2I0TA

Crystal structure of phenylacetaldehyde derived r-carbinolamine adduct of aromatic amine dehydrogenase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 104
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i0tA01
4ERZA 1N6DA 4XEIC 3NVNA 5FLXg 2B5LA 3JZHA 4QRJA 3PSCB 4J8BA 4FA4D 4X63B 2H6QA 1U2VC 4JT6C 3EU7A 3UVKA 2XU7A 1RI6A 4J77A 3N0EA 4BL0A 1OLZA 2IAAA 3OKWA 3IJ0A 2P9SC 2CO0C 3RN1D 2J57G 3OW8A 2GNQA 2HKRA 1S4UX 4PSWB 4A0BA 2P9UC 3JROA 2IWKA 4H5IA 4J0XA 5TEFA 2YNNA 4FAND 5EMJB 3J80g 2H3XA 3AH8B 2YMUA 4FB1D 4PBYA 3UVMA 3NVQA 2EBSA 3MMYA 3U4YA 3NVXA 5IJ7E 5EALA 3EG6A 3B7FA 2H14A 3SXTD 4A08B 4JXMA 2HJBA 3OKYA 4OWRA 4O45A 4FA9D 1YFQA 5GXIA 4JSNC 5K19A 4D0KA 4J86A 3SBPA 2UZYB 4A11A 3MKSB 3SBQA 1MG2A 2IUQA 2B5NA 3BWSA 4ESGA 4R7AB 5GMKn 4ZOXA 2OVQB 4L9OA 3SMRA 3I8EA 4OZUA 4GGCA 2IUPA 3I89A 3A0FA 3RMZD 3SLED 4FAVD 1GP2B 5JWZA 3CFSB 4A0AA 3N0DA 2HJ4A 4X3EA 4JSVC 3K27A 3C99A 4U1EI 2CN3A 5I5JA 3SVWD 3UR4A 4L3HD 2I3SA 2XL3A 2OVPB 4ZOVA 5FKRA 3ODTA 5B4WA 3I8CA 1B9XA 3P4FA 4L3GD 5TF2A 3DXKC 4GM9A 2YNOA 3OTTA 5GSAA 3SHFA 5HE2B 4J78A 2YNPA 4E5ZA 2OVRB 3MZLA 4GM8A 3UKRC 4CI3A 1VYHC 3MXXA 2P9LC 3DXMC 3VH0A 2H6NA 5FXYA 3RFHA 2HESX 4Y7RA 3AL8B 4A0BB 4KFMB 2P9IC 3PXTD 4A2LA 3EWEA 1NR0A 5C9ZB 4HDJA 1TYQC 1FWXA 4AOWA 3F3FA 4PC0A 4GGAA 3BG1A 3EI2A 4A09A 5IGOA 4J0WA 5HQGA 3EI1A 4A7JA 5EMLB 4E54A 4QQEA 2IURA 1L0QA 5GXHA 3KRWB 3RSEC 4XYIA 3I7NA 2H9MA 2Z2OA 5KDOB 3OKYB 3L4OD 4J73A 5CXCA 3JZGA 3C5MA 2H9NA 3CIKB 4MK0B 5A2Qg 4O3UB 4D6VA 4CZYA 4J81A 2I0RA 4X61B 4IMMA 5EMKB 2HKMA 3MZKA 2OJYA 1XIPA 3DWLC 4JSPC 4PNKB 1MG3A 2QXVA 5EM2B 2P9NC 3EI3B 3FM0A 3RN0D 4A0AB 5THAA 4CZXA 3PVUB 2AGXA 4CY2A 5CYKA 2AGLA 1JMXB 1GXRA 2H6KA 4GQ1A 4ZOZA 5C2WB 5HE1B 2G99A 4GGDA 2CE9A 5FKQA 3C9CA 3RLMD 2J55H 4ERQA 5EMMB 3ORVD 4J84A 4J87A 5FKTA 1SQ9A 2O9KA 5EAMA 3V5WB 2BCJB 2GC4A 3EI4A 4X60B 1JOFA 3PE7A 3RRMC 2HXCA 3IIYA 4ES0A 1N6FA 1K8KC 4GM3A 4JT5C 3JRPA 4U7AA 3UKUC 5AMSA 4ZOYA 2IUVA 2AGWA 4N14A 3ZWLB 1QNIA 4A08A 5K1CC 3SBRA 2TRCB 2IWFA 4A09B 4GQ2P 2I0SA 5AJAA 5HYNB 2OK4A 5FA5B 5TEEA 2Q7QA 4UI9R 1B9YA 3OL2A 2QC5A 1JJUB 4O9DA 3IJCA 4LG9A 1PI6A 1N6EA 3PXWD 2UZXB 4CZVA 3IJ1A 5CXCB 2XYIA 4GQBB 3PVWB 4GMBA 3JPXA 1PBYB 5I5MA 2PM9A 1P22A 4H5JA 5IC7A 2CNXA 3PSLA 4ERYA 2PM6B 1JMZB 2H47A 4LG8A 5H17A 3IIWA 1SQJA 4G56B 2AGZA 1TBGA 4PSXB 3F3PA 4ZN4A 5HE3B 4O3TB 4FHLA 5C2VB 1A0RB 4PBZA 4CC9A 3HFQA 2I0TA 3KRXB 4L1QD 4CI1A 2B5MA 4CY5A 1Q47A 3FRXA 4IA9A 5I5IA 3JB9L 4NSXA 5CYKB 1U4CA 1GOTB 4LGNA 3VGZA 4J82A 4A11B 2GC7A 2YB8B 2PBIB 4CI8A 3UVNA 2J56H 2Z2PA 4O1QD 4BH6A 3GREA 3I2NA 3DM0A 5SXMA 2G9AA 4GZ8A 4CI2A 4FA5D 3I7KA 2XL2A 5CXBA 2AGYA 5FQDA 1NEXB 3RFGA 3AL8A 3ULEC 4JSXC 2B4EA 1MDAH 4J79A 1K32A 4CY1A 3OKTA 2P9KC 2W18A 3V7DB 5IGQA 4PXWA 2MTAH 3EI4B 3UVOA 4JD2C 2YBAA 4YVDA 