2I0TA

Crystal structure of phenylacetaldehyde derived r-carbinolamine adduct of aromatic amine dehydrogenase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 104
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i0tA01
2H6KA 3VA6A 3HFQA 1P22A 3EI2A 4XYIA 5FKTA 2HJBA 1PBYB 3JZNA 4U1EI 2AGXA 3NVQA 3PVUB 2YMUA 4A11B 3SWSD 3EI3A 3EI2B 4GZ8A 5TEEA 2BCJB 3VH0A 4A0AA 2P9LC 5C9ZB 3C99A 4D6VA 2H9PA 3AL8B 5GXHA 2CO0A 2HYEA 4A0BA 1K32A 2MTAH 3RRMC 4FWWA 2Z2PA 4CY1A 4O9DA 3U4YA 5K19A 4JSNC 4L3GD 1XKSA 4G56B 5H17A 1XHMA 1B9YA 3L4MD 1PI6A 4JXMA 4E5ZB 2OK6A 5GXIA 5HQGA 2PM6B 4CI8A 3JB9L 2Z2NA 5HE0B 4J0XA 2B4EA 3SBPA 4TZ4A 4GQ2P 5K1CC 3C5MA 4J86A 3JRPA 2PM9B 4GGDA 4A2MA 2OK4A 4LG8A 4O1QD 5EMKB 3N0EA 4FA5D 5TDHB 4PBYA 4CI3A 4J84A 4L9OA 1U2VC 4L1QD 3I7PA 5A2Qg 4FB1D 3A0FA 3DM0A 3W15A 3FM0A 1S4UX 3V7DB 5GMKn 2IUQA 3DXMC 3UKRC 2OVQB 4ERZA 3AFCA 3EWEA 3EI4B 2H13A 3FGBA 1GXRA 4CI2A 4ZN4A 2IWKA 5C2VB 5FKQA 4FAND 1JOFA 1Q47A 3JZGA 5FLXg 2P9IC 4CY5A 3OKYB 2P9PC 3RLMD 2AGWA 5IT9g 1GOTB 1ERJA 4GQBB 3EI1B 2GC4A 5EAMA 4OZUA 4O3UB 4CY3A 2CN2A 2I0SA 3PE7A 4O45A 5HE3B 3OW8A 3OKYA 4L3HD 1TBGA 4J82A 2EBSA 2IWFA 4X63B 2AGLA 4J73A 5HYNB 2XL2A 4BH6A 5EAPA 4JT6C 5CXBA 3KRWB 3EMHA 3E0CA 4E54A 4A7JA 4ZOYA 1OLZA 2BBKH 4CY2A 3AH8B 4XYHA 5B4WA 5SXMA 2PM7B 3VGZA 3I7LA 2B5MA 3N0DA 3MKQA 5FKSA 2YB8B 3JZHA 1QNIA 4XEIC 2H6NA 3I7HA 5KDOB 3F3PA 4LGNA 4EWRA 5IGQA 5AFU3 4FA9D 4GGAA 5EMLB 5EMJB 2B5NA 2P9NC 4JT5C 5JWZA 2XL3A 2YNOA 4X60B 3OTTA 3I89A 2GC7A 5I5JA 1NEXB 1N6FA 2HXCA 2P9SC 2AGYA 4U7AA 4GGCA 4GM3A 4FA4D 4A2LA 3MKSB 3C75H 4J79A 3EI1A 2IUPA 3V9FA 3F3FA 4J0WA 3UVKA 4J8GA 2J55H 4Z8LA 4GQ1A 5IJ8E 1SQ9A 4CI1A 5CYKA 2OIZA 5EM2B 2YBAA 4FHLA 2W18A 3EU7A 3KRXB 3DSMA 3IKOA 2PBIB 1TYQC 3CIKB 4IMMA 2I0RA 5CXCB 2J56H 4ERQA 4J87A 4PSWB 3I8CA 1MG3A 5GSAA 4OWRA 3PSCB 5C2WB 1B9XA 4PBZA 2OJYA 4PSXB 3RFGA 1VYHC 5AMSA 2TRCB 4K3ID 4ZOXA 2H14A 4CZXA 4QL1A 5FXYA 4PNKB 4YVDA 5H14A 3L4OD 3OL2A 4ZOZA 1U4CA 5EMMB 3BWSA 4CC9A 2B5LA 2H68A 3ODTA 5HE1B 4AEZA 1JJUB 3OKWA 4QQEA 3UVNA 3BG0A 5TEFA 3J81g 1OMWB 3CFSB 2GNQA 2J57G 3EI3B 4JSVC 2CO0C 4N14A 4JD2C 5FA5B 5I5IA 4CZVA 1MDAH 3OKTA 3PSLA 5IJ7E 3RN0D 3RFHA 5H1MA 3SHFA 3PVWB 3ZWLB 4ERYA 1GP2B 5CYKB 3K26A 5THAA 2YNNA 1MG2A 1NR0A 4ES0A 3JPXA 5CXBB 1SHYB 3NVNA 5EM2A 2O9KA 3UVLA 1PGUA 4HDJA 2P9KC 1N6EA 3IJ0A 4Y5RD 3NVXA 2AGZA 2H6QA 3SMRA 2OVRB 5IGOA 2HJ4A 4JSPC 5AJAA 4D0KA 3FRXA 5EARA 3SBRA 2I3TA 3C9CA 2P9UC 2I3SA 3UVOA 2G99A 3SFZA 4A09A 3EG6A 4J77A 3SJLD 4A08B 1RI6A 3SCYA 4GMBA 3OL2B 2AH1A 3ORVD 3SN6B 2UZXB 3AL9A 4MK0B 2CNXA 4GM9A 2HKRA 2QXVA 1YFQA 4NSXA 3CFVA 4Y7RA 2UZYB 3GREA 4O3TB 4PC0A 5HE2B 2YNPA 3B7FA 2CN3A 3J80g 3I7NA 1FWXA 4BL0A 3F3GA 4R7AB 3SXTD 1PEVA 2QC5A 2CE8A 4ZOVA 2G9AA 4JSXC 4UI9R 3GFCA 2Q7QA 2CE9A 5I5MA 3RSEC 2OVPB 2I0TA 4IA9A 2H9LA 2XYIA 4A11A 3UVMA 1L0QA 2H3XA 3PXTD 3PXWD 3SLED 3I2NA 3RMZD 1JMZB 4A0AB 2Z2OA 4PXWA 3P4FA 4J81A 4A0BB 2IURA 4X3EA 1GG2B 3EI4A 3I7OA 2IAAA 3AL8A 4I79A 4LG9A 5FQDA 4K3JB 5IC7A 3JAMg 3V5WB 4E54B 4E5ZA 4H5IA 4X61B 3MZKA 4QT8A 3UKUC 3DXKC 2H9MA 5FKRA 5EALA 3IJCA 1N6DA 2AQ5A 3IJ1A 4GM8A 2H9NA 3BG1A 1SQJA 4KFMB 4A08A 5CXCA 3MMYA 4CZYA 3I7KA 4FAVD 3MZLA 3I8EA 3IIWA 4QRJA 5TF2A 2PM9A 3ULEC 3PXSD 3SBQA 4J78A 4ESGA 1JMXB 4BUJC 3UR4A 1A0RB 4J8BA 2IUVA 3DWLC 2HKMA 3SVWD 4H5JA 2AH0A 2XU7A 3IIYA 4FA1D 3RN1D 3K27A 2HESX 3MXXA 4AOWA 4A09B 1XIPA 3JROA 2H47A 1K8KC 1R5MA
