4FB1D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 60 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transfer
molecule keywords Methylamine utilization protein MauG
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fb1D00
2J56H 3EI1A 2G9AA 3IIWA 4FA5D 1GG2B 1MG2A 2AGWA 2I3SA 4CI1A 3VA6A 4O1QD 4PSXB 3OKWA 2B5LA 4GM8A 5TDHB 5IJ7E 4U7AA 2H6QA 4GMBA 2IUQA 3U4YA 3PSCB 2I0SA 3C99A 4ERZA 5FKTA 3GREA 3EI4A 4X3EA 5TF2A 2AGYA 5TEFA 4PSWB 3ORVD 1MDAH 2Z2OA 3OL2A 4QRJA 5EMJB 4X61B 3DSMA 5HQGA 2MTAH 1R5MA 4A08B 4A09B 1JMXB 2XYIA 4E54A 5FKQA 4A0BA 3OKYA 4GQ2P 2H13A 3JZGA 1PGUA 3GFCA 2BBKH 3I7NA 2TRCB 4FB1D 2EBSA 2GC4A 3DM0A 5THAA 2QC5A 4L3GD 4JSXC 2B4EA 4ZN4A 3OW8A 1VYHC 3J80g 4E5ZB 2YNOA 4A08A 4A09A 5EARA 2PM9A 2IAAA 5H14A 3AL8A 4A0AA 4A7JA 3MXXA 3ZWLB 3FRXA 3PSLA 1JMZB 2AH0A 3RFGA 4CI8A 3IJ1A 4J79A 1N6EA 3DXKC 3NVXA 5EMMB 4R7AB 3SVWD 2AGLA 4E5ZA 3RLMD 4IMMA 2AGZA 3BG1A 2IWKA 5EM2A 4J77A 3JZNA 4QL1A 3K26A 4PNKB 4J73A 4CY1A 1OLZA 4FA4D 3ODTA 2P9SC 3OL2B 4I79A 3IIYA 4GZ8A 4CY5A 2B5NA 2YNNA 3SBPA 5GMKn 2H14A 3EI3A 1P22A 1GP2B 5EAMA 5FLXg 1K32A 5IJ8E 5CXBA 2Q7QA 5KDOB 3V7DB 3RN0D 4H5JA 4KFMB 3UVLA 5FKSA 2HKMA 3JAMg 3CFSB 5HE2B 3EWEA 3MMYA 2AQ5A 3JB9L 1N6FA 2P9UC 1XHMA 2P9LC 5IGOA 3UKUC 3IJCA 2OIZA 3MKQA 3RFHA 4O9DA 3IJ0A 3PXSD 1U4CA 4GQBB 4MK0B 3I8EA 2I3TA 4A2MA 2H9PA 5K19A 4XYIA 4GGAA 4FA1D 4X63B 3JZHA 5EAPA 4FWWA 5AFU3 3MZKA 4YVDA 3C75H 1K8KC 4K3ID 1N6DA 3I89A 4A11B 3VH0A 4QT8A 2P9PC 2I0RA 3DWLC 4ZOYA 2H9LA 3EI4B 2CE9A 2IWFA 2UZYB 1JOFA 2CN2A 3RSEC 3JPXA 2H9NA 5GXHA 4D6VA 3EMHA 4PBYA 4O3UB 2PM7B 4E54B 3MKSB 2W18A 4J82A 4JSVC 4J0XA 3AL9A 1OMWB 5CXBB 5HE3B 4O45A 3HFQA 4FHLA 4CI3A 5H1MA 3C9CA 4ES0A 4PBZA 2O9KA 3SWSD 2BCJB 3I7KA 2AGXA 4J78A 4HDJA 4GGCA 4FA9D 2OVRB 5AJAA 4A0AB 5I5IA 5H17A 1SHYB 4JD2C 3SXTD 2P9IC 5TEEA 4FAND 2CE8A 4LGNA 4J86A 4TZ4A 1FWXA 4X60B 4A11A 3I8CA 2CNXA 4CZXA 2HKRA 3SLED 5EM2B 5I5MA 2UZXB 4JXMA 4XEIC 3OTTA 3NVNA 2OK4A 4J81A 5HYNB 3SFZA 5C2WB 2HESX 2H6NA 3OKTA 3SMRA 3N0DA 4CY3A 2XU7A 5FXYA 5IGQA 3EI3B 2OVPB 2Z2PA 3SHFA 4LG8A 4PXWA 4Y5RD 2IUVA 2AH1A 5EALA 4ZOVA 4L1QD 4OZUA 5EMLB 4AOWA 3I7HA 2IURA 4J84A 5EMKB 1ERJA 4K3JB 5FKRA 5K1CC 4Z8LA 2J55H 3SBRA 4EWRA 1TYQC 1YFQA 3PXTD 3B7FA 4O3TB 3CFVA 5HE1B 4XYHA 5FA5B 1PBYB 3RRMC 4Y7RA 4ESGA 2XL2A 4GM3A 4UI9R 3MZLA 1SQ9A 2HJBA 3PE7A 1QNIA 4GQ1A 5AMSA 4QQEA 5A2Qg 3C5MA 1TBGA 4NSXA 4CI2A 3AFCA 2XL3A 2H3XA 3I2NA 3V9FA 1RI6A 3L4OD 4ZOXA 2YBAA 1Q47A 5IT9g 3PVWB 5CXCA 3F3PA 1PI6A 3EI1B 3EI2B 1L0QA 2PBIB 4N14A 4CY2A 1JJUB 3SN6B 3NVQA 4A0BB 4CZVA 3PXWD 4J8GA 5I5JA 2OVQB 4IA9A 4U1EI 4L3HD 3N0EA 1MG3A 2YNPA 5FQDA 4LG9A 5GSAA 3FM0A 2PM6B 3SJLD 5CXCB 2H47A 3L4MD 4J0WA 2OJYA 3P4FA 2G99A 5CYKB 4ERQA 2HYEA 1B9YA 2J57G 3EG6A 3JRPA 3RMZD 4ERYA 4OWRA 1GXRA 4JSNC 2IUPA 2HJ4A 2I0TA 3BWSA 3F3FA 1A0RB 3FGBA 4J87A 3I7PA 3I7OA 2HXCA 3F3GA 1B9XA 3UVOA 4FAVD 2GC7A 3A0FA 2B5MA 3RN1D 2H9MA 5SXMA 2YMUA 2QXVA 4J8BA 2P9KC 3BG0A 4JT6C 2CN3A 4BH6A 3EI2A 1GOTB 3ULEC 3J81g 2PM9B 3V5WB 2H68A 3KRXB 3AL8B 5C2VB 2GNQA 3CIKB 5GXIA 3KRWB 3I7LA 4GGDA 4JSPC 1NR0A 4JT5C 1PEVA 4H5IA 4CZYA 1NEXB 4BUJC 1XKSA 5IC7A 2Z2NA 3E0CA 5C9ZB 4PC0A 5CYKA 4GM9A 3AH8B 1XIPA 1S4UX 3IKOA 1U2VC 3JROA 4G56B 5HE0B 3UR4A 3PVUB 4L9OA 1SQJA 3W15A 4AEZA 3SCYA 3VGZA 3UVKA 2OK6A 4ZOZA 3DXMC 4BL0A 2CO0C 5JWZA 4CC9A 2H6KA 3OKYB 4A2LA 3SBQA 3UVMA 2P9NC 3UKRC 3K27A 3UVNA 4D0KA 2CO0A 5B4WA 2YB8B 3EU7A