1SHYB 5H14A 2H68A 3MKQA 3AFCA 2I3TA 3AL9A 2Z2NA 3DSMA 1PGUA 3GFCA 5IJ8E 4QL1A 2H9PA 2PM7B 4E5ZB 5FKSA 3SWSD 4K3JB 3VA6A 3J81g 3CFVA 3OL2B 3SFZA 3SJLD 1OMWB 4Y5RD 3BG0A 2AQ5A 2H9LA 2HYEA 2CO0A 3I7HA 4FWWA 1XHMA 3C75H 4AEZA 5IT9g 1XKSA 4K3ID 2H13A 3PXSD 2PM9B 2P9PC 5EM2A 4BUJC 3EMHA 2AH1A 2CN2A 3EI3A 2CE8A 2OIZA 2OK6A 3UVLA 4EWRA 3EI2B 3SN6B 2AH0A 3V9FA 3EI1B 4CY3A 4E54B 4FA1D 5TDHB 4TZ4A 2BBKH 3IKOA 4Z8LA 3I7OA 5EAPA 3JZNA 1GG2B 3L4MD 3I7LA 1ERJA 5HE0B 5EARA 4QT8A 3SCYA 1PEVA 5H1MA 5AFU3 3W15A 1R5MA 4XYHA 5CXBB 3JAMg 4A2MA 4I79A 3I7PA 4J8GA 3E0CA 3F3GA 3K26A 3FGBA
chains in the Genus database with same CATH superfamily
2JKXA 4ERZA 1N6DA 4XEIC 3NVNA 5FLXg 2B5LA 3JZHA 4QRJA 4BP9A 3EQ8A 3PSCB 4J8BA 2VDQA 4X63B 4FA4D 2H6QA 1U2VC 4RE5A 4JT6C 3EU7A 3UVKA 2XU7A 3IUQA 1RI6A 4J77A 3N0EA 4BL0A 1OLZA 1UTCA 2IAAA 3OKWA 3IJ0A 2P9SC 2CO0C 1JV2A 3RN1D 2J57G 3OW8A 2GNQA 4AN1A 2HKRA 3EQ9A 1S4UX 4AMYA 4PSWB 1GOGA 4A0BA 2P9UC 3JROA 2IWKA 4H5IA 4J0XA 3IULA 3NIDA 5TEFA 2YNNA 4FAND 5EMJB 3J80g 2H3XA 1O6FA 3AH8B 1GOHA 2YMUA 4WK4A 4FB1D 1QFMA 4PBYA 3UVMA 3QI0A 3NVQA 2EBSA 3MMYA 3U4YA 5FFGA 3NVXA 1U8CA 5IJ7E 5EALA 3EG6A 4O02A 3B7FA 3VI4A 2H14A 3SXTD 4A08B 4G1EA 4JXMA 2HJBA 3OKYA 4OWRA 4O45A 5M5VA 1C9LA 1YFQA 4FA9D 5GXIA 2XE4A 4JSNC 5K19A 4D0KA 4J86A 3SBPA 2UZYB 4A11A 3T3MA 3MKSB 3SBQA 1MG2A 2IUQA 2B5NA 3BWSA 4ESGA 4R7AB 5GMKn 4ZOXA 2EIEA 4L9OA 4MMZA 2OVQB 3SMRA 3I8EA 4OZUA 4GGCA 2IUPA 3I89A 3A0FA 3RMZD 3SLED 4FAVD 1M1XA 1GP2B 1QFSA 5M5UA 5JWZA 3CFSB 4A0AA 3N0DA 2HJ4A 4X3EA 4JSVC 3K27A 3C99A 4U1EI 2CN3A 3O4JA 5I5JA 3SVWD 3UR4A 5M5TA 4L3HD 2I3SA 2XL3A 2OVPB 4UM8A 4ZOVA 1UOQA 5FKRA 3ODTA 5B4WA 3I8CA 1B9XA 3P4FA 3IUJA 4L3GD 5TF2A 3DXKC 4GM9A 3O4IA 2YNOA 4AN0A 3OTTA 5GSAA 2QZPA 3SHFA 5HE2B 4J78A 2YNPA 4E5ZA 2OVRB 3MZLA 4GM8A 3UKRC 4CI3A 1VYHC 1E8NA 3MXXA 2P9LC 3DXMC 3VH0A 2H6NA 5FXYA 3RFHA 1I2MB 2HESX 4Y7RA 3AL8B 4DNVA 4A0BB 4KFMB 2P9IC 4RE6A 3PXTD 4A2LA 3EWEA 4O2WA 1NR0A 4BCCA 5C9ZB 4HDJA 1VZ3A 2HU8A 1TYQC 1FWXA 4AOWA 3F3FA 4PC0A 4GGAA 3BG1A 3EI2A 4A09A 4AX4A 5IGOA 4J0WA 5HQGA 5C92A 3EI1A 4A7JA 5EMLB 4E54A 4QQEA 2IURA 1L0QA 4BCBA 5GXHA 3KRWB 3RSEC 4MMYA 4XYIA 3I7NA 2H9MA 2Z2OA 5KDOB 3OKYB 3NIFA 3K6SA 3L4OD 4J73A 2VZ3A 5CXCA 4Z7QA 3QHYB 4NBMA 5FFOA 3JZGA 3O4GA 4WJKA 1BPOA 2VDKA 2H9NA 3C5MA 3CIKB 4MK0B 1TYEA 2VDMA 1K3IA 4IRZA 5A2Qg 4O3UB 4D6VA 4CZYA 1E8MA 3ZE1A 4J81A 2I0RA 2EICA 2VZ1A 4X61B 4IMMA 3VI3A 2EIDA 5EMKB 2HKMA 3MZKA 2OJYA 1XIPA 3DWLC 4JSPC 4PNKB 1MG3A 2QXVA 3FCSA 5EM2B 2P9NC 3GD1I 3EI3B 3V4VA 2VDOA 3ZDZA 3DDUA 3FM0A 3RN0D 4A0AB 4AMZA 5THAA 4CZXA 3PVUB 1H2YA 2AGXA 3MUOA 4CY2A 5CYKA 2AGLA 1JMXB 1GXRA 2H6KA 2QR5A 1C9IA 4GQ1A 4ZOZA 4NENA 5C2WB 5HE1B 2G99A 4GGDA 2CE9A 5FKQA 3C9CA 3RLMD 2J55H 3O4HA 4ERQA 3IVMA 5EMMB 3ORVD 1YR2A 4J84A 4J87A 5FKTA 