1K8KC 5H14A 3IKOA 5FLXg 1OLZA 5GMKn 3DXMC 4N14A 4D0KA 5HE0B 4FAND 3ORVD 4JT5C 4CZVA 3RFGA 3F3PA 1N6DA 3SWSD 3J80g 2HXCA 2OVRB 5EMMB 3IIYA 2HJ4A 2AGZA 5HE3B 3RMZD 1XHMA 2PM6B 2H68A 3GREA 5C2WB 2HKRA 3PXSD 5EAMA 4FA4D 4Y5RD 2I0RA 4ZOXA 4A2LA 3ODTA 2Z2PA 5FKQA 4GZ8A 5TDHB 2P9LC 4PSXB 4CY2A 3EI4A 3SN6B 2UZXB 5EM2B 3GFCA 3NVQA 4NSXA 1SHYB 3NVNA 5H1MA 3BG1A 3F3FA 4J73A 5TEEA 2IWKA 4YVDA 3DXKC 4J8BA 2CO0C 4ZOVA 2P9PC 5EARA 3UR4A 5I5IA 4E54A 4O1QD 4XYIA 2H47A 1P22A 1Q47A 2OJYA 5THAA 3UKRC 4GGAA 3JZHA 1PEVA 5AFU3 4BUJC 5AJAA 3OKYA 4L3HD 4ZOZA 4FHLA 5TEFA 4K3JB 3MZKA 4J84A 3PVUB 1GOTB 3PSLA 3SHFA 3JB9L 3SMRA 3UVOA 2H13A 3MKSB 2YNPA 3AH8B 5I5JA 4BH6A 5IT9g 5FXYA 4JT6C 1ERJA 2YB8B 4PSWB 3AFCA 3JZNA 5GXIA 3RN0D 4CI2A 5HYNB 3EI4B 3I8CA 4FA1D 5FKRA 1U4CA 2P9UC 3I7KA 3OW8A 4A7JA 4FA9D 1A0RB 3VGZA 2P9NC 5SXMA 3F3GA 4JSPC 1GG2B 1GXRA 3HFQA 3PVWB 2H9MA 3EI2A 3EU7A 3SCYA 2I0SA 4PBYA 5IC7A 4K3ID 4E54B 4QRJA 5I5MA 5CXBA 2Z2NA 1MDAH 4BL0A 4J77A 4A09A 1MG2A 3U4YA 1JJUB 3RRMC 3V5WB 3OKYB 4JD2C 1NEXB 4X60B 2GNQA 4L3GD 4GQ1A 2J57G 4A11A 4A2MA 4HDJA 3JROA 4CY5A 3PXWD 3KRXB 4X61B 2I0TA 3I8EA 2IURA 4GM3A 4O3UB 3SJLD 4FWWA 3IIWA 3OKWA 3MMYA 2P9SC 3AL8A 4CZYA 3JRPA 4ESGA 3EI1A 3CIKB 4CI3A 2OK4A 4A08A 1PI6A 1FWXA 4PC0A 2BBKH 4ES0A 3C75H 1K32A 5C9ZB 4ERQA 2AQ5A 4J87A 3V9FA 5B4WA 4CC9A 2P9IC 3UVKA 5H17A 5EAPA 3EI2B 5FKTA 3PE7A 4O45A 5C2VB 3JZGA 2YNNA 5CXBB 2YMUA 2OIZA 2AGLA 4GM8A 3I2NA 5K1CC 4A09B 4KFMB 4A0AA 2XYIA 3BWSA 2HKMA 2OVQB 3V7DB 4UI9R 2J55H 2W18A 3N0DA 2HYEA 3OTTA 4QT8A 4A11B 2GC4A 1VYHC 5FA5B 5HE1B 5TF2A 4IA9A 2TRCB 2CNXA 2H6QA 5EMLB 3UVMA 3KRWB 1XIPA 4PBZA 3ULEC 4A0BA 1PBYB 4GGCA 3AL8B 3MZLA 2AH0A 3EI1B 3EWEA 4A08B 3RFHA 3IJ0A 2B5NA 3ZWLB 4CI1A 2AGXA 1PGUA 3RLMD 4LGNA 2CE9A 4JXMA 3PSCB 2Z2OA 1JMZB 4Z8LA 2PM9A 2G9AA 2PM7B 4D6VA 4J79A 4CI8A 2B5MA 3EG6A 4L1QD 3IJ1A 1N6FA 4OWRA 4I79A 2AH1A 4FA5D 3FRXA 4FB1D 1B9XA 3JPXA 1S4UX 4TZ4A 5EALA 5CXCA 4CY3A 1XKSA 4JSNC 3C99A 5HQGA 1OMWB 3N0EA 4LG8A 3K26A 3A0FA 4A0AB 2QC5A 3I89A 2BCJB 4U1EI 3C5MA 5FKSA 2H6NA 2IWFA 2OVPB 2P9KC 5IJ8E 3VA6A 3SFZA 2MTAH 1YFQA 3C9CA 3P4FA 4QL1A 2CN3A 4Y7RA 2GC7A 2AGYA 3SBRA 4A0BB 1N6EA 3IJCA 5AMSA 4L9OA 1JMXB 1SQ9A 4AEZA 4XYHA 4J0WA 2HJBA 4O3TB 3I7LA 1SQJA 1U2VC 4E5ZA 1MG3A 4J78A 3UVNA 3FGBA 4ZN4A 3CFVA 4CY1A 3UVLA 4EWRA 3SLED 3UKUC 1TYQC 1L0QA 3MKQA 4OZUA 4J81A 1RI6A 