4FB1D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 60 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transfer
molecule keywords Methylamine utilization protein MauG
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fb1D00
2YBAA 2Z2PA 4GGAA 4FAND 4J79A 2B5MA 5A2Qg 3OTTA 3SHFA 3SMRA 5FXYA 5AFU3 2AGYA 5HQGA 4CZVA 4ZOYA 2H6NA 4A0AB 3VH0A 2IUQA 3OKYA 3V5WB 3SBQA 2UZYB 2YMUA 1MDAH 4JSPC 3FGBA 3AL9A 3EU7A 3SJLD 4EWRA 2OVQB 5FKSA 3MKSB 4X3EA 4A09B 3OL2B 5EM2B 5IJ8E 2H13A 3L4OD 5EMJB 4Y7RA 4L9OA 4PXWA 3EI4B 4J82A 2I0TA 2P9NC 3NVXA 4JT5C 4E5ZA 5HE0B 2CO0C 2HKRA 3SCYA 2PM7B 4J84A 3NVNA 4QRJA 5GMKn 3W15A 3EI1B 2P9LC 2CO0A 3MKQA 4A11B 2J55H 3EMHA 2QXVA 2W18A 5FKRA 4U1EI 3RFHA 4GQ1A 4K3JB 2OIZA 3CFSB 4ZOZA 3ODTA 3SFZA 2EBSA 4N14A 2J57G 5EMKB 4JXMA 4LGNA 4PNKB 3N0EA 3RN0D 4X60B 2AQ5A 4KFMB 4J86A 4BH6A 3HFQA 5SXMA 3ZWLB 3DXKC 1N6FA 1XIPA 3FM0A 5CXBB 4I79A 2GC7A 3BG0A 5FKTA 3N0DA 3EI3B 2OVPB 4GGCA 3OW8A 5EAPA 5GSAA 1P22A 2CE9A 4GZ8A 3EI1A 1OLZA 4J8GA 1PGUA 3K27A 3OL2A 2AH1A 4A2LA 5TEFA 2P9SC 3I2NA 3SBRA 1A0RB 2QC5A 5EAMA 3OKYB 3I8CA 1B9XA 4FHLA 2Z2NA 2GNQA 1B9YA 2H6KA 4FAVD 5IT9g 1JJUB 5C2VB 2HJ4A 3IKOA 4A11A 1XKSA 2HXCA 3C99A 1PBYB 3I7PA 2CNXA 5H17A 3MXXA 3GFCA 4A0BB 3NVQA 3SWSD 1N6EA 3DWLC 1JMZB 2H9NA 5HE1B 4CY1A 4J87A 2PM6B 3V7DB 3RRMC 4YVDA 2IURA 3CIKB 3FRXA 2BBKH 2O9KA 2XL2A 4X63B 2PM9B 4J0WA 3PXWD 1PEVA 3DM0A 2TRCB 1QNIA 3EI2A 3DSMA 1OMWB 3KRXB 1K8KC 4D6VA 3J81g 4A0BA 5B4WA 1JOFA 4CC9A 4PBZA 4NSXA 3UVOA 3JZNA 3I7KA 5CYKB 2AGLA 5IC7A 3SN6B 5HE2B 3EWEA 2MTAH 3OKWA 4PBYA 4E54B 3PVUB 4IMMA 5TDHB 1PI6A 3PVWB 4PC0A 2IAAA 5HYNB 4G56B 5K1CC 2P9IC 1NEXB 3JZHA 4UI9R 4O3TB 2B5LA 4L1QD 4J77A 4IA9A 4E5ZB 3PXTD 3P4FA 3SLED 2G9AA 4OZUA 3I7LA 2YNNA 5H1MA 4XYHA 3PXSD 4A09A 1L0QA 3IIYA 4XEIC 3ULEC 3DXMC 2H14A 2BCJB 2CN2A 3F3FA 3BWSA 1TBGA 5EARA 4PSWB 5JWZA 2HYEA 2IUVA 4U7AA 4FWWA 2B5NA 2PBIB 2YB8B 3RSEC 5GXIA 3PSCB 5AJAA 1FWXA 2Q7QA 1U4CA 2H47A 1S4UX 3RMZD 4GQBB 5KDOB 5CXCB 2YNOA 2G99A 2P9UC 5EM2A 5HE3B 3VGZA 2IUPA 2IWFA 1Q47A 3EI4A 5GXHA 3EI3A 4CY2A 3KRWB 3OKTA 4AEZA 3UR4A 3IJ1A 5I5JA 3C75H 1GG2B 4ZOVA 3UVNA 3AL8A 4Y5RD 1RI6A 4CZXA 4LG9A 1YFQA 3IJ0A 2I0SA 4ERQA 4JT6C 4ZN4A 1SQJA 5TEEA 1N6DA 1VYHC 4CI3A 5FKQA 3EG6A 4J73A 2H9PA 4ES0A 5CXCA 3UVLA 4K3ID 1MG2A 2AH0A 3RN1D 3U4YA 2UZXB 3AFCA 2AGWA 4D0KA 2XU7A 3IIWA 4J81A 3C9CA 3JAMg 2CE8A 3I7NA 4JSVC 5CXBA 3IJCA 3MZLA 5THAA 5FQDA 4QQEA 2I3TA 3UKRC 4L3GD 4X61B 4HDJA 4FA1D 3B7FA 4CY3A 3GREA 3UVMA 3C5MA 1GXRA 3UVKA 4PSXB 2PM9A 3CFVA 1GP2B 2AGZA 4BUJC 2H9MA 5IGOA 3SXTD 4CI8A 4A2MA 2H3XA 1U2VC 4J78A 3F3GA 2OK4A 5AMSA 2CN3A 5CYKA 2OJYA 4XYIA 4FB1D 1JMXB 3I8EA 4MK0B 4BL0A 5TF2A 4Z8LA 3ORVD 4ESGA 4ZOXA 2OVRB 3EI2B 3VA6A 4R7AB 3J80g 1GOTB 5IGQA 1SHYB 3V9FA 4GQ2P 3I7HA 4O3UB 5C2WB 3E0CA 4E54A 2P9PC 2I3SA 4GGDA 4J8BA 4H5JA 4LG8A 5FA5B 2P9KC 4GM9A 4OWRA 5H14A 3UKUC 4L3HD 2J56H 1K32A 5I5MA 2YNPA 3F3PA 4A08A 1MG3A 3BG1A 4O45A 4TZ4A 4O1QD 2H6QA 3JPXA 4QT8A 1ERJA 4CI2A 2XYIA 1XHMA 4QL1A 4O9DA 4H5IA 3K26A 3L4MD 3JRPA 5EALA 1TYQC 3I89A 1NR0A 3AH8B 4GMBA 4J0XA 4A0AA 3PE7A 4JSXC 5K19A 2XL3A 4CY5A 5IJ7E 4FA5D 3RFGA 3I7OA 4AOWA 3JROA 4FA4D 2I0RA 4JSNC 4CI1A 5C9ZB 3JZGA 1R5MA 3SVWD 3AL8B 4ERZA 2H9LA 3PSLA 4A7JA 4FA9D 3MMYA 4A08B 5I5IA 3A0FA 3SBPA 5EMLB 4GM8A 2B4EA 2H68A 3RLMD 2HESX 2Z2OA 2GC4A 4JD2C 4CZYA 2OK6A 2IWKA 1SQ9A 3JB9L 3MZKA 5EMMB 4ERYA 4GM3A 2HJBA 5FLXg 2AGXA 2HKMA