3IUMA 1SQ9A 2O9KA 5EAMA 2VDNA 3V5WB 2BCJB 1VE6A 2GC4A 3EI4A 2BKLA 4X60B 1JOFA 3PE7A 3RRMC 2HXCA 1O6GA 4D9SA 3OF7A 4G1MA 3IIYA 2EIBA 4ES0A 1N6FA 1K8KC 4GM3A 1H2WA 4JT5C 3ZDXA 1GOFA 3JRPA 4U7AA 3UKUC 5AMSA 4ZOYA 2IUVA 2AGWA 4N14A 3ZWLB 4Z7NA 1QNIA 4A08A 5K1CC 3SBRA 2TRCB 2IWFA 4A09B 4GQ2P 2I0SA 5AJAA 5HYNB 3KCIA 3ZE2A 2OK4A 5FA5B 5TEEA 2Q7QA 4UI9R 1B9YA 4BCDA 4G55A 3OL2A 2QC5A 1JJUB 3EQ7A 3V4PA 4O9DA 4MMXA 3IJCA 4LG9A 1H2ZA 1H2XA 1PI6A 1N6EA 3PXWD 2UZXB 4NC4A 4CZVA 3IJ1A 5CXCB 2XYIA 4GQBB 2HU7A 2XZGA 3PVWB 4GMBA 3K71A 3JPXA 1PBYB 5M5RA 5I5MA 2PM9A 4DNWA 4BP8A 1P22A 4H5JA 5IC7A 2VDLA 2CNXA 3PSLA 4ERYA 2PM6B 1JMZB 2H47A 4LG8A 4UM9A 5H17A 3IIWA 1UOOA 1SQJA 4G56B 2AGZA 4NAAA 1TBGA 4PSXB 3F3PA 4ZN4A 3ZE0A 5HE3B 4O3TB 2VDPA 4FHLA 4WK0A 5C2VB 1A0RB 4PBZA 4CC9A 3HFQA 2I0TA 3KRXB 4L1QD 4CI1A 2B5MA 4JHNA 4CY5A 1Q47A 5E6SA 3FRXA 4IA9A 5I5IA 3IUNA 1E5TA 3JB9L 4NSXA 5CYKB 1U4CA 1GOTB 4LGNA 3VGZA 4J82A 4A11B 2GC7A 5M5SA 2YB8B 2PBIB 4CI8A 3UVNA 2J56H 2Z2PA 4O1QD 4BH6A 3GREA 1T2XA 3I2NA 2XDWA 3DM0A 5SXMA 2G9AA 4GZ8A 4CI2A 4FA5D 3I7KA 2XL2A 5CXBA 2AGYA 5FQDA 1NEXB 3RFGA 3AL8A 3ULEC 5E6UA 4JSXC 2B4EA 1MDAH 4J79A 1K32A 4CY1A 3OKTA 2P9KC 3T3PA 2W18A 3V7DB 5IGQA 4PXWA 2MTAH 3EI4B 3UVOA 1UOPA 4JD2C 2YBAA 3GC3B 4YVDA 1SHYB 5H14A 4QAMA 3ZDYA 2H68A 2VC2A 3MKQA 3AFCA 2I3TA 3AL9A 1JTDB 2Z2NA 3DSMA 3MVDK 1PGUA 3GFCA 5IJ8E 4JHPC 4QL1A 2H9PA 1VZ2A 2PM7B 4E5ZB 5FKSA 3SWSD 4K3JB 3VA6A 3J81g 3CFVA 3OL2B 3SFZA 3SJLD 1OMWB 4Y5RD 3BG0A 2AQ5A 2H9LA 2HYEA 2CO0A 3I7HA 5HDBA 4FWWA 1A12A 1XHMA 3C75H 4AEZA 5IT9g 1XKSA 4K3ID 2H13A 3PXSD 2PM9B 4DNUA 2P9PC 5EM2A 4BUJC 3EMHA 3EI3A 2AH1A 2CN2A 2CE8A 2OIZA 2OK6A 3UVLA 4EWRA 3EI2B 3SN6B 2AH0A 2WQ8A 3V9FA 3EI1B 4CY3A 3IJEA 3FCUA 4E54B 4FA1D 5TDHB 5E6RA 4TZ4A 2BBKH 2HU5A 3IKOA 1VE7A 3I7OA 4Z8LA 3JZNA 5EAPA 1GG2B 3L4MD 5M61A 3I7LA 4WK2A 1L5GA 3IURA 1ERJA 5HE0B 4L1MA 3K72A 5EARA 4QT8A 3SCYA 1PEVA 5H1MA 3NIGA 5AFU3 3W15A 1R5MA 5C86A 2VDRA 4XYHA 5CXBB 3JAMg 4A2MA 4I79A 3I7PA 4J8GA 3E0CA 4Z7OA 3F3GA 3K26A 3MUNA 3FGBA
chains in the Genus database with same CATH topology
4ERZA 1N6DA 4XEIC 3NVNA 5FLXg 2B5LA 3JZHA 4QRJA 3PSCB 4J8BA 4FA4D 4X63B 2H6QA 1U2VC 4JT6C 3EU7A 3UVKA 2XU7A 1RI6A 4J77A 3N0EA 4BL0A 1OLZA 2IAAA 3OKWA 3IJ0A 2P9SC 2CO0C 3RN1D 2J57G 3OW8A 2GNQA 2HKRA 1S4UX 4PSWB 4A0BA 2P9UC 3JROA 2IWKA 4H5IA 4J0XA 5TEFA 2YNNA 4FAND 5EMJB 3J80g 2H3XA 3AH8B 2YMUA 4FB1D 4PBYA 3UVMA 3NVQA 2EBSA 3MMYA 3U4YA 3NVXA 5IJ7E 5EALA 3EG6A 3B7FA 2H14A 3SXTD 4A08B 4JXMA 2HJBA 3OKYA 4OWRA 4O45A 4FA9D 1YFQA 5GXIA 4JSNC 5K19A 4D0KA 4J86A 3SBPA 2UZYB 4A11A 3MKSB 3SBQA 1MG2A 2IUQA 2B5NA 3BWSA 4ESGA 4R7AB 5GMKn 4ZOXA 2OVQB 4L9OA 3SMRA 3I8EA 4OZUA 4GGCA 2IUPA 3I89A 3A0FA 3RMZD 3SLED 4FAVD 1GP2B 5JWZA 3CFSB 4A0AA 3N0DA 2HJ4A 4X3EA 4JSVC 3K27A 3C99A 4U1EI 