chains in the Genus database with same CATH superfamily
1GOHA 2H6KA 3VA6A 3HFQA 2VDPA 1P22A 3EI2A 4XYIA 3IURA 5FKTA 2HJBA 1PBYB 3JZNA 4U1EI 4WK4A 2AGXA 1E5TA 3NVQA 3PVUB 1O6FA 2YMUA 1A12A 4A11B 3SWSD 1VZ2A 3EI3A 3EI2B 4GZ8A 5TEEA 2BCJB 3VH0A 4JHNA 4A0AA 2P9LC 3EQ8A 5C9ZB 3C99A 4D6VA 2H9PA 4AMYA 3AL8B 5GXHA 2CO0A 2HYEA 5M5TA 1K32A 2MTAH 3RRMC 4A0BA 4FWWA 2Z2PA 4CY1A 4O9DA 3MUNA 3U4YA 5K19A 4JSNC 4L3GD 1XKSA 4G56B 5H17A 1XHMA 1B9YA 3L4MD 1PI6A 4JXMA 4E5ZB 2OK6A 1H2ZA 5GXIA 5HQGA 2PM6B 4CI8A 3JB9L 2Z2NA 2VDLA 5HE0B 5C86A 4J0XA 2B4EA 3SBPA 4MMZA 4TZ4A 3O4IA 4GQ2P 5K1CC 5M5VA 1E8MA 3C5MA 3NIFA 4J86A 2XZGA 3JRPA 2PM9B 4GGDA 4G55A 4A2MA 1GOGA 2OK4A 4LG8A 4O1QD 3T3PA 3K71A 5EMKB 3N0EA 4UM8A 1QFSA 4FA5D 5TDHB 4BCCA 4PBYA 4CI3A 4J84A 4L9OA 2HU7A 1U2VC 5M5UA 3EQ9A 4L1QD 3I7PA 5A2Qg 4FB1D 3A0FA 3DM0A 3W15A 4RE6A 3FM0A 4BP8A 1S4UX 4NENA 3V7DB 2VDMA 3ZE2A 5GMKn 2IUQA 1QFMA 3DXMC 3UKRC 2OVQB 4ERZA 3AFCA 3EWEA 3EI4B 1UOOA 2H13A 3FGBA 4WK0A 1GXRA 4CI2A 4ZN4A 2IWKA 3FCSA 5FKQA 5C2VB 4FAND 1JOFA 1Q47A 3JZGA 5FLXg 2P9IC 4CY5A 3V4VA 3OKYB 2VZ1A 2P9PC 3RLMD 2AGWA 5IT9g 1GOTB 1ERJA 4GQBB 4NBMA 3EI1B 2GC4A 5EAMA 4OZUA 4O3UB 4CY3A 2CN2A 2I0SA 3PE7A 4O45A 3GC3B 3FCUA 3OW8A 5HE3B 3OKYA 4L3HD 1BPOA 1TBGA 4J82A 1T2XA 2EBSA 2VDQA 2IWFA 4X63B 5C92A 2AGLA 4J73A 5HYNB 2XL2A 3IJEA 4BP9A 4DNVA 4BH6A 5EAPA 4JT6C 5CXBA 3KRWB 3EMHA 3NIGA 4Z7NA 3E0CA 4E54A 4A7JA 4ZOYA 2BKLA 1OLZA 2BBKH 1H2WA 4CY2A 1C9IA 3AH8B 4XYHA 2EICA 5B4WA 5SXMA 2PM7B 3VGZA 3ZDXA 3I7LA 2B5MA 3GD1I 3N0DA 3MKQA 5FKSA 2YB8B 3JZHA 1QNIA 4XEIC 2H6NA 3I7HA 5KDOB 3F3PA 4MMYA 4LGNA 4BCDA 4EWRA 2EIBA 5IGQA 5AFU3 4FA9D 4GGAA 5EMLB 5EMJB 4DNWA 3ZDZA 1C9LA 2B5NA 2P9NC 4JT5C 5JWZA 2XL3A 2YNOA 4X60B 3OTTA 3I89A 2GC7A 5I5JA 1NEXB 1N6FA 2HXCA 5M5SA 2P9SC 2AGYA 4U7AA 4GGCA 4GM3A 4FA4D 4A2LA 3MKSB 3C75H 4J79A 3EI1A 2IUPA 3V9FA 3F3FA 4J0WA 3UVKA 4L1MA 3IULA 4J8GA 2J55H 3DDUA 4GQ1A 4Z8LA 5IJ8E 1SQ9A 4CI1A 5CYKA 2VDOA 2OIZA 5EM2B 2YBAA 4FHLA 4QAMA 2W18A 3EU7A 4O02A 3KRXB 3DSMA 2VC2A 1VE7A 3IKOA 2PBIB 1TYQC 3CIKB 4IMMA 2I0RA 5M61A 4AMZA 5CXCB 2J56H 4ERQA 4J87A 4PSWB 3I8CA 3IUMA 1MG3A 5GSAA 4OWRA 3PSCB 5C2WB 1B9XA 4PBZA 2OJYA 4PSXB 2EIEA 3RFGA 1VYHC 5AMSA 2TRCB 4K3ID 4ZOXA 2H14A 4CZXA 2WQ8A 4QL1A 5FXYA 4MMXA 4PNKB 3IUNA 4UM9A 4NC4A 4YVDA 5H14A 3L4OD 1UTCA 3OL2A 1UOQA 3ZE1A 3QHYB 4ZOZA 1VE6A 1U4CA 5EMMB 3BWSA 4CC9A 2B5LA 1H2YA 4AN0A 4AN1A 2H68A 3ODTA 5HE1B 4AEZA 1JJUB 3OKWA 4QQEA 3UVNA 3BG0A 5TEFA 3J81g 1OMWB 3CFSB 2GNQA 2J57G 3EI3B 4JSVC 2CO0C 1JTDB 4N14A 4JD2C 5FA5B 5I5IA 2XE4A 3T3MA 1MDAH 4CZVA 3OKTA 4AX4A 3PSLA 5IJ7E 3RN0D 3RFHA 4WK2A 5H1MA 3NIDA 3SHFA 3PVWB 3O4HA 3ZWLB 4ERYA 1GP2B 5CYKB 1UOPA 4DNUA 3K26A 5THAA 2YNNA 1L5GA 1MG2A 1NR0A 2EIDA 4ES0A 3JPXA 4NAAA 1SHYB 5CXBB 3NVNA 5EM2A 5FFOA 2O9KA 3UVLA 2VZ3A 1PGUA 4HDJA 2P9KC 1N6EA 3IJ0A 3IUJA 3MUOA 4Y5RD 3NVXA 2AGZA 2H6QA 3SMRA 2OVRB 5IGOA 2HJ4A 5E6UA 3OF7A 4JHPC 1YR2A 4JSPC 5AJAA 4D0KA 3FRXA 5EARA 3SBRA 2I3TA 3C9CA 4G1EA 2P9UC 1M1XA 2I3SA 1TYEA 3UVOA 2QZPA 2G99A 3SFZA 4A09A 3EG6A 4J77A 3SJLD 4A08B 1RI6A 3SCYA 3MVDK 4GMBA 3OL2B 2AH1A 5FFGA 3ORVD 5E6SA 3SN6B 3ZDYA 1U8CA 2UZXB 3AL9A 4IRZA 3O4JA 2CNXA 4MK0B 4GM9A 2HKRA 2QXVA 2VDNA 5M5RA 1YFQA 4NSXA 3V4PA 3CFVA 4Y7RA 3K72A 2UZYB 4D9SA 3GREA 4O3TB 4PC0A 5HE2B 2YNPA 3B7FA 2CN3A 3J80g 3I7NA 