2PM9B 4PXWA 5EMKB 2AGWA 3SVWD 4R7AB 4XEIC 2YNOA 2XU7A 3OL2A 5KDOB 1GP2B 4JSVC 2YBAA 3I7PA 4ERZA 5CXCB 2B5LA 4PNKB 4QQEA 3K27A 4H5IA 4G56B 3FM0A 5CYKA 5FQDA 3DM0A 3BG0A 2OK6A 2QXVA 3SXTD 2G99A 1JOFA 2UZYB 3W15A 4CZXA 3RSEC 3DSMA 3SBQA 4X63B 4J8GA 4X3EA 4GMBA 2I3SA 2J56H 4IMMA 4O9DA 2CO0A 4U7AA 1R5MA 3EI3A 4AOWA 1B9YA 4ZOYA 2Q7QA 2XL2A 4J82A 4JSXC 2IUPA 3J81g 3MXXA 2CN2A 3CFSB 5JWZA 3VH0A 2IAAA 4E5ZB 4GQBB 4LG9A 2CE8A 3L4MD 2IUVA 4H5JA 5HE2B 4J0XA 3DWLC 5A2Qg 3NVXA 3EMHA 3SBPA 2H6KA 3I7NA 4GM9A 5GXHA 2O9KA 2PBIB 4J86A 3OL2B 2H9LA 2HESX 1NR0A 5IJ7E 3AL9A 3PXTD 4GGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7F A;  3I7O A;  5IGQ A;  5EMJ B;  4ERY A;  1TBG A;  2H14 A;  3OKT A;  5CYK B;  2H9P A;  5EM2 A;  4GQ2 P;  2EBS A;  4FAV D;  1QNI A;  5GSA A;  3E0C A;  2IUQ A;  4MK0 B;  5IGO A;  2B4E A;  2XL3 A;  3L4O D;  3JAM g;  2I3T A;  3RN1 D;  2H9N A;  3I7H A;  2H3X A;  3EI3 B;  5K19 A;  1K8K C;  5H14 A;  3IKO A;  5FLX g;  1OLZ A;  5GMK n;  3DXM C;  4N14 A;  4D0K A;  5HE0 B;  4FAN D;  3ORV D;  4JT5 C;  4CZV A;  3RFG A;  3F3P A;  1N6D A;  3SWS D;  3J80 g;  2HXC A;  2OVR B;  5EMM B;  3IIY A;  2HJ4 A;  2AGZ A;  5HE3 B;  3RMZ D;  1XHM A;  2PM6 B;  2H68 A;  3GRE A;  5C2W B;  2HKR A;  3PXS D;  5EAM A;  4FA4 D;  4Y5R D;  2I0R A;  4ZOX A;  4A2L A;  3ODT A;  2Z2P A;  5FKQ A;  4GZ8 A;  5TDH B;  2P9L C;  4PSX B;  4CY2 A;  3EI4 A;  3SN6 B;  2UZX B;  5EM2 B;  3GFC A;  3NVQ A;  4NSX A;  1SHY B;  3NVN A;  5H1M A;  3BG1 A;  3F3F A;  4J73 A;  5TEE A;  2IWK A;  4YVD A;  3DXK C;  4J8B A;  2CO0 C;  4ZOV A;  2P9P C;  5EAR A;  3UR4 A;  5I5I A;  4E54 A;  4O1Q D;  4XYI A;  2H47 A;  1P22 A;  1Q47 A;  2OJY A;  5THA A;  3UKR C;  4GGA A;  3JZH A;  1PEV A;  5AFU 3;  4BUJ C;  5AJA A;  3OKY A;  4L3H D;  4ZOZ A;  4FHL A;  5TEF A;  4K3J B;  3MZK A;  4J84 A;  3PVU B;  1GOT B;  3PSL A;  3SHF A;  3JB9 L;  3SMR A;  3UVO A;  2H13 A;  3MKS B;  2YNP A;  3AH8 B;  5I5J A;  4BH6 A;  5IT9 g;  5FXY A;  4JT6 C;  1ERJ A;  2YB8 B;  4PSW B;  3AFC A;  3JZN A;  5GXI A;  3RN0 D;  4CI2 A;  5HYN B;  3EI4 B;  3I8C A;  4FA1 D;  5FKR A;  1U4C A;  2P9U C;  3I7K A;  3OW8 A;  4A7J A;  4FA9 D;  1A0R B;  3VGZ A;  2P9N C;  5SXM A;  3F3G A;  4JSP C;  1GG2 B;  1GXR A;  3HFQ A;  3PVW B;  2H9M A;  3EI2 A;  3EU7 A;  3SCY A;  2I0S A;  4PBY A;  5IC7 A;  4K3I D;  4E54 B;  4QRJ A;  5I5M A;  