4FB1D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 60 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transfer
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fb1D00
1L0QA 2H6KA 2BBKH 4GGCA 4FB1D 1N6DA 2IUPA 3MZKA 3DXKC 4QL1A 3N0DA 3VGZA 2IURA 3PE7A 3SFZA 3I7PA 2P9LC 4L9OA 3CFVA 4K3JB 1A0RB 2PM9B 3CFSB 3KRWB 2OVPB 4CY5A 4CZVA 3DWLC 3V9FA 2B5LA 4QT8A 3VA6A 1P22A 1Q47A 3PVUB 4FA9D 1MG2A 5I5JA 3C9CA 3B7FA 1N6EA 4R7AB 2H68A 2P9UC 2OVRB 5H1MA 2G9AA 4XEIC 4A0BB 4J79A 4A7JA 3SHFA 5EMJB 4FAND 4PBYA 3JZHA 2AH1A 3K27A 3MKSB 2HJBA 4ERZA 2IAAA 2CN2A 4E5ZA 4BH6A 2IWKA 5HE0B 4A11A 5GSAA 3SN6B 2AQ5A 4X61B 3IIYA 3J80g 5EMMB 3RSEC 4X60B 1MDAH 5CYKA 4J0XA 4O9DA 1FWXA 5K1CC 3OKYB 4FA1D 3IJ1A 3UR4A 5EMKB 3SJLD 4D6VA 5A2Qg 2XYIA 3NVNA 3RMZD 3GREA 2J57G 4GZ8A 3UKRC 2EBSA 3JPXA 3NVQA 4EWRA 1YFQA 2OIZA 3EI4A 3N0EA 5AFU3 4U7AA 3JB9L 3I8CA 3E0CA 2GC7A 2P9KC 5B4WA 3BWSA 4JD2C 3P4FA 2I0SA 4JT6C 2HYEA 3I8EA 2CE9A 2OK4A 2CN3A 4J8GA 5EMLB 4CY1A 4J87A 3EI1A 2I0RA 4BUJC 4D0KA 1VYHC 1XKSA 3FGBA 3IJCA 4YVDA 3DM0A 3JZNA 3MKQA 4QRJA 4LG8A 1TYQC 5EAMA 4J73A 3EI2B 3JROA 4CY2A 2B5MA 1QNIA 2Z2PA 1XIPA 4JXMA 4X3EA 4UI9R 4FAVD 2H13A 4OWRA 4O1QD 4CZXA 2PM7B 2HKRA 3KRXB 1JMZB 3OW8A 4O3UB 4GM9A 4PNKB 3IIWA 3PVWB 4JSVC 2XL3A 4O45A 4LG9A 1S4UX 3I7KA 3C99A 5I5MA 5EAPA 2W18A 3RFGA 4A2LA 4ZN4A 4XYHA 4Z8LA 4A09B 4L3GD 3PXTD 4JT5C 5I5IA 3UVOA 2XU7A 3OKWA 1GG2B 2AGWA 3RFHA 3NVXA 2AGZA 2HESX 1PEVA 3EI3B 4AOWA 4A08B 4PBZA 2OJYA 4PSWB 3RRMC 1K32A 2GC4A 2BCJB 3C5MA 4J8BA 2PM9A 4MK0B 2MTAH 1NEXB 4ES0A 5C2WB 2YNOA 3EMHA 3RN0D 1PI6A 3A0FA 4PC0A 4ERYA 3U4YA 3ODTA 1U4CA 3BG1A 4H5JA 3CIKB 4Y7RA 3JZGA 4E54A 1ERJA 5C2VB 3DSMA 4GQBB 2P9SC 3EU7A 4BL0A 3V7DB 2YBAA 3MMYA 3SVWD 4ESGA 1PGUA 3SBPA 3I7HA 2P9IC 4FHLA 4JSPC 3F3FA 3OKYA 5EM2A 2IUQA 4A0AB 1JMXB 2XL2A 4CI8A 5CXCB 2AGYA 3RN1D 5SXMA 5CXBB 3UVLA 5AJAA 4H5IA 4J82A 2OK6A 3UKUC 4J81A 2YNPA 2IWFA 3I7LA 4PSXB 3OKTA 3JAMg 3PSLA 5THAA 1OMWB 2I0TA 3OL2B 2UZXB 1SQJA 2CNXA 3FM0A 4J84A 1K8KC 1SQ9A 3ULEC 5FKTA 2GNQA 1SHYB 5EALA 4ZOXA 5TEEA 2H3XA 5EARA 2YMUA 4L1QD 5FLXg 3EI2A 3F3PA 3JRPA 5IGQA 4CZYA 4CI2A 3SCYA 2OVQB 4FWWA 1N6FA 2HJ4A 2I3TA 4KFMB 3AL8B 5C9ZB 2H6QA 5HE3B 2TRCB 4AEZA 5HYNB 4LGNA 5FQDA 3AFCA 4FA4D 5IGOA 3I7NA 4XYIA 5GMKn 2Q7QA 4K3ID 4TZ4A 1PBYB 2YNNA 3FRXA 3RLMD 4OZUA 2CE8A 4NSXA 2Z2NA 4PXWA 4CI3A 4J78A 5FKQA 5HE1B 4A09A 2IUVA 4GM8A 2P9PC 3GFCA 5KDOB 3V5WB 2H9LA 4FA5D 4J86A 4GMBA 3IJ0A 2H9NA 3SLED 5GXHA 2O9KA 2G99A 3EI3A 1MG3A 3I7OA 3I89A 4A08A 2HKMA 4ZOYA 3L4OD 4J77A 5IC7A 4E5ZB 3PXWD 1JOFA 5K19A 3EG6A 4A11B 4IA9A 4GGDA 4Y5RD 3J81g 3ORVD 4U1EI 5FKRA 4A0BA 4CI1A 5IJ8E 5HQGA 5CYKB 4E54B 2P9NC 1GOTB 4GGAA 3PSCB 2H9PA 2B5NA 2AGXA 1GP2B 4J0WA 2H9MA 3EI4B 2CO0A 3UVMA 2J55H 4GQ1A 3VH0A 5EM2B 4ERQA 3K26A 4L3HD 1NR0A 3SMRA 1RI6A 2QXVA 5IJ7E 2PM6B 1OLZA 2H14A 3MZLA 3HFQA 5IT9g 2H47A 3EI1B 4CY3A 2YB8B 4IMMA 4A0AA 5HE2B 5CXCA 3SXTD 5FXYA 5CXBA 4I79A 3DXMC 4ZOZA 5FKSA 4HDJA 3UVNA 4JSNC 3UVKA 1R5MA 1TBGA 3AH8B 1XHMA 3I2NA 2B4EA 2CO0C 2PBIB 3SWSD 5JWZA 3ZWLB 3OTTA 2HXCA 2UZYB 5AMSA 4GQ2P 4GM3A 1JJUB 2H6NA 5H17A 2I3SA 4QQEA 3W15A 5H14A 3OL2A 4JSXC 2QC5A 3EWEA 2Z2OA 5TEFA 5GXIA 2AGLA 4O3TB 5FA5B 3AL9A 4X63B 5TF2A 3C75H 3SBQA 3IKOA 3MXXA 3F3GA 5TDHB 3PXSD 1B9XA 2AH0A 3BG0A 1U2VC 4N14A 3AL8A 1B9YA 4G56B 3SBRA 4CC9A 3L4MD 1GXRA 4ZOVA 2J56H 4A2MA