chains in the Genus database with same CATH superfamily
2YBAA 2Z2PA 4GGAA 4FAND 4J79A 2B5MA 1YR2A 5A2Qg 3OTTA 3SHFA 3SMRA 5FXYA 5AFU3 2AGYA 5HQGA 4CZVA 4ZOYA 2H6NA 4A0AB 4BP9A 4Z7OA 3VH0A 2IUQA 3OKYA 2VDLA 3V5WB 3SBQA 2UZYB 2YMUA 1MDAH 4Z7NA 4JSPC 3FGBA 3AL9A 3EU7A 3SJLD 4EWRA 2OVQB 5FKSA 3MKSB 4X3EA 5C86A 4A09B 3GD1I 3V4PA 2VDPA 3OL2B 3K71A 5EM2B 2WQ8A 1H2YA 1GOFA 2H13A 3L4OD 4BCCA 5IJ8E 3K6SA 5EMJB 4Y7RA 4L9OA 1JTDB 4PXWA 3EI4B 4J82A 5FFGA 2I0TA 2P9NC 3NVXA 4JT5C 4E5ZA 5HE0B 2CO0C 1M1XA 2HKRA 3SCYA 2PM7B 4J84A 3NVNA 4DNWA 4QRJA 5GMKn 3W15A 3EI1B 2P9LC 2CO0A 1H2WA 3MKQA 4A11B 2J55H 2VDMA 3EMHA 2QXVA 2W18A 5FKRA 2EICA 4U1EI 3RFHA 4GQ1A 4K3JB 2OIZA 4DNVA 3T3PA 3CFSB 4ZOZA 3ODTA 3SFZA 2EBSA 4N14A 2J57G 5EMKB 4JXMA 4LGNA 4PNKB 3N0EA 3RN0D 4X60B 2AQ5A 4KFMB 4J86A 4BH6A 4DNUA 5E6RA 3HFQA 5E6SA 5SXMA 3DXKC 1N6FA 3T3MA 3ZWLB 1XIPA 3FM0A 5CXBB 4I79A 2GC7A 3BG0A 3IUMA 5FKTA 3NIDA 3N0DA 2VDNA 3EI3B 2OVPB 4GGCA 3OW8A 5EAPA 5GSAA 1P22A 2CE9A 4GZ8A 1GOHA 3EI1A 4MMZA 1OLZA 4QAMA 4J8GA 4BP8A 1PGUA 3K27A 3OL2A 2AH1A 4A2LA 1H2XA 3O4JA 2P9SC 5TEFA 3I2NA 3SBRA 1A0RB 4UM8A 2QC5A 5EAMA 3OKYB 3I8CA 1B9XA 4FHLA 2Z2NA 3EQ8A 2GNQA 1B9YA 1I2MB 2H6KA 4G1MA 4FAVD 5IT9g 1JJUB 5C2VB 2HJ4A 3IKOA 4WK2A 1XKSA 2HXCA 4A11A 3C99A 1PBYB 3I7PA 2CNXA 5H17A 3MXXA 3GFCA 3V4VA 4A0BB 3VI4A 3NVQA 3SWSD 1N6EA 2VDRA 3DDUA 3DWLC 1JMZB 1GOGA 2H9NA 5HE1B 1BPOA 4MMXA 4CY1A 4J87A 2PM6B 3V7DB 3RRMC 4YVDA 2IURA 3CIKB 3FRXA 1T2XA 2BBKH 4AN0A 2O9KA 5M5RA 2XL2A 4X63B 3O4GA 2PM9B 1U8CA 4J0WA 3PXWD 1PEVA 3DM0A 2HU7A 2TRCB 3IUQA 1QNIA 3EI2A 3DSMA 1OMWB 3MUOA 2XDWA 3KRXB 1K8KC 4NC4A 1QFSA 4D6VA 5B4WA 1JOFA 4CC9A 3ZDYA 4PBZA 3J81g 4A0BA 4NSXA 3UVOA 3JZNA 3I7KA 5CYKB 2AGLA 5E6UA 5IC7A 1UOPA 3SN6B 2QR5A 5HE2B 3EWEA 2MTAH 3OKWA 4PBYA 4E54B 3PVUB 4IMMA 5TDHB 1PI6A 3PVWB 4PC0A 2IAAA 5HDBA 5HYNB 4G56B 5K1CC 2P9IC 1NEXB 2VDKA 4JHPC 1C9IA 2XZGA 3JZHA 4UI9R 4O3TB 1UOQA 5M61A 2B5LA 4L1QD 3K72A 3NIFA 4J77A 4IA9A 4E5ZB 5M5TA 3PXTD 3P4FA 3SLED 2G9AA 4D9SA 4OZUA 3I7LA 2YNNA 5H1MA 4XYHA 3PXSD 4A09A 1L0QA 3IIYA 4XEIC 4O2WA 3ULEC 3DXMC 1E5TA 2H14A 1QFMA 2BCJB 2CN2A 3F3FA 3BWSA 1TBGA 5EARA 4PSWB 5JWZA 2HYEA 2IUVA 4U7AA 1E8NA 2B5NA 4FWWA 2PBIB 2YB8B 3QHYB 3RSEC 3PSCB 5GXIA 5AJAA 1FWXA 2Q7QA 1U4CA 2EIBA 1O6FA 2H47A 4BCDA 1S4UX 2VZ1A 3RMZD 4GQBB 5KDOB 1O6GA 1VE7A 3EQ7A 5CXCB 1K3IA 4G55A 2YNOA 2G99A 2P9UC 5EM2A 5HE3B 4AMZA 3VGZA 2IUPA 2IWFA 4O02A 2VDOA 4WK0A 1Q47A 2EIDA 3EI4A 5GXHA 3EI3A 4CY2A 3KRWB 3OKTA 4AEZA 3UR4A 3IJ1A 5I5JA 3C75H 1GG2B 4ZOVA 2XE4A 2VDQA 3AL8A 3UVNA 2QZPA 3KCIA 3QI0A 4Y5RD 1A12A 1RI6A 4LG9A 4CZXA 5C92A 1YFQA 3IJ0A 3IURA 4MMYA 2I0SA 4ERQA 4JT6C 4ZN4A 1SQJA 5TEEA 1N6DA 1VYHC 4CI3A 2HU5A 3ZE2A 5FKQA 3EG6A 4J73A 2H9PA 4ES0A 1C9LA 5CXCA 3UVLA 4K3ID 1MG2A 2AH0A 2VC2A 3RN1D 3U4YA 2UZXB 3AFCA 2AGWA 4D0KA 2XU7A 3IIWA 4J81A 3C9CA 3JAMg 2CE8A 3I7NA 4JSVC 5CXBA 3IJCA 3MZLA 5THAA 5FQDA 4QQEA 2I3TA 3UKRC 4G1EA 4L3GD 4X61B 3NIGA 4HDJA 4FA1D 3B7FA 4CY3A 1E8MA 3GREA 3UVMA 3C5MA 1GXRA 3UVKA 4PSXB 2PM9A 3CFVA 1GP2B 2AGZA 4IRZA 4BUJC 2H9MA 5IGOA 2HU8A 3SXTD 1TYEA 4CI8A 4A2MA 2H3XA 1U2VC 4J78A 3F3GA 1UTCA 2OK4A 2BKLA 4Z7QA 3ZDZA 3IUJA 4AMYA 3O4HA 5AMSA 2CN3A 5CYKA 1VZ3A 2OJYA 4XYIA 5M5VA 4FB1D 3IULA 1JMXB 3I8EA 3GC3B 4WK4A 4MK0B 3MVDK 4BL0A 3IUNA 5TF2A 4Z8LA 3ORVD 