4FB1D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 60 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transfer
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fb1D00
4Z8LA 4A08A 3OTTA 3IIYA 1VYHC 5EM2B 3EI1A 2AGLA 4Y5RD 4XEIC 2B5NA 2H3XA 3F3FA 1S4UX 1A0RB 3IJ0A 2PM9B 2XL2A 2YBAA 2OVRB 4BUJC 5IJ7E 4PSXB 4ERZA 5EM2A 3K27A 3ODTA 3P4FA 4JT6C 5FKTA 3SFZA 3UVLA 5IGOA 2YMUA 4JSPC 4GM9A 5FA5B 4A09B 4A0BB 2CE8A 4CY2A 4J84A 3I7LA 4JT5C 2OVQB 2BCJB 2PM9A 2I0RA 1TYQC 3MZLA 4TZ4A 2P9UC 3KRWB 4J0WA 2Z2PA 4CI1A 3OKWA 2J57G 4A09A 1MG3A 5EAMA 4PC0A 4UI9R 4O3UB 2IUPA 2H68A 3AL9A 5EMKB 4XYHA 2IURA 4LG8A 3I7OA 5AMSA 3CFSB 2OJYA 3JB9L 4QL1A 1NR0A 3F3GA 4J87A 2OVPB 3PE7A 2H6NA 2GC4A 4J79A 2UZYB 5GXIA 4X60B 4A11B 4BL0A 4KFMB 3B7FA 3VA6A 5KDOB 2XYIA 1PI6A 3PXWD 2I3SA 2O9KA 5HE2B 3EWEA 4FWWA 1K8KC 4LG9A 4ZOZA 1PEVA 4A11A 2B5LA 3I7PA 3SBQA 5IJ8E 5K1CC 3PVWB 3RN0D 1PBYB 4K3JB 5HYNB 3FM0A 3L4OD 3ORVD 3UKRC 3AL8A 5JWZA 4QT8A 1GP2B 5CXBB 5TEFA 2QC5A 3DXKC 2XU7A 5GMKn 5C2VB 2AQ5A 1PGUA 3SXTD 4ERQA 4FA9D 5TF2A 3AFCA 4OWRA 2AGWA 3MKSB 5IC7A 5CXBA 2OIZA 3BG1A 3SMRA 3C99A 5EALA 4E54B 2HJ4A 3RMZD 3JPXA 4FHLA 4GM8A 3UVNA 3JRPA 2P9NC 2HKRA 3RFGA 3MKQA 5CYKB 5EMMB 3I8CA 2HKMA 3DM0A 3SJLD 4FA4D 4E54A 2MTAH 4JSNC 5AFU3 1YFQA 1XKSA 5TEEA 4A0AB 5CYKA 3MMYA 5IGQA 3CIKB 3SWSD 4OZUA 4GQBB 1JOFA 2PBIB 5FKQA 4PBZA 4XYIA 1XIPA 4R7AB 2YNNA 1B9XA 3I8EA 2H9LA 1U2VC 2H6KA 2TRCB 5HE0B 1MG2A 4A0BA 4EWRA 2CNXA 2HJBA 2OK4A 3MZKA 3UR4A 2CN2A 3JZHA 1RI6A 3DWLC 4YVDA 5H14A 2EBSA 4X63B 4D6VA 4X61B 2BBKH 5FQDA 3DXMC 3NVXA 4CC9A 4ERYA 3IJ1A 5I5IA 5EMLB 4GZ8A 4O45A 1SQ9A 3EMHA 2Z2OA 4J0XA 4J86A 4X3EA 3PVUB 2AGZA 2P9LC 3JZNA 3NVQA 3C5MA 2GC7A 5H1MA 4U1EI 1B9YA 4E5ZB 2IAAA 3V9FA 3BG0A 3RRMC 2IUQA 3EI2B 2H13A 4J77A 4ZOYA 4K3ID 3OL2B 1SHYB 5EMJB 4GGCA 5FXYA 2YNOA 4G56B 3OKYB 1U4CA 4O1QD 2HXCA 2CE9A 4MK0B 4J8BA 4J81A 3I7KA 3JZGA 4HDJA 4GM3A 2H47A 2B4EA 3EI2A 4L3GD 2G99A 2P9SC 3OL2A 3HFQA 5HE1B 4CY5A 4CI8A 2H9MA 3RSEC 4PNKB 3NVNA 3N0EA 5TDHB 4GGAA 2W18A 5IT9g 5A2Qg 3SN6B 1R5MA 2J55H 3UKUC 5FLXg 3JAMg 3SVWD 5I5MA 4JD2C 4JSVC 5C2WB 2XL3A 3J81g 4L1QD 3I7NA 2OK6A 1OLZA 1QNIA 3I2NA 4IMMA 2AGYA 1GXRA 5FKRA 5H17A 2P9KC 4CY3A 1OMWB 3PSCB 4I79A 3EU7A 4N14A 3UVMA 4ZN4A 4CZYA 4O3TB 4L9OA 5FKSA 5HE3B 4ES0A 4CZVA 4J73A 5AJAA 4JSXC 3DSMA 2Q7QA 3A0FA 1N6FA 1JMZB 3F3PA 3SCYA 5EAPA 3L4MD 2H9NA 4GQ1A 4CI3A 2PM6B 1N6EA 5K19A 5HQGA 4L3HD 4J78A 1P22A 2GNQA 3AH8B 3SBRA 4A2MA 3MXXA 3GFCA 4IA9A 1GG2B 4A7JA 3OW8A 2J56H 2P9IC 3UVKA 3RLMD 3UVOA 4PSWB 2B5MA 4U7AA 4CI2A 4A0AA 3PXTD 5THAA 5CXCB 5SXMA 4QRJA 3ULEC 4FB1D 3RFHA 1N6DA 4FAVD 3SHFA 4A2LA 4ZOXA 1SQJA 3EI4B 5CXCA 3N0DA 4AOWA 3U4YA 4D0KA 2CN3A 4CZXA 3EG6A 4GMBA 3GREA 3E0CA 1XHMA 2I0SA 3JROA 4FAND 3EI4A 3W15A 1K32A 2CO0A 4PXWA 4Y7RA 1GOTB 3VGZA 2AH0A 4FA5D 4GQ2P 2H6QA 5C9ZB 4E5ZA 2I0TA 2CO0C 3PXSD 2IWKA 3I7HA 3EI3B 3PSLA 1L0QA 4AEZA 3VH0A 3OKYA 2AH1A 4J82A 1FWXA 4GGDA 5GSAA 2YNPA 3ZWLB 3CFVA 5B4WA 5I5JA 3I89A 3EI3A 1JJUB 1MDAH 2I3TA 2YB8B 2HYEA 1JMXB 3AL8B 3K26A 3C9CA 4ESGA 3V5WB 4O9DA 2IWFA 4FA1D 3FRXA 4JXMA 1Q47A 3RN1D 4J8GA 2G9AA 2AGXA 2UZXB 3BWSA 1TBGA 3V7DB 3OKTA 3IJCA 3IIWA 4PBYA 4H5IA 2IUVA 4NSXA 2HESX 3J80g 2QXVA 3IKOA 4ZOVA 4LGNA 4A08B 4CY1A 3KRXB 4H5JA 3SBPA 3FGBA 2P9PC 3EI1B 5EARA 2PM7B 1ERJA 3C75H 1NEXB 2H9PA 4BH6A 2Z2NA 4QQEA 5GXHA 2H14A 3SLED