2CN3A 5I5JA 3SVWD 3UR4A 4L3HD 2I3SA 2XL3A 2OVPB 4ZOVA 5FKRA 3ODTA 5B4WA 3I8CA 1B9XA 3P4FA 4L3GD 5TF2A 3DXKC 4GM9A 2YNOA 3OTTA 5GSAA 3SHFA 5HE2B 4J78A 2YNPA 4E5ZA 2OVRB 3MZLA 4GM8A 3UKRC 4CI3A 1VYHC 3MXXA 2P9LC 3DXMC 3VH0A 2H6NA 5FXYA 3RFHA 2HESX 4Y7RA 3AL8B 4A0BB 4KFMB 2P9IC 3PXTD 4A2LA 3EWEA 1NR0A 5C9ZB 4HDJA 1TYQC 1FWXA 4AOWA 3F3FA 4PC0A 4GGAA 3BG1A 3EI2A 4A09A 5IGOA 4J0WA 5HQGA 3EI1A 4A7JA 5EMLB 4E54A 4QQEA 2IURA 1L0QA 5GXHA 3KRWB 3RSEC 4XYIA 3I7NA 2H9MA 2Z2OA 5KDOB 3OKYB 3L4OD 4J73A 5CXCA 3JZGA 3C5MA 2H9NA 3CIKB 4MK0B 5A2Qg 4O3UB 4D6VA 4CZYA 4J81A 2I0RA 4X61B 4IMMA 5EMKB 2HKMA 3MZKA 2OJYA 1XIPA 3DWLC 4JSPC 4PNKB 1MG3A 2QXVA 5EM2B 2P9NC 3EI3B 3FM0A 3RN0D 4A0AB 5THAA 4CZXA 3PVUB 2AGXA 4CY2A 5CYKA 2AGLA 1JMXB 1GXRA 2H6KA 4GQ1A 4ZOZA 5C2WB 5HE1B 2G99A 4GGDA 2CE9A 5FKQA 3C9CA 3RLMD 2J55H 4ERQA 5EMMB 3ORVD 4J84A 4J87A 5FKTA 1SQ9A 2O9KA 5EAMA 3V5WB 2BCJB 2GC4A 3EI4A 4X60B 1JOFA 3PE7A 3RRMC 2HXCA 3IIYA 4ES0A 1N6FA 1K8KC 4GM3A 4JT5C 3JRPA 4U7AA 3UKUC 5AMSA 4ZOYA 2IUVA 2AGWA 4N14A 3ZWLB 1QNIA 4A08A 5K1CC 3SBRA 2TRCB 2IWFA 4A09B 4GQ2P 2I0SA 5AJAA 5HYNB 2OK4A 5FA5B 5TEEA 2Q7QA 4UI9R 1B9YA 3OL2A 2QC5A 1JJUB 4O9DA 3IJCA 4LG9A 1PI6A 1N6EA 3PXWD 2UZXB 4CZVA 3IJ1A 5CXCB 2XYIA 4GQBB 3PVWB 4GMBA 3JPXA 1PBYB 5I5MA 2PM9A 1P22A 4H5JA 5IC7A 2CNXA 3PSLA 4ERYA 2PM6B 1JMZB 2H47A 4LG8A 5H17A 3IIWA 1SQJA 4G56B 2AGZA 1TBGA 4PSXB 3F3PA 4ZN4A 5HE3B 4O3TB 4FHLA 5C2VB 1A0RB 4PBZA 4CC9A 3HFQA 2I0TA 3KRXB 4L1QD 4CI1A 2B5MA 4CY5A 1Q47A 3FRXA 4IA9A 5I5IA 3JB9L 4NSXA 5CYKB 1U4CA 1GOTB 4LGNA 3VGZA 4J82A 4A11B 2GC7A 2YB8B 2PBIB 4CI8A 3UVNA 2J56H 2Z2PA 4O1QD 4BH6A 3GREA 3I2NA 3DM0A 5SXMA 2G9AA 4GZ8A 4CI2A 4FA5D 3I7KA 2XL2A 5CXBA 2AGYA 5FQDA 1NEXB 3RFGA 3AL8A 3ULEC 4JSXC 2B4EA 1MDAH 4J79A 1K32A 4CY1A 3OKTA 2P9KC 2W18A 3V7DB 5IGQA 4PXWA 2MTAH 3EI4B 3UVOA 4JD2C 2YBAA 4YVDA 1SHYB 5H14A 2H68A 3MKQA 3AFCA 2I3TA 3AL9A 2Z2NA 3DSMA 1PGUA 3GFCA 5IJ8E 4QL1A 2H9PA 2PM7B 4E5ZB 5FKSA 3SWSD 4K3JB 3VA6A 3J81g 3CFVA 3OL2B 3SFZA 3SJLD 1OMWB 4Y5RD 3BG0A 2AQ5A 2H9LA 2HYEA 2CO0A 3I7HA 4FWWA 1XHMA 3C75H 4AEZA 5IT9g 1XKSA 4K3ID 2H13A 3PXSD 2PM9B 2P9PC 5EM2A 4BUJC 3EMHA 2AH1A 2CN2A 3EI3A 2CE8A 2OIZA 2OK6A 3UVLA 4EWRA 3EI2B 3SN6B 2AH0A 3V9FA 3EI1B 4CY3A 4E54B 4FA1D 5TDHB 4TZ4A 2BBKH 3IKOA 4Z8LA 3I7OA 5EAPA 3JZNA 1GG2B 3L4MD 3I7LA 1ERJA 5HE0B 5EARA 4QT8A 3SCYA 1PEVA 5H1MA 5AFU3 3W15A 1R5MA 4XYHA 5CXBB 3JAMg 4A2MA 4I79A 3I7PA 4J8GA 3E0CA 3F3GA 3K26A 3FGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERZ A;  1N6D A;  4XEI C;  3NVN A;  5FLX g;  2B5L A;  3JZH A;  4QRJ A;  3PSC B;  4J8B A;  4FA4 D;  4X63 B;  2H6Q A;  1U2V C;  4JT6 C;  3EU7 A;  3UVK A;  2XU7 A;  1RI6 A;  4J77 A;  3N0E A;  4BL0 A;  1OLZ A;  2IAA A;  3OKW A;  3IJ0 A;  2P9S C;  2CO0 C;  3RN1 D;  2J57 G;  3OW8 A;  