5CXB A;  2Z2N A;  1MDA H;  4BL0 A;  4J77 A;  4A09 A;  1MG2 A;  3U4Y A;  1JJU B;  3RRM C;  3V5W B;  3OKY B;  4JD2 C;  1NEX B;  4X60 B;  2GNQ A;  4L3G D;  4GQ1 A;  2J57 G;  4A11 A;  4A2M A;  4HDJ A;  3JRO A;  4CY5 A;  3PXW D;  3KRX B;  4X61 B;  2I0T A;  3I8E A;  2IUR A;  4GM3 A;  4O3U B;  3SJL D;  4FWW A;  3IIW A;  3OKW A;  3MMY A;  2P9S C;  3AL8 A;  4CZY A;  3JRP A;  4ESG A;  3EI1 A;  3CIK B;  4CI3 A;  2OK4 A;  4A08 A;  1PI6 A;  1FWX A;  4PC0 A;  2BBK H;  4ES0 A;  3C75 H;  1K32 A;  5C9Z B;  4ERQ A;  2AQ5 A;  4J87 A;  3V9F A;  5B4W A;  4CC9 A;  2P9I C;  3UVK A;  5H17 A;  5EAP A;  3EI2 B;  5FKT A;  3PE7 A;  4O45 A;  5C2V B;  3JZG A;  2YNN A;  5CXB B;  2YMU A;  2OIZ A;  2AGL A;  4GM8 A;  3I2N A;  5K1C C;  4A09 B;  4KFM B;  4A0A A;  2XYI A;  3BWS A;  2HKM A;  2OVQ B;  3V7D B;  4UI9 R;  2J55 H;  2W18 A;  3N0D A;  2HYE A;  3OTT A;  4QT8 A;  4A11 B;  2GC4 A;  1VYH C;  5FA5 B;  5HE1 B;  5TF2 A;  4IA9 A;  2TRC B;  2CNX A;  2H6Q A;  5EML B;  3UVM A;  3KRW B;  1XIP A;  4PBZ A;  3ULE C;  4A0B A;  1PBY B;  4GGC A;  3AL8 B;  3MZL A;  2AH0 A;  3EI1 B;  3EWE A;  4A08 B;  3RFH A;  3IJ0 A;  2B5N A;  3ZWL B;  4CI1 A;  2AGX A;  1PGU A;  3RLM D;  4LGN A;  2CE9 A;  4JXM A;  3PSC B;  2Z2O A;  1JMZ B;  4Z8L A;  2PM9 A;  2G9A A;  2PM7 B;  4D6V A;  4J79 A;  4CI8 A;  2B5M A;  3EG6 A;  4L1Q D;  3IJ1 A;  1N6F A;  4OWR A;  4I79 A;  2AH1 A;  4FA5 D;  3FRX A;  4FB1 D;  1B9X A;  3JPX A;  1S4U X;  4TZ4 A;  5EAL A;  5CXC A;  4CY3 A;  1XKS A;  4JSN C;  3C99 A;  5HQG A;  1OMW B;  3N0E A;  4LG8 A;  3K26 A;  3A0F A;  4A0A B;  2QC5 A;  3I89 A;  2BCJ B;  4U1E I;  3C5M A;  5FKS A;  2H6N A;  2IWF A;  2OVP B;  2P9K C;  5IJ8 E;  3VA6 A;  3SFZ A;  2MTA H;  1YFQ A;  3C9C A;  3P4F A;  4QL1 A;  2CN3 A;  4Y7R A;  2GC7 A;  2AGY A;  3SBR A;  4A0B B;  1N6E A;  3IJC A;  5AMS A;  4L9O A;  1JMX B;  1SQ9 A;  4AEZ A;  4XYH A;  4J0W A;  2HJB A;  4O3T B;  3I7L A;  1SQJ A;  1U2V C;  4E5Z A;  1MG3 A;  4J78 A;  3UVN A;  3FGB A;  4ZN4 A;  3CFV A;  4CY1 A;  3UVL A;  4EWR A;  3SLE D;  3UKU C;  1TYQ C;  1L0Q A;  3MKQ A;  4OZU A;  4J81 A;  1RI6 A;  2PM9 B;  4PXW A;  5EMK B;  2AGW A;  3SVW D;  4R7A B;  4XEI C;  2YNO A;  2XU7 A;  3OL2 A;  5KDO B;  1GP2 B;  4JSV C;  2YBA A;  3I7P A;  4ERZ A;  5CXC B;  2B5L A;  4PNK B;  4QQE A;  3K27 A;  4H5I A;  4G56 B;  3FM0 A;  5CYK A;  5FQD A;  