chains in the Genus database with same CATH superfamily
4Z8LA 4A08A 3OTTA 2HU8A 3IIYA 1VYHC 2VDMA 5EM2B 3EI1A 3MUNA 3VI3A 2AGLA 2VZ1A 4Y5RD 1A12A 4XEIC 2B5NA 2H3XA 3F3FA 3IJEA 1S4UX 1A0RB 3IJ0A 2PM9B 2XL2A 2YBAA 3EQ9A 2OVRB 4BUJC 5IJ7E 4BCBA 4PSXB 4ERZA 5EM2A 3K27A 2VDLA 3ODTA 3P4FA 4JT6C 1JTDB 4WK4A 5FKTA 3SFZA 3UVLA 5IGOA 2YMUA 4JSPC 4GM9A 5E6SA 5FA5B 5M5TA 4A09B 4A0BB 2CE8A 4CY2A 4J84A 3I7LA 4JT5C 2OVQB 2BCJB 2PM9A 2I0RA 1TYQC 3MZLA 4TZ4A 2QZPA 2P9UC 3KRWB 4J0WA 2Z2PA 2HU7A 3IUJA 4UM9A 4CI1A 3V4VA 3OKWA 4NBMA 2J57G 4A09A 1UOPA 1MG3A 1VE6A 2VDPA 5EAMA 4PC0A 4UI9R 4O3UB 2IUPA 2H68A 1YR2A 3AL9A 5EMKB 4XYHA 2IURA 4LG8A 3O4GA 3I7OA 5AMSA 3CFSB 4NENA 2OJYA 3JB9L 4QL1A 1NR0A 3F3GA 4J87A 2OVPB 3PE7A 2H6NA 2GC4A 2VDOA 5E6UA 4J79A 2UZYB 3O4JA 4WJKA 4X60B 3EQ7A 4D9SA 5GXIA 4A11B 1H2XA 4BL0A 3QI0A 4KFMB 3B7FA 3VA6A 5KDOB 2XYIA 5M61A 1E5TA 1PI6A 3PXWD 1UTCA 2I3SA 2O9KA 3IVMA 1VE7A 5HE2B 3EWEA 4FWWA 1K8KC 4LG9A 4ZOZA 1PEVA 4A11A 2B5LA 3I7PA 3SBQA 5IJ8E 4AN1A 5K1CC 3PVWB 3RN0D 1PBYB 2VC2A 4K3JB 5HYNB 3FM0A 3L4OD 3ORVD 3UKRC 3AL8A 5JWZA 4QT8A 1GP2B 5CXBB 5TEFA 3QHYB 2QC5A 3VI4A 3DXKC 2XU7A 5GMKn 5C2VB 2AQ5A 1GOFA 1BPOA 1PGUA 3OF7A 4O02A 3SXTD 4ERQA 4FA9D 4O2WA 5TF2A 1UOQA 3AFCA 4OWRA 2AGWA 3GC3B 3MKSB 5IC7A 5CXBA 2OIZA 3BG1A 3SMRA 3C99A 5EALA 4E54B 2HJ4A 3RMZD 3JPXA 3MUOA 2XE4A 3ZDYA 5FFGA 4FHLA 4GM8A 3FCSA 3UVNA 3JRPA 2P9NC 5M5UA 2HKRA 3RFGA 3MKQA 5CYKB 5EMMB 5E6RA 3I8CA 2HKMA 2VDRA 3DM0A 3SJLD 3ZE1A 4WK0A 4FA4D 4E54A 4AX4A 5M5VA 2MTAH 4JSNC 5AFU3 1YFQA 1XKSA 2BKLA 1TYEA 3T3MA 2VDKA 5TEEA 4A0AB 3ZE0A 5CYKA 3MMYA 5IGQA 3CIKB 3SWSD 4OZUA 4GQBB 1JOFA 1H2WA 2PBIB 5FKQA 3DDUA 4PBZA 1GOGA 4XYIA 1XIPA 1K3IA 4R7AB 2YNNA 1B9XA 3ZDXA 3I8EA 2H9LA 1U2VC 2H6KA 2TRCB 5HE0B 1MG2A 4NAAA 4A0BA 4EWRA 2CNXA 2HJBA 2OK4A 4JHPC 3MZKA 3UR4A 2CN2A 3JZHA 4Z7NA 1RI6A 4RE5A 1U8CA 3DWLC 4YVDA 4MMZA 1H2ZA 5H14A 2EBSA 4X63B 4BCDA 4D6VA 4X61B 2BBKH 5FQDA 3DXMC 4L1MA 3NVXA 4CC9A 4ERYA 3IJ1A 5I5IA 1E8NA 5EMLB 4GZ8A 4O45A 1SQ9A 3EMHA 2VDQA 2Z2OA 4J0XA 4J86A 4X3EA 1O6GA 2AGZA 2P9LC 3JZNA 3NVQA 3C5MA 3PVUB 2GC7A 5H1MA 4U1EI 1B9YA 4E5ZB 2IAAA 3V9FA 3BG0A 4UM8A 3RRMC 1GOHA 2IUQA 3EI2B 4G1EA 5M5RA 2H13A 2XZGA 4J77A 4ZOYA 4K3ID 3OL2B 1SHYB 5EMJB 1M1XA 4GGCA 5FXYA 2YNOA 4G56B 3OKYB 1U4CA 4O1QD 2HXCA 2CE9A 4MK0B 4J8BA 4J81A 3I7KA 3JZGA 4G1MA 4HDJA 2EIDA 4GM3A 5C92A 2H47A 2B4EA 3IUQA 5FFOA 3EI2A 4MMYA 4L3GD 2G99A 1L5GA 2P9SC 3OL2A 3HFQA 5HE1B 4CY5A 4CI8A 2H9MA 3RSEC 4PNKB 3NVNA 3N0EA 5TDHB 4GGAA 2W18A 2EIBA 4G55A 5IT9g 5A2Qg 3O4HA 3SN6B 1R5MA 2J55H 3UKUC 5FLXg 3JAMg 3SVWD 1I2MB 2XDWA 5I5MA 3FCUA 4JD2C 4JSVC 4DNUA 2JKXA 5C2WB 3K71A 2XL3A 3J81g 1VZ3A 4L1QD 1E8MA 4JHNA 3I7NA 2OK6A 1OLZA 1QNIA 3I2NA 4IMMA 2AGYA 1GXRA 5FKRA 5H17A 2P9KC 4CY3A 1OMWB 3PSCB 3IUMA 4I79A 3EU7A 4N14A 3UVMA 4ZN4A 4CZYA 1VZ2A 4AMYA 4O3TB 4L9OA 5FKSA 3NIGA 5HE3B 4ES0A 4CZVA 4J73A 5AJAA 4JSXC 3DSMA 2Q7QA 3IUNA 3KCIA 3A0FA 1N6FA 1JMZB 3F3PA 3SCYA 5EAPA 3L4MD 2H9NA 4GQ1A 3ZE2A 4CI3A 2PM6B 1O6FA 1N6EA 3NIDA 5K19A 5HQGA 2WQ8A 4J78A 4L3HD 1P22A 2GNQA 4DNVA 3AH8B 3SBRA 4A2MA 3MXXA 3GFCA 4IA9A 1GG2B 4A7JA 3OW8A 2J56H 2P9IC 3UVKA 3RLMD 3UVOA 1H2YA 2EIEA 4PSWB 2B5MA 4U7AA 4CI2A 4A0AA 4QAMA 1C9IA 3PXTD 5THAA 1QFMA 2VDNA 5CXCB 5SXMA 4Z7QA 4QRJA 4BP8A 3ULEC 4WK2A 4Z7OA 1JV2A 4FB1D 3RFHA 1N6DA 2QR5A 4FAVD 4NC4A 3K6SA 1C9LA 