2GNQ A;  2HKR A;  1S4U X;  4PSW B;  4A0B A;  2P9U C;  3JRO A;  2IWK A;  4H5I A;  4J0X A;  5TEF A;  2YNN A;  4FAN D;  5EMJ B;  3J80 g;  2H3X A;  3AH8 B;  2YMU A;  4FB1 D;  4PBY A;  3UVM A;  3NVQ A;  2EBS A;  3MMY A;  3U4Y A;  3NVX A;  5IJ7 E;  5EAL A;  3EG6 A;  3B7F A;  2H14 A;  3SXT D;  4A08 B;  4JXM A;  2HJB A;  3OKY A;  4OWR A;  4O45 A;  4FA9 D;  1YFQ A;  5GXI A;  4JSN C;  5K19 A;  4D0K A;  4J86 A;  3SBP A;  2UZY B;  4A11 A;  3MKS B;  3SBQ A;  1MG2 A;  2IUQ A;  2B5N A;  3BWS A;  4ESG A;  4R7A B;  5GMK n;  4ZOX A;  2OVQ B;  4L9O A;  3SMR A;  3I8E A;  4OZU A;  4GGC A;  2IUP A;  3I89 A;  3A0F A;  3RMZ D;  3SLE D;  4FAV D;  1GP2 B;  5JWZ A;  3CFS B;  4A0A A;  3N0D A;  2HJ4 A;  4X3E A;  4JSV C;  3K27 A;  3C99 A;  4U1E I;  2CN3 A;  5I5J A;  3SVW D;  3UR4 A;  4L3H D;  2I3S A;  2XL3 A;  2OVP B;  4ZOV A;  5FKR A;  3ODT A;  5B4W A;  3I8C A;  1B9X A;  3P4F A;  4L3G D;  5TF2 A;  3DXK C;  4GM9 A;  2YNO A;  3OTT A;  5GSA A;  3SHF A;  5HE2 B;  4J78 A;  2YNP A;  4E5Z A;  2OVR B;  3MZL A;  4GM8 A;  3UKR C;  4CI3 A;  1VYH C;  3MXX A;  2P9L C;  3DXM C;  3VH0 A;  2H6N A;  5FXY A;  3RFH A;  2HES X;  4Y7R A;  3AL8 B;  4A0B B;  4KFM B;  2P9I C;  3PXT D;  4A2L A;  3EWE A;  1NR0 A;  5C9Z B;  4HDJ A;  1TYQ C;  1FWX A;  4AOW A;  3F3F A;  4PC0 A;  4GGA A;  3BG1 A;  3EI2 A;  4A09 A;  5IGO A;  4J0W A;  5HQG A;  3EI1 A;  4A7J A;  5EML B;  4E54 A;  4QQE A;  2IUR A;  1L0Q A;  5GXH A;  3KRW B;  3RSE C;  4XYI A;  3I7N A;  2H9M A;  2Z2O A;  5KDO B;  3OKY B;  3L4O D;  4J73 A;  5CXC A;  3JZG A;  3C5M A;  2H9N A;  3CIK B;  4MK0 B;  5A2Q g;  4O3U B;  4D6V A;  4CZY A;  4J81 A;  2I0R A;  4X61 B;  4IMM A;  5EMK B;  2HKM A;  3MZK A;  2OJY A;  1XIP A;  3DWL C;  4JSP C;  4PNK B;  1MG3 A;  2QXV A;  5EM2 B;  2P9N C;  3EI3 B;  3FM0 A;  3RN0 D;  4A0A B;  5THA A;  4CZX A;  3PVU B;  2AGX A;  4CY2 A;  5CYK A;  2AGL A;  1JMX B;  1GXR A;  2H6K A;  4GQ1 A;  4ZOZ A;  5C2W B;  5HE1 B;  2G99 A;  4GGD A;  2CE9 A;  5FKQ A;  3C9C A;  3RLM D;  2J55 H;  4ERQ A;  5EMM B;  3ORV D;  4J84 A;  4J87 A;  5FKT A;  1SQ9 A;  2O9K A;  5EAM A;  3V5W B;  2BCJ B;  2GC4 A;  3EI4 A;  4X60 B;  1JOF A;  3PE7 A;  3RRM C;  2HXC A;  3IIY A;  4ES0 A;  1N6F A;  1K8K C;  4GM3 A;  4JT5 C;  3JRP A;  4U7A A;  3UKU C;  5AMS A;  4ZOY A;  2IUV A;  2AGW A;  4N14 A;  3ZWL B;  1QNI A;  4A08 A;  5K1C C;  3SBR A;  2TRC B;  2IWF A;  4A09 B;  4GQ2 P;  2I0S A;  5AJA A;  5HYN B;  2OK4 A;  5FA5 B;  5TEE A;  2Q7Q A;  4UI9 R;  1B9Y A;  3OL2 A;  2QC5 A;  1JJU B;  4O9D A;  3IJC A;  4LG9 A;  1PI6 A;  1N6E A;  3PXW D;  2UZX B;  4CZV A;  3IJ1 A;  5CXC B;  2XYI A;  4GQB B;  3PVW B;  4GMB A;  3JPX A;  1PBY B;  5I5M A;  2PM9 A;  1P22 A;  4H5J A;  5IC7 A;  2CNX A;  3PSL A;  4ERY A;  2PM6 B;  1JMZ B;  2H47 A;  4LG8 A;  5H17 A;  3IIW