3IUQA 1FWXA 3KCIA 4BL0A 3F3GA 4RE5A 2XDWA 4R7AB 3SXTD 1PEVA 2QC5A 2CE8A 4ZOVA 2G9AA 1O6GA 4JSXC 3GFCA 2Q7QA 2CE9A 4UI9R 1E8NA 4Z7QA 5I5MA 3RSEC 2OVPB 2I0TA 4IA9A 2H9LA 2XYIA 4A11A 3UVMA 1L0QA 2H3XA 3PXTD 3PXWD 3SLED 3I2NA 1I2MB 3RMZD 1JMZB 4A0AB 2Z2OA 4PXWA 3P4FA 4J81A 4A0BB 2IURA 4X3EA 1GG2B 3EI4A 3I7OA 2IAAA 3AL8A 4I79A 4G1MA 5E6RA 4LG9A 5FQDA 4K3JB 2HU8A 5IC7A 4Z7OA 3JAMg 3V5WB 4WJKA 1K3IA 5HDBA 4E54B 1JV2A 2JKXA 4E5ZA 4H5IA 4X61B 3MZKA 4QT8A 3UKUC 3DXKC 2H9MA 5FKRA 2VDRA 5EALA 3IJCA 3K6SA 1N6DA 4O2WA 2AQ5A 1H2XA 3IJ1A 4GM8A 2H9NA 3BG1A 1SQJA 4KFMB 4A08A 5CXCA 3MMYA 4CZYA 3I7KA 4FAVD 3MZLA 3I8EA 2HU5A 4BCBA 3IIWA 4QRJA 2QR5A 2PM9A 5TF2A 3ULEC 3PXSD 3SBQA 4J78A 4ESGA 3VI3A 1JMXB 3O4GA 4BUJC 3QI0A 3UR4A 1A0RB 4J8BA 2IUVA 1VZ3A 3DWLC 1GOFA 2HKMA 3SVWD 4H5JA 2AH0A 2XU7A 3IIYA 4FA1D 3RN1D 2VDKA 3ZE0A 3K27A 2HESX 3MXXA 4AOWA 4A09B 3VI4A 1XIPA 3EQ7A 3JROA 2H47A 3IVMA 1K8KC 1R5MA
chains in the Genus database with same CATH topology
2H6KA 3VA6A 3HFQA 1P22A 3EI2A 4XYIA 5FKTA 2HJBA 1PBYB 3JZNA 4U1EI 2AGXA 3NVQA 3PVUB 2YMUA 4A11B 3SWSD 3EI3A 3EI2B 4GZ8A 5TEEA 2BCJB 3VH0A 4A0AA 2P9LC 5C9ZB 3C99A 4D6VA 2H9PA 3AL8B 5GXHA 2CO0A 2HYEA 4A0BA 1K32A 2MTAH 3RRMC 4FWWA 2Z2PA 4CY1A 4O9DA 3U4YA 5K19A 4JSNC 4L3GD 1XKSA 4G56B 5H17A 1XHMA 1B9YA 3L4MD 1PI6A 4JXMA 4E5ZB 2OK6A 5GXIA 5HQGA 2PM6B 4CI8A 3JB9L 2Z2NA 5HE0B 4J0XA 2B4EA 3SBPA 4TZ4A 4GQ2P 5K1CC 3C5MA 4J86A 3JRPA 2PM9B 4GGDA 4A2MA 2OK4A 4LG8A 4O1QD 5EMKB 3N0EA 4FA5D 5TDHB 4PBYA 4CI3A 4J84A 4L9OA 1U2VC 4L1QD 3I7PA 5A2Qg 4FB1D 3A0FA 3DM0A 3W15A 3FM0A 1S4UX 3V7DB 5GMKn 2IUQA 3DXMC 3UKRC 2OVQB 4ERZA 3AFCA 3EWEA 3EI4B 2H13A 3FGBA 1GXRA 4CI2A 4ZN4A 2IWKA 5C2VB 5FKQA 4FAND 1JOFA 1Q47A 3JZGA 5FLXg 2P9IC 4CY5A 3OKYB 2P9PC 3RLMD 2AGWA 5IT9g 1GOTB 1ERJA 4GQBB 3EI1B 2GC4A 5EAMA 4OZUA 4O3UB 4CY3A 2CN2A 2I0SA 3PE7A 4O45A 5HE3B 3OW8A 3OKYA 4L3HD 1TBGA 4J82A 2EBSA 2IWFA 4X63B 2AGLA 4J73A 5HYNB 2XL2A 4BH6A 5EAPA 4JT6C 5CXBA 3KRWB 3EMHA 3E0CA 4E54A 4A7JA 4ZOYA 1OLZA 2BBKH 4CY2A 3AH8B 4XYHA 5B4WA 5SXMA 2PM7B 3VGZA 3I7LA 2B5MA 3N0DA 3MKQA 5FKSA 2YB8B 3JZHA 1QNIA 4XEIC 2H6NA 3I7HA 5KDOB 3F3PA 4LGNA 4EWRA 5IGQA 5AFU3 4FA9D 4GGAA 5EMLB 5EMJB 2B5NA 2P9NC 4JT5C 5JWZA 2XL3A 2YNOA 4X60B 3OTTA 3I89A 2GC7A 5I5JA 1NEXB 1N6FA 2HXCA 2P9SC 2AGYA 4U7AA 4GGCA 4GM3A 4FA4D 4A2LA 3MKSB 3C75H 4J79A 3EI1A 2IUPA 3V9FA 3F3FA 4J0WA 3UVKA 4J8GA 2J55H 4Z8LA 4GQ1A 5IJ8E 1SQ9A 4CI1A 5CYKA 2OIZA 5EM2B 2YBAA 4FHLA 2W18A 3EU7A 3KRXB 3DSMA 3IKOA 2PBIB 1TYQC 3CIKB 4IMMA 2I0RA 5CXCB 2J56H 4ERQA 4J87A 4PSWB 3I8CA 1MG3A 5GSAA 4OWRA 3PSCB 5C2WB 1B9XA 4PBZA 2OJYA 4PSXB 3RFGA 1VYHC 5AMSA 2TRCB 4K3ID 4ZOXA 2H14A 4CZXA 4QL1A 5FXYA 4PNKB 4YVDA 5H14A 3L4OD 3OL2A 4ZOZA 1U4CA 5EMMB 3BWSA 4CC9A 2B5LA 2H68A 3ODTA 5HE1B 4AEZA 1JJUB 3OKWA 4QQEA 3UVNA 3BG0A 5TEFA 3J81g 1OMWB 3CFSB 2GNQA 2J57G 3EI3B 4JSVC 2CO0C 4N14A 4JD2C 5FA5B 5I5IA 4CZVA 1MDAH 3OKTA 3PSLA 5IJ7E 3RN0D 3RFHA 5H1MA 3SHFA 3PVWB 3ZWLB 4ERYA 1GP2B 5CYKB 3K26A 5THAA 2YNNA 1MG2A 1NR0A 4ES0A 3JPXA 5CXBB 1SHYB 3NVNA 5EM2A 2O9KA 3UVLA 1PGUA 4HDJA 2P9KC 1N6EA 3IJ0A 4Y5RD 3NVXA 2AGZA 2H6QA 3SMRA 2OVRB 5IGOA 2HJ4A 4JSPC 5AJAA 4D0KA 3FRXA 5EARA 3SBRA 2I3TA 3C9CA 2P9UC 2I3SA 3UVOA 2G99A 3SFZA 4A09A 3EG6A 4J77A 3SJLD 4A08B 1RI6A 3SCYA 4GMBA 3OL2B 2AH1A 3ORVD 3SN6B 2UZXB 3AL9A 4MK0B 2CNXA 4GM9A 2HKRA 2QXVA 1YFQA 4NSXA 