chains in the Genus database with same CATH superfamily
2J56H 5M5UA 3EI1A 2G9AA 3IIWA 4FA5D 1GG2B 1MG2A 2AGWA 2I3SA 4CI1A 3VA6A 4O1QD 4PSXB 4AMZA 3OKWA 2HU5A 2B5LA 4GM8A 5TDHB 5IJ7E 4QAMA 4U7AA 2H6QA 4GMBA 2IUQA 4Z7NA 3U4YA 1VZ2A 4IRZA 3PSCB 2I0SA 3C99A 5E6RA 1GOHA 3ZE0A 4ERZA 5FKTA 3GREA 5E6SA 3EI4A 1QFMA 3FCSA 4X3EA 5TF2A 2AGYA 5TEFA 4BCDA 4PSWB 1E8NA 3ORVD 1MDAH 2Z2OA 3OL2A 4QRJA 5EMJB 1QFSA 4X61B 3DSMA 4DNVA 5HQGA 2MTAH 1R5MA 4A08B 4A09B 1JMXB 2XYIA 3GC3B 4E54A 5FKQA 4A0BA 3OKYA 4GQ2P 2H13A 3JZGA 1PGUA 1UOQA 3GFCA 2BBKH 3I7NA 2TRCB 2HU8A 4FB1D 2EIBA 2EBSA 1T2XA 2GC4A 3DM0A 5THAA 3EQ7A 2QC5A 3O4HA 4L3GD 4JSXC 2B4EA 4ZN4A 3OW8A 1GOFA 1VYHC 3J80g 4E5ZB 2YNOA 4A08A 4A09A 5EARA 2PM9A 2IAAA 5H14A 3AL8A 4DNWA 4A0AA 4A7JA 3MXXA 3ZWLB 3FRXA 3PSLA 1JMZB 2AH0A 3RFGA 4CI8A 3IJ1A 4J79A 1N6EA 3DXKC 3NVXA 5EMMB 5M5TA 4R7AB 3KCIA 3VI3A 3SVWD 2XDWA 2AGLA 4E5ZA 1C9IA 3RLMD 4IMMA 3OF7A 2AGZA 3BG1A 2IWKA 5EM2A 4J77A 2VDMA 3JZNA 4QL1A 3K26A 4PNKB 4J73A 4CY1A 1OLZA 4FA4D 3ODTA 2P9SC 3OL2B 3MVDK 3IURA 4I79A 3EQ8A 4WK2A 4AN0A 3IIYA 4GZ8A 3V4PA 4CY5A 2B5NA 2YNNA 3SBPA 5GMKn 2H14A 1M1XA 3EI3A 1P22A 3IULA 1GP2B 5EAMA 5FLXg 1K32A 1JV2A 1TYEA 5IJ8E 5CXBA 2Q7QA 5KDOB 3V7DB 3RN0D 4H5JA 4KFMB 3UVLA 5FKSA 3VI4A 2HKMA 2WQ8A 3JAMg 3CFSB 2QZPA 5HE2B 3EWEA 3MMYA 2AQ5A 3JB9L 1N6FA 2P9UC 1XHMA 2P9LC 5IGOA 3UKUC 5HDBA 2EIEA 3IJCA 4AX4A 3IVMA 2OIZA 3MKQA 3ZE1A 3RFHA 4NAAA 4BCCA 4O9DA 3IJ0A 3PXSD 1U4CA 4GQBB 4MK0B 3I8EA 2I3TA 4A2MA 3FCUA 2H9PA 5K19A 4XYIA 1VE6A 4GGAA 4FA1D 4X63B 3JZHA 5EAPA 4FWWA 2VC2A 5AFU3 3MZKA 4YVDA 3C75H 1K8KC 4K3ID 1A12A 1N6DA 3I89A 4A11B 2VDNA 2VDLA 3VH0A 4QT8A 2P9PC 2VZ1A 2I0RA 3DWLC 4ZOYA 1VE7A 2H9LA 4AMYA 3EI4B 1H2XA 2CE9A 2IWFA 2UZYB 1JOFA 4JHNA 2CN2A 3RSEC 1E8MA 3JPXA 2H9NA 5GXHA 4D6VA 3EMHA 4PBYA 4O3UB 4D9SA 2PM7B 4E54B 3MKSB 2W18A 4J82A 4O2WA 3K71A 4JSVC 3O4IA 4J0XA 3AL9A 1OMWB 5CXBB 5HE3B 3QHYB 4O45A 3HFQA 1C9LA 4FHLA 4CI3A 5H1MA 3C9CA 4ES0A 4PBZA 2O9KA 3SWSD 2BCJB 1UOPA 3I7KA 2JKXA 5M5SA 2AGXA 4J78A 4HDJA 4GGCA 4FA9D 2OVRB 5AJAA 4A0AB 5I5IA 5M5RA 5H17A 2VDOA 1SHYB 4JD2C 3MUOA 3SXTD 2P9IC 1YR2A 5TEEA 4FAND 2CE8A 4LGNA 4J86A 4TZ4A 1FWXA 4X60B 4A11A 3K72A 3I8CA 2CNXA 1UTCA 4CZXA 2HKRA 3SLED 5EM2B 5I5MA 2UZXB 4JXMA 4XEIC 3OTTA 3NVNA 2OK4A 4J81A 4WJKA 5HYNB 3SFZA 5C2WB 2HESX 3ZDXA 2H6NA 3OKTA 3SMRA 3N0DA 4CY3A 4BCBA 2XU7A 5FXYA 5IGQA 3EI3B 2OVPB 2Z2PA 3SHFA 4LG8A 4PXWA 4UM8A 4Y5RD 2IUVA 2AH1A 3ZDYA 2EIDA 3IUNA 3NIFA 5EALA 1GOGA 4ZOVA 4L1QD 4OZUA 5EMLB 4AOWA 3I7HA 2IURA 4J84A 4NENA 5EMKB 1ERJA 4K3JB 5FKRA 5K1CC 4Z8LA 2J55H 5FFGA 3SBRA 4EWRA 4O02A 1TYQC 1YFQA 3PXTD 3B7FA 4O3TB 4Z7QA 3EQ9A 3CFVA 4AN1A 5HE1B 4XYHA 5FA5B 1PBYB 3RRMC 1JTDB 2VDPA 4Y7RA 5M5VA 1BPOA 4ESGA 2XL2A 4GM3A 4UI9R 3MZLA 1SQ9A 2HJBA 3PE7A 1QNIA 4GQ1A 5AMSA 4QQEA 5A2Qg 3NIGA 3C5MA 1TBGA 4WK0A 4NSXA 4CI2A 3AFCA 2XL3A 2H3XA 3I2NA 3MUNA 3V9FA 1RI6A 3L4OD 1E5TA 4RE5A 4ZOXA 2YBAA 5M61A 3T3PA 3IUQA 1Q47A 5IT9g 3PVWB 1I2MB 5CXCA 3F3PA 1PI6A 3EI1B 3IUMA 3EI2B 2EICA 4Z7OA 1L0QA 2PBIB 4N14A 3K6SA 3GD1I 4CY2A 1JJUB 3SN6B 3NVQA 4A0BB 4CZVA 3PXWD 4J8GA 5I5JA 2OVQB 4IA9A 2VDRA 4U1EI 1U8CA 5FFOA 2XZGA 4L3HD 3N0EA 4G1MA 1MG3A 2YNPA 5FQDA 4LG9A 3IUJA 5GSAA 3FM0A 4MMYA 2PM6B 3SJLD 4DNUA 2VDKA 5CXCB 4L1MA 2H47A 3IJEA 3L4MD 4J0WA 2OJYA 3P4FA 2G99A 