chains in the Genus database with same CATH superfamily
1L0QA 2H6KA 2BBKH 4GGCA 4FB1D 1N6DA 5M5SA 2IUPA 3MZKA 3DXKC 4QL1A 3N0DA 3VGZA 2IURA 3ZE0A 3PE7A 4AX4A 3SFZA 1K3IA 3O4IA 3I7PA 5M5RA 2P9LC 4QAMA 4L9OA 3CFVA 4K3JB 1A0RB 2PM9B 4BCCA 3CFSB 3KRWB 2OVPB 4CY5A 3NIDA 4CZVA 3DWLC 3V9FA 3ZDXA 3EQ8A 2B5LA 4QT8A 3VA6A 1P22A 1Q47A 3PVUB 3ZE1A 1MG2A 5I5JA 4DNUA 3C9CA 4UM9A 3B7FA 3IUQA 4G55A 1N6EA 4R7AB 3K72A 2H68A 2P9UC 3ZDZA 4JHPC 4DNWA 2OVRB 1TYEA 5H1MA 5M61A 2G9AA 4XEIC 4O02A 4A0BB 4J79A 4DNVA 4A7JA 1M1XA 3SHFA 5EMJB 4FAND 4PBYA 3JZHA 2AH1A 3K27A 3MKSB 2HJBA 3VI3A 4ERZA 2IAAA 2CN2A 4E5ZA 4BH6A 2IWKA 5HE0B 4A11A 5GSAA 3SN6B 2AQ5A 2VDQA 4X61B 3IIYA 3J80g 5EMMB 2HU8A 4X60B 3RSEC 1MDAH 5CYKA 4J0XA 4O9DA 1FWXA 5K1CC 3OKYB 4AMYA 4FA1D 3IJ1A 3UR4A 5EMKB 3SJLD 3O4HA 4D6VA 3IUNA 5A2Qg 4IRZA 2XYIA 3NVNA 3RMZD 3GREA 3QI0A 2J57G 4GZ8A 3UKRC 2EBSA 3JPXA 3NVQA 4EWRA 1YFQA 2OIZA 3EI4A 3N0EA 5AFU3 4U7AA 4BCBA 3JB9L 4BCDA 3I8CA 3E0CA 2GC7A 2P9KC 1L5GA 5B4WA 3BWSA 4JD2C 3P4FA 2I0SA 4JT6C 1UOPA 2HYEA 4MMXA 3I8EA 2CE9A 2OK4A 2CN3A 4J8GA 5EMLB 3QHYB 4CY1A 4J87A 3EI1A 2I0RA 4AMZA 4BUJC 4D0KA 1VYHC 1XKSA 3FGBA 3IJCA 4YVDA 3MUNA 3DM0A 4JHNA 3JZNA 3MKQA 4QRJA 4LG8A 1TYQC 5E6RA 5EAMA 4J73A 3EI2B 4AN1A 3JROA 4CY2A 2B5MA 1QNIA 2Z2PA 1XIPA 4JXMA 4AN0A 4X3EA 2VDRA 4UI9R 2QR5A 4FAVD 2H13A 3MUOA 4OWRA 4O1QD 3GD1I 4CZXA 1H2YA 2BKLA 2PM7B 2HKRA 3KRXB 1UTCA 1JMZB 3OW8A 4O3UB 4GM9A 4PNKB 3IIWA 3PVWB 4JSVC 5E6UA 2XL3A 4O45A 4LG9A 1S4UX 3I7KA 3C99A 5I5MA 5EAPA 2W18A 1BPOA 3RFGA 4A2LA 1I2MB 4ZN4A 3FCSA 4XYHA 4Z8LA 4A09B 2WQ8A 3ZDYA 4NENA 4L3GD 3PXTD 4D9SA 1H2XA 4JT5C 5I5IA 3UVOA 2XU7A 3NIFA 4WK2A 1C9IA 2HU7A 3OKWA 1GG2B 2AGWA 3RFHA 3NVXA 3MVDK 2AGZA 3T3PA 3IJEA 2HESX 1PEVA 3EI3B 2XE4A 1VZ3A 4AOWA 4A08B 4PBZA 2OJYA 4WK4A 4PSWB 3RRMC 1K32A 2GC4A 4NBMA 2BCJB 3C5MA 4J8BA 2PM9A 4MK0B 4RE5A 2MTAH 1NEXB 4ES0A 5C2WB 1C9LA 2YNOA 3EMHA 3FCUA 4MMZA 3RN0D 1VZ2A 2VDKA 1PI6A 2HU5A 2VDLA 1T2XA 3A0FA 4PC0A 4ERYA 3U4YA 3ODTA 1U4CA 3BG1A 4H5JA 3CIKB 4Y7RA 3JZGA 4E54A 3IUMA 1ERJA 5C2VB 3DSMA 4GQBB 2EIEA 2P9SC 3EU7A 4BL0A 3V7DB 2VDNA 2YBAA 3DDUA 3MMYA 3SVWD 4ESGA 1PGUA 2VC2A 3SBPA 4MMYA 3I7HA 3K71A 2P9IC 4FHLA 4JSPC 1O6GA 3F3FA 3OKYA 5EM2A 2IUQA 4A0AB 1JMXB 2XL2A 4CI8A 5CXCB 2AGYA 3RN1D 5SXMA 5CXBB 3UVLA 2VDPA 4WK0A 5AJAA 4G1MA 3EQ7A 4H5IA 4J82A 2OK6A 3UKUC 4J81A 2YNPA 2IWFA 3I7LA 4PSXB 5M5TA 3OKTA 3JAMg 3PSLA 3K6SA 5THAA 1OMWB 2I0TA 4Z7NA 3OL2B 2UZXB 3NIGA 1SQJA 2CNXA 3FM0A 4J84A 2VZ1A 3KCIA 3IURA 1K8KC 1SQ9A 3ULEC 3ZE2A 5FKTA 1QFSA 2GNQA 1SHYB 5EALA 4NAAA 4ZOXA 5TEEA 4BP9A 2H3XA 5EARA 2YMUA 4L1QD 5FLXg 3EI2A 3F3PA 3JRPA 5IGQA 4CZYA 4CI2A 3SCYA 1JTDB 2OVQB 4FWWA 1N6FA 1JV2A 2I3TA 2HJ4A 4KFMB 3AL8B 5C9ZB 1GOGA 2H6QA 5HE3B 2TRCB 4AEZA 5HYNB 4LGNA 5FQDA 3AFCA 4FA4D 4RE6A 5IGOA 3I7NA 4XYIA 5GMKn 2Q7QA 4K3ID 4TZ4A 1YR2A 4FA9D 1PBYB 2YNNA 3FRXA 3RLMD 4OZUA 2CE8A 4NSXA 2Z2NA 4PXWA 1GOHA 4CI3A 4J78A 5HDBA 3GC3B 5FKQA 1O6FA 3IVMA 3VI4A 5HE1B 4A09A 2IUVA 4GM8A 2P9PC 3GFCA 5KDOB 2VDMA 3V5WB 2H9LA 4FA5D 3EQ9A 4J86A 4GMBA 4L1MA 3IJ0A 2H9NA 3SLED 3IUJA 5GXHA 2O9KA 4Z7OA 2G99A 3EI3A 1MG3A 3I7OA 3O4GA 3I89A 2EIDA 4A08A 3IULA 2HKMA 4ZOYA 3L4OD 4J77A 5IC7A 4E5ZB 1JOFA 3PXWD 5K19A 3EG6A 4A11B 4IA9A 4GGDA 4Y5RD 3J81g 3ORVD 4U1EI 5FKRA 4A0BA 4CI1A 5IJ8E 5HQGA 5CYKB 4E54B 2P9NC 1A12A 1GOTB 3V4PA 3T3MA 4GGAA 