A;  1SQJ A;  4G56 B;  2AGZ A;  1TBG A;  4PSX B;  3F3P A;  4ZN4 A;  5HE3 B;  4O3T B;  4FHL A;  5C2V B;  1A0R B;  4PBZ A;  4CC9 A;  3HFQ A;  2I0T A;  3KRX B;  4L1Q D;  4CI1 A;  2B5M A;  4CY5 A;  1Q47 A;  3FRX A;  4IA9 A;  5I5I A;  3JB9 L;  4NSX A;  5CYK B;  1U4C A;  1GOT B;  4LGN A;  3VGZ A;  4J82 A;  4A11 B;  2GC7 A;  2YB8 B;  2PBI B;  4CI8 A;  3UVN A;  2J56 H;  2Z2P A;  4O1Q D;  4BH6 A;  3GRE A;  3I2N A;  3DM0 A;  5SXM A;  2G9A A;  4GZ8 A;  4CI2 A;  4FA5 D;  3I7K A;  2XL2 A;  5CXB A;  2AGY A;  5FQD A;  1NEX B;  3RFG A;  3AL8 A;  3ULE C;  4JSX C;  2B4E A;  1MDA H;  4J79 A;  1K32 A;  4CY1 A;  3OKT A;  2P9K C;  2W18 A;  3V7D B;  5IGQ A;  4PXW A;  2MTA H;  3EI4 B;  3UVO A;  4JD2 C;  2YBA A;  4YVD A;  1SHY B;  5H14 A;  2H68 A;  3MKQ A;  3AFC A;  2I3T A;  3AL9 A;  2Z2N A;  3DSM A;  1PGU A;  3GFC A;  5IJ8 E;  4QL1 A;  2H9P A;  2PM7 B;  4E5Z B;  5FKS A;  3SWS D;  4K3J B;  3VA6 A;  3J81 g;  3CFV A;  3OL2 B;  3SFZ A;  3SJL D;  1OMW B;  4Y5R D;  3BG0 A;  2AQ5 A;  2H9L A;  2HYE A;  2CO0 A;  3I7H A;  4FWW A;  1XHM A;  3C75 H;  4AEZ A;  5IT9 g;  1XKS A;  4K3I D;  2H13 A;  3PXS D;  2PM9 B;  2P9P C;  5EM2 A;  4BUJ C;  3EMH A;  2AH1 A;  2CN2 A;  3EI3 A;  2CE8 A;  2OIZ A;  2OK6 A;  3UVL A;  4EWR A;  3EI2 B;  3SN6 B;  2AH0 A;  3V9F A;  3EI1 B;  4CY3 A;  4E54 B;  4FA1 D;  5TDH B;  4TZ4 A;  2BBK H;  3IKO A;  4Z8L A;  3I7O A;  5EAP A;  3JZN A;  1GG2 B;  3L4M D;  3I7L A;  1ERJ A;  5HE0 B;  5EAR A;  4QT8 A;  3SCY A;  1PEV A;  5H1M A;  5AFU 3;  3W15 A;  1R5M A;  4XYH A;  5CXB B;  3JAM g;  4A2M A;  4I79 A;  3I7P A;  4J8G A;  3E0C A;  3F3G A;  3K26 A;  3FGB A; 
#chains in the Genus database with same CATH topology
 2JKX A;  4ERZ A;  1N6D A;  4XEI C;  3NVN A;  5FLX g;  2B5L A;  3JZH A;  4QRJ A;  4BP9 A;  3EQ8 A;  3PSC B;  4J8B A;  2VDQ A;  4X63 B;  4FA4 D;  2H6Q A;  1U2V C;  4RE5 A;  4JT6 C;  3EU7 A;  3UVK A;  2XU7 A;  3IUQ A;  1RI6 A;  4J77 A;  3N0E A;  4BL0 A;  1OLZ A;  1UTC A;  2IAA A;  3OKW A;  3IJ0 A;  2P9S C;  2CO0 C;  1JV2 A;  3RN1 D;  2J57 G;  3OW8 A;  2GNQ A;  4AN1 A;  2HKR A;  3EQ9 A;  1S4U X;  4AMY A;  4PSW B;  1GOG A;  4A0B A;  2P9U C;  3JRO A;  2IWK A;  4H5I A;  4J0X A;  3IUL A;  3NID A;  5TEF A;  2YNN A;  4FAN D;  5EMJ B;  3J80 g;  2H3X A;  1O6F A;  3AH8 B;  1GOH A;  2YMU A;  4WK4 A;  4FB1 D;  1QFM A;  4PBY A;  3UVM A;  3QI0 A;  3NVQ A;  2EBS A;  3MMY A;  3U4Y A;  5FFG A;  3NVX A;  1U8C A;  5IJ7 E;  5EAL A;  3EG6 A;  4O02 A;  3B7F A;  3VI4 A;  2H14 A;  3SXT D;  4A08 B;  4G1E A;  4JXM A;  2HJB A;  3OKY A;  4OWR A;  4O45 A;  5M5V A;  1C9L A;  1YFQ A;  4FA9 D;  5GXI A;  2XE4 A;  4JSN C;  5K19 A;  4D0K A;  4J86 A;  3SBP A;  2UZY B;  4A11 A;  3T3M A;  3MKS B;  3SBQ A;  1MG2 A;  2IUQ A;  2B5N A;  3BWS A;  4ESG A;  4R7A B;  5GMK n;  4ZOX