3SHFA 2VZ3A 4A2LA 4ZOXA 1SQJA 3EI4B 3K72A 5CXCA 3N0DA 4AOWA 3U4YA 4DNWA 4D0KA 2CN3A 5HDBA 4CZXA 3EG6A 3ZDZA 4GMBA 3GREA 3E0CA 1XHMA 1T2XA 2I0SA 1QFSA 3JROA 3IURA 4FAND 3EI4A 3W15A 1K32A 2CO0A 4PXWA 4Y7RA 1GOTB 3VGZA 2AH0A 4FA5D 4GQ2P 2H6QA 5C9ZB 4E5ZA 2I0TA 2CO0C 3V4PA 4AN0A 4BCCA 3PXSD 2IWKA 3I7HA 3EI3B 3PSLA 1L0QA 4AEZA 4BP9A 3VH0A 3OKYA 2AH1A 4J82A 1FWXA 4GGDA 4MMXA 2YNPA 5GSAA 5M5SA 3ZWLB 3CFVA 5B4WA 3O4IA 5I5JA 3I89A 1UOOA 3EI3A 1JJUB 2HU5A 1MDAH 2I3TA 2YB8B 2HYEA 1JMXB 3AL8B 3K26A 3C9CA 4ESGA 3V5WB 3IULA 4O9DA 2IWFA 4FA1D 3FRXA 4JXMA 1Q47A 3RN1D 4IRZA 4J8GA 2G9AA 2AGXA 2UZXB 3BWSA 1TBGA 3V7DB 3OKTA 3EQ8A 3IJCA 3IIWA 4PBYA 4H5IA 5C86A 2IUVA 4NSXA 2HESX 3GD1I 3J80g 2QXVA 3IKOA 4ZOVA 4AMZA 4LGNA 4A08B 4CY1A 3T3PA 3KRXB 4H5JA 3SBPA 3FGBA 2P9PC 3EI1B 5EARA 2PM7B 1ERJA 3C75H 1NEXB 2H9PA 4BH6A 2Z2NA 4QQEA 2EICA 4RE6A 5GXHA 2H14A 3NIFA 3MVDK 3SLED
chains in the Genus database with same CATH topology
4Z8LA 4A08A 3OTTA 3IIYA 1VYHC 5EM2B 3EI1A 2AGLA 4Y5RD 4XEIC 2B5NA 2H3XA 3F3FA 1S4UX 1A0RB 3IJ0A 2PM9B 2XL2A 2YBAA 2OVRB 4BUJC 5IJ7E 4PSXB 4ERZA 5EM2A 3K27A 3ODTA 3P4FA 4JT6C 5FKTA 3SFZA 3UVLA 5IGOA 2YMUA 4JSPC 4GM9A 5FA5B 4A09B 4A0BB 2CE8A 4CY2A 4J84A 3I7LA 4JT5C 2OVQB 2BCJB 2PM9A 2I0RA 1TYQC 3MZLA 4TZ4A 2P9UC 3KRWB 4J0WA 2Z2PA 4CI1A 3OKWA 2J57G 4A09A 1MG3A 5EAMA 4PC0A 4UI9R 4O3UB 2IUPA 2H68A 3AL9A 5EMKB 4XYHA 2IURA 4LG8A 3I7OA 5AMSA 3CFSB 2OJYA 3JB9L 4QL1A 1NR0A 3F3GA 4J87A 2OVPB 3PE7A 2H6NA 2GC4A 4J79A 2UZYB 5GXIA 4X60B 4A11B 4BL0A 4KFMB 3B7FA 3VA6A 5KDOB 2XYIA 1PI6A 3PXWD 2I3SA 2O9KA 5HE2B 3EWEA 4FWWA 1K8KC 4LG9A 4ZOZA 1PEVA 4A11A 2B5LA 3I7PA 3SBQA 5IJ8E 5K1CC 3PVWB 3RN0D 1PBYB 4K3JB 5HYNB 3FM0A 3L4OD 3ORVD 3UKRC 3AL8A 5JWZA 4QT8A 1GP2B 5CXBB 5TEFA 2QC5A 3DXKC 2XU7A 5GMKn 5C2VB 2AQ5A 1PGUA 3SXTD 4ERQA 4FA9D 5TF2A 3AFCA 4OWRA 2AGWA 3MKSB 5IC7A 5CXBA 2OIZA 3BG1A 3SMRA 3C99A 5EALA 4E54B 2HJ4A 3RMZD 3JPXA 4FHLA 4GM8A 3UVNA 3JRPA 2P9NC 2HKRA 3RFGA 3MKQA 5CYKB 5EMMB 3I8CA 2HKMA 3DM0A 3SJLD 4FA4D 4E54A 2MTAH 4JSNC 5AFU3 1YFQA 1XKSA 5TEEA 4A0AB 5CYKA 3MMYA 5IGQA 3CIKB 3SWSD 4OZUA 4GQBB 1JOFA 2PBIB 5FKQA 4PBZA 4XYIA 1XIPA 4R7AB 2YNNA 1B9XA 3I8EA 2H9LA 1U2VC 2H6KA 2TRCB 5HE0B 1MG2A 4A0BA 4EWRA 2CNXA 2HJBA 2OK4A 3MZKA 3UR4A 2CN2A 3JZHA 1RI6A 3DWLC 4YVDA 5H14A 2EBSA 4X63B 4D6VA 4X61B 2BBKH 5FQDA 3DXMC 3NVXA 4CC9A 4ERYA 3IJ1A 5I5IA 5EMLB 4GZ8A 4O45A 1SQ9A 3EMHA 2Z2OA 4J0XA 4J86A 4X3EA 3PVUB 2AGZA 2P9LC 3JZNA 3NVQA 3C5MA 2GC7A 5H1MA 4U1EI 1B9YA 4E5ZB 2IAAA 3V9FA 3BG0A 3RRMC 2IUQA 3EI2B 2H13A 4J77A 4ZOYA 4K3ID 3OL2B 1SHYB 5EMJB 4GGCA 5FXYA 2YNOA 4G56B 3OKYB 1U4CA 4O1QD 2HXCA 2CE9A 4MK0B 4J8BA 4J81A 3I7KA 3JZGA 4HDJA 4GM3A 2H47A 2B4EA 3EI2A 4L3GD 2G99A 2P9SC 3OL2A 3HFQA 5HE1B 4CY5A 4CI8A 2H9MA 3RSEC 4PNKB 3NVNA 3N0EA 5TDHB 4GGAA 2W18A 5IT9g 5A2Qg 3SN6B 1R5MA 2J55H 3UKUC 5FLXg 3JAMg 3SVWD 5I5MA 4JD2C 4JSVC 5C2WB 2XL3A 3J81g 4L1QD 3I7NA 2OK6A 1OLZA 1QNIA 3I2NA 4IMMA 2AGYA 1GXRA 5FKRA 5H17A 2P9KC 4CY3A 1OMWB 3PSCB 4I79A 3EU7A 4N14A 3UVMA 4ZN4A 4CZYA 4O3TB 4L9OA 5FKSA 5HE3B 4ES0A 4CZVA 4J73A 5AJAA 4JSXC 3DSMA 2Q7QA 3A0FA 1N6FA 1JMZB 3F3PA 3SCYA 5EAPA 3L4MD 2H9NA 4GQ1A 4CI3A 2PM6B 1N6EA 5K19A 5HQGA 4L3HD 4J78A 1P22A 2GNQA 3AH8B 3SBRA 4A2MA 3MXXA 3GFCA 4IA9A 1GG2B 4A7JA 3OW8A 2J56H 2P9IC 3UVKA 3RLMD 3UVOA 4PSWB 2B5MA 4U7AA 4CI2A 4A0AA 3PXTD 5THAA 5CXCB 5SXMA 