3PSCB 2H9PA 2B5NA 2AGXA 1GP2B 5M5UA 5C86A 3O4JA 4J0WA 1E8NA 2H9MA 4WJKA 1E5TA 3EI4B 2CO0A 3UVMA 2J55H 4GQ1A 3VH0A 5EM2B 4ERQA 2VZ3A 3K26A 4L3HD 1NR0A 3SMRA 1RI6A 1E8MA 1H2ZA 2QXVA 5IJ7E 2JKXA 2PM6B 1OLZA 2QZPA 1QFMA 2H14A 3MZLA 1GOFA 3HFQA 2H47A 5IT9g 3EI1B 4O2WA 5C92A 4CY3A 2YB8B 4IMMA 4A0AA 5HE2B 2XDWA 5CXCA 3SXTD 5FXYA 5CXBA 4I79A 3DXMC 1UOOA 4ZOZA 5FKSA 4HDJA 3UVNA 4JSNC 3UVKA 1R5MA 1TBGA 3AH8B 1XHMA 3I2NA 2B4EA 2CO0C 2PBIB 3SWSD 5JWZA 3ZWLB 3OTTA 5E6SA 2HXCA 2UZYB 5AMSA 4GQ2P 4GM3A 1JJUB 4NC4A 2H6NA 5M5VA 5H17A 2I3SA 4QQEA 5FFOA 3W15A 5H14A 3OL2A 4JSXC 2QC5A 2XZGA 3V4VA 1VE6A 3EWEA 3OF7A 2Z2OA 5TEFA 5GXIA 2AGLA 4O3TB 4BP8A 5FA5B 5FFGA 3AL9A 2EIBA 4X63B 1UOQA 4G1EA 5TF2A 3C75H 1VE7A 3SBQA 3IKOA 1U8CA 3MXXA 2EICA 3F3GA 5TDHB 3PXSD 1B9XA 2AH0A 3BG0A 1U2VC 4N14A 2VDOA 3AL8A 1B9YA 1H2WA 4G56B 3SBRA 4CC9A 4Z7QA 3L4MD 1GXRA 4UM8A 4ZOVA 2J56H 4A2MA
chains in the Genus database with same CATH topology
1L0QA 2H6KA 2BBKH 4GGCA 4FB1D 1N6DA 2IUPA 3MZKA 3DXKC 4QL1A 3N0DA 3VGZA 2IURA 3PE7A 3SFZA 3I7PA 2P9LC 4L9OA 3CFVA 4K3JB 1A0RB 2PM9B 3CFSB 3KRWB 2OVPB 4CY5A 4CZVA 3DWLC 3V9FA 2B5LA 4QT8A 3VA6A 1P22A 1Q47A 3PVUB 4FA9D 1MG2A 5I5JA 3C9CA 3B7FA 1N6EA 4R7AB 2H68A 2P9UC 2OVRB 5H1MA 2G9AA 4XEIC 4A0BB 4J79A 4A7JA 3SHFA 5EMJB 4FAND 4PBYA 3JZHA 2AH1A 3K27A 3MKSB 2HJBA 4ERZA 2IAAA 2CN2A 4E5ZA 4BH6A 2IWKA 5HE0B 4A11A 5GSAA 3SN6B 2AQ5A 4X61B 3IIYA 3J80g 5EMMB 3RSEC 4X60B 1MDAH 5CYKA 4J0XA 4O9DA 1FWXA 5K1CC 3OKYB 4FA1D 3IJ1A 3UR4A 5EMKB 3SJLD 4D6VA 5A2Qg 2XYIA 3NVNA 3RMZD 3GREA 2J57G 4GZ8A 3UKRC 2EBSA 3JPXA 3NVQA 4EWRA 1YFQA 2OIZA 3EI4A 3N0EA 5AFU3 4U7AA 3JB9L 3I8CA 3E0CA 2GC7A 2P9KC 5B4WA 3BWSA 4JD2C 3P4FA 2I0SA 4JT6C 2HYEA 3I8EA 2CE9A 2OK4A 2CN3A 4J8GA 5EMLB 4CY1A 4J87A 3EI1A 2I0RA 4BUJC 4D0KA 1VYHC 1XKSA 3FGBA 3IJCA 4YVDA 3DM0A 3JZNA 3MKQA 4QRJA 4LG8A 1TYQC 5EAMA 4J73A 3EI2B 3JROA 4CY2A 2B5MA 1QNIA 2Z2PA 1XIPA 4JXMA 4X3EA 4UI9R 4FAVD 2H13A 4OWRA 4O1QD 4CZXA 2PM7B 2HKRA 3KRXB 1JMZB 3OW8A 4O3UB 4GM9A 4PNKB 3IIWA 3PVWB 4JSVC 2XL3A 4O45A 4LG9A 1S4UX 3I7KA 3C99A 5I5MA 5EAPA 2W18A 3RFGA 4A2LA 4ZN4A 4XYHA 4Z8LA 4A09B 4L3GD 3PXTD 4JT5C 5I5IA 3UVOA 2XU7A 3OKWA 1GG2B 2AGWA 3RFHA 3NVXA 2AGZA 2HESX 1PEVA 3EI3B 4AOWA 4A08B 4PBZA 2OJYA 4PSWB 3RRMC 1K32A 2GC4A 2BCJB 3C5MA 4J8BA 2PM9A 4MK0B 2MTAH 1NEXB 4ES0A 5C2WB 2YNOA 3EMHA 3RN0D 1PI6A 3A0FA 4PC0A 4ERYA 3U4YA 3ODTA 1U4CA 3BG1A 4H5JA 3CIKB 4Y7RA 3JZGA 4E54A 1ERJA 5C2VB 3DSMA 4GQBB 2P9SC 3EU7A 4BL0A 3V7DB 2YBAA 3MMYA 3SVWD 4ESGA 1PGUA 3SBPA 3I7HA 2P9IC 4FHLA 4JSPC 3F3FA 3OKYA 5EM2A 2IUQA 4A0AB 1JMXB 2XL2A 4CI8A 5CXCB 2AGYA 3RN1D 5SXMA 5CXBB 3UVLA 5AJAA 4H5IA 4J82A 2OK6A 3UKUC 4J81A 2YNPA 2IWFA 3I7LA 4PSXB 3OKTA 3JAMg 3PSLA 5THAA 1OMWB 2I0TA 3OL2B 2UZXB 1SQJA 2CNXA 3FM0A 4J84A 1K8KC 1SQ9A 3ULEC 5FKTA 2GNQA 1SHYB 5EALA 4ZOXA 5TEEA 2H3XA 5EARA 2YMUA 4L1QD 5FLXg 3EI2A 3F3PA 3JRPA 5IGQA 4CZYA 4CI2A 3SCYA 2OVQB 4FWWA 1N6FA 2HJ4A 2I3TA 4KFMB 3AL8B 5C9ZB 2H6QA 5HE3B 2TRCB 4AEZA 5HYNB 4LGNA 5FQDA 3AFCA 4FA4D 5IGOA 3I7NA 4XYIA 5GMKn 2Q7QA 4K3ID 4TZ4A 1PBYB 2YNNA 3FRXA 3RLMD 4OZUA 2CE8A 4NSXA 2Z2NA 4PXWA 4CI3A 4J78A 5FKQA 5HE1B 4A09A 2IUVA 4GM8A 2P9PC 3GFCA 5KDOB 3V5WB 2H9LA 4FA5D 4J86A 4GMBA 3IJ0A 2H9NA 3SLED 5GXHA 2O9KA 2G99A 3EI3A 1MG3A 3I7OA 3I89A 4A08A 2HKMA 4ZOYA 3L4OD 4J77A 5IC7A 4E5ZB 3PXWD 1JOFA 5K19A 3EG6A 4A11B 