5CYKB 4ERQA 2HYEA 1B9YA 2VDQA 2J57G 4WK4A 3EG6A 3JRPA 3RMZD 4ERYA 4OWRA 1GXRA 4JSNC 1O6FA 2IUPA 4UM9A 1H2ZA 2HJ4A 1UOOA 2I0TA 3ZE2A 2VZ3A 4G1EA 3BWSA 3F3FA 1A0RB 3FGBA 4J87A 3I7PA 4JHPC 3I7OA 2HXCA 2QR5A 3F3GA 1B9XA 3UVOA 4BP9A 4FAVD 2GC7A 3A0FA 2B5MA 3RN1D 4G55A 5C86A 2H9MA 5SXMA 2YMUA 5C92A 2QXVA 4J8BA 2P9KC 3O4GA 3BG0A 3NIDA 4JT6C 2CN3A 4BH6A 3EI2A 1H2YA 1GOTB 3ULEC 3J81g 2PM9B 3V5WB 2H68A 5E6UA 3KRXB 3AL8B 5C2VB 2XE4A 2GNQA 2HU7A 3CIKB 5GXIA 3KRWB 3I7LA 1O6GA 4GGDA 4MMXA 4JSPC 1NR0A 1L5GA 4JT5C 1PEVA 4H5IA 4CZYA 1NEXB 1VZ3A 3ZDZA 4BUJC 3DDUA 1XKSA 5IC7A 3O4JA 2Z2NA 3E0CA 5C9ZB 1K3IA 1H2WA 2BKLA 4PC0A 5CYKA 4GM9A 4MMZA 3AH8B 4BP8A 1XIPA 1S4UX 3IKOA 1U2VC 3JROA 4G56B 5HE0B 3UR4A 3PVUB 4L9OA 1SQJA 3W15A 4AEZA 4NC4A 3SCYA 3VGZA 3UVKA 2OK6A 4ZOZA 3DXMC 4BL0A 3QI0A 2CO0C 3V4VA 5JWZA 4CC9A 4NBMA 4RE6A 2H6KA 3OKYB 4A2LA 3SBQA 3UVMA 2P9NC 3UKRC 3K27A 3UVNA 3T3MA 4D0KA 2CO0A 5B4WA 2YB8B 3EU7A
chains in the Genus database with same CATH topology
2J56H 3EI1A 2G9AA 3IIWA 4FA5D 1GG2B 1MG2A 2AGWA 2I3SA 4CI1A 3VA6A 4O1QD 4PSXB 3OKWA 2B5LA 4GM8A 5TDHB 5IJ7E 4U7AA 2H6QA 4GMBA 2IUQA 3U4YA 3PSCB 2I0SA 3C99A 4ERZA 5FKTA 3GREA 3EI4A 4X3EA 5TF2A 2AGYA 5TEFA 4PSWB 3ORVD 1MDAH 2Z2OA 3OL2A 4QRJA 5EMJB 4X61B 3DSMA 5HQGA 2MTAH 1R5MA 4A08B 4A09B 1JMXB 2XYIA 4E54A 5FKQA 4A0BA 3OKYA 4GQ2P 2H13A 3JZGA 1PGUA 3GFCA 2BBKH 3I7NA 2TRCB 4FB1D 2EBSA 2GC4A 3DM0A 5THAA 2QC5A 4L3GD 4JSXC 2B4EA 4ZN4A 3OW8A 1VYHC 3J80g 4E5ZB 2YNOA 4A08A 4A09A 5EARA 2PM9A 2IAAA 5H14A 3AL8A 4A0AA 4A7JA 3MXXA 3ZWLB 3FRXA 3PSLA 1JMZB 2AH0A 3RFGA 4CI8A 3IJ1A 4J79A 1N6EA 3DXKC 3NVXA 5EMMB 4R7AB 3SVWD 2AGLA 4E5ZA 3RLMD 4IMMA 2AGZA 3BG1A 2IWKA 5EM2A 4J77A 3JZNA 4QL1A 3K26A 4PNKB 4J73A 4CY1A 1OLZA 4FA4D 3ODTA 2P9SC 3OL2B 4I79A 3IIYA 4GZ8A 4CY5A 2B5NA 2YNNA 3SBPA 5GMKn 2H14A 3EI3A 1P22A 1GP2B 5EAMA 5FLXg 1K32A 5IJ8E 5CXBA 2Q7QA 5KDOB 3V7DB 3RN0D 4H5JA 4KFMB 3UVLA 5FKSA 2HKMA 3JAMg 3CFSB 5HE2B 3EWEA 3MMYA 2AQ5A 3JB9L 1N6FA 2P9UC 1XHMA 2P9LC 5IGOA 3UKUC 3IJCA 2OIZA 3MKQA 3RFHA 4O9DA 3IJ0A 3PXSD 1U4CA 4GQBB 4MK0B 3I8EA 2I3TA 4A2MA 2H9PA 5K19A 4XYIA 4GGAA 4FA1D 4X63B 3JZHA 5EAPA 4FWWA 5AFU3 3MZKA 4YVDA 3C75H 1K8KC 4K3ID 1N6DA 3I89A 4A11B 3VH0A 4QT8A 2P9PC 2I0RA 3DWLC 4ZOYA 2H9LA 3EI4B 2CE9A 2IWFA 2UZYB 1JOFA 2CN2A 3RSEC 3JPXA 2H9NA 5GXHA 4D6VA 3EMHA 4PBYA 4O3UB 2PM7B 4E54B 3MKSB 2W18A 4J82A 4JSVC 4J0XA 3AL9A 1OMWB 5CXBB 5HE3B 4O45A 3HFQA 4FHLA 4CI3A 5H1MA 3C9CA 4ES0A 4PBZA 2O9KA 3SWSD 2BCJB 3I7KA 2AGXA 4J78A 4HDJA 4GGCA 4FA9D 2OVRB 5AJAA 4A0AB 5I5IA 5H17A 1SHYB 4JD2C 3SXTD 2P9IC 5TEEA 4FAND 2CE8A 4LGNA 4J86A 4TZ4A 1FWXA 4X60B 4A11A 3I8CA 2CNXA 4CZXA 2HKRA 3SLED 5EM2B 5I5MA 2UZXB 4JXMA 4XEIC 3OTTA 3NVNA 2OK4A 4J81A 5HYNB 3SFZA 5C2WB 2HESX 2H6NA 3OKTA 3SMRA 3N0DA 4CY3A 2XU7A 5FXYA 5IGQA 3EI3B 2OVPB 2Z2PA 3SHFA 4LG8A 4PXWA 4Y5RD 2IUVA 2AH1A 5EALA 4ZOVA 4L1QD 4OZUA 5EMLB 4AOWA 3I7HA 2IURA 4J84A 5EMKB 1ERJA 4K3JB 5FKRA 5K1CC 4Z8LA 2J55H 3SBRA 4EWRA 1TYQC 1YFQA 3PXTD 3B7FA 4O3TB 3CFVA 5HE1B 4XYHA 5FA5B 1PBYB 3RRMC 4Y7RA 4ESGA 2XL2A 4GM3A 4UI9R 3MZLA 1SQ9A 2HJBA 3PE7A 1QNIA 4GQ1A 5AMSA 4QQEA 5A2Qg 3C5MA 1TBGA 4NSXA 4CI2A 3AFCA 2XL3A 2H3XA 3I2NA 3V9FA 1RI6A 3L4OD 4ZOXA 2YBAA 1Q47A 5IT9g 3PVWB 5CXCA 3F3PA 1PI6A 3EI1B 3EI2B 1L0QA 2PBIB 4N14A 4CY2A 1JJUB 3SN6B 3NVQA 4A0BB 4CZVA 3PXWD 4J8GA 5I5JA 2OVQB 4IA9A 4U1EI 4L3HD 