4ESGA 4ZOXA 2OVRB 3EI2B 3VA6A 3VI3A 4R7AB 3J80g 5M5SA 1GOTB 5IGQA 1SHYB 3V9FA 4GQ2P 3I7HA 4O3UB 5C2WB 3E0CA 1L5GA 4E54A 2P9PC 2I3SA 4GGDA 4J8BA 4H5JA 4LG8A 5FA5B 2P9KC 4GM9A 3IJEA 4OWRA 5H14A 3UKUC 4L3HD 2J56H 1K32A 4UM9A 3ZDXA 5I5MA 1H2ZA 2YNPA 3F3PA 4A08A 1MG3A 3BG1A 3O4IA 4O45A 4TZ4A 3FCUA 4RE6A 4O1QD 2H6QA 3JPXA 4QT8A 1ERJA 4CI2A 2XYIA 1XHMA 4L1MA 4O9DA 4H5IA 3K26A 4QL1A 3IVMA 3FCSA 3L4MD 3JRPA 5M5UA 4NENA 5EALA 4AX4A 2VZ3A 1TYQC 3I89A 1NR0A 3AH8B 4GMBA 4J0XA 4NBMA 4WJKA 3PE7A 4A0AA 4JSXC 5K19A 2XL3A 2EIEA 4CY5A 4JHNA 5IJ7E 4FA5D 1VE6A 3RFGA 3I7OA 4AOWA 3JROA 4FA4D 2I0RA 4JSNC 3ZE1A 5C9ZB 1JV2A 1R5MA 3JZGA 4CI1A 3SVWD 3AL8B 4ERZA 2H9LA 3PSLA 4A7JA 4FA9D 3MMYA 3MUNA 4A08B 5I5IA 3A0FA 3SBPA 2JKXA 5EMLB 4GM8A 5FFOA 2B4EA 2H68A 3RLMD 2HESX 2Z2OA 2GC4A 4JD2C 4CZYA 2OK6A 2IWKA 4AN1A 1SQ9A 3JB9L 3ZE0A 3MZKA 4NAAA 4RE5A 5EMMB 4ERYA 3EQ9A 4GM3A 2HJBA 3OF7A 5FLXg 1VZ2A 2AGXA 2HKMA 4BCBA 1UOOA
chains in the Genus database with same CATH topology
2YBAA 2Z2PA 4GGAA 4FAND 4J79A 2B5MA 5A2Qg 3OTTA 3SHFA 3SMRA 5FXYA 5AFU3 2AGYA 5HQGA 4CZVA 4ZOYA 2H6NA 4A0AB 3VH0A 2IUQA 3OKYA 3V5WB 3SBQA 2UZYB 2YMUA 1MDAH 4JSPC 3FGBA 3AL9A 3EU7A 3SJLD 4EWRA 2OVQB 5FKSA 3MKSB 4X3EA 4A09B 3OL2B 5EM2B 5IJ8E 2H13A 3L4OD 5EMJB 4Y7RA 4L9OA 4PXWA 3EI4B 4J82A 2I0TA 2P9NC 3NVXA 4JT5C 4E5ZA 5HE0B 2CO0C 2HKRA 3SCYA 2PM7B 4J84A 3NVNA 4QRJA 5GMKn 3W15A 3EI1B 2P9LC 2CO0A 3MKQA 4A11B 2J55H 3EMHA 2QXVA 2W18A 5FKRA 4U1EI 3RFHA 4GQ1A 4K3JB 2OIZA 3CFSB 4ZOZA 3ODTA 3SFZA 2EBSA 4N14A 2J57G 5EMKB 4JXMA 4LGNA 4PNKB 3N0EA 3RN0D 4X60B 2AQ5A 4KFMB 4J86A 4BH6A 3HFQA 5SXMA 3ZWLB 3DXKC 1N6FA 1XIPA 3FM0A 5CXBB 4I79A 2GC7A 3BG0A 5FKTA 3N0DA 3EI3B 2OVPB 4GGCA 3OW8A 5EAPA 5GSAA 1P22A 2CE9A 4GZ8A 3EI1A 1OLZA 4J8GA 1PGUA 3K27A 3OL2A 2AH1A 4A2LA 5TEFA 2P9SC 3I2NA 3SBRA 1A0RB 2QC5A 5EAMA 3OKYB 3I8CA 1B9XA 4FHLA 2Z2NA 2GNQA 1B9YA 2H6KA 4FAVD 5IT9g 1JJUB 5C2VB 2HJ4A 3IKOA 4A11A 1XKSA 2HXCA 3C99A 1PBYB 3I7PA 2CNXA 5H17A 3MXXA 3GFCA 4A0BB 3NVQA 3SWSD 1N6EA 3DWLC 1JMZB 2H9NA 5HE1B 4CY1A 4J87A 2PM6B 3V7DB 3RRMC 4YVDA 2IURA 3CIKB 3FRXA 2BBKH 2O9KA 2XL2A 4X63B 2PM9B 4J0WA 3PXWD 1PEVA 3DM0A 2TRCB 1QNIA 3EI2A 3DSMA 1OMWB 3KRXB 1K8KC 4D6VA 3J81g 4A0BA 5B4WA 1JOFA 4CC9A 4PBZA 4NSXA 3UVOA 3JZNA 3I7KA 5CYKB 2AGLA 5IC7A 3SN6B 5HE2B 3EWEA 2MTAH 3OKWA 4PBYA 4E54B 3PVUB 4IMMA 5TDHB 1PI6A 3PVWB 4PC0A 2IAAA 5HYNB 4G56B 5K1CC 2P9IC 1NEXB 3JZHA 4UI9R 4O3TB 2B5LA 4L1QD 4J77A 4IA9A 4E5ZB 3PXTD 3P4FA 3SLED 2G9AA 4OZUA 3I7LA 2YNNA 5H1MA 4XYHA 3PXSD 4A09A 1L0QA 3IIYA 4XEIC 3ULEC 3DXMC 2H14A 2BCJB 2CN2A 3F3FA 3BWSA 1TBGA 5EARA 4PSWB 5JWZA 2HYEA 2IUVA 4U7AA 4FWWA 2B5NA 2PBIB 2YB8B 3RSEC 5GXIA 3PSCB 5AJAA 1FWXA 2Q7QA 1U4CA 2H47A 1S4UX 3RMZD 4GQBB 5KDOB 5CXCB 2YNOA 2G99A 2P9UC 5EM2A 5HE3B 3VGZA 2IUPA 2IWFA 1Q47A 3EI4A 5GXHA 3EI3A 4CY2A 3KRWB 3OKTA 4AEZA 3UR4A 3IJ1A 5I5JA 3C75H 1GG2B 4ZOVA 3UVNA 3AL8A 4Y5RD 1RI6A 4CZXA 4LG9A 1YFQA 3IJ0A 2I0SA 4ERQA 4JT6C 4ZN4A 1SQJA 5TEEA 1N6DA 1VYHC 4CI3A 5FKQA 3EG6A 4J73A 2H9PA 4ES0A 5CXCA 3UVLA 4K3ID 1MG2A 2AH0A 3RN1D 3U4YA 2UZXB 3AFCA 2AGWA 4D0KA 2XU7A 3IIWA 4J81A 3C9CA 3JAMg 2CE8A 3I7NA 4JSVC 5CXBA 3IJCA 3MZLA 5THAA 5FQDA 4QQEA 2I3TA 3UKRC 4L3GD 4X61B 4HDJA 4FA1D 3B7FA 4CY3A 3GREA 3UVMA 3C5MA 1GXRA 3UVKA 4PSXB 2PM9A 3CFVA 1GP2B 2AGZA 4BUJC 2H9MA 5IGOA 3SXTD 4CI8A 4A2MA 2H3XA 1U2VC 4J78A 3F3GA 2OK4A 