3DM0 A;  3BG0 A;  2OK6 A;  2QXV A;  3SXT D;  2G99 A;  1JOF A;  2UZY B;  3W15 A;  4CZX A;  3RSE C;  3DSM A;  3SBQ A;  4X63 B;  4J8G A;  4X3E A;  4GMB A;  2I3S A;  2J56 H;  4IMM A;  4O9D A;  2CO0 A;  4U7A A;  1R5M A;  3EI3 A;  4AOW A;  1B9Y A;  4ZOY A;  2Q7Q A;  2XL2 A;  4J82 A;  4JSX C;  2IUP A;  3J81 g;  3MXX A;  2CN2 A;  3CFS B;  5JWZ A;  3VH0 A;  2IAA A;  4E5Z B;  4GQB B;  4LG9 A;  2CE8 A;  3L4M D;  2IUV A;  4H5J A;  5HE2 B;  4J0X A;  3DWL C;  5A2Q g;  3NVX A;  3EMH A;  3SBP A;  2H6K A;  3I7N A;  4GM9 A;  5GXH A;  2O9K A;  2PBI B;  4J86 A;  3OL2 B;  2H9L A;  2HES X;  1NR0 A;  5IJ7 E;  3AL9 A;  3PXT D;  4GGD A; 
#chains in the Genus database with same CATH topology
 3B7F A;  3I7O A;  3IUR A;  3EQ8 A;  5IGQ A;  5EMJ B;  4WK0 A;  4ERY A;  1TBG A;  2H14 A;  3OKT A;  3IUJ A;  4DNV A;  3GD1 I;  5CYK B;  2H9P A;  5EM2 A;  4GQ2 P;  4DNW A;  4NBM A;  2EBS A;  4FAV D;  1QNI A;  5GSA A;  2VZ3 A;  3E0C A;  3ZDZ A;  2IUQ A;  2VDO A;  4MK0 B;  5IGO A;  4Z7O A;  2B4E A;  2XL3 A;  3L4O D;  3JAM g;  2I3T A;  3RN1 D;  2H9N A;  3I7H A;  2H3X A;  1L5G A;  2BKL A;  3VI4 A;  3EI3 B;  3T3M A;  5K19 A;  1K8K C;  5H14 A;  3IKO A;  5FLX g;  1UTC A;  3EQ7 A;  1OLZ A;  5GMK n;  3DXM C;  4N14 A;  4D0K A;  5HE0 B;  4FAN D;  3ORV D;  3ZE1 A;  4JT5 C;  4CZV A;  5M5T A;  3RFG A;  3F3P A;  1N6D A;  3SWS D;  3J80 g;  2HXC A;  2OVR B;  3MUN A;  5EMM B;  3IIY A;  2HJ4 A;  2AGZ A;  5HE3 B;  3RMZ D;  1XHM A;  2PM6 B;  2H68 A;  1H2Y A;  3GRE A;  5C2W B;  3NIF A;  2HKR A;  5C92 A;  3PXS D;  2XE4 A;  5EAM A;  4FA4 D;  4Y5R D;  5M61 A;  2I0R A;  4ZOX A;  4A2L A;  4MMX A;  1VZ3 A;  3O4G A;  2Z2P A;  3ODT A;  4GZ8 A;  5FKQ A;  5TDH B;  2P9L C;  4PSX B;  4AN1 A;  3EI4 A;  4CY2 A;  3IUM A;  3SN6 B;  2UZX B;  5EM2 B;  3GFC A;  3NVQ A;  4NSX A;  1SHY B;  3NVN A;  5H1M A;  3BG1 A;  3F3F A;  1VZ2 A;  4J73 A;  5TEE A;  3OF7 A;  2IWK A;  4YVD A;  3DXK C;  4J8B A;  2CO0 C;  4ZOV A;  2P9P C;  4AN0 A;  5EAR A;  1O6F A;  3UR4 A;  5I5I A;  4E54 A;  1M1X A;  4MMZ A;  4O1Q D;  2H47 A;  4XYI A;  1A12 A;  1P22 A;  1Q47 A;  4UM8 A;  5M5R A;  2OJY A;  5THA A;  3UKR C;  1UOP A;  4GGA A;  3K72 A;  3JZH A;  3IUQ A;  1PEV A;  5AFU 3;  4BUJ C;  5AJA A;  1GOG A;  2XZG A;  3OKY A;  4L3H D;  4ZOZ A;  4FHL A;  4O2W A;  5TEF A;  2HU8 A;  4K3J B;  3MZK A;  4J84 A;  3PVU B;  4NC4 A;  1GOT