3N0EA 1MG3A 2YNPA 5FQDA 4LG9A 5GSAA 3FM0A 2PM6B 3SJLD 5CXCB 2H47A 3L4MD 4J0WA 2OJYA 3P4FA 2G99A 5CYKB 4ERQA 2HYEA 1B9YA 2J57G 3EG6A 3JRPA 3RMZD 4ERYA 4OWRA 1GXRA 4JSNC 2IUPA 2HJ4A 2I0TA 3BWSA 3F3FA 1A0RB 3FGBA 4J87A 3I7PA 3I7OA 2HXCA 3F3GA 1B9XA 3UVOA 4FAVD 2GC7A 3A0FA 2B5MA 3RN1D 2H9MA 5SXMA 2YMUA 2QXVA 4J8BA 2P9KC 3BG0A 4JT6C 2CN3A 4BH6A 3EI2A 1GOTB 3ULEC 3J81g 2PM9B 3V5WB 2H68A 3KRXB 3AL8B 5C2VB 2GNQA 3CIKB 5GXIA 3KRWB 3I7LA 4GGDA 4JSPC 1NR0A 4JT5C 1PEVA 4H5IA 4CZYA 1NEXB 4BUJC 1XKSA 5IC7A 2Z2NA 3E0CA 5C9ZB 4PC0A 5CYKA 4GM9A 3AH8B 1XIPA 1S4UX 3IKOA 1U2VC 3JROA 4G56B 5HE0B 3UR4A 3PVUB 4L9OA 1SQJA 3W15A 4AEZA 3SCYA 3VGZA 3UVKA 2OK6A 4ZOZA 3DXMC 4BL0A 2CO0C 5JWZA 4CC9A 2H6KA 3OKYB 4A2LA 3SBQA 3UVMA 2P9NC 3UKRC 3K27A 3UVNA 4D0KA 2CO0A 5B4WA 2YB8B 3EU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J56 H;  3EI1 A;  2G9A A;  3IIW A;  4FA5 D;  1GG2 B;  1MG2 A;  2AGW A;  2I3S A;  4CI1 A;  3VA6 A;  4O1Q D;  4PSX B;  3OKW A;  2B5L A;  4GM8 A;  5TDH B;  5IJ7 E;  4U7A A;  2H6Q A;  4GMB A;  2IUQ A;  3U4Y A;  3PSC B;  2I0S A;  3C99 A;  4ERZ A;  5FKT A;  3GRE A;  3EI4 A;  4X3E A;  5TF2 A;  2AGY A;  5TEF A;  4PSW B;  3ORV D;  1MDA H;  2Z2O A;  3OL2 A;  4QRJ A;  5EMJ B;  4X61 B;  3DSM A;  5HQG A;  2MTA H;  1R5M A;  4A08 B;  4A09 B;  1JMX B;  2XYI A;  4E54 A;  5FKQ A;  4A0B A;  3OKY A;  4GQ2 P;  2H13 A;  3JZG A;  1PGU A;  3GFC A;  2BBK H;  3I7N A;  2TRC B;  4FB1 D;  2EBS A;  2GC4 A;  3DM0 A;  5THA A;  2QC5 A;  4L3G D;  4JSX C;  2B4E A;  4ZN4 A;  3OW8 A;  1VYH C;  3J80 g;  4E5Z B;  2YNO A;  4A08 A;  4A09 A;  5EAR A;  2PM9 A;  2IAA A;  5H14 A;  3AL8 A;  4A0A A;  4A7J A;  3MXX A;  3ZWL B;  3FRX A;  3PSL A;  1JMZ B;  2AH0 A;  3RFG A;  4CI8 A;  3IJ1 A;  4J79 A;  1N6E A;  3DXK C;  3NVX A;  5EMM B;  4R7A B;  3SVW D;  2AGL A;  4E5Z A;  3RLM D;  4IMM A;  2AGZ A;  3BG1 A;  2IWK A;  5EM2 A;  4J77 A;  3JZN A;  4QL1 A;  3K26 A;  4PNK B;  4J73 A;  4CY1 A;  1OLZ A;  4FA4 D;  3ODT A;  2P9S C;  3OL2 B;  4I79 A;  3IIY A;  4GZ8 A;  4CY5 A;  2B5N A;  2YNN A;  3SBP A;  5GMK n;  2H14 A;  3EI3 A;  1P22 A;  1GP2 B;  5EAM A;  5FLX g;  1K32 A;  5IJ8 E;  5CXB A;  2Q7Q A;  5KDO B;  3V7D B;  3RN0 D;  4H5J A;  4KFM B;  3UVL A;  5FKS A;  2HKM A;  3JAM g;  3CFS B;  5HE2 B;  3EWE A;  3MMY A;  2AQ5 A;  3JB9 L;  1N6F A;  2P9U C;  1XHM A;  2P9L C;  5IGO A;  3UKU C;  3IJC A;  2OIZ A;  3MKQ A;  3RFH A;  4O9D A;  3IJ0 A;  3PXS D;  1U4C A;  4GQB B;  4MK0 B;  3I8E A;  2I3T A;  4A2M A;  2H9P A;  5K19 A;  4XYI A;  4GGA A;  4FA1 D;  4X63 B;  3JZH A;  5EAP A;  4FWW A;  5AFU 3;  3MZK A;  4YVD A;  3C75 H;  1K8K C;  4K3I D;  1N6D A;  3I89 A;  4A11 B;  3VH0 A;  4QT8 A;  2P9P C;  2I0R A;  3DWL C;  4ZOY A;  2H9L A;  3EI4 B;  2CE9 A;  2IWF A;  2UZY B;  1JOF A;  2CN2 A;  3RSE C;  3JPX A;  2H9N A;  5GXH A;  4D6V A;  3EMH A;  4PBY A;  4O3U B;  2PM7 B;  4E54 B;  3MKS B;  2W18 A;  4J82 A;  4JSV C;  4J0X A;  3AL9 A;  1OMW B;  5CXB B;  5HE3 B;  4O45 A;  3HFQ A;  4FHL A;  4CI3 A;  5H1M A;  3C9C A;  4ES0 A;  4PBZ A;  2O9K A;  3SWS D;  2BCJ B;  3I7K A;  2AGX A;  4J78 A;  4HDJ A;  4GGC A;  4FA9 D;  2OVR B;  5AJA A;  4A0A B;  5I5I A;  5H17 A;  1SHY B;  4JD2 C;  3SXT D;  2P9I C;  5TEE A;  4FAN D;  2CE8 A;  4LGN A;  4J86 A;  4TZ4 A;  1FWX A;  4X60 B;  4A11 A;  3I8C A;  2CNX A;  4CZX A;  2HKR A;  3SLE D;  5EM2 