5AMSA 2CN3A 5CYKA 2OJYA 4XYIA 4FB1D 1JMXB 3I8EA 4MK0B 4BL0A 5TF2A 4Z8LA 3ORVD 4ESGA 4ZOXA 2OVRB 3EI2B 3VA6A 4R7AB 3J80g 1GOTB 5IGQA 1SHYB 3V9FA 4GQ2P 3I7HA 4O3UB 5C2WB 3E0CA 4E54A 2P9PC 2I3SA 4GGDA 4J8BA 4H5JA 4LG8A 5FA5B 2P9KC 4GM9A 4OWRA 5H14A 3UKUC 4L3HD 2J56H 1K32A 5I5MA 2YNPA 3F3PA 4A08A 1MG3A 3BG1A 4O45A 4TZ4A 4O1QD 2H6QA 3JPXA 4QT8A 1ERJA 4CI2A 2XYIA 1XHMA 4QL1A 4O9DA 4H5IA 3K26A 3L4MD 3JRPA 5EALA 1TYQC 3I89A 1NR0A 3AH8B 4GMBA 4J0XA 4A0AA 3PE7A 4JSXC 5K19A 2XL3A 4CY5A 5IJ7E 4FA5D 3RFGA 3I7OA 4AOWA 3JROA 4FA4D 2I0RA 4JSNC 4CI1A 5C9ZB 3JZGA 1R5MA 3SVWD 3AL8B 4ERZA 2H9LA 3PSLA 4A7JA 4FA9D 3MMYA 4A08B 5I5IA 3A0FA 3SBPA 5EMLB 4GM8A 2B4EA 2H68A 3RLMD 2HESX 2Z2OA 2GC4A 4JD2C 4CZYA 2OK6A 2IWKA 1SQ9A 3JB9L 3MZKA 5EMMB 4ERYA 4GM3A 2HJBA 5FLXg 2AGXA 2HKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YBA A;  2Z2P A;  4GGA A;  4FAN D;  4J79 A;  2B5M A;  5A2Q g;  3OTT A;  3SHF A;  3SMR A;  5FXY A;  5AFU 3;  2AGY A;  5HQG A;  4CZV A;  4ZOY A;  2H6N A;  4A0A B;  3VH0 A;  2IUQ A;  3OKY A;  3V5W B;  3SBQ A;  2UZY B;  2YMU A;  1MDA H;  4JSP C;  3FGB A;  3AL9 A;  3EU7 A;  3SJL D;  4EWR A;  2OVQ B;  5FKS A;  3MKS B;  4X3E A;  4A09 B;  3OL2 B;  5EM2 B;  5IJ8 E;  2H13 A;  3L4O D;  5EMJ B;  4Y7R A;  4L9O A;  4PXW A;  3EI4 B;  4J82 A;  2I0T A;  2P9N C;  3NVX A;  4JT5 C;  4E5Z A;  5HE0 B;  2CO0 C;  2HKR A;  3SCY A;  2PM7 B;  4J84 A;  3NVN A;  4QRJ A;  5GMK n;  3W15 A;  3EI1 B;  2P9L C;  2CO0 A;  3MKQ A;  4A11 B;  2J55 H;  3EMH A;  2QXV A;  2W18 A;  5FKR A;  4U1E I;  3RFH A;  4GQ1 A;  4K3J B;  2OIZ A;  3CFS B;  4ZOZ A;  3ODT A;  3SFZ A;  2EBS A;  4N14 A;  2J57 G;  5EMK B;  4JXM A;  4LGN A;  4PNK B;  3N0E A;  3RN0 D;  4X60 B;  2AQ5 A;  4KFM B;  4J86 A;  4BH6 A;  3HFQ A;  5SXM A;  3ZWL B;  3DXK C;  1N6F A;  1XIP A;  3FM0 A;  5CXB B;  4I79 A;  2GC7 A;  3BG0 A;  5FKT A;  3N0D A;  3EI3 B;  2OVP B;  4GGC A;  3OW8 A;  5EAP A;  5GSA A;  1P22 A;  2CE9 A;  4GZ8 A;  3EI1 A;  1OLZ A;  4J8G A;  1PGU A;  3K27 A;  3OL2 A;  2AH1 A;  4A2L A;  5TEF A;  2P9S C;  3I2N A;  3SBR A;  1A0R B;  2QC5 A;  5EAM A;  3OKY B;  3I8C A;  1B9X A;  4FHL A;  2Z2N A;  2GNQ A;  1B9Y A;  2H6K A;  4FAV D;  5IT9 g;  1JJU B;  5C2V B;  2HJ4 A;  3IKO A;  4A11 A;  1XKS A;  2HXC A;  3C99 A;  1PBY B;  3I7P A;  2CNX A;  5H17 A;  3MXX A;  3GFC A;  4A0B B;  3NVQ A;  3SWS D;  1N6E A;  3DWL C;  1JMZ B;  2H9N A;  5HE1 B;  4CY1 A;  4J87 A;  2PM6 B;  3V7D B;  3RRM C;  4YVD A;  2IUR A;  3CIK B;  3FRX A;  2BBK H;  2O9K A;  2XL2 A;  4X63 B;  2PM9 B;  4J0W A;  3PXW D;  1PEV A;  3DM0 A;  2TRC B;  1QNI A;  3EI2 A;  3DSM A;  1OMW B;  3KRX B;  1K8K C;  4D6V A;  3J81 g;  4A0B A;  5B4W A;  1JOF A;  4CC9 A;  4PBZ A;  4NSX A;  3UVO A;  3JZN A;  3I7K A;  5CYK B;  2AGL A;  5IC7 A;  3SN6 B;  5HE2 B;  3EWE A;  2MTA H;  3OKW A;  4PBY A;  4E54 B;  3PVU B;  4IMM A;  5TDH B;  1PI6 A;  3PVW B;  4PC0 A;  2IAA A;  5HYN B;  4G56 B;  5K1C C;  2P9I C;  1NEX B;  3JZH A;  4UI9 R;  4O3T B;  2B5L A;  4L1Q D;  4J77 A;  4IA9 A;  4E5Z B;  3PXT D;  3P4F A;  3SLE D;  2G9A A;  4OZU A;  3I7L A;  2YNN A;  5H1M A;  4XYH A;  3PXS D;  4A09 A;  1L0Q A;  3IIY A;  4XEI C;  3ULE C;  3DXM C;  2H14 A;  2BCJ B;  2CN2 A;  3F3F A;  3BWS A;  1TBG A;  5EAR A;  4PSW B;  5JWZ A;  2HYE A;  2IUV A;  4U7A A;  4FWW A;  2B5N A;  2PBI B;  2YB8 B;  3RSE C;  5GXI