B;  1H2W A;  3PSL A;  3SHF A;  3JB9 L;  3SMR A;  3UVO A;  2H13 A;  3MKS B;  2YNP A;  3AH8 B;  5I5J A;  4BH6 A;  5IT9 g;  5FXY A;  4JT6 C;  1ERJ A;  3IUL A;  2YB8 B;  4PSW B;  3V4V A;  3AFC A;  4BP9 A;  3JZN A;  5GXI A;  2WQ8 A;  4QAM A;  3RN0 D;  4CI2 A;  3QI0 A;  5HYN B;  1BPO A;  2QZP A;  4G1M A;  3EI4 B;  3I8C A;  5C86 A;  4FA1 D;  5FKR A;  1U4C A;  2P9U C;  3I7K A;  3OW8 A;  4A7J A;  4FA9 D;  1A0R B;  2VC2 A;  3VGZ A;  2P9N C;  5SXM A;  3F3G A;  1GOF A;  4JSP C;  1GG2 B;  1GXR A;  3HFQ A;  3PVW B;  2H9M A;  3EI2 A;  3EU7 A;  3SCY A;  2I0S A;  1JTD B;  3FCU A;  1H2X A;  4PBY A;  5IC7 A;  4K3I D;  4E54 B;  1I2M B;  4QRJ A;  5I5M A;  4G1E A;  5CXB A;  2Z2N A;  1MDA H;  2EIB A;  4BL0 A;  4J77 A;  2VDR A;  4A09 A;  1QFM A;  4Z7N A;  1MG2 A;  3U4Y A;  1JJU B;  3RRM C;  3V5W B;  3OKY B;  4JD2 C;  1NEX B;  4X60 B;  2GNQ A;  4L3G D;  4GQ1 A;  4AMY A;  2J57 G;  4A11 A;  4A2M A;  1VE6 A;  4HDJ A;  3JRO A;  5FFG A;  3PXW D;  4CY5 A;  3KRX B;  1C9I A;  4X61 B;  2I0T A;  3I8E A;  2IUR A;  4G55 A;  4GM3 A;  4O3U B;  4RE5 A;  4L1M A;  3SJL D;  4FWW A;  3IIW A;  3OKW A;  3MMY A;  2P9S C;  1C9L A;  3AL8 A;  4CZY A;  1U8C A;  3JRP A;  2VZ1 A;  4ESG A;  3EI1 A;  3CIK B;  4CI3 A;  4Z7Q A;  2OK4 A;  4A08 A;  1TYE A;  1PI6 A;  1FWX A;  1E5T A;  4PC0 A;  2BBK H;  5M5S A;  3IJE A;  4ES0 A;  3KCI A;  3C75 H;  1K32 A;  5C9Z B;  4ERQ A;  4WK4 A;  3V4P A;  2AQ5 A;  5HDB A;  4J87 A;  4BCB A;  3V9F A;  5B4W A;  4CC9 A;  4IRZ A;  1VE7 A;  2P9I C;  1K3I A;  3UVK A;  5H17 A;  5EAP A;  3EI2 B;  3ZE0 A;  5FKT A;  3PE7 A;  4O45 A;  5C2V B;  3JZG A;  2YNN A;  5CXB B;  2YMU A;  5M5V A;  3K71 A;  2OIZ A;  2AGL A;  4GM8 A;  3I2N A;  5K1C C;  4A09 B;  4KFM B;  4A0A A;  1QFS A;  2XYI A;  3BWS A;  2VDQ A;  2HKM A;  2OVQ B;  4WK2 A;  3V7D B;  4UI9 R;  4NEN A;  4JHN A;  2J55 H;  2W18 A;  3N0D A;  3T3P A;  2HYE A;  3OTT A;  4QT8 A;  4A11 B;  2GC4 A;  1VYH C;  5FA5 B;  5HE1 B;  5TF2 A;  3ZDY A;  4IA9 A;  2TRC B;  2CNX A;  2H6Q A;  2VDL A;  5EML B;  3UVM A;  3KRW B;  2XDW A;  1XIP A;  4PBZ A;  3ULE C;  4A0B A;  1PBY B;  4GGC A;  3AL8 B;  1UOQ A;  3MZL A;  4AX4 A;  2AH0 A;  3O4I A;  3EI1 B;  3EWE A;  4A08 B;  3RFH A;  3IJ0 A;  4BCC A;  2B5N A;  3ZWL B;  4CI1 A;  1YR2 A;  2AGX A;  1PGU A;  3RLM D;  2QR5 A;  2HU7 A;  4LGN A;  2CE9 A;  4JXM A;  3PSC B;  2Z2O