4IA9A 4GGDA 4Y5RD 3J81g 3ORVD 4U1EI 5FKRA 4A0BA 4CI1A 5IJ8E 5HQGA 5CYKB 4E54B 2P9NC 1GOTB 4GGAA 3PSCB 2H9PA 2B5NA 2AGXA 1GP2B 4J0WA 2H9MA 3EI4B 2CO0A 3UVMA 2J55H 4GQ1A 3VH0A 5EM2B 4ERQA 3K26A 4L3HD 1NR0A 3SMRA 1RI6A 2QXVA 5IJ7E 2PM6B 1OLZA 2H14A 3MZLA 3HFQA 5IT9g 2H47A 3EI1B 4CY3A 2YB8B 4IMMA 4A0AA 5HE2B 5CXCA 3SXTD 5FXYA 5CXBA 4I79A 3DXMC 4ZOZA 5FKSA 4HDJA 3UVNA 4JSNC 3UVKA 1R5MA 1TBGA 3AH8B 1XHMA 3I2NA 2B4EA 2CO0C 2PBIB 3SWSD 5JWZA 3ZWLB 3OTTA 2HXCA 2UZYB 5AMSA 4GQ2P 4GM3A 1JJUB 2H6NA 5H17A 2I3SA 4QQEA 3W15A 5H14A 3OL2A 4JSXC 2QC5A 3EWEA 2Z2OA 5TEFA 5GXIA 2AGLA 4O3TB 5FA5B 3AL9A 4X63B 5TF2A 3C75H 3SBQA 3IKOA 3MXXA 3F3GA 5TDHB 3PXSD 1B9XA 2AH0A 3BG0A 1U2VC 4N14A 3AL8A 1B9YA 4G56B 3SBRA 4CC9A 3L4MD 1GXRA 4ZOVA 2J56H 4A2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0Q A;  2H6K A;  2BBK H;  4GGC A;  4FB1 D;  1N6D A;  2IUP A;  3MZK A;  3DXK C;  4QL1 A;  3N0D A;  3VGZ A;  2IUR A;  3PE7 A;  3SFZ A;  3I7P A;  2P9L C;  4L9O A;  3CFV A;  4K3J B;  1A0R B;  2PM9 B;  3CFS B;  3KRW B;  2OVP B;  4CY5 A;  4CZV A;  3DWL C;  3V9F A;  2B5L A;  4QT8 A;  3VA6 A;  1P22 A;  1Q47 A;  3PVU B;  4FA9 D;  1MG2 A;  5I5J A;  3C9C A;  3B7F A;  1N6E A;  4R7A B;  2H68 A;  2P9U C;  2OVR B;  5H1M A;  2G9A A;  4XEI C;  4A0B B;  4J79 A;  4A7J A;  3SHF A;  5EMJ B;  4FAN D;  4PBY A;  3JZH A;  2AH1 A;  3K27 A;  3MKS B;  2HJB A;  4ERZ A;  2IAA A;  2CN2 A;  4E5Z A;  4BH6 A;  2IWK A;  5HE0 B;  4A11 A;  5GSA A;  3SN6 B;  2AQ5 A;  4X61 B;  3IIY A;  3J80 g;  5EMM B;  3RSE C;  4X60 B;  1MDA H;  5CYK A;  4J0X A;  4O9D A;  1FWX A;  5K1C C;  3OKY B;  4FA1 D;  3IJ1 A;  3UR4 A;  5EMK B;  3SJL D;  4D6V A;  5A2Q g;  2XYI A;  3NVN A;  3RMZ D;  3GRE A;  2J57 G;  4GZ8 A;  3UKR C;  2EBS A;  3JPX A;  3NVQ A;  4EWR A;  1YFQ A;  2OIZ A;  3EI4 A;  3N0E A;  5AFU 3;  4U7A A;  3JB9 L;  3I8C A;  3E0C A;  2GC7 A;  2P9K C;  5B4W A;  3BWS A;  4JD2 C;  3P4F A;  2I0S A;  4JT6 C;  2HYE A;  3I8E A;  2CE9 A;  2OK4 A;  2CN3 A;  4J8G A;  5EML B;  4CY1 A;  4J87 A;  3EI1 A;  2I0R A;  4BUJ C;  4D0K A;  1VYH C;  1XKS A;  3FGB A;  3IJC A;  4YVD A;  3DM0 A;  3JZN A;  3MKQ A;  4QRJ A;  4LG8 A;  1TYQ C;  5EAM A;  4J73 A;  3EI2 B;  3JRO A;  4CY2 A;  2B5M A;  1QNI A;  2Z2P A;  1XIP A;  4JXM A;  4X3E A;  4UI9 R;  4FAV D;  2H13 A;  4OWR A;  4O1Q D;  4CZX A;  2PM7 B;  2HKR A;  3KRX B;  1JMZ B;  3OW8 A;  4O3U B;  4GM9 A;  4PNK B;  3IIW A;  3PVW B;  4JSV C;  2XL3 A;  4O45 A;  4LG9 A;  1S4U X;  3I7K A;  3C99 A;  5I5M A;  5EAP A;  2W18 A;  3RFG A;  4A2L A;  4ZN4 A;  4XYH A;  4Z8L A;  4A09 B;  4L3G D;  3PXT D;  4JT5 C;  5I5I A;  3UVO A;  2XU7 A;  3OKW A;  1GG2 B;  2AGW A;  3RFH A;  3NVX A;  2AGZ A;  2HES X;  1PEV A;  3EI3 B;  4AOW A;  4A08 B;  4PBZ A;  2OJY A;  4PSW B;  3RRM C;  1K32 A;  2GC4 A;  2BCJ B;  3C5M A;  4J8B A;  2PM9 A;  4MK0 B;  2MTA H;  1NEX B;  4ES0 A;  5C2W B;  2YNO A;  3EMH A;  3RN0 D;  1PI6 A;  3A0F A;  4PC0 A;  4ERY A;  3U4Y A;  3ODT A;  1U4C A;  3BG1 A;  4H5J A;  3CIK B;  4Y7R A;  3JZG A;  4E54 A;  1ERJ A;  5C2V B;  3DSM A;  4GQB B;  2P9S C;  3EU7 A;  4BL0 A;  3V7D B;  2YBA A;  3MMY A;  3SVW D;  4ESG A;  1PGU A;  3SBP A;  3I7H A;  2P9I C;  4FHL A;  4JSP C;  3F3F A;  3OKY A;  5EM2 A;  2IUQ A;  4A0A B;  1JMX B;  2XL2 A;  4CI8 A;  5CXC B;  2AGY A;  3RN1 D;  5SXM A;  5CXB B;  3UVL A;  5AJA A;  4H5I