3CFVA 4Y7RA 2UZYB 3GREA 4O3TB 4PC0A 5HE2B 2YNPA 3B7FA 2CN3A 3J80g 3I7NA 1FWXA 4BL0A 3F3GA 4R7AB 3SXTD 1PEVA 2QC5A 2CE8A 4ZOVA 2G9AA 4JSXC 4UI9R 3GFCA 2Q7QA 2CE9A 5I5MA 3RSEC 2OVPB 2I0TA 4IA9A 2H9LA 2XYIA 4A11A 3UVMA 1L0QA 2H3XA 3PXTD 3PXWD 3SLED 3I2NA 3RMZD 1JMZB 4A0AB 2Z2OA 4PXWA 3P4FA 4J81A 4A0BB 2IURA 4X3EA 1GG2B 3EI4A 3I7OA 2IAAA 3AL8A 4I79A 4LG9A 5FQDA 4K3JB 5IC7A 3JAMg 3V5WB 4E54B 4E5ZA 4H5IA 4X61B 3MZKA 4QT8A 3UKUC 3DXKC 2H9MA 5FKRA 5EALA 3IJCA 1N6DA 2AQ5A 3IJ1A 4GM8A 2H9NA 3BG1A 1SQJA 4KFMB 4A08A 5CXCA 3MMYA 4CZYA 3I7KA 4FAVD 3MZLA 3I8EA 3IIWA 4QRJA 5TF2A 2PM9A 3ULEC 3PXSD 3SBQA 4J78A 4ESGA 1JMXB 4BUJC 3UR4A 1A0RB 4J8BA 2IUVA 3DWLC 2HKMA 3SVWD 4H5JA 2AH0A 2XU7A 3IIYA 4FA1D 3RN1D 3K27A 2HESX 3MXXA 4AOWA 4A09B 1XIPA 3JROA 2H47A 1K8KC 1R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6K A;  3VA6 A;  3HFQ A;  1P22 A;  3EI2 A;  4XYI A;  5FKT A;  2HJB A;  1PBY B;  3JZN A;  4U1E I;  2AGX A;  3NVQ A;  3PVU B;  2YMU A;  4A11 B;  3SWS D;  3EI3 A;  3EI2 B;  4GZ8 A;  5TEE A;  2BCJ B;  3VH0 A;  4A0A A;  2P9L C;  5C9Z B;  3C99 A;  4D6V A;  2H9P A;  3AL8 B;  5GXH A;  2CO0 A;  2HYE A;  4A0B A;  1K32 A;  2MTA H;  3RRM C;  4FWW A;  2Z2P A;  4CY1 A;  4O9D A;  3U4Y A;  5K19 A;  4JSN C;  4L3G D;  1XKS A;  4G56 B;  5H17 A;  1XHM A;  1B9Y A;  3L4M D;  1PI6 A;  4JXM A;  4E5Z B;  2OK6 A;  5GXI A;  5HQG A;  2PM6 B;  4CI8 A;  3JB9 L;  2Z2N A;  5HE0 B;  4J0X A;  2B4E A;  3SBP A;  4TZ4 A;  4GQ2 P;  5K1C C;  3C5M A;  4J86 A;  3JRP A;  2PM9 B;  4GGD A;  4A2M A;  2OK4 A;  4LG8 A;  4O1Q D;  5EMK B;  3N0E A;  4FA5 D;  5TDH B;  4PBY A;  4CI3 A;  4J84 A;  4L9O A;  1U2V C;  4L1Q D;  3I7P A;  5A2Q g;  4FB1 D;  3A0F A;  3DM0 A;  3W15 A;  3FM0 A;  1S4U X;  3V7D B;  5GMK n;  2IUQ A;  3DXM C;  3UKR C;  2OVQ B;  4ERZ A;  3AFC A;  3EWE A;  3EI4 B;  2H13 A;  3FGB A;  1GXR A;  4CI2 A;  4ZN4 A;  2IWK A;  5C2V B;  5FKQ A;  4FAN D;  1JOF A;  1Q47 A;  3JZG A;  5FLX g;  2P9I C;  4CY5 A;  3OKY B;  2P9P C;  3RLM D;  2AGW A;  5IT9 g;  1GOT B;  1ERJ A;  4GQB B;  3EI1 B;  2GC4 A;  5EAM A;  4OZU A;  4O3U B;  4CY3 A;  2CN2 A;  2I0S A;  3PE7 A;  4O45 A;  5HE3 B;  3OW8 A;  3OKY A;  4L3H D;  1TBG A;  4J82 A;  2EBS A;  2IWF A;  4X63 B;  2AGL A;  4J73 A;  5HYN B;  2XL2 A;  4BH6 A;  5EAP A;  4JT6 C;  5CXB A;  3KRW B;  3EMH A;  3E0C A;  4E54 A;  4A7J A;  4ZOY A;  1OLZ A;  2BBK H;  4CY2 A;  3AH8 B;  4XYH A;  5B4W A;  5SXM A;  2PM7 B;  3VGZ A;  3I7L A;  2B5M A;  3N0D A;  3MKQ A;  5FKS A;  2YB8 B;  3JZH A;  1QNI A;  4XEI C;  2H6N A;  3I7H A;  5KDO B;  3F3P A;  4LGN A;  4EWR A;  5IGQ A;  5AFU 3;  4FA9 D;  4GGA A;  5EML B;  5EMJ B;  2B5N A;  2P9N C;  4JT5 C;  5JWZ A;  2XL3 A;  2YNO A;  4X60 B;  3OTT A;  3I89 A;  2GC7 A;  5I5J A;  1NEX B;  1N6F A;  2HXC A;  2P9S C;  2AGY A;  4U7A A;  4GGC A;  4GM3 A;  4FA4 D;  4A2L A;  3MKS B;  3C75 H;  4J79 A;  3EI1 A;  2IUP A;  3V9F A;  3F3F A;  4J0W A;  3UVK A;  4J8G A;  2J55 H;  4Z8L A;  4GQ1 A;  5IJ8 E;  1SQ9 A;  4CI1 A;  5CYK A;  2OIZ A;  5EM2 B;  2YBA A;  4FHL A;  2W18 A;  3EU7 A;  3KRX B;  3DSM A;  3IKO A;  2PBI B;  1TYQ C;  3CIK B;  4IMM A;  2I0R A;  5CXC B;  2J56 H;  4ERQ A;  4J87 A;  4PSW B;  3I8C A;  1MG3 A;  5GSA A;  4OWR A;  3PSC B;  5C2W B;  1B9X A;  4PBZ A;  2OJY A;  4PSX B;  3RFG A;  1VYH C;  5AMS A;  2TRC B;  4K3I D;  4ZOX A;  2H14 A;  