A;  1JMZ B;  4Z8L A;  2PM9 A;  2G9A A;  2PM7 B;  4D6V A;  4J79 A;  4CI8 A;  2B5M A;  3EG6 A;  4L1Q D;  3IJ1 A;  3IVM A;  1N6F A;  4DNU A;  4OWR A;  4I79 A;  2AH1 A;  4FA5 D;  3FRX A;  2HU5 A;  4D9S A;  4FB1 D;  1B9X A;  3JPX A;  1S4U X;  4TZ4 A;  5EAL A;  5CXC A;  3NIG A;  4CY3 A;  1XKS A;  4JSN C;  4JHP C;  3C99 A;  5HQG A;  1OMW B;  3N0E A;  4LG8 A;  3K26 A;  3A0F A;  4A0A B;  3NID A;  2QC5 A;  3I89 A;  2BCJ B;  4U1E I;  2EID A;  3C5M A;  5FKS A;  2H6N A;  2IWF A;  2OVP B;  2P9K C;  5IJ8 E;  3VA6 A;  3SFZ A;  2MTA H;  1YFQ A;  3C9C A;  3P4F A;  4QL1 A;  4RE6 A;  4WJK A;  2CN3 A;  4Y7R A;  2GC7 A;  2AGY A;  3SBR A;  4A0B B;  1N6E A;  3IJC A;  5AMS A;  4L9O A;  3QHY B;  1JMX B;  1SQ9 A;  4AEZ A;  4XYH A;  4J0W A;  2HJB A;  4O3T B;  3I7L A;  3ZDX A;  1SQJ A;  1U2V C;  4E5Z A;  1MG3 A;  4J78 A;  3UVN A;  4O02 A;  3FGB A;  4ZN4 A;  3CFV A;  4CY1 A;  3UVL A;  4EWR A;  2VDP A;  3SLE D;  3UKU C;  1L0Q A;  1TYQ C;  2VDM A;  3MKQ A;  1JV2 A;  4J81 A;  1RI6 A;  2PM9 B;  2JKX A;  3EQ9 A;  4OZU A;  2AGW A;  4PXW A;  5EMK B;  3ZE2 A;  3SVW D;  4R7A B;  4XEI C;  2YNO A;  2XU7 A;  3OL2 A;  1E8M A;  5KDO B;  4MMY A;  1GP2 B;  4JSV C;  2YBA A;  3I7P A;  3O4J A;  4AMZ A;  4ERZ A;  5CXC B;  2B5L A;  4PNK B;  4QQE A;  3IUN A;  3K27 A;  4H5I A;  4G56 B;  3FM0 A;  5CYK A;  5FQD A;  3DM0 A;  3BG0 A;  2OK6 A;  2QXV A;  3SXT D;  2G99 A;  4NAA A;  1JOF A;  2UZY B;  2EIE A;  3W15 A;  4CZX A;  3RSE C;  3DSM A;  3SBQ A;  4X63 B;  4J8G A;  3VI3 A;  1O6G A;  4X3E A;  4GMB A;  2I3S A;  2J56 H;  4IMM A;  1UOO A;  4O9D A;  3O4H A;  2CO0 A;  4U7A A;  1T2X A;  1R5M A;  3EI3 A;  5M5U A;  1E8N A;  4AOW A;  1B9Y A;  4ZOY A;  2Q7Q A;  2XL2 A;  4J82 A;  4JSX C;  5E6S A;  2IUP A;  3J81 g;  5FFO A;  3MXX A;  2VDN A;  2CN2 A;  3CFS B;  4BP8 A;  5JWZ A;  3VH0 A;  3MVD K;  2IAA A;  4E5Z B;  4GQB B;  4LG9 A;  2CE8 A;  3L4M D;  2IUV A;  4H5J A;  5HE2 B;  4J0X A;  3DWL C;  5A2Q g;  3NVX A;  3EMH A;  3SBP A;  3FCS A;  2H6K A;  3DDU A;  3I7N A;  4GM9 A;  4UM9 A;  5GXH A;  2O9K A;  3MUO A;  2PBI B;  4J86 A;  3GC3 B;  1H2Z A;  3OL2 B;  1GOH A;  4BCD A;  5E6U A;  2H9L A;  3K6S A;  2HES X;  1NR0 A;  2EIC A;  5IJ7 E;  3AL9 A;  3PXT D;  2VDK A;  5E6R A;  4GGD A; 
#chains in the Genus database with same CATH homology