A;  3PSC B;  5AJA A;  1FWX A;  2Q7Q A;  1U4C A;  2H47 A;  1S4U X;  3RMZ D;  4GQB B;  5KDO B;  5CXC B;  2YNO A;  2G99 A;  2P9U C;  5EM2 A;  5HE3 B;  3VGZ A;  2IUP A;  2IWF A;  1Q47 A;  3EI4 A;  5GXH A;  3EI3 A;  4CY2 A;  3KRW B;  3OKT A;  4AEZ A;  3UR4 A;  3IJ1 A;  5I5J A;  3C75 H;  1GG2 B;  4ZOV A;  3UVN A;  3AL8 A;  4Y5R D;  1RI6 A;  4CZX A;  4LG9 A;  1YFQ A;  3IJ0 A;  2I0S A;  4ERQ A;  4JT6 C;  4ZN4 A;  1SQJ A;  5TEE A;  1N6D A;  1VYH C;  4CI3 A;  5FKQ A;  3EG6 A;  4J73 A;  2H9P A;  4ES0 A;  5CXC A;  3UVL A;  4K3I D;  1MG2 A;  2AH0 A;  3RN1 D;  3U4Y A;  2UZX B;  3AFC A;  2AGW A;  4D0K A;  2XU7 A;  3IIW A;  4J81 A;  3C9C A;  3JAM g;  2CE8 A;  3I7N A;  4JSV C;  5CXB A;  3IJC A;  3MZL A;  5THA A;  5FQD A;  4QQE A;  2I3T A;  3UKR C;  4L3G D;  4X61 B;  4HDJ A;  4FA1 D;  3B7F A;  4CY3 A;  3GRE A;  3UVM A;  3C5M A;  1GXR A;  3UVK A;  4PSX B;  2PM9 A;  3CFV A;  1GP2 B;  2AGZ A;  4BUJ C;  2H9M A;  5IGO A;  3SXT D;  4CI8 A;  4A2M A;  2H3X A;  1U2V C;  4J78 A;  3F3G A;  2OK4 A;  5AMS A;  2CN3 A;  5CYK A;  2OJY A;  4XYI A;  4FB1 D;  1JMX B;  3I8E A;  4MK0 B;  4BL0 A;  5TF2 A;  4Z8L A;  3ORV D;  4ESG A;  4ZOX A;  2OVR B;  3EI2 B;  3VA6 A;  4R7A B;  3J80 g;  1GOT B;  5IGQ A;  1SHY B;  3V9F A;  4GQ2 P;  3I7H A;  4O3U B;  5C2W B;  3E0C A;  4E54 A;  2P9P C;  2I3S A;  4GGD A;  4J8B A;  4H5J A;  4LG8 A;  5FA5 B;  2P9K C;  4GM9 A;  4OWR A;  5H14 A;  3UKU C;  4L3H D;  2J56 H;  1K32 A;  5I5M A;  2YNP A;  3F3P A;  4A08 A;  1MG3 A;  3BG1 A;  4O45 A;  4TZ4 A;  4O1Q D;  2H6Q A;  3JPX A;  4QT8 A;  1ERJ A;  4CI2 A;  2XYI A;  1XHM A;  4QL1 A;  4O9D A;  4H5I A;  3K26 A;  3L4M D;  3JRP A;  5EAL A;  1TYQ C;  3I89 A;  1NR0 A;  3AH8 B;  4GMB A;  4J0X A;  4A0A A;  3PE7 A;  4JSX C;  5K19 A;  2XL3 A;  4CY5 A;  5IJ7 E;  4FA5 D;  3RFG A;  3I7O A;  4AOW A;  3JRO A;  4FA4 D;  2I0R A;  4JSN C;  4CI1 A;  5C9Z B;  3JZG A;  1R5M A;  3SVW D;  3AL8 B;  4ERZ A;  2H9L A;  3PSL A;  4A7J A;  4FA9 D;  3MMY A;  4A08 B;  5I5I A;  3A0F A;  3SBP A;  5EML B;  4GM8 A;  2B4E A;  2H68 A;  3RLM D;  2HES X;  2Z2O A;  2GC4 A;  4JD2 C;  4CZY A;  2OK6 A;  2IWK A;  1SQ9 A;  3JB9 L;  3MZK A;  5EMM B;  4ERY A;  4GM3 A;  2HJB A;  5FLX g;  2AGX A;  2HKM A; 
#chains in the Genus database with same CATH topology
 2YBA A;  2Z2P A;  4GGA A;  4FAN D;  4J79 A;  2B5M A;  1YR2 A;  5A2Q g;  3OTT A;  3SHF A;  3SMR A;  5FXY A;  5AFU 3;  2AGY A;  5HQG A;  4CZV A;  4ZOY A;  2H6N A;  4A0A B;  4BP9 A;  4Z7O A;  3VH0 A;  2IUQ A;  3OKY A;  2VDL A;  3V5W B;  3SBQ A;  2UZY B;  2YMU A;  1MDA H;  4Z7N A;  4JSP C;  3FGB A;  3AL9 A;  3EU7 A;  3SJL D;  4EWR A;  2OVQ B;  5FKS A;  3MKS B;  4X3E A;  5C86 A;  4A09 B;  3GD1 I;  3V4P A;  2VDP A;  3OL2 B;  3K71 A;  5EM2 B;  2WQ8 A;  1H2Y A;  1GOF A;  2H13 A;  3L4O D;  4BCC A;  5IJ8 E;  3K6S A;  5EMJ B;  4Y7R A;  4L9O A;  1JTD B;  4PXW A;  3EI4 B;  4J82 A;  5FFG A;  2I0T A;  2P9N C;  3NVX A;  4JT5 C;  4E5Z A;  5HE0 B;  2CO0 C;  1M1X A;  2HKR A;  3SCY A;  2PM7 B;  4J84 A;  3NVN A;  4DNW A;  4QRJ A;  5GMK n;  3W15 A;  3EI1 B;  2P9L C;  2CO0 A;  1H2W A;  3MKQ A;  4A11 B;  2J55 H;  2VDM A;  3EMH A;  2QXV A;  2W18 A;  5FKR A;  2EIC A;  4U1E I;  3RFH A;  4GQ1 A;  4K3J B;  2OIZ A;  4DNV A;  3T3P A;  3CFS B;  4ZOZ A;  3ODT A;  3SFZ A;  2EBS A;  4N14 A;  2J57 G;  5EMK B;  4JXM A;  4LGN A;  