B;  5I5M A;  2UZX B;  4JXM A;  4XEI C;  3OTT A;  3NVN A;  2OK4 A;  4J81 A;  5HYN B;  3SFZ A;  5C2W B;  2HES X;  2H6N A;  3OKT A;  3SMR A;  3N0D A;  4CY3 A;  2XU7 A;  5FXY A;  5IGQ A;  3EI3 B;  2OVP B;  2Z2P A;  3SHF A;  4LG8 A;  4PXW A;  4Y5R D;  2IUV A;  2AH1 A;  5EAL A;  4ZOV A;  4L1Q D;  4OZU A;  5EML B;  4AOW A;  3I7H A;  2IUR A;  4J84 A;  5EMK B;  1ERJ A;  4K3J B;  5FKR A;  5K1C C;  4Z8L A;  2J55 H;  3SBR A;  4EWR A;  1TYQ C;  1YFQ A;  3PXT D;  3B7F A;  4O3T B;  3CFV A;  5HE1 B;  4XYH A;  5FA5 B;  1PBY B;  3RRM C;  4Y7R A;  4ESG A;  2XL2 A;  4GM3 A;  4UI9 R;  3MZL A;  1SQ9 A;  2HJB A;  3PE7 A;  1QNI A;  4GQ1 A;  5AMS A;  4QQE A;  5A2Q g;  3C5M A;  1TBG A;  4NSX A;  4CI2 A;  3AFC A;  2XL3 A;  2H3X A;  3I2N A;  3V9F A;  1RI6 A;  3L4O D;  4ZOX A;  2YBA A;  1Q47 A;  5IT9 g;  3PVW B;  5CXC A;  3F3P A;  1PI6 A;  3EI1 B;  3EI2 B;  1L0Q A;  2PBI B;  4N14 A;  4CY2 A;  1JJU B;  3SN6 B;  3NVQ A;  4A0B B;  4CZV A;  3PXW D;  4J8G A;  5I5J A;  2OVQ B;  4IA9 A;  4U1E I;  4L3H D;  3N0E A;  1MG3 A;  2YNP A;  5FQD A;  4LG9 A;  5GSA A;  3FM0 A;  2PM6 B;  3SJL D;  5CXC B;  2H47 A;  3L4M D;  4J0W A;  2OJY A;  3P4F A;  2G99 A;  5CYK B;  4ERQ A;  2HYE A;  1B9Y A;  2J57 G;  3EG6 A;  3JRP A;  3RMZ D;  4ERY A;  4OWR A;  1GXR A;  4JSN C;  2IUP A;  2HJ4 A;  2I0T A;  3BWS A;  3F3F A;  1A0R B;  3FGB A;  4J87 A;  3I7P A;  3I7O A;  2HXC A;  3F3G A;  1B9X A;  3UVO A;  4FAV D;  2GC7 A;  3A0F A;  2B5M A;  3RN1 D;  2H9M A;  5SXM A;  2YMU A;  2QXV A;  4J8B A;  2P9K C;  3BG0 A;  4JT6 C;  2CN3 A;  4BH6 A;  3EI2 A;  1GOT B;  3ULE C;  3J81 g;  2PM9 B;  3V5W B;  2H68 A;  3KRX B;  3AL8 B;  5C2V B;  2GNQ A;  3CIK B;  5GXI A;  3KRW B;  3I7L A;  4GGD A;  4JSP C;  1NR0 A;  4JT5 C;  1PEV A;  4H5I A;  4CZY A;  1NEX B;  4BUJ C;  1XKS A;  5IC7 A;  2Z2N A;  3E0C A;  5C9Z B;  4PC0 A;  5CYK A;  4GM9 A;  3AH8 B;  1XIP A;  1S4U X;  3IKO A;  1U2V C;  3JRO A;  4G56 B;  5HE0 B;  3UR4 A;  3PVU B;  4L9O A;  1SQJ A;  3W15 A;  4AEZ A;  3SCY A;  3VGZ A;  3UVK A;  2OK6 A;  4ZOZ A;  3DXM C;  4BL0 A;  2CO0 C;  5JWZ A;  4CC9 A;  2H6K A;  3OKY B;  4A2L A;  3SBQ A;  3UVM A;  2P9N C;  3UKR C;  3K27 A;  3UVN A;  4D0K A;  2CO0 A;  5B4W A;  2YB8 B;  3EU7 A; 
#chains in the Genus database with same CATH topology
 2J56 H;  5M5U A;  3EI1 A;  2G9A A;  3IIW A;  4FA5 D;  1GG2 B;  1MG2 A;  2AGW A;  2I3S A;  4CI1 A;  3VA6 A;  4O1Q D;  4PSX B;  4AMZ A;  3OKW A;  2HU5 A;  2B5L A;  4GM8 A;  5TDH B;  5IJ7 E;  4QAM A;  4U7A A;  2H6Q A;  4GMB A;  2IUQ A;  4Z7N A;  3U4Y A;  1VZ2 A;  4IRZ A;  3PSC B;  2I0S A;  3C99 A;  5E6R A;  1GOH A;  3ZE0 A;  4ERZ A;  5FKT A;  3GRE A;  5E6S A;  3EI4 A;  1QFM A;  3FCS A;  4X3E A;  5TF2 A;  2AGY A;  5TEF A;  4BCD A;  4PSW B;  1E8N A;  3ORV D;  1MDA H;  2Z2O A;  3OL2 A;  4QRJ A;  5EMJ B;  1QFS A;  4X61 B;  3DSM A;  4DNV A;  5HQG A;  2MTA H;  1R5M A;  4A08 B;  4A09 B;  1JMX B;  2XYI A;  3GC3 B;  4E54 A;  5FKQ A;  4A0B A;  3OKY A;  4GQ2 P;  2H13 A;  3JZG A;  1PGU A;  1UOQ A;  3GFC A;  2BBK H;  3I7N A;  2TRC B;  2HU8 A;  4FB1 D;  2EIB A;  2EBS A;  1T2X A;  2GC4 A;  3DM0 A;  5THA A;  3EQ7 A;  2QC5 A;  3O4H A;  4L3G D;  4JSX C;  2B4E A;  4ZN4 A;  3OW8 A;  1GOF A;  1VYH C;  3J80 g;  4E5Z B;  2YNO A;  4A08 A;  4A09 A;  5EAR A;  2PM9 A;  2IAA A;  5H14 A;  3AL8 A;  4DNW A;  4A0A A;  4A7J A;  