A;  4J82 A;  2OK6 A;  3UKU C;  4J81 A;  2YNP A;  2IWF A;  3I7L A;  4PSX B;  3OKT A;  3JAM g;  3PSL A;  5THA A;  1OMW B;  2I0T A;  3OL2 B;  2UZX B;  1SQJ A;  2CNX A;  3FM0 A;  4J84 A;  1K8K C;  1SQ9 A;  3ULE C;  5FKT A;  2GNQ A;  1SHY B;  5EAL A;  4ZOX A;  5TEE A;  2H3X A;  5EAR A;  2YMU A;  4L1Q D;  5FLX g;  3EI2 A;  3F3P A;  3JRP A;  5IGQ A;  4CZY A;  4CI2 A;  3SCY A;  2OVQ B;  4FWW A;  1N6F A;  2HJ4 A;  2I3T A;  4KFM B;  3AL8 B;  5C9Z B;  2H6Q A;  5HE3 B;  2TRC B;  4AEZ A;  5HYN B;  4LGN A;  5FQD A;  3AFC A;  4FA4 D;  5IGO A;  3I7N A;  4XYI A;  5GMK n;  2Q7Q A;  4K3I D;  4TZ4 A;  1PBY B;  2YNN A;  3FRX A;  3RLM D;  4OZU A;  2CE8 A;  4NSX A;  2Z2N A;  4PXW A;  4CI3 A;  4J78 A;  5FKQ A;  5HE1 B;  4A09 A;  2IUV A;  4GM8 A;  2P9P C;  3GFC A;  5KDO B;  3V5W B;  2H9L A;  4FA5 D;  4J86 A;  4GMB A;  3IJ0 A;  2H9N A;  3SLE D;  5GXH A;  2O9K A;  2G99 A;  3EI3 A;  1MG3 A;  3I7O A;  3I89 A;  4A08 A;  2HKM A;  4ZOY A;  3L4O D;  4J77 A;  5IC7 A;  4E5Z B;  3PXW D;  1JOF A;  5K19 A;  3EG6 A;  4A11 B;  4IA9 A;  4GGD A;  4Y5R D;  3J81 g;  3ORV D;  4U1E I;  5FKR A;  4A0B A;  4CI1 A;  5IJ8 E;  5HQG A;  5CYK B;  4E54 B;  2P9N C;  1GOT B;  4GGA A;  3PSC B;  2H9P A;  2B5N A;  2AGX A;  1GP2 B;  4J0W A;  2H9M A;  3EI4 B;  2CO0 A;  3UVM A;  2J55 H;  4GQ1 A;  3VH0 A;  5EM2 B;  4ERQ A;  3K26 A;  4L3H D;  1NR0 A;  3SMR A;  1RI6 A;  2QXV A;  5IJ7 E;  2PM6 B;  1OLZ A;  2H14 A;  3MZL A;  3HFQ A;  5IT9 g;  2H47 A;  3EI1 B;  4CY3 A;  2YB8 B;  4IMM A;  4A0A A;  5HE2 B;  5CXC A;  3SXT D;  5FXY A;  5CXB A;  4I79 A;  3DXM C;  4ZOZ A;  5FKS A;  4HDJ A;  3UVN A;  4JSN C;  3UVK A;  1R5M A;  1TBG A;  3AH8 B;  1XHM A;  3I2N A;  2B4E A;  2CO0 C;  2PBI B;  3SWS D;  5JWZ A;  3ZWL B;  3OTT A;  2HXC A;  2UZY B;  5AMS A;  4GQ2 P;  4GM3 A;  1JJU B;  2H6N A;  5H17 A;  2I3S A;  4QQE A;  3W15 A;  5H14 A;  3OL2 A;  4JSX C;  2QC5 A;  3EWE A;  2Z2O A;  5TEF A;  5GXI A;  2AGL A;  4O3T B;  5FA5 B;  3AL9 A;  4X63 B;  5TF2 A;  3C75 H;  3SBQ A;  3IKO A;  3MXX A;  3F3G A;  5TDH B;  3PXS D;  1B9X A;  2AH0 A;  3BG0 A;  1U2V C;  4N14 A;  3AL8 A;  1B9Y A;  4G56 B;  3SBR A;  4CC9 A;  3L4M D;  1GXR A;  4ZOV A;  2J56 H;  4A2M A; 
#chains in the Genus database with same CATH topology
 1L0Q A;  2H6K A;  2BBK H;  4GGC A;  4FB1 D;  1N6D A;  5M5S A;  2IUP A;  3MZK A;  3DXK C;  4QL1 A;  3N0D A;  3VGZ A;  2IUR A;  3ZE0 A;  3PE7 A;  4AX4 A;  3SFZ A;  1K3I A;  3O4I A;  3I7P A;  5M5R A;  2P9L C;  4QAM A;  4L9O A;  3CFV A;  4K3J B;  1A0R B;  2PM9 B;  4BCC A;  3CFS B;  3KRW B;  2OVP B;  4CY5 A;  3NID A;  4CZV A;  3DWL C;  3V9F A;  3ZDX A;  3EQ8 A;  2B5L A;  4QT8 A;  3VA6 A;  1P22 A;  1Q47 A;  3PVU B;  3ZE1 A;  1MG2 A;  5I5J A;  4DNU A;  3C9C A;  4UM9 A;  3B7F A;  3IUQ A;  4G55 A;  1N6E A;  4R7A B;  3K72 A;  2H68 A;  2P9U C;  3ZDZ A;  4JHP C;  4DNW A;  2OVR B;  1TYE A;  5H1M A;  5M61 A;  2G9A A;  4XEI C;  4O02 A;  4A0B B;  4J79 A;  4DNV A;  4A7J A;  1M1X A;  3SHF A;  5EMJ B;  4FAN D;  4PBY A;  3JZH A;  2AH1 A;  3K27 A;  3MKS B;  2HJB A;  3VI3 A;  4ERZ A;  2IAA A;  2CN2 A;  4E5Z A;  4BH6 A;  2IWK A;  5HE0 B;  4A11 A;  5GSA A;  3SN6 B;  2AQ5 A;  2VDQ A;  4X61 B;  3IIY A;  3J80 g;  5EMM B;  2HU8 A;  4X60 B;  3RSE C;  1MDA H;  5CYK A;  4J0X A;  4O9D A;  1FWX A;  5K1C C;  3OKY B;  4AMY A;  4FA1 D;  3IJ1 A;  3UR4 