4QRJA 3ULEC 4FB1D 3RFHA 1N6DA 4FAVD 3SHFA 4A2LA 4ZOXA 1SQJA 3EI4B 5CXCA 3N0DA 4AOWA 3U4YA 4D0KA 2CN3A 4CZXA 3EG6A 4GMBA 3GREA 3E0CA 1XHMA 2I0SA 3JROA 4FAND 3EI4A 3W15A 1K32A 2CO0A 4PXWA 4Y7RA 1GOTB 3VGZA 2AH0A 4FA5D 4GQ2P 2H6QA 5C9ZB 4E5ZA 2I0TA 2CO0C 3PXSD 2IWKA 3I7HA 3EI3B 3PSLA 1L0QA 4AEZA 3VH0A 3OKYA 2AH1A 4J82A 1FWXA 4GGDA 5GSAA 2YNPA 3ZWLB 3CFVA 5B4WA 5I5JA 3I89A 3EI3A 1JJUB 1MDAH 2I3TA 2YB8B 2HYEA 1JMXB 3AL8B 3K26A 3C9CA 4ESGA 3V5WB 4O9DA 2IWFA 4FA1D 3FRXA 4JXMA 1Q47A 3RN1D 4J8GA 2G9AA 2AGXA 2UZXB 3BWSA 1TBGA 3V7DB 3OKTA 3IJCA 3IIWA 4PBYA 4H5IA 2IUVA 4NSXA 2HESX 3J80g 2QXVA 3IKOA 4ZOVA 4LGNA 4A08B 4CY1A 3KRXB 4H5JA 3SBPA 3FGBA 2P9PC 3EI1B 5EARA 2PM7B 1ERJA 3C75H 1NEXB 2H9PA 4BH6A 2Z2NA 4QQEA 5GXHA 2H14A 3SLED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z8L A;  4A08 A;  3OTT A;  3IIY A;  1VYH C;  5EM2 B;  3EI1 A;  2AGL A;  4Y5R D;  4XEI C;  2B5N A;  2H3X A;  3F3F A;  1S4U X;  1A0R B;  3IJ0 A;  2PM9 B;  2XL2 A;  2YBA A;  2OVR B;  4BUJ C;  5IJ7 E;  4PSX B;  4ERZ A;  5EM2 A;  3K27 A;  3ODT A;  3P4F A;  4JT6 C;  5FKT A;  3SFZ A;  3UVL A;  5IGO A;  2YMU A;  4JSP C;  4GM9 A;  5FA5 B;  4A09 B;  4A0B B;  2CE8 A;  4CY2 A;  4J84 A;  3I7L A;  4JT5 C;  2OVQ B;  2BCJ B;  2PM9 A;  2I0R A;  1TYQ C;  3MZL A;  4TZ4 A;  2P9U C;  3KRW B;  4J0W A;  2Z2P A;  4CI1 A;  3OKW A;  2J57 G;  4A09 A;  1MG3 A;  5EAM A;  4PC0 A;  4UI9 R;  4O3U B;  2IUP A;  2H68 A;  3AL9 A;  5EMK B;  4XYH A;  2IUR A;  4LG8 A;  3I7O A;  5AMS A;  3CFS B;  2OJY A;  3JB9 L;  4QL1 A;  1NR0 A;  3F3G A;  4J87 A;  2OVP B;  3PE7 A;  2H6N A;  2GC4 A;  4J79 A;  2UZY B;  5GXI A;  4X60 B;  4A11 B;  4BL0 A;  4KFM B;  3B7F A;  3VA6 A;  5KDO B;  2XYI A;  1PI6 A;  3PXW D;  2I3S A;  2O9K A;  5HE2 B;  3EWE A;  4FWW A;  1K8K C;  4LG9 A;  4ZOZ A;  1PEV A;  4A11 A;  2B5L A;  3I7P A;  3SBQ A;  5IJ8 E;  5K1C C;  3PVW B;  3RN0 D;  1PBY B;  4K3J B;  5HYN B;  3FM0 A;  3L4O D;  3ORV D;  3UKR C;  3AL8 A;  5JWZ A;  4QT8 A;  1GP2 B;  5CXB B;  5TEF A;  2QC5 A;  3DXK C;  2XU7 A;  5GMK n;  5C2V B;  2AQ5 A;  1PGU A;  3SXT D;  4ERQ A;  4FA9 D;  5TF2 A;  3AFC A;  4OWR A;  2AGW A;  3MKS B;  5IC7 A;  5CXB A;  2OIZ A;  3BG1 A;  3SMR A;  3C99 A;  5EAL A;  4E54 B;  2HJ4 A;  3RMZ D;  3JPX A;  4FHL A;  4GM8 A;  3UVN A;  3JRP A;  2P9N C;  2HKR A;  3RFG A;  3MKQ A;  5CYK B;  5EMM B;  3I8C A;  2HKM A;  3DM0 A;  3SJL D;  4FA4 D;  4E54 A;  2MTA H;  4JSN C;  5AFU 3;  1YFQ A;  1XKS A;  5TEE A;  4A0A B;  5CYK A;  3MMY A;  5IGQ A;  3CIK B;  3SWS D;  4OZU A;  4GQB B;  1JOF A;  2PBI B;  5FKQ A;  4PBZ A;  4XYI A;  1XIP A;  4R7A B;  2YNN A;  1B9X A;  3I8E A;  2H9L A;  1U2V C;  2H6K A;  2TRC B;  5HE0 B;  1MG2 A;  4A0B A;  4EWR A;  2CNX A;  2HJB A;  2OK4 A;  3MZK A;  3UR4 A;  2CN2 A;  3JZH A;  1RI6 A;  3DWL C;  4YVD A;  5H14 A;  2EBS A;  4X63 B;  4D6V A;  4X61 B;  2BBK H;  5FQD A;  3DXM C;  3NVX A;  4CC9 A;  4ERY A;  3IJ1 A;  5I5I A;  5EML B;  4GZ8 A;  4O45 A;  1SQ9 A;  3EMH A;  2Z2O A;  4J0X A;  4J86 A;  4X3E A;  3PVU B;  2AGZ A;  2P9L C;  3JZN A;  3NVQ A;  3C5M A;  2GC7 A;  5H1M A;  4U1E I;  1B9Y A;  4E5Z B;  2IAA A;  3V9F A;  3BG0 A;  3RRM C;  2IUQ A;  3EI2 B;  2H13 A;  4J77 A;  4ZOY A;  4K3I D;  3OL2 B;  1SHY B;  5EMJ B;  4GGC A;  5FXY A;  2YNO A;  4G56 B;  3OKY B;  1U4C A;  4O1Q D;  2HXC A;  2CE9 A;  4MK0 B;  4J8B