4CZX A;  4QL1 A;  5FXY A;  4PNK B;  4YVD A;  5H14 A;  3L4O D;  3OL2 A;  4ZOZ A;  1U4C A;  5EMM B;  3BWS A;  4CC9 A;  2B5L A;  2H68 A;  3ODT A;  5HE1 B;  4AEZ A;  1JJU B;  3OKW A;  4QQE A;  3UVN A;  3BG0 A;  5TEF A;  3J81 g;  1OMW B;  3CFS B;  2GNQ A;  2J57 G;  3EI3 B;  4JSV C;  2CO0 C;  4N14 A;  4JD2 C;  5FA5 B;  5I5I A;  4CZV A;  1MDA H;  3OKT A;  3PSL A;  5IJ7 E;  3RN0 D;  3RFH A;  5H1M A;  3SHF A;  3PVW B;  3ZWL B;  4ERY A;  1GP2 B;  5CYK B;  3K26 A;  5THA A;  2YNN A;  1MG2 A;  1NR0 A;  4ES0 A;  3JPX A;  5CXB B;  1SHY B;  3NVN A;  5EM2 A;  2O9K A;  3UVL A;  1PGU A;  4HDJ A;  2P9K C;  1N6E A;  3IJ0 A;  4Y5R D;  3NVX A;  2AGZ A;  2H6Q A;  3SMR A;  2OVR B;  5IGO A;  2HJ4 A;  4JSP C;  5AJA A;  4D0K A;  3FRX A;  5EAR A;  3SBR A;  2I3T A;  3C9C A;  2P9U C;  2I3S A;  3UVO A;  2G99 A;  3SFZ A;  4A09 A;  3EG6 A;  4J77 A;  3SJL D;  4A08 B;  1RI6 A;  3SCY A;  4GMB A;  3OL2 B;  2AH1 A;  3ORV D;  3SN6 B;  2UZX B;  3AL9 A;  4MK0 B;  2CNX A;  4GM9 A;  2HKR A;  2QXV A;  1YFQ A;  4NSX A;  3CFV A;  4Y7R A;  2UZY B;  3GRE A;  4O3T B;  4PC0 A;  5HE2 B;  2YNP A;  3B7F A;  2CN3 A;  3J80 g;  3I7N A;  1FWX A;  4BL0 A;  3F3G A;  4R7A B;  3SXT D;  1PEV A;  2QC5 A;  2CE8 A;  4ZOV A;  2G9A A;  4JSX C;  4UI9 R;  3GFC A;  2Q7Q A;  2CE9 A;  5I5M A;  3RSE C;  2OVP B;  2I0T A;  4IA9 A;  2H9L A;  2XYI A;  4A11 A;  3UVM A;  1L0Q A;  2H3X A;  3PXT D;  3PXW D;  3SLE D;  3I2N A;  3RMZ D;  1JMZ B;  4A0A B;  2Z2O A;  4PXW A;  3P4F A;  4J81 A;  4A0B B;  2IUR A;  4X3E A;  1GG2 B;  3EI4 A;  3I7O A;  2IAA A;  3AL8 A;  4I79 A;  4LG9 A;  5FQD A;  4K3J B;  5IC7 A;  3JAM g;  3V5W B;  4E54 B;  4E5Z A;  4H5I A;  4X61 B;  3MZK A;  4QT8 A;  3UKU C;  3DXK C;  2H9M A;  5FKR A;  5EAL A;  3IJC A;  1N6D A;  2AQ5 A;  3IJ1 A;  4GM8 A;  2H9N A;  3BG1 A;  1SQJ A;  4KFM B;  4A08 A;  5CXC A;  3MMY A;  4CZY A;  3I7K A;  4FAV D;  3MZL A;  3I8E A;  3IIW A;  4QRJ A;  5TF2 A;  2PM9 A;  3ULE C;  3PXS D;  3SBQ A;  4J78 A;  4ESG A;  1JMX B;  4BUJ C;  3UR4 A;  1A0R B;  4J8B A;  2IUV A;  3DWL C;  2HKM A;  3SVW D;  4H5J A;  2AH0 A;  2XU7 A;  3IIY A;  4FA1 D;  3RN1 D;  3K27 A;  2HES X;  3MXX A;  4AOW A;  4A09 B;  1XIP A;  3JRO A;  2H47 A;  1K8K C;  1R5M A; 
#chains in the Genus database with same CATH topology
 1GOH A;  2H6K A;  3VA6 A;  3HFQ A;  2VDP A;  1P22 A;  3EI2 A;  4XYI A;  3IUR A;  5FKT A;  2HJB A;  1PBY B;  3JZN A;  4U1E I;  4WK4 A;  2AGX A;  1E5T A;  3NVQ A;  3PVU B;  1O6F A;  2YMU A;  1A12 A;  4A11 B;  3SWS D;  1VZ2 A;  3EI3 A;  3EI2 B;  4GZ8 A;  5TEE A;  2BCJ B;  3VH0 A;  4JHN A;  4A0A A;  2P9L C;  3EQ8 A;  5C9Z B;  3C99 A;  4D6V A;  2H9P A;  4AMY A;  3AL8 B;  5GXH A;  2CO0 A;  2HYE A;  5M5T A;  1K32 A;  2MTA H;  3RRM C;  4A0B A;  4FWW A;  2Z2P A;  4CY1 A;  4O9D A;  3MUN A;  3U4Y A;  5K19 A;  4JSN C;  4L3G D;  1XKS A;  4G56 B;  5H17 A;  1XHM A;  1B9Y A;  3L4M D;  1PI6 A;  4JXM A;  4E5Z B;  2OK6 A;  1H2Z A;  5GXI A;  5HQG A;  2PM6 B;  4CI8 A;  3JB9 L;  2Z2N A;  2VDL A;  5HE0 B;  5C86 A;  4J0X A;  2B4E A;  3SBP A;  4MMZ A;  4TZ4 A;  3O4I A;  4GQ2 P;  5K1C C;  5M5V A;  1E8M A;  3C5M A;  3NIF A;  4J86 A;  2XZG A;  3JRP A;  2PM9 B;  4GGD A;  4G55 A;  4A2M A;  1GOG A;  2OK4 A;  4LG8 A;  4O1Q D;  3T3P A;  3K71 A;  5EMK B;  3N0E A;  4UM8 A;  1QFS A;  4FA5 D;  5TDH B;  4BCC A;  4PBY A;  4CI3 A;  4J84 