A;  5EMK B;  3SJL D;  3O4H A;  4D6V A;  3IUN A;  5A2Q g;  4IRZ A;  2XYI A;  3NVN A;  3RMZ D;  3GRE A;  3QI0 A;  2J57 G;  4GZ8 A;  3UKR C;  2EBS A;  3JPX A;  3NVQ A;  4EWR A;  1YFQ A;  2OIZ A;  3EI4 A;  3N0E A;  5AFU 3;  4U7A A;  4BCB A;  3JB9 L;  4BCD A;  3I8C A;  3E0C A;  2GC7 A;  2P9K C;  1L5G A;  5B4W A;  3BWS A;  4JD2 C;  3P4F A;  2I0S A;  4JT6 C;  1UOP A;  2HYE A;  4MMX A;  3I8E A;  2CE9 A;  2OK4 A;  2CN3 A;  4J8G A;  5EML B;  3QHY B;  4CY1 A;  4J87 A;  3EI1 A;  2I0R A;  4AMZ A;  4BUJ C;  4D0K A;  1VYH C;  1XKS A;  3FGB A;  3IJC A;  4YVD A;  3MUN A;  3DM0 A;  4JHN A;  3JZN A;  3MKQ A;  4QRJ A;  4LG8 A;  1TYQ C;  5E6R A;  5EAM A;  4J73 A;  3EI2 B;  4AN1 A;  3JRO A;  4CY2 A;  2B5M A;  1QNI A;  2Z2P A;  1XIP A;  4JXM A;  4AN0 A;  4X3E A;  2VDR A;  4UI9 R;  2QR5 A;  4FAV D;  2H13 A;  3MUO A;  4OWR A;  4O1Q D;  3GD1 I;  4CZX A;  1H2Y A;  2BKL A;  2PM7 B;  2HKR A;  3KRX B;  1UTC A;  1JMZ B;  3OW8 A;  4O3U B;  4GM9 A;  4PNK B;  3IIW A;  3PVW B;  4JSV C;  5E6U A;  2XL3 A;  4O45 A;  4LG9 A;  1S4U X;  3I7K A;  3C99 A;  5I5M A;  5EAP A;  2W18 A;  1BPO A;  3RFG A;  4A2L A;  1I2M B;  4ZN4 A;  3FCS A;  4XYH A;  4Z8L A;  4A09 B;  2WQ8 A;  3ZDY A;  4NEN A;  4L3G D;  3PXT D;  4D9S A;  1H2X A;  4JT5 C;  5I5I A;  3UVO A;  2XU7 A;  3NIF A;  4WK2 A;  1C9I A;  2HU7 A;  3OKW A;  1GG2 B;  2AGW A;  3RFH A;  3NVX A;  3MVD K;  2AGZ A;  3T3P A;  3IJE A;  2HES X;  1PEV A;  3EI3 B;  2XE4 A;  1VZ3 A;  4AOW A;  4A08 B;  4PBZ A;  2OJY A;  4WK4 A;  4PSW B;  3RRM C;  1K32 A;  2GC4 A;  4NBM A;  2BCJ B;  3C5M A;  4J8B A;  2PM9 A;  4MK0 B;  4RE5 A;  2MTA H;  1NEX B;  4ES0 A;  5C2W B;  1C9L A;  2YNO A;  3EMH A;  3FCU A;  4MMZ A;  3RN0 D;  1VZ2 A;  2VDK A;  1PI6 A;  2HU5 A;  2VDL A;  1T2X A;  3A0F A;  4PC0 A;  4ERY A;  3U4Y A;  3ODT A;  1U4C A;  3BG1 A;  4H5J A;  3CIK B;  4Y7R A;  3JZG A;  4E54 A;  3IUM A;  1ERJ A;  5C2V B;  3DSM A;  4GQB B;  2EIE A;  2P9S C;  3EU7 A;  4BL0 A;  3V7D B;  2VDN A;  2YBA A;  3DDU A;  3MMY A;  3SVW D;  4ESG A;  1PGU A;  2VC2 A;  3SBP A;  4MMY A;  3I7H A;  3K71 A;  2P9I C;  4FHL A;  4JSP C;  1O6G A;  3F3F A;  3OKY A;  5EM2 A;  2IUQ A;  4A0A B;  1JMX B;  2XL2 A;  4CI8 A;  5CXC B;  2AGY A;  3RN1 D;  5SXM A;  5CXB B;  3UVL A;  2VDP A;  4WK0 A;  5AJA A;  4G1M A;  3EQ7 A;  4H5I A;  4J82 A;  2OK6 A;  3UKU C;  4J81 A;  2YNP A;  2IWF A;  3I7L A;  4PSX B;  5M5T A;  3OKT A;  3JAM g;  3PSL A;  3K6S A;  5THA A;  1OMW B;  2I0T A;  4Z7N A;  3OL2 B;  2UZX B;  3NIG A;  1SQJ A;  2CNX A;  3FM0 A;  4J84 A;  2VZ1 A;  3KCI A;  3IUR A;  1K8K C;  1SQ9 A;  3ULE C;  3ZE2 A;  5FKT A;  1QFS A;  2GNQ A;  1SHY B;  5EAL A;  4NAA A;  4ZOX A;  5TEE A;  4BP9 A;  2H3X A;  5EAR A;  2YMU A;  4L1Q D;  5FLX g;  3EI2 A;  3F3P A;  3JRP A;  5IGQ A;  4CZY A;  4CI2 A;  3SCY A;  1JTD B;  2OVQ B;  4FWW A;  1N6F A;  1JV2 A;  2I3T A;  2HJ4 A;  4KFM B;  3AL8 B;  5C9Z B;  1GOG A;  2H6Q A;  5HE3 B;  2TRC B;  4AEZ A;  5HYN B;  4LGN A;  5FQD A;  3AFC A;  4FA4 D;  4RE6 A;  5IGO A;  3I7N A;  4XYI A;  5GMK n;  2Q7Q A;  4K3I D;  4TZ4 A;  1YR2 A;  4FA9 D;  1PBY B;  2YNN A;  3FRX A;  3RLM D;  4OZU A;  2CE8 A;  4NSX A;  2Z2N A;  4PXW A;  1GOH A;  4CI3 A;  4J78 A;  5HDB A;  3GC3 B;  5FKQ A;  1O6F A;  3IVM A;  3VI4 A;  5HE1 B;  4A09 A;  2IUV A;  4GM8 A;  2P9P C;  3GFC A;  5KDO B;  2VDM A;  3V5W