A;  4J81 A;  3I7K A;  3JZG A;  4HDJ A;  4GM3 A;  2H47 A;  2B4E A;  3EI2 A;  4L3G D;  2G99 A;  2P9S C;  3OL2 A;  3HFQ A;  5HE1 B;  4CY5 A;  4CI8 A;  2H9M A;  3RSE C;  4PNK B;  3NVN A;  3N0E A;  5TDH B;  4GGA A;  2W18 A;  5IT9 g;  5A2Q g;  3SN6 B;  1R5M A;  2J55 H;  3UKU C;  5FLX g;  3JAM g;  3SVW D;  5I5M A;  4JD2 C;  4JSV C;  5C2W B;  2XL3 A;  3J81 g;  4L1Q D;  3I7N A;  2OK6 A;  1OLZ A;  1QNI A;  3I2N A;  4IMM A;  2AGY A;  1GXR A;  5FKR A;  5H17 A;  2P9K C;  4CY3 A;  1OMW B;  3PSC B;  4I79 A;  3EU7 A;  4N14 A;  3UVM A;  4ZN4 A;  4CZY A;  4O3T B;  4L9O A;  5FKS A;  5HE3 B;  4ES0 A;  4CZV A;  4J73 A;  5AJA A;  4JSX C;  3DSM A;  2Q7Q A;  3A0F A;  1N6F A;  1JMZ B;  3F3P A;  3SCY A;  5EAP A;  3L4M D;  2H9N A;  4GQ1 A;  4CI3 A;  2PM6 B;  1N6E A;  5K19 A;  5HQG A;  4L3H D;  4J78 A;  1P22 A;  2GNQ A;  3AH8 B;  3SBR A;  4A2M A;  3MXX A;  3GFC A;  4IA9 A;  1GG2 B;  4A7J A;  3OW8 A;  2J56 H;  2P9I C;  3UVK A;  3RLM D;  3UVO A;  4PSW B;  2B5M A;  4U7A A;  4CI2 A;  4A0A A;  3PXT D;  5THA A;  5CXC B;  5SXM A;  4QRJ A;  3ULE C;  4FB1 D;  3RFH A;  1N6D A;  4FAV D;  3SHF A;  4A2L A;  4ZOX A;  1SQJ A;  3EI4 B;  5CXC A;  3N0D A;  4AOW A;  3U4Y A;  4D0K A;  2CN3 A;  4CZX A;  3EG6 A;  4GMB A;  3GRE A;  3E0C A;  1XHM A;  2I0S A;  3JRO A;  4FAN D;  3EI4 A;  3W15 A;  1K32 A;  2CO0 A;  4PXW A;  4Y7R A;  1GOT B;  3VGZ A;  2AH0 A;  4FA5 D;  4GQ2 P;  2H6Q A;  5C9Z B;  4E5Z A;  2I0T A;  2CO0 C;  3PXS D;  2IWK A;  3I7H A;  3EI3 B;  3PSL A;  1L0Q A;  4AEZ A;  3VH0 A;  3OKY A;  2AH1 A;  4J82 A;  1FWX A;  4GGD A;  5GSA A;  2YNP A;  3ZWL B;  3CFV A;  5B4W A;  5I5J A;  3I89 A;  3EI3 A;  1JJU B;  1MDA H;  2I3T A;  2YB8 B;  2HYE A;  1JMX B;  3AL8 B;  3K26 A;  3C9C A;  4ESG A;  3V5W B;  4O9D A;  2IWF A;  4FA1 D;  3FRX A;  4JXM A;  1Q47 A;  3RN1 D;  4J8G A;  2G9A A;  2AGX A;  2UZX B;  3BWS A;  1TBG A;  3V7D B;  3OKT A;  3IJC A;  3IIW A;  4PBY A;  4H5I A;  2IUV A;  4NSX A;  2HES X;  3J80 g;  2QXV A;  3IKO A;  4ZOV A;  4LGN A;  4A08 B;  4CY1 A;  3KRX B;  4H5J A;  3SBP A;  3FGB A;  2P9P C;  3EI1 B;  5EAR A;  2PM7 B;  1ERJ A;  3C75 H;  1NEX B;  2H9P A;  4BH6 A;  2Z2N A;  4QQE A;  5GXH A;  2H14 A;  3SLE D; 
#chains in the Genus database with same CATH topology
 4Z8L A;  4A08 A;  3OTT A;  2HU8 A;  3IIY A;  1VYH C;  2VDM A;  5EM2 B;  3EI1 A;  3MUN A;  3VI3 A;  2AGL A;  2VZ1 A;  4Y5R D;  1A12 A;  4XEI C;  2B5N A;  2H3X A;  3F3F A;  3IJE A;  1S4U X;  1A0R B;  3IJ0 A;  2PM9 B;  2XL2 A;  2YBA A;  3EQ9 A;  2OVR B;  4BUJ C;  5IJ7 E;  4BCB A;  4PSX B;  4ERZ A;  5EM2 A;  3K27 A;  2VDL A;  3ODT A;  3P4F A;  4JT6 C;  1JTD B;  4WK4 A;  5FKT A;  3SFZ A;  3UVL A;  5IGO A;  2YMU A;  4JSP C;  4GM9 A;  5E6S A;  5FA5 B;  5M5T A;  4A09 B;  4A0B B;  2CE8 A;  4CY2 A;  4J84 A;  3I7L A;  4JT5 C;  2OVQ B;  2BCJ B;  2PM9 A;  2I0R A;  1TYQ C;  3MZL A;  4TZ4 A;  2QZP A;  2P9U C;  3KRW B;  4J0W A;  2Z2P A;  2HU7 A;  3IUJ A;  4UM9 A;  4CI1 A;  3V4V A;  3OKW A;  4NBM A;  2J57 G;  4A09 A;  1UOP A;  1MG3 A;  1VE6 A;  2VDP A;  5EAM A;  4PC0 A;  4UI9 R;  4O3U B;  2IUP A;  2H68 A;  1YR2 A;  3AL9 A;  5EMK B;  4XYH A;  2IUR A;  4LG8 A;  3O4G A;  3I7O A;  5AMS A;  3CFS B;  4NEN A;  2OJY A;  3JB9 L;  4QL1 A;  1NR0 A;  3F3G A;  4J87 A;  2OVP B;  3PE7 A;  2H6N A;  2GC4 A;  2VDO A;  5E6U A;  4J79 A;  2UZY B;  3O4J