A;  4L9O A;  2HU7 A;  1U2V C;  5M5U A;  3EQ9 A;  4L1Q D;  3I7P A;  5A2Q g;  4FB1 D;  3A0F A;  3DM0 A;  3W15 A;  4RE6 A;  3FM0 A;  4BP8 A;  1S4U X;  4NEN A;  3V7D B;  2VDM A;  3ZE2 A;  5GMK n;  2IUQ A;  1QFM A;  3DXM C;  3UKR C;  2OVQ B;  4ERZ A;  3AFC A;  3EWE A;  3EI4 B;  1UOO A;  2H13 A;  3FGB A;  4WK0 A;  1GXR A;  4CI2 A;  4ZN4 A;  2IWK A;  3FCS A;  5FKQ A;  5C2V B;  4FAN D;  1JOF A;  1Q47 A;  3JZG A;  5FLX g;  2P9I C;  4CY5 A;  3V4V A;  3OKY B;  2VZ1 A;  2P9P C;  3RLM D;  2AGW A;  5IT9 g;  1GOT B;  1ERJ A;  4GQB B;  4NBM A;  3EI1 B;  2GC4 A;  5EAM A;  4OZU A;  4O3U B;  4CY3 A;  2CN2 A;  2I0S A;  3PE7 A;  4O45 A;  3GC3 B;  3FCU A;  3OW8 A;  5HE3 B;  3OKY A;  4L3H D;  1BPO A;  1TBG A;  4J82 A;  1T2X A;  2EBS A;  2VDQ A;  2IWF A;  4X63 B;  5C92 A;  2AGL A;  4J73 A;  5HYN B;  2XL2 A;  3IJE A;  4BP9 A;  4DNV A;  4BH6 A;  5EAP A;  4JT6 C;  5CXB A;  3KRW B;  3EMH A;  3NIG A;  4Z7N A;  3E0C A;  4E54 A;  4A7J A;  4ZOY A;  2BKL A;  1OLZ A;  2BBK H;  1H2W A;  4CY2 A;  1C9I A;  3AH8 B;  4XYH A;  2EIC A;  5B4W A;  5SXM A;  2PM7 B;  3VGZ A;  3ZDX A;  3I7L A;  2B5M A;  3GD1 I;  3N0D A;  3MKQ A;  5FKS A;  2YB8 B;  3JZH A;  1QNI A;  4XEI C;  2H6N A;  3I7H A;  5KDO B;  3F3P A;  4MMY A;  4LGN A;  4BCD A;  4EWR A;  2EIB A;  5IGQ A;  5AFU 3;  4FA9 D;  4GGA A;  5EML B;  5EMJ B;  4DNW A;  3ZDZ A;  1C9L A;  2B5N A;  2P9N C;  4JT5 C;  5JWZ A;  2XL3 A;  2YNO A;  4X60 B;  3OTT A;  3I89 A;  2GC7 A;  5I5J A;  1NEX B;  1N6F A;  2HXC A;  5M5S A;  2P9S C;  2AGY A;  4U7A A;  4GGC A;  4GM3 A;  4FA4 D;  4A2L A;  3MKS B;  3C75 H;  4J79 A;  3EI1 A;  2IUP A;  3V9F A;  3F3F A;  4J0W A;  3UVK A;  4L1M A;  3IUL A;  4J8G A;  2J55 H;  3DDU A;  4GQ1 A;  4Z8L A;  5IJ8 E;  1SQ9 A;  4CI1 A;  5CYK A;  2VDO A;  2OIZ A;  5EM2 B;  2YBA A;  4FHL A;  4QAM A;  2W18 A;  3EU7 A;  4O02 A;  3KRX B;  3DSM A;  2VC2 A;  1VE7 A;  3IKO A;  2PBI B;  1TYQ C;  3CIK B;  4IMM A;  2I0R A;  5M61 A;  4AMZ A;  5CXC B;  2J56 H;  4ERQ A;  4J87 A;  4PSW B;  3I8C A;  3IUM A;  1MG3 A;  5GSA A;  4OWR A;  3PSC B;  5C2W B;  1B9X A;  4PBZ A;  2OJY A;  4PSX B;  2EIE A;  3RFG A;  1VYH C;  5AMS A;  2TRC B;  4K3I D;  4ZOX A;  2H14 A;  4CZX A;  2WQ8 A;  4QL1 A;  5FXY A;  4MMX A;  4PNK B;  3IUN A;  4UM9 A;  4NC4 A;  4YVD A;  5H14 A;  3L4O D;  1UTC A;  3OL2 A;  1UOQ A;  3ZE1 A;  3QHY B;  4ZOZ A;  1VE6 A;  1U4C A;  5EMM B;  3BWS A;  4CC9 A;  2B5L A;  1H2Y A;  4AN0 A;  4AN1 A;  2H68 A;  3ODT A;  5HE1 B;  4AEZ A;  1JJU B;  3OKW A;  4QQE A;  3UVN A;  3BG0 A;  5TEF A;  3J81 g;  1OMW B;  3CFS B;  2GNQ A;  2J57 G;  3EI3 B;  4JSV C;  2CO0 C;  1JTD B;  4N14 A;  4JD2 C;  5FA5 B;  5I5I A;  2XE4 A;  3T3M A;  1MDA H;  4CZV A;  3OKT A;  4AX4 A;  3PSL A;  5IJ7 E;  3RN0 D;  3RFH A;  4WK2 A;  5H1M A;  3NID A;  3SHF A;  3PVW B;  3O4H A;  3ZWL B;  4ERY A;  1GP2 B;  5CYK B;  1UOP A;  4DNU A;  3K26 A;  5THA A;  2YNN A;  1L5G A;  1MG2 A;  1NR0 A;  2EID A;  4ES0 A;  3JPX A;  4NAA A;  1SHY B;  5CXB B;  3NVN A;  5EM2 A;  5FFO A;  2O9K A;  3UVL A;  2VZ3 A;  1PGU A;  4HDJ A;  2P9K C;  1N6E A;  3IJ0 A;  3IUJ A;  3MUO A;  4Y5R D;  3NVX A;  2AGZ A;  2H6Q A;  3SMR A;  2OVR B;  5IGO A;  2HJ4 A;  5E6U A;  3OF7 A;  4JHP C;  1YR2 A;  4JSP C;  5AJA A;  4D0K A;  3FRX A;  5EAR A;  3SBR A;  2I3T A;  3C9C A;  4G1E A;  2P9U C;  1M1X A;  2I3S A;  1TYE A;  3UVO