3MXX A;  3ZWL B;  3FRX A;  3PSL A;  1JMZ B;  2AH0 A;  3RFG A;  4CI8 A;  3IJ1 A;  4J79 A;  1N6E A;  3DXK C;  3NVX A;  5EMM B;  5M5T A;  4R7A B;  3KCI A;  3VI3 A;  3SVW D;  2XDW A;  2AGL A;  4E5Z A;  1C9I A;  3RLM D;  4IMM A;  3OF7 A;  2AGZ A;  3BG1 A;  2IWK A;  5EM2 A;  4J77 A;  2VDM A;  3JZN A;  4QL1 A;  3K26 A;  4PNK B;  4J73 A;  4CY1 A;  1OLZ A;  4FA4 D;  3ODT A;  2P9S C;  3OL2 B;  3MVD K;  3IUR A;  4I79 A;  3EQ8 A;  4WK2 A;  4AN0 A;  3IIY A;  4GZ8 A;  3V4P A;  4CY5 A;  2B5N A;  2YNN A;  3SBP A;  5GMK n;  2H14 A;  1M1X A;  3EI3 A;  1P22 A;  3IUL A;  1GP2 B;  5EAM A;  5FLX g;  1K32 A;  1JV2 A;  1TYE A;  5IJ8 E;  5CXB A;  2Q7Q A;  5KDO B;  3V7D B;  3RN0 D;  4H5J A;  4KFM B;  3UVL A;  5FKS A;  3VI4 A;  2HKM A;  2WQ8 A;  3JAM g;  3CFS B;  2QZP A;  5HE2 B;  3EWE A;  3MMY A;  2AQ5 A;  3JB9 L;  1N6F A;  2P9U C;  1XHM A;  2P9L C;  5IGO A;  3UKU C;  5HDB A;  2EIE A;  3IJC A;  4AX4 A;  3IVM A;  2OIZ A;  3MKQ A;  3ZE1 A;  3RFH A;  4NAA A;  4BCC A;  4O9D A;  3IJ0 A;  3PXS D;  1U4C A;  4GQB B;  4MK0 B;  3I8E A;  2I3T A;  4A2M A;  3FCU A;  2H9P A;  5K19 A;  4XYI A;  1VE6 A;  4GGA A;  4FA1 D;  4X63 B;  3JZH A;  5EAP A;  4FWW A;  2VC2 A;  5AFU 3;  3MZK A;  4YVD A;  3C75 H;  1K8K C;  4K3I D;  1A12 A;  1N6D A;  3I89 A;  4A11 B;  2VDN A;  2VDL A;  3VH0 A;  4QT8 A;  2P9P C;  2VZ1 A;  2I0R A;  3DWL C;  4ZOY A;  1VE7 A;  2H9L A;  4AMY A;  3EI4 B;  1H2X A;  2CE9 A;  2IWF A;  2UZY B;  1JOF A;  4JHN A;  2CN2 A;  3RSE C;  1E8M A;  3JPX A;  2H9N A;  5GXH A;  4D6V A;  3EMH A;  4PBY A;  4O3U B;  4D9S A;  2PM7 B;  4E54 B;  3MKS B;  2W18 A;  4J82 A;  4O2W A;  3K71 A;  4JSV C;  3O4I A;  4J0X A;  3AL9 A;  1OMW B;  5CXB B;  5HE3 B;  3QHY B;  4O45 A;  3HFQ A;  1C9L A;  4FHL A;  4CI3 A;  5H1M A;  3C9C A;  4ES0 A;  4PBZ A;  2O9K A;  3SWS D;  2BCJ B;  1UOP A;  3I7K A;  2JKX A;  5M5S A;  2AGX A;  4J78 A;  4HDJ A;  4GGC A;  4FA9 D;  2OVR B;  5AJA A;  4A0A B;  5I5I A;  5M5R A;  5H17 A;  2VDO A;  1SHY B;  4JD2 C;  3MUO A;  3SXT D;  2P9I C;  1YR2 A;  5TEE A;  4FAN D;  2CE8 A;  4LGN A;  4J86 A;  4TZ4 A;  1FWX A;  4X60 B;  4A11 A;  3K72 A;  3I8C A;  2CNX A;  1UTC A;  4CZX A;  2HKR A;  3SLE D;  5EM2 B;  5I5M A;  2UZX B;  4JXM A;  4XEI C;  3OTT A;  3NVN A;  2OK4 A;  4J81 A;  4WJK A;  5HYN B;  3SFZ A;  5C2W B;  2HES X;  3ZDX A;  2H6N A;  3OKT A;  3SMR A;  3N0D A;  4CY3 A;  4BCB A;  2XU7 A;  5FXY A;  5IGQ A;  3EI3 B;  2OVP B;  2Z2P A;  3SHF A;  4LG8 A;  4PXW A;  4UM8 A;  4Y5R D;  2IUV A;  2AH1 A;  3ZDY A;  2EID A;  3IUN A;  3NIF A;  5EAL A;  1GOG A;  4ZOV A;  4L1Q D;  4OZU A;  5EML B;  4AOW A;  3I7H A;  2IUR A;  4J84 A;  4NEN A;  5EMK B;  1ERJ A;  4K3J B;  5FKR A;  5K1C C;  4Z8L A;  2J55 H;  5FFG A;  3SBR A;  4EWR A;  4O02 A;  1TYQ C;  1YFQ A;  3PXT D;  3B7F A;  4O3T B;  4Z7Q A;  3EQ9 A;  3CFV A;  4AN1 A;  5HE1 B;  4XYH A;  5FA5 B;  1PBY B;  3RRM C;  1JTD B;  2VDP A;  4Y7R A;  5M5V A;  1BPO A;  4ESG A;  2XL2 A;  4GM3 A;  4UI9 R;  3MZL A;  1SQ9 A;  2HJB A;  3PE7 A;  1QNI A;  4GQ1 A;  5AMS A;  4QQE A;  5A2Q g;  3NIG A;  3C5M A;  1TBG A;  4WK0 A;  4NSX A;  4CI2 A;  3AFC A;  2XL3 A;  2H3X A;  3I2N A;  3MUN A;  3V9F A;  1RI6 A;  3L4O D;  1E5T A;  4RE5 A;  4ZOX A;  2YBA A;  5M61 A;  3T3P A;  3IUQ A;  1Q47 A;  5IT9 g;  3PVW B;  1I2M B;  5CXC A;  3F3P A;  1PI6 A;  3EI1 B;  3IUM A;  3EI2 B;  