A;  4WJK A;  4X60 B;  3EQ7 A;  4D9S A;  5GXI A;  4A11 B;  1H2X A;  4BL0 A;  3QI0 A;  4KFM B;  3B7F A;  3VA6 A;  5KDO B;  2XYI A;  5M61 A;  1E5T A;  1PI6 A;  3PXW D;  1UTC A;  2I3S A;  2O9K A;  3IVM A;  1VE7 A;  5HE2 B;  3EWE A;  4FWW A;  1K8K C;  4LG9 A;  4ZOZ A;  1PEV A;  4A11 A;  2B5L A;  3I7P A;  3SBQ A;  5IJ8 E;  4AN1 A;  5K1C C;  3PVW B;  3RN0 D;  1PBY B;  2VC2 A;  4K3J B;  5HYN B;  3FM0 A;  3L4O D;  3ORV D;  3UKR C;  3AL8 A;  5JWZ A;  4QT8 A;  1GP2 B;  5CXB B;  5TEF A;  3QHY B;  2QC5 A;  3VI4 A;  3DXK C;  2XU7 A;  5GMK n;  5C2V B;  2AQ5 A;  1GOF A;  1BPO A;  1PGU A;  3OF7 A;  4O02 A;  3SXT D;  4ERQ A;  4FA9 D;  4O2W A;  5TF2 A;  1UOQ A;  3AFC A;  4OWR A;  2AGW A;  3GC3 B;  3MKS B;  5IC7 A;  5CXB A;  2OIZ A;  3BG1 A;  3SMR A;  3C99 A;  5EAL A;  4E54 B;  2HJ4 A;  3RMZ D;  3JPX A;  3MUO A;  2XE4 A;  3ZDY A;  5FFG A;  4FHL A;  4GM8 A;  3FCS A;  3UVN A;  3JRP A;  2P9N C;  5M5U A;  2HKR A;  3RFG A;  3MKQ A;  5CYK B;  5EMM B;  5E6R A;  3I8C A;  2HKM A;  2VDR A;  3DM0 A;  3SJL D;  3ZE1 A;  4WK0 A;  4FA4 D;  4E54 A;  4AX4 A;  5M5V A;  2MTA H;  4JSN C;  5AFU 3;  1YFQ A;  1XKS A;  2BKL A;  1TYE A;  3T3M A;  2VDK A;  5TEE A;  4A0A B;  3ZE0 A;  5CYK A;  3MMY A;  5IGQ A;  3CIK B;  3SWS D;  4OZU A;  4GQB B;  1JOF A;  1H2W A;  2PBI B;  5FKQ A;  3DDU A;  4PBZ A;  1GOG A;  4XYI A;  1XIP A;  1K3I A;  4R7A B;  2YNN A;  1B9X A;  3ZDX A;  3I8E A;  2H9L A;  1U2V C;  2H6K A;  2TRC B;  5HE0 B;  1MG2 A;  4NAA A;  4A0B A;  4EWR A;  2CNX A;  2HJB A;  2OK4 A;  4JHP C;  3MZK A;  3UR4 A;  2CN2 A;  3JZH A;  4Z7N A;  1RI6 A;  4RE5 A;  1U8C A;  3DWL C;  4YVD A;  4MMZ A;  1H2Z A;  5H14 A;  2EBS A;  4X63 B;  4BCD A;  4D6V A;  4X61 B;  2BBK H;  5FQD A;  3DXM C;  4L1M A;  3NVX A;  4CC9 A;  4ERY A;  3IJ1 A;  5I5I A;  1E8N A;  5EML B;  4GZ8 A;  4O45 A;  1SQ9 A;  3EMH A;  2VDQ A;  2Z2O A;  4J0X A;  4J86 A;  4X3E A;  1O6G A;  2AGZ A;  2P9L C;  3JZN A;  3NVQ A;  3C5M A;  3PVU B;  2GC7 A;  5H1M A;  4U1E I;  1B9Y A;  4E5Z B;  2IAA A;  3V9F A;  3BG0 A;  4UM8 A;  3RRM C;  1GOH A;  2IUQ A;  3EI2 B;  4G1E A;  5M5R A;  2H13 A;  2XZG A;  4J77 A;  4ZOY A;  4K3I D;  3OL2 B;  1SHY B;  5EMJ B;  1M1X A;  4GGC A;  5FXY A;  2YNO A;  4G56 B;  3OKY B;  1U4C A;  4O1Q D;  2HXC A;  2CE9 A;  4MK0 B;  4J8B A;  4J81 A;  3I7K A;  3JZG A;  4G1M A;  4HDJ A;  2EID A;  4GM3 A;  5C92 A;  2H47 A;  2B4E A;  3IUQ A;  5FFO A;  3EI2 A;  4MMY A;  4L3G D;  2G99 A;  1L5G A;  2P9S C;  3OL2 A;  3HFQ A;  5HE1 B;  4CY5 A;  4CI8 A;  2H9M A;  3RSE C;  4PNK B;  3NVN A;  3N0E A;  5TDH B;  4GGA A;  2W18 A;  2EIB A;  4G55 A;  5IT9 g;  5A2Q g;  3O4H A;  3SN6 B;  1R5M A;  2J55 H;  3UKU C;  5FLX g;  3JAM g;  3SVW D;  1I2M B;  2XDW A;  5I5M A;  3FCU A;  4JD2 C;  4JSV C;  4DNU A;  2JKX A;  5C2W B;  3K71 A;  2XL3 A;  3J81 g;  1VZ3 A;  4L1Q D;  1E8M A;  4JHN A;  3I7N A;  2OK6 A;  1OLZ A;  1QNI A;  3I2N A;  4IMM A;  2AGY A;  1GXR A;  5FKR A;  5H17 A;  2P9K C;  4CY3 A;  1OMW B;  3PSC B;  3IUM A;  4I79 A;  3EU7 A;  4N14 A;  3UVM A;  4ZN4 A;  4CZY A;  1VZ2 A;  4AMY A;  4O3T B;  4L9O A;  5FKS A;  3NIG A;  5HE3 B;  4ES0 A;  4CZV A;  4J73 A;  5AJA A;  4JSX C;  3DSM A;  2Q7Q A;  3IUN A;  3KCI A;  3A0F A;  1N6F A;  1JMZ B;  3F3P A;  3SCY A;  5EAP A;  3L4M D;  2H9N A;  4GQ1 A;  3ZE2 A;  4CI3 A;  2PM6 B;  1O6F A;  1N6E A;  3NID