4PNK B;  3N0E A;  3RN0 D;  4X60 B;  2AQ5 A;  4KFM B;  4J86 A;  4BH6 A;  4DNU A;  5E6R A;  3HFQ A;  5E6S A;  5SXM A;  3DXK C;  1N6F A;  3T3M A;  3ZWL B;  1XIP A;  3FM0 A;  5CXB B;  4I79 A;  2GC7 A;  3BG0 A;  3IUM A;  5FKT A;  3NID A;  3N0D A;  2VDN A;  3EI3 B;  2OVP B;  4GGC A;  3OW8 A;  5EAP A;  5GSA A;  1P22 A;  2CE9 A;  4GZ8 A;  1GOH A;  3EI1 A;  4MMZ A;  1OLZ A;  4QAM A;  4J8G A;  4BP8 A;  1PGU A;  3K27 A;  3OL2 A;  2AH1 A;  4A2L A;  1H2X A;  3O4J A;  2P9S C;  5TEF A;  3I2N A;  3SBR A;  1A0R B;  4UM8 A;  2QC5 A;  5EAM A;  3OKY B;  3I8C A;  1B9X A;  4FHL A;  2Z2N A;  3EQ8 A;  2GNQ A;  1B9Y A;  1I2M B;  2H6K A;  4G1M A;  4FAV D;  5IT9 g;  1JJU B;  5C2V B;  2HJ4 A;  3IKO A;  4WK2 A;  1XKS A;  2HXC A;  4A11 A;  3C99 A;  1PBY B;  3I7P A;  2CNX A;  5H17 A;  3MXX A;  3GFC A;  3V4V A;  4A0B B;  3VI4 A;  3NVQ A;  3SWS D;  1N6E A;  2VDR A;  3DDU A;  3DWL C;  1JMZ B;  1GOG A;  2H9N A;  5HE1 B;  1BPO A;  4MMX A;  4CY1 A;  4J87 A;  2PM6 B;  3V7D B;  3RRM C;  4YVD A;  2IUR A;  3CIK B;  3FRX A;  1T2X A;  2BBK H;  4AN0 A;  2O9K A;  5M5R A;  2XL2 A;  4X63 B;  3O4G A;  2PM9 B;  1U8C A;  4J0W A;  3PXW D;  1PEV A;  3DM0 A;  2HU7 A;  2TRC B;  3IUQ A;  1QNI A;  3EI2 A;  3DSM A;  1OMW B;  3MUO A;  2XDW A;  3KRX B;  1K8K C;  4NC4 A;  1QFS A;  4D6V A;  5B4W A;  1JOF A;  4CC9 A;  3ZDY A;  4PBZ A;  3J81 g;  4A0B A;  4NSX A;  3UVO A;  3JZN A;  3I7K A;  5CYK B;  2AGL A;  5E6U A;  5IC7 A;  1UOP A;  3SN6 B;  2QR5 A;  5HE2 B;  3EWE A;  2MTA H;  3OKW A;  4PBY A;  4E54 B;  3PVU B;  4IMM A;  5TDH B;  1PI6 A;  3PVW B;  4PC0 A;  2IAA A;  5HDB A;  5HYN B;  4G56 B;  5K1C C;  2P9I C;  1NEX B;  2VDK A;  4JHP C;  1C9I A;  2XZG A;  3JZH A;  4UI9 R;  4O3T B;  1UOQ A;  5M61 A;  2B5L A;  4L1Q D;  3K72 A;  3NIF A;  4J77 A;  4IA9 A;  4E5Z B;  5M5T A;  3PXT D;  3P4F A;  3SLE D;  2G9A A;  4D9S A;  4OZU A;  3I7L A;  2YNN A;  5H1M A;  4XYH A;  3PXS D;  4A09 A;  1L0Q A;  3IIY A;  4XEI C;  4O2W A;  3ULE C;  3DXM C;  1E5T A;  2H14 A;  1QFM A;  2BCJ B;  2CN2 A;  3F3F A;  3BWS A;  1TBG A;  5EAR A;  4PSW B;  5JWZ A;  2HYE A;  2IUV A;  4U7A A;  1E8N A;  2B5N A;  4FWW A;  2PBI B;  2YB8 B;  3QHY B;  3RSE C;  3PSC B;  5GXI A;  5AJA A;  1FWX A;  2Q7Q A;  1U4C A;  2EIB A;  1O6F A;  2H47 A;  4BCD A;  1S4U X;  2VZ1 A;  3RMZ D;  4GQB B;  5KDO B;  1O6G A;  1VE7 A;  3EQ7 A;  5CXC B;  1K3I A;  4G55 A;  2YNO A;  2G99 A;  2P9U C;  5EM2 A;  5HE3 B;  4AMZ A;  3VGZ A;  2IUP A;  2IWF A;  4O02 A;  2VDO A;  4WK0 A;  1Q47 A;  2EID A;  3EI4 A;  5GXH A;  3EI3 A;  4CY2 A;  3KRW B;  3OKT A;  4AEZ A;  3UR4 A;  3IJ1 A;  5I5J A;  3C75 H;  1GG2 B;  4ZOV A;  2XE4 A;  2VDQ A;  3AL8 A;  3UVN A;  2QZP A;  3KCI A;  3QI0 A;  4Y5R D;  1A12 A;  1RI6 A;  4LG9 A;  4CZX A;  5C92 A;  1YFQ A;  3IJ0 A;  3IUR A;  4MMY A;  2I0S A;  4ERQ A;  4JT6 C;  4ZN4 A;  1SQJ A;  5TEE A;  1N6D A;  1VYH C;  4CI3 A;  2HU5 A;  3ZE2 A;  5FKQ A;  3EG6 A;  4J73 A;  2H9P A;  4ES0 A;  1C9L A;  5CXC A;  3UVL A;  4K3I D;  1MG2 A;  2AH0 A;  2VC2 A;  3RN1 D;  3U4Y A;  2UZX B;  3AFC A;  2AGW A;  4D0K A;  2XU7 A;  3IIW A;  4J81 A;  3C9C A;  3JAM g;  2CE8 A;  3I7N A;  4JSV C;  5CXB A;  3IJC A;  3MZL A;  5THA A;  5FQD A;  4QQE A;  2I3T A;  3UKR C;  4G1E A;  4L3G D;  4X61 B;  3NIG A;  4HDJ A;  4FA1 D;  3B7F A;  4CY3 A;  1E8M A;  3GRE A;  3UVM A;  3C5M A;  1GXR A;  