B;  2H9L A;  4FA5 D;  3EQ9 A;  4J86 A;  4GMB A;  4L1M A;  3IJ0 A;  2H9N A;  3SLE D;  3IUJ A;  5GXH A;  2O9K A;  4Z7O A;  2G99 A;  3EI3 A;  1MG3 A;  3I7O A;  3O4G A;  3I89 A;  2EID A;  4A08 A;  3IUL A;  2HKM A;  4ZOY A;  3L4O D;  4J77 A;  5IC7 A;  4E5Z B;  1JOF A;  3PXW D;  5K19 A;  3EG6 A;  4A11 B;  4IA9 A;  4GGD A;  4Y5R D;  3J81 g;  3ORV D;  4U1E I;  5FKR A;  4A0B A;  4CI1 A;  5IJ8 E;  5HQG A;  5CYK B;  4E54 B;  2P9N C;  1A12 A;  1GOT B;  3V4P A;  3T3M A;  4GGA A;  3PSC B;  2H9P A;  2B5N A;  2AGX A;  1GP2 B;  5M5U A;  5C86 A;  3O4J A;  4J0W A;  1E8N A;  2H9M A;  4WJK A;  1E5T A;  3EI4 B;  2CO0 A;  3UVM A;  2J55 H;  4GQ1 A;  3VH0 A;  5EM2 B;  4ERQ A;  2VZ3 A;  3K26 A;  4L3H D;  1NR0 A;  3SMR A;  1RI6 A;  1E8M A;  1H2Z A;  2QXV A;  5IJ7 E;  2JKX A;  2PM6 B;  1OLZ A;  2QZP A;  1QFM A;  2H14 A;  3MZL A;  1GOF A;  3HFQ A;  2H47 A;  5IT9 g;  3EI1 B;  4O2W A;  5C92 A;  4CY3 A;  2YB8 B;  4IMM A;  4A0A A;  5HE2 B;  2XDW A;  5CXC A;  3SXT D;  5FXY A;  5CXB A;  4I79 A;  3DXM C;  1UOO A;  4ZOZ A;  5FKS A;  4HDJ A;  3UVN A;  4JSN C;  3UVK A;  1R5M A;  1TBG A;  3AH8 B;  1XHM A;  3I2N A;  2B4E A;  2CO0 C;  2PBI B;  3SWS D;  5JWZ A;  3ZWL B;  3OTT A;  5E6S A;  2HXC A;  2UZY B;  5AMS A;  4GQ2 P;  4GM3 A;  1JJU B;  4NC4 A;  2H6N A;  5M5V A;  5H17 A;  2I3S A;  4QQE A;  5FFO A;  3W15 A;  5H14 A;  3OL2 A;  4JSX C;  2QC5 A;  2XZG A;  3V4V A;  1VE6 A;  3EWE A;  3OF7 A;  2Z2O A;  5TEF A;  5GXI A;  2AGL A;  4O3T B;  4BP8 A;  5FA5 B;  5FFG A;  3AL9 A;  2EIB A;  4X63 B;  1UOQ A;  4G1E A;  5TF2 A;  3C75 H;  1VE7 A;  3SBQ A;  3IKO A;  1U8C A;  3MXX A;  2EIC A;  3F3G A;  5TDH B;  3PXS D;  1B9X A;  2AH0 A;  3BG0 A;  1U2V C;  4N14 A;  2VDO A;  3AL8 A;  1B9Y A;  1H2W A;  4G56 B;  3SBR A;  4CC9 A;  4Z7Q A;  3L4M D;  1GXR A;  4UM8 A;  4ZOV A;  2J56 H;  4A2M A; 
#chains in the Genus database with same CATH homology
 1L0Q A;  2H6K A;  2BBK H;  4GGC A;  4FB1 D;  1N6D A;  2IUP A;  3MZK A;  3DXK C;  4QL1 A;  3N0D A;  3VGZ A;  2IUR A;  3PE7 A;  3SFZ A;  3I7P A;  2P9L C;  4L9O A;  3CFV A;  4K3J B;  1A0R B;  2PM9 B;  3CFS B;  3KRW B;  2OVP B;  4CY5 A;  4CZV A;  3DWL C;  3V9F A;  2B5L A;  4QT8 A;  3VA6 A;  1P22 A;  1Q47 A;  3PVU B;  4FA9 D;  1MG2 A;  5I5J A;  3C9C A;  3B7F A;  1N6E A;  4R7A B;  2H68 A;  2P9U C;  2OVR B;  5H1M A;  2G9A A;  4XEI C;  4A0B B;  4J79 A;  4A7J A;  3SHF A;  5EMJ B;  4FAN D;  4PBY A;  3JZH A;  2AH1 A;  3K27 A;  3MKS B;  2HJB A;  4ERZ A;  2IAA A;  2CN2 A;  4E5Z A;  4BH6 A;  2IWK A;  5HE0 B;  4A11 A;  5GSA A;  3SN6 B;  2AQ5 A;  4X61 B;  3IIY A;  3J80 g;  5EMM B;  3RSE C;  4X60 B;  1MDA H;  5CYK A;  4J0X A;  4O9D A;  1FWX A;  5K1C C;  3OKY B;  4FA1 D;  3IJ1 A;  3UR4 A;  5EMK B;  3SJL D;  4D6V A;  5A2Q g;  2XYI A;  3NVN A;  3RMZ D;  3GRE A;  2J57 G;  4GZ8 A;  3UKR C;  2EBS A;  3JPX A;  3NVQ A;  4EWR A;  1YFQ A;  2OIZ A;  3EI4 A;  3N0E A;  5AFU 3;  4U7A A;  3JB9 L;  3I8C A;  3E0C A;  2GC7 A;  2P9K C;  5B4W A;  3BWS A;  4JD2 C;  3P4F A;  2I0S A;  4JT6 C;  2HYE A;  3I8E A;  2CE9 A;  2OK4 A;  2CN3 A;  4J8G A;  5EML B;  4CY1 A;  4J87 A;  3EI1 A;  2I0R A;  4BUJ C;  4D0K A;  1VYH C;  1XKS A;  3FGB A;  3IJC A;  4YVD A;  3DM0 A;  3JZN A;  3MKQ A;  4QRJ A;  4LG8 A;  1TYQ C;  5EAM A;  4J73 A;  3EI2 B;  3JRO A;  4CY2 A;  2B5M A;  1QNI A;  2Z2P A;  1XIP A;  4JXM