A;  5K19 A;  5HQG A;  2WQ8 A;  4J78 A;  4L3H D;  1P22 A;  2GNQ A;  4DNV A;  3AH8 B;  3SBR A;  4A2M A;  3MXX A;  3GFC A;  4IA9 A;  1GG2 B;  4A7J A;  3OW8 A;  2J56 H;  2P9I C;  3UVK A;  3RLM D;  3UVO A;  1H2Y A;  2EIE A;  4PSW B;  2B5M A;  4U7A A;  4CI2 A;  4A0A A;  4QAM A;  1C9I A;  3PXT D;  5THA A;  1QFM A;  2VDN A;  5CXC B;  5SXM A;  4Z7Q A;  4QRJ A;  4BP8 A;  3ULE C;  4WK2 A;  4Z7O A;  1JV2 A;  4FB1 D;  3RFH A;  1N6D A;  2QR5 A;  4FAV D;  4NC4 A;  3K6S A;  1C9L A;  3SHF A;  2VZ3 A;  4A2L A;  4ZOX A;  1SQJ A;  3EI4 B;  3K72 A;  5CXC A;  3N0D A;  4AOW A;  3U4Y A;  4DNW A;  4D0K A;  2CN3 A;  5HDB A;  4CZX A;  3EG6 A;  3ZDZ A;  4GMB A;  3GRE A;  3E0C A;  1XHM A;  1T2X A;  2I0S A;  1QFS A;  3JRO A;  3IUR A;  4FAN D;  3EI4 A;  3W15 A;  1K32 A;  2CO0 A;  4PXW A;  4Y7R A;  1GOT B;  3VGZ A;  2AH0 A;  4FA5 D;  4GQ2 P;  2H6Q A;  5C9Z B;  4E5Z A;  2I0T A;  2CO0 C;  3V4P A;  4AN0 A;  4BCC A;  3PXS D;  2IWK A;  3I7H A;  3EI3 B;  3PSL A;  1L0Q A;  4AEZ A;  4BP9 A;  3VH0 A;  3OKY A;  2AH1 A;  4J82 A;  1FWX A;  4GGD A;  4MMX A;  2YNP A;  5GSA A;  5M5S A;  3ZWL B;  3CFV A;  5B4W A;  3O4I A;  5I5J A;  3I89 A;  1UOO A;  3EI3 A;  1JJU B;  2HU5 A;  1MDA H;  2I3T A;  2YB8 B;  2HYE A;  1JMX B;  3AL8 B;  3K26 A;  3C9C A;  4ESG A;  3V5W B;  3IUL A;  4O9D A;  2IWF A;  4FA1 D;  3FRX A;  4JXM A;  1Q47 A;  3RN1 D;  4IRZ A;  4J8G A;  2G9A A;  2AGX A;  2UZX B;  3BWS A;  1TBG A;  3V7D B;  3OKT A;  3EQ8 A;  3IJC A;  3IIW A;  4PBY A;  4H5I A;  5C86 A;  2IUV A;  4NSX A;  2HES X;  3GD1 I;  3J80 g;  2QXV A;  3IKO A;  4ZOV A;  4AMZ A;  4LGN A;  4A08 B;  4CY1 A;  3T3P A;  3KRX B;  4H5J A;  3SBP A;  3FGB A;  2P9P C;  3EI1 B;  5EAR A;  2PM7 B;  1ERJ A;  3C75 H;  1NEX B;  2H9P A;  4BH6 A;  2Z2N A;  4QQE A;  2EIC A;  4RE6 A;  5GXH A;  2H14 A;  3NIF A;  3MVD K;  3SLE D; 
#chains in the Genus database with same CATH homology
 4Z8L A;  4A08 A;  3OTT A;  3IIY A;  1VYH C;  5EM2 B;  3EI1 A;  2AGL A;  4Y5R D;  4XEI C;  2B5N A;  2H3X A;  3F3F A;  1S4U X;  1A0R B;  3IJ0 A;  2PM9 B;  2XL2 A;  2YBA A;  2OVR B;  4BUJ C;  5IJ7 E;  4PSX B;  4ERZ A;  5EM2 A;  3K27 A;  3ODT A;  3P4F A;  4JT6 C;  5FKT A;  3SFZ A;  3UVL A;  5IGO A;  2YMU A;  4JSP C;  4GM9 A;  5FA5 B;  4A09 B;  4A0B B;  2CE8 A;  4CY2 A;  4J84 A;  3I7L A;  4JT5 C;  2OVQ B;  2BCJ B;  2PM9 A;  2I0R A;  1TYQ C;  3MZL A;  4TZ4 A;  2P9U C;  3KRW B;  4J0W A;  2Z2P A;  4CI1 A;  3OKW A;  2J57 G;  4A09 A;  1MG3 A;  5EAM A;  4PC0 A;  4UI9 R;  4O3U B;  2IUP A;  2H68 A;  3AL9 A;  5EMK B;  4XYH A;  2IUR A;  4LG8 A;  3I7O A;  5AMS A;  3CFS B;  2OJY A;  3JB9 L;  4QL1 A;  1NR0 A;  3F3G A;  4J87 A;  2OVP B;  3PE7 A;  2H6N A;  2GC4 A;  4J79 A;  2UZY B;  5GXI A;  4X60 B;  4A11 B;  4BL0 A;  4KFM B;  3B7F A;  3VA6 A;  5KDO B;  2XYI A;  1PI6 A;  3PXW D;  2I3S A;  2O9K A;  5HE2 B;  3EWE A;  4FWW A;  1K8K C;  4LG9 A;  4ZOZ A;  1PEV A;  4A11 A;  2B5L A;  3I7P A;  3SBQ A;  5IJ8 E;  5K1C C;  3PVW B;  3RN0 D;  1PBY B;  4K3J B;  5HYN B;  3FM0 A;  3L4O D;  3ORV D;  3UKR C;  3AL8 A;  5JWZ A;  4QT8 A;  1GP2 B;  5CXB B;  5TEF A;  2QC5 A;  3DXK C;  2XU7 A;  5GMK n;  5C2V B;  2AQ5 A;  1PGU A;  3SXT D;  4ERQ A;  4FA9 D;  5TF2 A;  3AFC A;  4OWR A;  2AGW A;  3MKS B;  5IC7 A;  5CXB A;  2OIZ A;  3BG1 A;  3SMR A;  3C99 A;  5EAL A;  4E54 B;  2HJ4 A;  3RMZ D;  3JPX