3UVK A;  4PSX B;  2PM9 A;  3CFV A;  1GP2 B;  2AGZ A;  4IRZ A;  4BUJ C;  2H9M A;  5IGO A;  2HU8 A;  3SXT D;  1TYE A;  4CI8 A;  4A2M A;  2H3X A;  1U2V C;  4J78 A;  3F3G A;  1UTC A;  2OK4 A;  2BKL A;  4Z7Q A;  3ZDZ A;  3IUJ A;  4AMY A;  3O4H A;  5AMS A;  2CN3 A;  5CYK A;  1VZ3 A;  2OJY A;  4XYI A;  5M5V A;  4FB1 D;  3IUL A;  1JMX B;  3I8E A;  3GC3 B;  4WK4 A;  4MK0 B;  3MVD K;  4BL0 A;  3IUN A;  5TF2 A;  4Z8L A;  3ORV D;  4ESG A;  4ZOX A;  2OVR B;  3EI2 B;  3VA6 A;  3VI3 A;  4R7A B;  3J80 g;  5M5S A;  1GOT B;  5IGQ A;  1SHY B;  3V9F A;  4GQ2 P;  3I7H A;  4O3U B;  5C2W B;  3E0C A;  1L5G A;  4E54 A;  2P9P C;  2I3S A;  4GGD A;  4J8B A;  4H5J A;  4LG8 A;  5FA5 B;  2P9K C;  4GM9 A;  3IJE A;  4OWR A;  5H14 A;  3UKU C;  4L3H D;  2J56 H;  1K32 A;  4UM9 A;  3ZDX A;  5I5M A;  1H2Z A;  2YNP A;  3F3P A;  4A08 A;  1MG3 A;  3BG1 A;  3O4I A;  4O45 A;  4TZ4 A;  3FCU A;  4RE6 A;  4O1Q D;  2H6Q A;  3JPX A;  4QT8 A;  1ERJ A;  4CI2 A;  2XYI A;  1XHM A;  4L1M A;  4O9D A;  4H5I A;  3K26 A;  4QL1 A;  3IVM A;  3FCS A;  3L4M D;  3JRP A;  5M5U A;  4NEN A;  5EAL A;  4AX4 A;  2VZ3 A;  1TYQ C;  3I89 A;  1NR0 A;  3AH8 B;  4GMB A;  4J0X A;  4NBM A;  4WJK A;  3PE7 A;  4A0A A;  4JSX C;  5K19 A;  2XL3 A;  2EIE A;  4CY5 A;  4JHN A;  5IJ7 E;  4FA5 D;  1VE6 A;  3RFG A;  3I7O A;  4AOW A;  3JRO A;  4FA4 D;  2I0R A;  4JSN C;  3ZE1 A;  5C9Z B;  1JV2 A;  1R5M A;  3JZG A;  4CI1 A;  3SVW D;  3AL8 B;  4ERZ A;  2H9L A;  3PSL A;  4A7J A;  4FA9 D;  3MMY A;  3MUN A;  4A08 B;  5I5I A;  3A0F A;  3SBP A;  2JKX A;  5EML B;  4GM8 A;  5FFO A;  2B4E A;  2H68 A;  3RLM D;  2HES X;  2Z2O A;  2GC4 A;  4JD2 C;  4CZY A;  2OK6 A;  2IWK A;  4AN1 A;  1SQ9 A;  3JB9 L;  3ZE0 A;  3MZK A;  4NAA A;  4RE5 A;  5EMM B;  4ERY A;  3EQ9 A;  4GM3 A;  2HJB A;  3OF7 A;  5FLX g;  1VZ2 A;  2AGX A;  2HKM A;  4BCB A;  1UOO A; 
#chains in the Genus database with same CATH homology
 2YBA A;  2Z2P A;  4GGA A;  4FAN D;  4J79 A;  2B5M A;  5A2Q g;  3OTT A;  3SHF A;  3SMR A;  5FXY A;  5AFU 3;  2AGY A;  5HQG A;  4CZV A;  4ZOY A;  2H6N A;  4A0A B;  3VH0 A;  2IUQ A;  3OKY A;  3V5W B;  3SBQ A;  2UZY B;  2YMU A;  1MDA H;  4JSP C;  3FGB A;  3AL9 A;  3EU7 A;  3SJL D;  4EWR A;  2OVQ B;  5FKS A;  3MKS B;  4X3E A;  4A09 B;  3OL2 B;  5EM2 B;  5IJ8 E;  2H13 A;  3L4O D;  5EMJ B;  4Y7R A;  4L9O A;  4PXW A;  3EI4 B;  4J82 A;  2I0T A;  2P9N C;  3NVX A;  4JT5 C;  4E5Z A;  5HE0 B;  2CO0 C;  2HKR A;  3SCY A;  2PM7 B;  4J84 A;  3NVN A;  4QRJ A;  5GMK n;  3W15 A;  3EI1 B;  2P9L C;  2CO0 A;  3MKQ A;  4A11 B;  2J55 H;  3EMH A;  2QXV A;  2W18 A;  5FKR A;  4U1E I;  3RFH A;  4GQ1 A;  4K3J B;  2OIZ A;  3CFS B;  4ZOZ A;  3ODT A;  3SFZ A;  2EBS A;  4N14 A;  2J57 G;  5EMK B;  4JXM A;  4LGN A;  4PNK B;  3N0E A;  3RN0 D;  4X60 B;  2AQ5 A;  4KFM B;  4J86 A;  4BH6 A;  3HFQ A;  5SXM A;  3ZWL B;  3DXK C;  1N6F A;  1XIP A;  3FM0 A;  5CXB B;  4I79 A;  2GC7 A;  3BG0 A;  5FKT A;  3N0D A;  3EI3 B;  2OVP B;  4GGC A;  3OW8 A;  5EAP A;  5GSA A;  1P22 A;  2CE9 A;  4GZ8 A;  3EI1 A;  1OLZ A;  4J8G A;  1PGU A;  3K27 A;  3OL2 A;  2AH1 A;  4A2L A;  5TEF A;  2P9S C;  3I2N A;  3SBR A;  1A0R B;  2QC5 A;  5EAM A;  3OKY B;  3I8C A;  1B9X A;  4FHL A;  2Z2N A;  2GNQ A;  1B9Y A;  2H6K A;  4FAV D;  5IT9 g;  1JJU B;  5C2V B;  2HJ4 A;  3IKO A;  4A11 A;  1XKS A;  2HXC A;  3C99 A;  1PBY