A;  2QZP A;  2G99 A;  3SFZ A;  4A09 A;  3EG6 A;  4J77 A;  3SJL D;  4A08 B;  1RI6 A;  3SCY A;  3MVD K;  4GMB A;  3OL2 B;  2AH1 A;  5FFG A;  3ORV D;  5E6S A;  3SN6 B;  3ZDY A;  1U8C A;  2UZX B;  3AL9 A;  4IRZ A;  3O4J A;  2CNX A;  4MK0 B;  4GM9 A;  2HKR A;  2QXV A;  2VDN A;  5M5R A;  1YFQ A;  4NSX A;  3V4P A;  3CFV A;  4Y7R A;  3K72 A;  2UZY B;  4D9S A;  3GRE A;  4O3T B;  4PC0 A;  5HE2 B;  2YNP A;  3B7F A;  2CN3 A;  3J80 g;  3I7N A;  3IUQ A;  1FWX A;  3KCI A;  4BL0 A;  3F3G A;  4RE5 A;  2XDW A;  4R7A B;  3SXT D;  1PEV A;  2QC5 A;  2CE8 A;  4ZOV A;  2G9A A;  1O6G A;  4JSX C;  3GFC A;  2Q7Q A;  2CE9 A;  4UI9 R;  1E8N A;  4Z7Q A;  5I5M A;  3RSE C;  2OVP B;  2I0T A;  4IA9 A;  2H9L A;  2XYI A;  4A11 A;  3UVM A;  1L0Q A;  2H3X A;  3PXT D;  3PXW D;  3SLE D;  3I2N A;  1I2M B;  3RMZ D;  1JMZ B;  4A0A B;  2Z2O A;  4PXW A;  3P4F A;  4J81 A;  4A0B B;  2IUR A;  4X3E A;  1GG2 B;  3EI4 A;  3I7O A;  2IAA A;  3AL8 A;  4I79 A;  4G1M A;  5E6R A;  4LG9 A;  5FQD A;  4K3J B;  2HU8 A;  5IC7 A;  4Z7O A;  3JAM g;  3V5W B;  4WJK A;  1K3I A;  5HDB A;  4E54 B;  1JV2 A;  2JKX A;  4E5Z A;  4H5I A;  4X61 B;  3MZK A;  4QT8 A;  3UKU C;  3DXK C;  2H9M A;  5FKR A;  2VDR A;  5EAL A;  3IJC A;  3K6S A;  1N6D A;  4O2W A;  2AQ5 A;  1H2X A;  3IJ1 A;  4GM8 A;  2H9N A;  3BG1 A;  1SQJ A;  4KFM B;  4A08 A;  5CXC A;  3MMY A;  4CZY A;  3I7K A;  4FAV D;  3MZL A;  3I8E A;  2HU5 A;  4BCB A;  3IIW A;  4QRJ A;  2QR5 A;  2PM9 A;  5TF2 A;  3ULE C;  3PXS D;  3SBQ A;  4J78 A;  4ESG A;  3VI3 A;  1JMX B;  3O4G A;  4BUJ C;  3QI0 A;  3UR4 A;  1A0R B;  4J8B A;  2IUV A;  1VZ3 A;  3DWL C;  1GOF A;  2HKM A;  3SVW D;  4H5J A;  2AH0 A;  2XU7 A;  3IIY A;  4FA1 D;  3RN1 D;  2VDK A;  3ZE0 A;  3K27 A;  2HES X;  3MXX A;  4AOW A;  4A09 B;  3VI4 A;  1XIP A;  3EQ7 A;  3JRO A;  2H47 A;  3IVM A;  1K8K C;  1R5M A; 
#chains in the Genus database with same CATH homology
 2H6K A;  3VA6 A;  3HFQ A;  1P22 A;  3EI2 A;  4XYI A;  5FKT A;  2HJB A;  1PBY B;  3JZN A;  4U1E I;  2AGX A;  3NVQ A;  3PVU B;  2YMU A;  4A11 B;  3SWS D;  3EI3 A;  3EI2 B;  4GZ8 A;  5TEE A;  2BCJ B;  3VH0 A;  4A0A A;  2P9L C;  5C9Z B;  3C99 A;  4D6V A;  2H9P A;  3AL8 B;  5GXH A;  2CO0 A;  2HYE A;  4A0B A;  1K32 A;  2MTA H;  3RRM C;  4FWW A;  2Z2P A;  4CY1 A;  4O9D A;  3U4Y A;  5K19 A;  4JSN C;  4L3G D;  1XKS A;  4G56 B;  5H17 A;  1XHM A;  1B9Y A;  3L4M D;  1PI6 A;  4JXM A;  4E5Z B;  2OK6 A;  5GXI A;  5HQG A;  2PM6 B;  4CI8 A;  3JB9 L;  2Z2N A;  5HE0 B;  4J0X A;  2B4E A;  3SBP A;  4TZ4 A;  4GQ2 P;  5K1C C;  3C5M A;  4J86 A;  3JRP A;  2PM9 B;  4GGD A;  4A2M A;  2OK4 A;  4LG8 A;  4O1Q D;  5EMK B;  3N0E A;  4FA5 D;  5TDH B;  4PBY A;  4CI3 A;  4J84 A;  4L9O A;  1U2V C;  4L1Q D;  3I7P A;  5A2Q g;  4FB1 D;  3A0F A;  3DM0 A;  3W15 A;  3FM0 A;  1S4U X;  3V7D B;  5GMK n;  2IUQ A;  3DXM C;  3UKR C;  2OVQ B;  4ERZ A;  3AFC A;  3EWE A;  3EI4 B;  2H13 A;  3FGB A;  1GXR A;  4CI2 A;  4ZN4 A;  2IWK A;  5C2V B;  5FKQ A;  4FAN D;  1JOF A;  1Q47 A;  3JZG A;  5FLX g;  2P9I C;  4CY5 A;  3OKY B;  2P9P C;  3RLM D;  2AGW A;  5IT9 g;  1GOT B;  1ERJ A;  4GQB B;  3EI1 B;  2GC4 A;  5EAM A;  4OZU A;  4O3U B;  4CY3 A;  2CN2 A;  2I0S A;  3PE7 A;  4O45 A;  5HE3 B;  3OW8 A;  3OKY A;  4L3H D;  1TBG A;  4J82 A;  2EBS A;  2IWF A;  4X63 B;  2AGL A;  4J73 A;  5HYN B;  2XL2 A;  4BH6 A;  