A;  2EIE A;  4L9O A;  4MMZ A;  2OVQ B;  3SMR A;  3I8E A;  4OZU A;  4GGC A;  2IUP A;  3I89 A;  3A0F A;  3RMZ D;  3SLE D;  4FAV D;  1M1X A;  1GP2 B;  1QFS A;  5M5U A;  5JWZ A;  3CFS B;  4A0A A;  3N0D A;  2HJ4 A;  4X3E A;  4JSV C;  3K27 A;  3C99 A;  4U1E I;  2CN3 A;  3O4J A;  5I5J A;  3SVW D;  3UR4 A;  5M5T A;  4L3H D;  2I3S A;  2XL3 A;  2OVP B;  4UM8 A;  4ZOV A;  1UOQ A;  5FKR A;  3ODT A;  5B4W A;  3I8C A;  1B9X A;  3P4F A;  3IUJ A;  4L3G D;  5TF2 A;  3DXK C;  4GM9 A;  3O4I A;  2YNO A;  4AN0 A;  3OTT A;  5GSA A;  2QZP A;  3SHF A;  5HE2 B;  4J78 A;  2YNP A;  4E5Z A;  2OVR B;  3MZL A;  4GM8 A;  3UKR C;  4CI3 A;  1VYH C;  1E8N A;  3MXX A;  2P9L C;  3DXM C;  3VH0 A;  2H6N A;  5FXY A;  3RFH A;  1I2M B;  2HES X;  4Y7R A;  3AL8 B;  4DNV A;  4A0B B;  4KFM B;  2P9I C;  4RE6 A;  3PXT D;  4A2L A;  3EWE A;  4O2W A;  1NR0 A;  4BCC A;  5C9Z B;  4HDJ A;  1VZ3 A;  2HU8 A;  1TYQ C;  1FWX A;  4AOW A;  3F3F A;  4PC0 A;  4GGA A;  3BG1 A;  3EI2 A;  4A09 A;  4AX4 A;  5IGO A;  4J0W A;  5HQG A;  5C92 A;  3EI1 A;  4A7J A;  5EML B;  4E54 A;  4QQE A;  2IUR A;  1L0Q A;  4BCB A;  5GXH A;  3KRW B;  3RSE C;  4MMY A;  4XYI A;  3I7N A;  2H9M A;  2Z2O A;  5KDO B;  3OKY B;  3NIF A;  3K6S A;  3L4O D;  4J73 A;  2VZ3 A;  5CXC A;  4Z7Q A;  3QHY B;  4NBM A;  5FFO A;  3JZG A;  3O4G A;  4WJK A;  1BPO A;  2VDK A;  2H9N A;  3C5M A;  3CIK B;  4MK0 B;  1TYE A;  2VDM A;  1K3I A;  4IRZ A;  5A2Q g;  4O3U B;  4D6V A;  4CZY A;  1E8M A;  3ZE1 A;  4J81 A;  2I0R A;  2EIC A;  2VZ1 A;  4X61 B;  4IMM A;  3VI3 A;  2EID A;  5EMK B;  2HKM A;  3MZK A;  2OJY A;  1XIP A;  3DWL C;  4JSP C;  4PNK B;  1MG3 A;  2QXV A;  3FCS A;  5EM2 B;  2P9N C;  3GD1 I;  3EI3 B;  3V4V A;  2VDO A;  3ZDZ A;  3DDU A;  3FM0 A;  3RN0 D;  4A0A B;  4AMZ A;  5THA A;  4CZX A;  3PVU B;  1H2Y A;  2AGX A;  3MUO A;  4CY2 A;  5CYK A;  2AGL A;  1JMX B;  1GXR A;  2H6K A;  2QR5 A;  1C9I A;  4GQ1 A;  4ZOZ A;  4NEN A;  5C2W B;  5HE1 B;  2G99 A;  4GGD A;  2CE9 A;  5FKQ A;  3C9C A;  3RLM D;  2J55 H;  3O4H A;  4ERQ A;  3IVM A;  5EMM B;  3ORV D;  1YR2 A;  4J84 A;  4J87 A;  5FKT A;  3IUM A;  1SQ9 A;  2O9K A;  5EAM A;  2VDN A;  3V5W B;  2BCJ B;  1VE6 A;  2GC4 A;  3EI4 A;  2BKL A;  4X60 B;  1JOF A;  3PE7 A;  3RRM C;  2HXC A;  1O6G A;  4D9S A;  3OF7 A;  4G1M A;  3IIY A;  2EIB A;  4ES0 A;  1N6F A;  1K8K C;  4GM3 A;  1H2W A;  4JT5 C;  3ZDX A;  1GOF A;  3JRP A;  4U7A A;  3UKU C;  5AMS A;  4ZOY A;  2IUV A;  2AGW A;  4N14 A;  3ZWL B;  4Z7N A;  1QNI A;  4A08 A;  5K1C C;  3SBR A;  2TRC B;  2IWF A;  4A09 B;  4GQ2 P;  2I0S A;  5AJA A;  5HYN B;  3KCI A;  3ZE2 A;  2OK4 A;  5FA5 B;  5TEE A;  2Q7Q A;  4UI9 R;  1B9Y A;  4BCD A;  4G55 A;  3OL2 A;  2QC5 A;  1JJU B;  3EQ7 A;  3V4P A;  4O9D A;  4MMX A;  3IJC A;  4LG9 A;  1H2Z A;  1H2X A;  1PI6 