 3B7F A;  3I7O A;  5IGQ A;  5EMJ B;  4ERY A;  1TBG A;  2H14 A;  3OKT A;  5CYK B;  2H9P A;  5EM2 A;  4GQ2 P;  2EBS A;  4FAV D;  1QNI A;  5GSA A;  3E0C A;  2IUQ A;  4MK0 B;  5IGO A;  2B4E A;  2XL3 A;  3L4O D;  3JAM g;  2I3T A;  3RN1 D;  2H9N A;  3I7H A;  2H3X A;  3EI3 B;  5K19 A;  1K8K C;  5H14 A;  3IKO A;  5FLX g;  1OLZ A;  5GMK n;  3DXM C;  4N14 A;  4D0K A;  5HE0 B;  4FAN D;  3ORV D;  4JT5 C;  4CZV A;  3RFG A;  3F3P A;  1N6D A;  3SWS D;  3J80 g;  2HXC A;  2OVR B;  5EMM B;  3IIY A;  2HJ4 A;  2AGZ A;  5HE3 B;  3RMZ D;  1XHM A;  2PM6 B;  2H68 A;  3GRE A;  5C2W B;  2HKR A;  3PXS D;  5EAM A;  4FA4 D;  4Y5R D;  2I0R A;  4ZOX A;  4A2L A;  3ODT A;  2Z2P A;  5FKQ A;  4GZ8 A;  5TDH B;  2P9L C;  4PSX B;  4CY2 A;  3EI4 A;  3SN6 B;  2UZX B;  5EM2 B;  3GFC A;  3NVQ A;  4NSX A;  1SHY B;  3NVN A;  5H1M A;  3BG1 A;  3F3F A;  4J73 A;  5TEE A;  2IWK A;  4YVD A;  3DXK C;  4J8B A;  2CO0 C;  4ZOV A;  2P9P C;  5EAR A;  3UR4 A;  5I5I A;  4E54 A;  4O1Q D;  4XYI A;  2H47 A;  1P22 A;  1Q47 A;  2OJY A;  5THA A;  3UKR C;  4GGA A;  3JZH A;  1PEV A;  5AFU 3;  4BUJ C;  5AJA A;  3OKY A;  4L3H D;  4ZOZ A;  4FHL A;  5TEF A;  4K3J B;  3MZK A;  4J84 A;  3PVU B;  1GOT B;  3PSL A;  3SHF A;  3JB9 L;  3SMR A;  3UVO A;  2H13 A;  3MKS B;  2YNP A;  3AH8 B;  5I5J A;  4BH6 A;  5IT9 g;  5FXY A;  4JT6 C;  1ERJ A;  2YB8 B;  4PSW B;  3AFC A;  3JZN A;  5GXI A;  3RN0 D;  4CI2 A;  5HYN B;  3EI4 B;  3I8C A;  4FA1 D;  5FKR A;  1U4C A;  2P9U C;  3I7K A;  3OW8 A;  4A7J A;  4FA9 D;  1A0R B;  3VGZ A;  2P9N C;  5SXM A;  3F3G A;  4JSP C;  1GG2 B;  1GXR A;  3HFQ A;  3PVW B;  2H9M A;  3EI2 A;  3EU7 A;  3SCY A;  2I0S A;  4PBY A;  5IC7 A;  4K3I D;  4E54 B;  4QRJ A;  5I5M A;  5CXB A;  2Z2N A;  1MDA H;  4BL0 A;  4J77 A;  4A09 A;  1MG2 A;  3U4Y A;  1JJU B;  3RRM C;  3V5W B;  3OKY B;  4JD2 C;  1NEX B;  4X60 B;  2GNQ A;  4L3G D;  4GQ1 A;  2J57 G;  4A11 A;  4A2M A;  4HDJ A;  3JRO A;  4CY5 A;  3PXW D;  3KRX B;  4X61 B;  2I0T A;  3I8E A;  2IUR A;  4GM3 A;  4O3U B;  3SJL D;  4FWW A;  3IIW A;  3OKW A;  3MMY A;  2P9S C;  3AL8 A;  4CZY A;  3JRP A;  4ESG A;  3EI1 A;  3CIK B;  4CI3 A;  2OK4 A;  4A08 A;  1PI6 A;  1FWX A;  4PC0 A;  2BBK H;  4ES0 A;  3C75 H;  1K32 A;  5C9Z B;  4ERQ A;  2AQ5 A;  4J87 A;  3V9F A;  5B4W A;  4CC9 A;  2P9I C;  3UVK A;  5H17 A;  5EAP A;  3EI2 B;  5FKT A;  3PE7 A;  4O45 A;  5C2V B;  3JZG A;  2YNN A;  5CXB B;  2YMU A;  