5EAP A;  4JT6 C;  5CXB A;  3KRW B;  3EMH A;  3E0C A;  4E54 A;  4A7J A;  4ZOY A;  1OLZ A;  2BBK H;  4CY2 A;  3AH8 B;  4XYH A;  5B4W A;  5SXM A;  2PM7 B;  3VGZ A;  3I7L A;  2B5M A;  3N0D A;  3MKQ A;  5FKS A;  2YB8 B;  3JZH A;  1QNI A;  4XEI C;  2H6N A;  3I7H A;  5KDO B;  3F3P A;  4LGN A;  4EWR A;  5IGQ A;  5AFU 3;  4FA9 D;  4GGA A;  5EML B;  5EMJ B;  2B5N A;  2P9N C;  4JT5 C;  5JWZ A;  2XL3 A;  2YNO A;  4X60 B;  3OTT A;  3I89 A;  2GC7 A;  5I5J A;  1NEX B;  1N6F A;  2HXC A;  2P9S C;  2AGY A;  4U7A A;  4GGC A;  4GM3 A;  4FA4 D;  4A2L A;  3MKS B;  3C75 H;  4J79 A;  3EI1 A;  2IUP A;  3V9F A;  3F3F A;  4J0W A;  3UVK A;  4J8G A;  2J55 H;  4Z8L A;  4GQ1 A;  5IJ8 E;  1SQ9 A;  4CI1 A;  5CYK A;  2OIZ A;  5EM2 B;  2YBA A;  4FHL A;  2W18 A;  3EU7 A;  3KRX B;  3DSM A;  3IKO A;  2PBI B;  1TYQ C;  3CIK B;  4IMM A;  2I0R A;  5CXC B;  2J56 H;  4ERQ A;  4J87 A;  4PSW B;  3I8C A;  1MG3 A;  5GSA A;  4OWR A;  3PSC B;  5C2W B;  1B9X A;  4PBZ A;  2OJY A;  4PSX B;  3RFG A;  1VYH C;  5AMS A;  2TRC B;  4K3I D;  4ZOX A;  2H14 A;  4CZX A;  4QL1 A;  5FXY A;  4PNK B;  4YVD A;  5H14 A;  3L4O D;  3OL2 A;  4ZOZ A;  1U4C A;  5EMM B;  3BWS A;  4CC9 A;  2B5L A;  2H68 A;  3ODT A;  5HE1 B;  4AEZ A;  1JJU B;  3OKW A;  4QQE A;  3UVN A;  3BG0 A;  5TEF A;  3J81 g;  1OMW B;  3CFS B;  2GNQ A;  2J57 G;  3EI3 B;  4JSV C;  2CO0 C;  4N14 A;  4JD2 C;  5FA5 B;  5I5I A;  4CZV A;  1MDA H;  3OKT A;  3PSL A;  5IJ7 E;  3RN0 D;  3RFH A;  5H1M A;  3SHF A;  3PVW B;  3ZWL B;  4ERY A;  1GP2 B;  5CYK B;  3K26 A;  5THA A;  2YNN A;  1MG2 A;  1NR0 A;  4ES0 A;  3JPX A;  5CXB B;  1SHY B;  3NVN A;  5EM2 A;  2O9K A;  3UVL A;  1PGU A;  4HDJ A;  2P9K C;  1N6E A;  3IJ0 A;  4Y5R D;  3NVX A;  2AGZ A;  2H6Q A;  3SMR A;  2OVR B;  5IGO A;  2HJ4 A;  4JSP C;  5AJA A;  4D0K A;  3FRX A;  5EAR A;  3SBR A;  2I3T A;  3C9C A;  2P9U C;  2I3S A;  3UVO A;  2G99 A;  3SFZ A;  4A09 A;  3EG6 A;  4J77 A;  3SJL D;  4A08 B;  1RI6 A;  3SCY A;  4GMB A;  3OL2 B;  2AH1 A;  3ORV D;  3SN6 B;  2UZX B;  3AL9 A;  4MK0 B;  2CNX A;  4GM9 A;  2HKR A;  2QXV A;  1YFQ A;  4NSX A;  3CFV A;  4Y7R A;  2UZY B;  3GRE A;  4O3T B;  4PC0 A;  5HE2 B;  2YNP A;  3B7F A;  2CN3 A;  3J80 g;  3I7N A;  1FWX A;  4BL0 A;  3F3G A;  4R7A B;  3SXT D;  1PEV A;  2QC5 A;  2CE8 A;  4ZOV A;  2G9A A;  4JSX C;  4UI9 R;  3GFC A;  2Q7Q A;  2CE9 A;  5I5M A;  3RSE C;  2OVP B;  2I0T A;  4IA9 A;  2H9L A;  2XYI A;  4A11 A;  3UVM A;  1L0Q A;  2H3X A;  3PXT D;  3PXW D;  3SLE D;  3I2N A;  3RMZ D;  1JMZ B;  4A0A B;  2Z2O A;  4PXW A;  3P4F A;  4J81 A;  4A0B B;  2IUR A;  4X3E A;  1GG2 B;  3EI4 A;  3I7O A;  2IAA A;  3AL8 A;  4I79 A;  4LG9 A;  5FQD A;  4K3J B;  5IC7 A;  3JAM g;  3V5W B;  4E54 B;  4E5Z A;  4H5I A;  4X61 B;  3MZK A;  4QT8 A;  3UKU C;  3DXK C;  2H9M A;  5FKR A;  5EAL A;  3IJC A;  1N6D A;  2AQ5 A;  3IJ1 A;  4GM8 A;  2H9N A;  3BG1 A;  1SQJ A;  4KFM B;  4A08 A;  5CXC A;  3MMY A;  4CZY A;  3I7K A;  4FAV D;  3MZL A;  3I8E A;  3IIW A;  4QRJ A;  5TF2 A;  2PM9 A;  3ULE C;  3PXS D;  3SBQ A;  4J78 A;  4ESG A;  1JMX B;  4BUJ C;  3UR4 A;  1A0R B;  4J8B A;  2IUV A;  3DWL C;  2HKM A;  3SVW D;  4H5J A;  2AH0 A;  2XU7 A;  3IIY A;  4FA1 D;  3RN1 D;  3K27 A;  2HES X;  3MXX A;  4AOW A;  4A09 B;  1XIP A;  3JRO A;  2H47 A;  1K8K C;  1R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...