2EIC A;  4Z7O A;  1L0Q A;  2PBI B;  4N14 A;  3K6S A;  3GD1 I;  4CY2 A;  1JJU B;  3SN6 B;  3NVQ A;  4A0B B;  4CZV A;  3PXW D;  4J8G A;  5I5J A;  2OVQ B;  4IA9 A;  2VDR A;  4U1E I;  1U8C A;  5FFO A;  2XZG A;  4L3H D;  3N0E A;  4G1M A;  1MG3 A;  2YNP A;  5FQD A;  4LG9 A;  3IUJ A;  5GSA A;  3FM0 A;  4MMY A;  2PM6 B;  3SJL D;  4DNU A;  2VDK A;  5CXC B;  4L1M A;  2H47 A;  3IJE A;  3L4M D;  4J0W A;  2OJY A;  3P4F A;  2G99 A;  5CYK B;  4ERQ A;  2HYE A;  1B9Y A;  2VDQ A;  2J57 G;  4WK4 A;  3EG6 A;  3JRP A;  3RMZ D;  4ERY A;  4OWR A;  1GXR A;  4JSN C;  1O6F A;  2IUP A;  4UM9 A;  1H2Z A;  2HJ4 A;  1UOO A;  2I0T A;  3ZE2 A;  2VZ3 A;  4G1E A;  3BWS A;  3F3F A;  1A0R B;  3FGB A;  4J87 A;  3I7P A;  4JHP C;  3I7O A;  2HXC A;  2QR5 A;  3F3G A;  1B9X A;  3UVO A;  4BP9 A;  4FAV D;  2GC7 A;  3A0F A;  2B5M A;  3RN1 D;  4G55 A;  5C86 A;  2H9M A;  5SXM A;  2YMU A;  5C92 A;  2QXV A;  4J8B A;  2P9K C;  3O4G A;  3BG0 A;  3NID A;  4JT6 C;  2CN3 A;  4BH6 A;  3EI2 A;  1H2Y A;  1GOT B;  3ULE C;  3J81 g;  2PM9 B;  3V5W B;  2H68 A;  5E6U A;  3KRX B;  3AL8 B;  5C2V B;  2XE4 A;  2GNQ A;  2HU7 A;  3CIK B;  5GXI A;  3KRW B;  3I7L A;  1O6G A;  4GGD A;  4MMX A;  4JSP C;  1NR0 A;  1L5G A;  4JT5 C;  1PEV A;  4H5I A;  4CZY A;  1NEX B;  1VZ3 A;  3ZDZ A;  4BUJ C;  3DDU A;  1XKS A;  5IC7 A;  3O4J A;  2Z2N A;  3E0C A;  5C9Z B;  1K3I A;  1H2W A;  2BKL A;  4PC0 A;  5CYK A;  4GM9 A;  4MMZ A;  3AH8 B;  4BP8 A;  1XIP A;  1S4U X;  3IKO A;  1U2V C;  3JRO A;  4G56 B;  5HE0 B;  3UR4 A;  3PVU B;  4L9O A;  1SQJ A;  3W15 A;  4AEZ A;  4NC4 A;  3SCY A;  3VGZ A;  3UVK A;  2OK6 A;  4ZOZ A;  3DXM C;  4BL0 A;  3QI0 A;  2CO0 C;  3V4V A;  5JWZ A;  4CC9 A;  4NBM A;  4RE6 A;  2H6K A;  3OKY B;  4A2L A;  3SBQ A;  3UVM A;  2P9N C;  3UKR C;  3K27 A;  3UVN A;  3T3M A;  4D0K A;  2CO0 A;  5B4W A;  2YB8 B;  3EU7 A; 
#chains in the Genus database with same CATH homology
 2J56 H;  3EI1 A;  2G9A A;  3IIW A;  4FA5 D;  1GG2 B;  1MG2 A;  2AGW A;  2I3S A;  4CI1 A;  3VA6 A;  4O1Q D;  4PSX B;  3OKW A;  2B5L A;  4GM8 A;  5TDH B;  5IJ7 E;  4U7A A;  2H6Q A;  4GMB A;  2IUQ A;  3U4Y A;  3PSC B;  2I0S A;  3C99 A;  4ERZ A;  5FKT A;  3GRE A;  3EI4 A;  4X3E A;  5TF2 A;  2AGY A;  5TEF A;  4PSW B;  3ORV D;  1MDA H;  2Z2O A;  3OL2 A;  4QRJ A;  5EMJ B;  4X61 B;  3DSM A;  5HQG A;  2MTA H;  1R5M A;  4A08 B;  4A09 B;  1JMX B;  2XYI A;  4E54 A;  5FKQ A;  4A0B A;  3OKY A;  4GQ2 P;  2H13 A;  3JZG A;  1PGU A;  3GFC A;  2BBK H;  3I7N A;  2TRC B;  4FB1 D;  2EBS A;  2GC4 A;  3DM0 A;  5THA A;  2QC5 A;  4L3G D;  4JSX C;  2B4E A;  4ZN4 A;  3OW8 A;  1VYH C;  3J80 g;  4E5Z B;  2YNO A;  4A08 A;  4A09 A;  5EAR A;  2PM9 A;  2IAA A;  5H14 A;  3AL8 A;  4A0A A;  4A7J A;  3MXX A;  3ZWL B;  3FRX A;  3PSL A;  1JMZ B;  2AH0 A;  3RFG A;  4CI8 A;  3IJ1 A;  4J79 A;  1N6E A;  3DXK C;  3NVX A;  5EMM B;  4R7A B;  3SVW D;  2AGL A;  4E5Z A;  3RLM D;  4IMM A;  2AGZ A;  3BG1 A;  2IWK A;  5EM2 A;  4J77 A;  3JZN A;  4QL1 A;  3K26 A;  4PNK B;  4J73 A;  4CY1 A;  1OLZ A;  4FA4 D;  3ODT A;  2P9S C;  3OL2 B;  4I79 A;  3IIY A;  4GZ8 A;  4CY5 A;  2B5N A;  2YNN A;  3SBP A;  5GMK n;  2H14 A;  3EI3 A;  1P22 A;  1GP2 B;  5EAM A;  5FLX g;  1K32 A;  5IJ8 E;  5CXB A;  2Q7Q A;  5KDO B;  3V7D B;  3RN0 D;  4H5J A;  4KFM B;  3UVL A;  5FKS A;  2HKM A;  3JAM g;  3CFS B;  5HE2 B;  3EWE