A;  4X3E A;  4UI9 R;  4FAV D;  2H13 A;  4OWR A;  4O1Q D;  4CZX A;  2PM7 B;  2HKR A;  3KRX B;  1JMZ B;  3OW8 A;  4O3U B;  4GM9 A;  4PNK B;  3IIW A;  3PVW B;  4JSV C;  2XL3 A;  4O45 A;  4LG9 A;  1S4U X;  3I7K A;  3C99 A;  5I5M A;  5EAP A;  2W18 A;  3RFG A;  4A2L A;  4ZN4 A;  4XYH A;  4Z8L A;  4A09 B;  4L3G D;  3PXT D;  4JT5 C;  5I5I A;  3UVO A;  2XU7 A;  3OKW A;  1GG2 B;  2AGW A;  3RFH A;  3NVX A;  2AGZ A;  2HES X;  1PEV A;  3EI3 B;  4AOW A;  4A08 B;  4PBZ A;  2OJY A;  4PSW B;  3RRM C;  1K32 A;  2GC4 A;  2BCJ B;  3C5M A;  4J8B A;  2PM9 A;  4MK0 B;  2MTA H;  1NEX B;  4ES0 A;  5C2W B;  2YNO A;  3EMH A;  3RN0 D;  1PI6 A;  3A0F A;  4PC0 A;  4ERY A;  3U4Y A;  3ODT A;  1U4C A;  3BG1 A;  4H5J A;  3CIK B;  4Y7R A;  3JZG A;  4E54 A;  1ERJ A;  5C2V B;  3DSM A;  4GQB B;  2P9S C;  3EU7 A;  4BL0 A;  3V7D B;  2YBA A;  3MMY A;  3SVW D;  4ESG A;  1PGU A;  3SBP A;  3I7H A;  2P9I C;  4FHL A;  4JSP C;  3F3F A;  3OKY A;  5EM2 A;  2IUQ A;  4A0A B;  1JMX B;  2XL2 A;  4CI8 A;  5CXC B;  2AGY A;  3RN1 D;  5SXM A;  5CXB B;  3UVL A;  5AJA A;  4H5I A;  4J82 A;  2OK6 A;  3UKU C;  4J81 A;  2YNP A;  2IWF A;  3I7L A;  4PSX B;  3OKT A;  3JAM g;  3PSL A;  5THA A;  1OMW B;  2I0T A;  3OL2 B;  2UZX B;  1SQJ A;  2CNX A;  3FM0 A;  4J84 A;  1K8K C;  1SQ9 A;  3ULE C;  5FKT A;  2GNQ A;  1SHY B;  5EAL A;  4ZOX A;  5TEE A;  2H3X A;  5EAR A;  2YMU A;  4L1Q D;  5FLX g;  3EI2 A;  3F3P A;  3JRP A;  5IGQ A;  4CZY A;  4CI2 A;  3SCY A;  2OVQ B;  4FWW A;  1N6F A;  2HJ4 A;  2I3T A;  4KFM B;  3AL8 B;  5C9Z B;  2H6Q A;  5HE3 B;  2TRC B;  4AEZ A;  5HYN B;  4LGN A;  5FQD A;  3AFC A;  4FA4 D;  5IGO A;  3I7N A;  4XYI A;  5GMK n;  2Q7Q A;  4K3I D;  4TZ4 A;  1PBY B;  2YNN A;  3FRX A;  3RLM D;  4OZU A;  2CE8 A;  4NSX A;  2Z2N A;  4PXW A;  4CI3 A;  4J78 A;  5FKQ A;  5HE1 B;  4A09 A;  2IUV A;  4GM8 A;  2P9P C;  3GFC A;  5KDO B;  3V5W B;  2H9L A;  4FA5 D;  4J86 A;  4GMB A;  3IJ0 A;  2H9N A;  3SLE D;  5GXH A;  2O9K A;  2G99 A;  3EI3 A;  1MG3 A;  3I7O A;  3I89 A;  4A08 A;  2HKM A;  4ZOY A;  3L4O D;  4J77 A;  5IC7 A;  4E5Z B;  3PXW D;  1JOF A;  5K19 A;  3EG6 A;  4A11 B;  4IA9 A;  4GGD A;  4Y5R D;  3J81 g;  3ORV D;  4U1E I;  5FKR A;  4A0B A;  4CI1 A;  5IJ8 E;  5HQG A;  5CYK B;  4E54 B;  2P9N C;  1GOT B;  4GGA A;  3PSC B;  2H9P A;  2B5N A;  2AGX A;  1GP2 B;  4J0W A;  2H9M A;  3EI4 B;  2CO0 A;  3UVM A;  2J55 H;  4GQ1 A;  3VH0 A;  5EM2 B;  4ERQ A;  3K26 A;  4L3H D;  1NR0 A;  3SMR A;  1RI6 A;  2QXV A;  5IJ7 E;  2PM6 B;  1OLZ A;  2H14 A;  3MZL A;  3HFQ A;  5IT9 g;  2H47 A;  3EI1 B;  4CY3 A;  2YB8 B;  4IMM A;  4A0A A;  5HE2 B;  5CXC A;  3SXT D;  5FXY A;  5CXB A;  4I79 A;  3DXM C;  4ZOZ A;  5FKS A;  4HDJ A;  3UVN A;  4JSN C;  3UVK A;  1R5M A;  1TBG A;  3AH8 B;  1XHM A;  3I2N A;  2B4E A;  2CO0 C;  2PBI B;  3SWS D;  5JWZ A;  3ZWL B;  3OTT A;  2HXC A;  2UZY B;  5AMS A;  4GQ2 P;  4GM3 A;  1JJU B;  2H6N A;  5H17 A;  2I3S A;  4QQE A;  3W15 A;  5H14 A;  3OL2 A;  4JSX C;  2QC5 A;  3EWE A;  2Z2O A;  5TEF A;  5GXI A;  2AGL A;  4O3T B;  5FA5 B;  3AL9 A;  4X63 B;  5TF2 A;  3C75 H;  3SBQ A;  3IKO A;  3MXX A;  3F3G A;  5TDH B;  3PXS D;  1B9X A;  2AH0 A;  3BG0 A;  1U2V C;  4N14 A;  3AL8 A;  1B9Y A;  4G56 B;  3SBR A;  4CC9 A;  3L4M D;  1GXR A;  4ZOV A;  2J56 H;  4A2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...