B;  3I7P A;  2CNX A;  5H17 A;  3MXX A;  3GFC A;  4A0B B;  3NVQ A;  3SWS D;  1N6E A;  3DWL C;  1JMZ B;  2H9N A;  5HE1 B;  4CY1 A;  4J87 A;  2PM6 B;  3V7D B;  3RRM C;  4YVD A;  2IUR A;  3CIK B;  3FRX A;  2BBK H;  2O9K A;  2XL2 A;  4X63 B;  2PM9 B;  4J0W A;  3PXW D;  1PEV A;  3DM0 A;  2TRC B;  1QNI A;  3EI2 A;  3DSM A;  1OMW B;  3KRX B;  1K8K C;  4D6V A;  3J81 g;  4A0B A;  5B4W A;  1JOF A;  4CC9 A;  4PBZ A;  4NSX A;  3UVO A;  3JZN A;  3I7K A;  5CYK B;  2AGL A;  5IC7 A;  3SN6 B;  5HE2 B;  3EWE A;  2MTA H;  3OKW A;  4PBY A;  4E54 B;  3PVU B;  4IMM A;  5TDH B;  1PI6 A;  3PVW B;  4PC0 A;  2IAA A;  5HYN B;  4G56 B;  5K1C C;  2P9I C;  1NEX B;  3JZH A;  4UI9 R;  4O3T B;  2B5L A;  4L1Q D;  4J77 A;  4IA9 A;  4E5Z B;  3PXT D;  3P4F A;  3SLE D;  2G9A A;  4OZU A;  3I7L A;  2YNN A;  5H1M A;  4XYH A;  3PXS D;  4A09 A;  1L0Q A;  3IIY A;  4XEI C;  3ULE C;  3DXM C;  2H14 A;  2BCJ B;  2CN2 A;  3F3F A;  3BWS A;  1TBG A;  5EAR A;  4PSW B;  5JWZ A;  2HYE A;  2IUV A;  4U7A A;  4FWW A;  2B5N A;  2PBI B;  2YB8 B;  3RSE C;  5GXI A;  3PSC B;  5AJA A;  1FWX A;  2Q7Q A;  1U4C A;  2H47 A;  1S4U X;  3RMZ D;  4GQB B;  5KDO B;  5CXC B;  2YNO A;  2G99 A;  2P9U C;  5EM2 A;  5HE3 B;  3VGZ A;  2IUP A;  2IWF A;  1Q47 A;  3EI4 A;  5GXH A;  3EI3 A;  4CY2 A;  3KRW B;  3OKT A;  4AEZ A;  3UR4 A;  3IJ1 A;  5I5J A;  3C75 H;  1GG2 B;  4ZOV A;  3UVN A;  3AL8 A;  4Y5R D;  1RI6 A;  4CZX A;  4LG9 A;  1YFQ A;  3IJ0 A;  2I0S A;  4ERQ A;  4JT6 C;  4ZN4 A;  1SQJ A;  5TEE A;  1N6D A;  1VYH C;  4CI3 A;  5FKQ A;  3EG6 A;  4J73 A;  2H9P A;  4ES0 A;  5CXC A;  3UVL A;  4K3I D;  1MG2 A;  2AH0 A;  3RN1 D;  3U4Y A;  2UZX B;  3AFC A;  2AGW A;  4D0K A;  2XU7 A;  3IIW A;  4J81 A;  3C9C A;  3JAM g;  2CE8 A;  3I7N A;  4JSV C;  5CXB A;  3IJC A;  3MZL A;  5THA A;  5FQD A;  4QQE A;  2I3T A;  3UKR C;  4L3G D;  4X61 B;  4HDJ A;  4FA1 D;  3B7F A;  4CY3 A;  3GRE A;  3UVM A;  3C5M A;  1GXR A;  3UVK A;  4PSX B;  2PM9 A;  3CFV A;  1GP2 B;  2AGZ A;  4BUJ C;  2H9M A;  5IGO A;  3SXT D;  4CI8 A;  4A2M A;  2H3X A;  1U2V C;  4J78 A;  3F3G A;  2OK4 A;  5AMS A;  2CN3 A;  5CYK A;  2OJY A;  4XYI A;  4FB1 D;  1JMX B;  3I8E A;  4MK0 B;  4BL0 A;  5TF2 A;  4Z8L A;  3ORV D;  4ESG A;  4ZOX A;  2OVR B;  3EI2 B;  3VA6 A;  4R7A B;  3J80 g;  1GOT B;  5IGQ A;  1SHY B;  3V9F A;  4GQ2 P;  3I7H A;  4O3U B;  5C2W B;  3E0C A;  4E54 A;  2P9P C;  2I3S A;  4GGD A;  4J8B A;  4H5J A;  4LG8 A;  5FA5 B;  2P9K C;  4GM9 A;  4OWR A;  5H14 A;  3UKU C;  4L3H D;  2J56 H;  1K32 A;  5I5M A;  2YNP A;  3F3P A;  4A08 A;  1MG3 A;  3BG1 A;  4O45 A;  4TZ4 A;  4O1Q D;  2H6Q A;  3JPX A;  4QT8 A;  1ERJ A;  4CI2 A;  2XYI A;  1XHM A;  4QL1 A;  4O9D A;  4H5I A;  3K26 A;  3L4M D;  3JRP A;  5EAL A;  1TYQ C;  3I89 A;  1NR0 A;  3AH8 B;  4GMB A;  4J0X A;  4A0A A;  3PE7 A;  4JSX C;  5K19 A;  2XL3 A;  4CY5 A;  5IJ7 E;  4FA5 D;  3RFG A;  3I7O A;  4AOW A;  3JRO A;  4FA4 D;  2I0R A;  4JSN C;  4CI1 A;  5C9Z B;  3JZG A;  1R5M A;  3SVW D;  3AL8 B;  4ERZ A;  2H9L A;  3PSL A;  4A7J A;  4FA9 D;  3MMY A;  4A08 B;  5I5I A;  3A0F A;  3SBP A;  5EML B;  4GM8 A;  2B4E A;  2H68 A;  3RLM D;  2HES X;  2Z2O A;  2GC4 A;  4JD2 C;  4CZY A;  2OK6 A;  2IWK A;  1SQ9 A;  3JB9 L;  3MZK A;  5EMM B;  4ERY A;  4GM3 A;  2HJB A;  5FLX g;  2AGX A;  2HKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...