A;  3MMY A;  2AQ5 A;  3JB9 L;  1N6F A;  2P9U C;  1XHM A;  2P9L C;  5IGO A;  3UKU C;  3IJC A;  2OIZ A;  3MKQ A;  3RFH A;  4O9D A;  3IJ0 A;  3PXS D;  1U4C A;  4GQB B;  4MK0 B;  3I8E A;  2I3T A;  4A2M A;  2H9P A;  5K19 A;  4XYI A;  4GGA A;  4FA1 D;  4X63 B;  3JZH A;  5EAP A;  4FWW A;  5AFU 3;  3MZK A;  4YVD A;  3C75 H;  1K8K C;  4K3I D;  1N6D A;  3I89 A;  4A11 B;  3VH0 A;  4QT8 A;  2P9P C;  2I0R A;  3DWL C;  4ZOY A;  2H9L A;  3EI4 B;  2CE9 A;  2IWF A;  2UZY B;  1JOF A;  2CN2 A;  3RSE C;  3JPX A;  2H9N A;  5GXH A;  4D6V A;  3EMH A;  4PBY A;  4O3U B;  2PM7 B;  4E54 B;  3MKS B;  2W18 A;  4J82 A;  4JSV C;  4J0X A;  3AL9 A;  1OMW B;  5CXB B;  5HE3 B;  4O45 A;  3HFQ A;  4FHL A;  4CI3 A;  5H1M A;  3C9C A;  4ES0 A;  4PBZ A;  2O9K A;  3SWS D;  2BCJ B;  3I7K A;  2AGX A;  4J78 A;  4HDJ A;  4GGC A;  4FA9 D;  2OVR B;  5AJA A;  4A0A B;  5I5I A;  5H17 A;  1SHY B;  4JD2 C;  3SXT D;  2P9I C;  5TEE A;  4FAN D;  2CE8 A;  4LGN A;  4J86 A;  4TZ4 A;  1FWX A;  4X60 B;  4A11 A;  3I8C A;  2CNX A;  4CZX A;  2HKR A;  3SLE D;  5EM2 B;  5I5M A;  2UZX B;  4JXM A;  4XEI C;  3OTT A;  3NVN A;  2OK4 A;  4J81 A;  5HYN B;  3SFZ A;  5C2W B;  2HES X;  2H6N A;  3OKT A;  3SMR A;  3N0D A;  4CY3 A;  2XU7 A;  5FXY A;  5IGQ A;  3EI3 B;  2OVP B;  2Z2P A;  3SHF A;  4LG8 A;  4PXW A;  4Y5R D;  2IUV A;  2AH1 A;  5EAL A;  4ZOV A;  4L1Q D;  4OZU A;  5EML B;  4AOW A;  3I7H A;  2IUR A;  4J84 A;  5EMK B;  1ERJ A;  4K3J B;  5FKR A;  5K1C C;  4Z8L A;  2J55 H;  3SBR A;  4EWR A;  1TYQ C;  1YFQ A;  3PXT D;  3B7F A;  4O3T B;  3CFV A;  5HE1 B;  4XYH A;  5FA5 B;  1PBY B;  3RRM C;  4Y7R A;  4ESG A;  2XL2 A;  4GM3 A;  4UI9 R;  3MZL A;  1SQ9 A;  2HJB A;  3PE7 A;  1QNI A;  4GQ1 A;  5AMS A;  4QQE A;  5A2Q g;  3C5M A;  1TBG A;  4NSX A;  4CI2 A;  3AFC A;  2XL3 A;  2H3X A;  3I2N A;  3V9F A;  1RI6 A;  3L4O D;  4ZOX A;  2YBA A;  1Q47 A;  5IT9 g;  3PVW B;  5CXC A;  3F3P A;  1PI6 A;  3EI1 B;  3EI2 B;  1L0Q A;  2PBI B;  4N14 A;  4CY2 A;  1JJU B;  3SN6 B;  3NVQ A;  4A0B B;  4CZV A;  3PXW D;  4J8G A;  5I5J A;  2OVQ B;  4IA9 A;  4U1E I;  4L3H D;  3N0E A;  1MG3 A;  2YNP A;  5FQD A;  4LG9 A;  5GSA A;  3FM0 A;  2PM6 B;  3SJL D;  5CXC B;  2H47 A;  3L4M D;  4J0W A;  2OJY A;  3P4F A;  2G99 A;  5CYK B;  4ERQ A;  2HYE A;  1B9Y A;  2J57 G;  3EG6 A;  3JRP A;  3RMZ D;  4ERY A;  4OWR A;  1GXR A;  4JSN C;  2IUP A;  2HJ4 A;  2I0T A;  3BWS A;  3F3F A;  1A0R B;  3FGB A;  4J87 A;  3I7P A;  3I7O A;  2HXC A;  3F3G A;  1B9X A;  3UVO A;  4FAV D;  2GC7 A;  3A0F A;  2B5M A;  3RN1 D;  2H9M A;  5SXM A;  2YMU A;  2QXV A;  4J8B A;  2P9K C;  3BG0 A;  4JT6 C;  2CN3 A;  4BH6 A;  3EI2 A;  1GOT B;  3ULE C;  3J81 g;  2PM9 B;  3V5W B;  2H68 A;  3KRX B;  3AL8 B;  5C2V B;  2GNQ A;  3CIK B;  5GXI A;  3KRW B;  3I7L A;  4GGD A;  4JSP C;  1NR0 A;  4JT5 C;  1PEV A;  4H5I A;  4CZY A;  1NEX B;  4BUJ C;  1XKS A;  5IC7 A;  2Z2N A;  3E0C A;  5C9Z B;  4PC0 A;  5CYK A;  4GM9 A;  3AH8 B;  1XIP A;  1S4U X;  3IKO A;  1U2V C;  3JRO A;  4G56 B;  5HE0 B;  3UR4 A;  3PVU B;  4L9O A;  1SQJ A;  3W15 A;  4AEZ A;  3SCY A;  3VGZ A;  3UVK A;  2OK6 A;  4ZOZ A;  3DXM C;  4BL0 A;  2CO0 C;  5JWZ A;  4CC9 A;  2H6K A;  3OKY B;  4A2L A;  3SBQ A;  3UVM A;  2P9N C;  3UKR C;  3K27 A;  3UVN A;  4D0K A;  2CO0 A;  5B4W A;  2YB8 B;  3EU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...