2OIZ A;  2AGL A;  4GM8 A;  3I2N A;  5K1C C;  4A09 B;  4KFM B;  4A0A A;  2XYI A;  3BWS A;  2HKM A;  2OVQ B;  3V7D B;  4UI9 R;  2J55 H;  2W18 A;  3N0D A;  2HYE A;  3OTT A;  4QT8 A;  4A11 B;  2GC4 A;  1VYH C;  5FA5 B;  5HE1 B;  5TF2 A;  4IA9 A;  2TRC B;  2CNX A;  2H6Q A;  5EML B;  3UVM A;  3KRW B;  1XIP A;  4PBZ A;  3ULE C;  4A0B A;  1PBY B;  4GGC A;  3AL8 B;  3MZL A;  2AH0 A;  3EI1 B;  3EWE A;  4A08 B;  3RFH A;  3IJ0 A;  2B5N A;  3ZWL B;  4CI1 A;  2AGX A;  1PGU A;  3RLM D;  4LGN A;  2CE9 A;  4JXM A;  3PSC B;  2Z2O A;  1JMZ B;  4Z8L A;  2PM9 A;  2G9A A;  2PM7 B;  4D6V A;  4J79 A;  4CI8 A;  2B5M A;  3EG6 A;  4L1Q D;  3IJ1 A;  1N6F A;  4OWR A;  4I79 A;  2AH1 A;  4FA5 D;  3FRX A;  4FB1 D;  1B9X A;  3JPX A;  1S4U X;  4TZ4 A;  5EAL A;  5CXC A;  4CY3 A;  1XKS A;  4JSN C;  3C99 A;  5HQG A;  1OMW B;  3N0E A;  4LG8 A;  3K26 A;  3A0F A;  4A0A B;  2QC5 A;  3I89 A;  2BCJ B;  4U1E I;  3C5M A;  5FKS A;  2H6N A;  2IWF A;  2OVP B;  2P9K C;  5IJ8 E;  3VA6 A;  3SFZ A;  2MTA H;  1YFQ A;  3C9C A;  3P4F A;  4QL1 A;  2CN3 A;  4Y7R A;  2GC7 A;  2AGY A;  3SBR A;  4A0B B;  1N6E A;  3IJC A;  5AMS A;  4L9O A;  1JMX B;  1SQ9 A;  4AEZ A;  4XYH A;  4J0W A;  2HJB A;  4O3T B;  3I7L A;  1SQJ A;  1U2V C;  4E5Z A;  1MG3 A;  4J78 A;  3UVN A;  3FGB A;  4ZN4 A;  3CFV A;  4CY1 A;  3UVL A;  4EWR A;  3SLE D;  3UKU C;  1TYQ C;  1L0Q A;  3MKQ A;  4OZU A;  4J81 A;  1RI6 A;  2PM9 B;  4PXW A;  5EMK B;  2AGW A;  3SVW D;  4R7A B;  4XEI C;  2YNO A;  2XU7 A;  3OL2 A;  5KDO B;  1GP2 B;  4JSV C;  2YBA A;  3I7P A;  4ERZ A;  5CXC B;  2B5L A;  4PNK B;  4QQE A;  3K27 A;  4H5I A;  4G56 B;  3FM0 A;  5CYK A;  5FQD A;  3DM0 A;  3BG0 A;  2OK6 A;  2QXV A;  3SXT D;  2G99 A;  1JOF A;  2UZY B;  3W15 A;  4CZX A;  3RSE C;  3DSM A;  3SBQ A;  4X63 B;  4J8G A;  4X3E A;  4GMB A;  2I3S A;  2J56 H;  4IMM A;  4O9D A;  2CO0 A;  4U7A A;  1R5M A;  3EI3 A;  4AOW A;  1B9Y A;  4ZOY A;  2Q7Q A;  2XL2 A;  4J82 A;  4JSX C;  2IUP A;  3J81 g;  3MXX A;  2CN2 A;  3CFS B;  5JWZ A;  3VH0 A;  2IAA A;  4E5Z B;  4GQB B;  4LG9 A;  2CE8 A;  3L4M D;  2IUV A;  4H5J A;  5HE2 B;  4J0X A;  3DWL C;  5A2Q g;  3NVX A;  3EMH A;  3SBP A;  2H6K A;  3I7N A;  4GM9 A;  5GXH A;  2O9K A;  2PBI B;  4J86 A;  3OL2 B;  2H9L A;  2HES X;  1NR0 A;  5IJ7 E;  3AL9 A;  3PXT D;  4GGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...