A;  4FHL A;  4GM8 A;  3UVN A;  3JRP A;  2P9N C;  2HKR A;  3RFG A;  3MKQ A;  5CYK B;  5EMM B;  3I8C A;  2HKM A;  3DM0 A;  3SJL D;  4FA4 D;  4E54 A;  2MTA H;  4JSN C;  5AFU 3;  1YFQ A;  1XKS A;  5TEE A;  4A0A B;  5CYK A;  3MMY A;  5IGQ A;  3CIK B;  3SWS D;  4OZU A;  4GQB B;  1JOF A;  2PBI B;  5FKQ A;  4PBZ A;  4XYI A;  1XIP A;  4R7A B;  2YNN A;  1B9X A;  3I8E A;  2H9L A;  1U2V C;  2H6K A;  2TRC B;  5HE0 B;  1MG2 A;  4A0B A;  4EWR A;  2CNX A;  2HJB A;  2OK4 A;  3MZK A;  3UR4 A;  2CN2 A;  3JZH A;  1RI6 A;  3DWL C;  4YVD A;  5H14 A;  2EBS A;  4X63 B;  4D6V A;  4X61 B;  2BBK H;  5FQD A;  3DXM C;  3NVX A;  4CC9 A;  4ERY A;  3IJ1 A;  5I5I A;  5EML B;  4GZ8 A;  4O45 A;  1SQ9 A;  3EMH A;  2Z2O A;  4J0X A;  4J86 A;  4X3E A;  3PVU B;  2AGZ A;  2P9L C;  3JZN A;  3NVQ A;  3C5M A;  2GC7 A;  5H1M A;  4U1E I;  1B9Y A;  4E5Z B;  2IAA A;  3V9F A;  3BG0 A;  3RRM C;  2IUQ A;  3EI2 B;  2H13 A;  4J77 A;  4ZOY A;  4K3I D;  3OL2 B;  1SHY B;  5EMJ B;  4GGC A;  5FXY A;  2YNO A;  4G56 B;  3OKY B;  1U4C A;  4O1Q D;  2HXC A;  2CE9 A;  4MK0 B;  4J8B A;  4J81 A;  3I7K A;  3JZG A;  4HDJ A;  4GM3 A;  2H47 A;  2B4E A;  3EI2 A;  4L3G D;  2G99 A;  2P9S C;  3OL2 A;  3HFQ A;  5HE1 B;  4CY5 A;  4CI8 A;  2H9M A;  3RSE C;  4PNK B;  3NVN A;  3N0E A;  5TDH B;  4GGA A;  2W18 A;  5IT9 g;  5A2Q g;  3SN6 B;  1R5M A;  2J55 H;  3UKU C;  5FLX g;  3JAM g;  3SVW D;  5I5M A;  4JD2 C;  4JSV C;  5C2W B;  2XL3 A;  3J81 g;  4L1Q D;  3I7N A;  2OK6 A;  1OLZ A;  1QNI A;  3I2N A;  4IMM A;  2AGY A;  1GXR A;  5FKR A;  5H17 A;  2P9K C;  4CY3 A;  1OMW B;  3PSC B;  4I79 A;  3EU7 A;  4N14 A;  3UVM A;  4ZN4 A;  4CZY A;  4O3T B;  4L9O A;  5FKS A;  5HE3 B;  4ES0 A;  4CZV A;  4J73 A;  5AJA A;  4JSX C;  3DSM A;  2Q7Q A;  3A0F A;  1N6F A;  1JMZ B;  3F3P A;  3SCY A;  5EAP A;  3L4M D;  2H9N A;  4GQ1 A;  4CI3 A;  2PM6 B;  1N6E A;  5K19 A;  5HQG A;  4L3H D;  4J78 A;  1P22 A;  2GNQ A;  3AH8 B;  3SBR A;  4A2M A;  3MXX A;  3GFC A;  4IA9 A;  1GG2 B;  4A7J A;  3OW8 A;  2J56 H;  2P9I C;  3UVK A;  3RLM D;  3UVO A;  4PSW B;  2B5M A;  4U7A A;  4CI2 A;  4A0A A;  3PXT D;  5THA A;  5CXC B;  5SXM A;  4QRJ A;  3ULE C;  4FB1 D;  3RFH A;  1N6D A;  4FAV D;  3SHF A;  4A2L A;  4ZOX A;  1SQJ A;  3EI4 B;  5CXC A;  3N0D A;  4AOW A;  3U4Y A;  4D0K A;  2CN3 A;  4CZX A;  3EG6 A;  4GMB A;  3GRE A;  3E0C A;  1XHM A;  2I0S A;  3JRO A;  4FAN D;  3EI4 A;  3W15 A;  1K32 A;  2CO0 A;  4PXW A;  4Y7R A;  1GOT B;  3VGZ A;  2AH0 A;  4FA5 D;  4GQ2 P;  2H6Q A;  5C9Z B;  4E5Z A;  2I0T A;  2CO0 C;  3PXS D;  2IWK A;  3I7H A;  3EI3 B;  3PSL A;  1L0Q A;  4AEZ A;  3VH0 A;  3OKY A;  2AH1 A;  4J82 A;  1FWX A;  4GGD A;  5GSA A;  2YNP A;  3ZWL B;  3CFV A;  5B4W A;  5I5J A;  3I89 A;  3EI3 A;  1JJU B;  1MDA H;  2I3T A;  2YB8 B;  2HYE A;  1JMX B;  3AL8 B;  3K26 A;  3C9C A;  4ESG A;  3V5W B;  4O9D A;  2IWF A;  4FA1 D;  3FRX A;  4JXM A;  1Q47 A;  3RN1 D;  4J8G A;  2G9A A;  2AGX A;  2UZX B;  3BWS A;  1TBG A;  3V7D B;  3OKT A;  3IJC A;  3IIW A;  4PBY A;  4H5I A;  2IUV A;  4NSX A;  2HES X;  3J80 g;  2QXV A;  3IKO A;  4ZOV A;  4LGN A;  4A08 B;  4CY1 A;  3KRX B;  4H5J A;  3SBP A;  3FGB A;  2P9P C;  3EI1 B;  5EAR A;  2PM7 B;  1ERJ A;  3C75 H;  1NEX B;  2H9P A;  4BH6 A;  2Z2N A;  4QQE A;  5GXH A;  2H14 A;  3SLE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...