A;  1N6E A;  3PXW D;  2UZX B;  4NC4 A;  4CZV A;  3IJ1 A;  5CXC B;  2XYI A;  4GQB B;  2HU7 A;  2XZG A;  3PVW B;  4GMB A;  3K71 A;  3JPX A;  1PBY B;  5M5R A;  5I5M A;  2PM9 A;  4DNW A;  4BP8 A;  1P22 A;  4H5J A;  5IC7 A;  2VDL A;  2CNX A;  3PSL A;  4ERY A;  2PM6 B;  1JMZ B;  2H47 A;  4LG8 A;  4UM9 A;  5H17 A;  3IIW A;  1UOO A;  1SQJ A;  4G56 B;  2AGZ A;  4NAA A;  1TBG A;  4PSX B;  3F3P A;  4ZN4 A;  3ZE0 A;  5HE3 B;  4O3T B;  2VDP A;  4FHL A;  4WK0 A;  5C2V B;  1A0R B;  4PBZ A;  4CC9 A;  3HFQ A;  2I0T A;  3KRX B;  4L1Q D;  4CI1 A;  2B5M A;  4JHN A;  4CY5 A;  1Q47 A;  5E6S A;  3FRX A;  4IA9 A;  5I5I A;  3IUN A;  1E5T A;  3JB9 L;  4NSX A;  5CYK B;  1U4C A;  1GOT B;  4LGN A;  3VGZ A;  4J82 A;  4A11 B;  2GC7 A;  5M5S A;  2YB8 B;  2PBI B;  4CI8 A;  3UVN A;  2J56 H;  2Z2P A;  4O1Q D;  4BH6 A;  3GRE A;  1T2X A;  3I2N A;  2XDW A;  3DM0 A;  5SXM A;  2G9A A;  4GZ8 A;  4CI2 A;  4FA5 D;  3I7K A;  2XL2 A;  5CXB A;  2AGY A;  5FQD A;  1NEX B;  3RFG A;  3AL8 A;  3ULE C;  5E6U A;  4JSX C;  2B4E A;  1MDA H;  4J79 A;  1K32 A;  4CY1 A;  3OKT A;  2P9K C;  3T3P A;  2W18 A;  3V7D B;  5IGQ A;  4PXW A;  2MTA H;  3EI4 B;  3UVO A;  1UOP A;  4JD2 C;  2YBA A;  3GC3 B;  4YVD A;  1SHY B;  5H14 A;  4QAM A;  3ZDY A;  2H68 A;  2VC2 A;  3MKQ A;  3AFC A;  2I3T A;  3AL9 A;  1JTD B;  2Z2N A;  3DSM A;  3MVD K;  1PGU A;  3GFC A;  5IJ8 E;  4JHP C;  4QL1 A;  2H9P A;  1VZ2 A;  2PM7 B;  4E5Z B;  5FKS A;  3SWS D;  4K3J B;  3VA6 A;  3J81 g;  3CFV A;  3OL2 B;  3SFZ A;  3SJL D;  1OMW B;  4Y5R D;  3BG0 A;  2AQ5 A;  2H9L A;  2HYE A;  2CO0 A;  3I7H A;  5HDB A;  4FWW A;  1A12 A;  1XHM A;  3C75 H;  4AEZ A;  5IT9 g;  1XKS A;  4K3I D;  2H13 A;  3PXS D;  2PM9 B;  4DNU A;  2P9P C;  5EM2 A;  4BUJ C;  3EMH A;  3EI3 A;  2AH1 A;  2CN2 A;  2CE8 A;  2OIZ A;  2OK6 A;  3UVL A;  4EWR A;  3EI2 B;  3SN6 B;  2AH0 A;  2WQ8 A;  3V9F A;  3EI1 B;  4CY3 A;  3IJE A;  3FCU A;  4E54 B;  4FA1 D;  5TDH B;  5E6R A;  4TZ4 A;  2BBK H;  2HU5 A;  3IKO A;  1VE7 A;  3I7O A;  4Z8L A;  3JZN A;  5EAP A;  1GG2 B;  3L4M D;  5M61 A;  3I7L A;  4WK2 A;  1L5G A;  3IUR A;  1ERJ A;  5HE0 B;  4L1M A;  3K72 A;  5EAR A;  4QT8 A;  3SCY A;  1PEV A;  5H1M A;  3NIG A;  5AFU 3;  3W15 A;  1R5M A;  5C86 A;  2VDR A;  4XYH A;  5CXB B;  3JAM g;  4A2M A;  4I79 A;  3I7P A;  4J8G A;  3E0C A;  4Z7O A;  3F3G A;  3K26 A;  3MUN A;  3FGB A; 
#chains in the Genus database with same CATH homology
 4ERZ A;  1N6D A;  4XEI C;  3NVN A;  5FLX g;  2B5L A;  3JZH A;  4QRJ A;  3PSC B;  4J8B A;  4FA4 D;  4X63 B;  2H6Q A;  1U2V C;  4JT6 C;  3EU7 A;  3UVK A;  2XU7 A;  1RI6 A;  4J77 A;  3N0E A;  4BL0 A;  1OLZ A;  2IAA A;  3OKW A;  3IJ0 A;  2P9S C;  2CO0 C;  3RN1 D;  2J57 G;  3OW8 A;  2GNQ A;  2HKR A;  1S4U X;  4PSW B;  4A0B A;  2P9U C;  3JRO A;  2IWK A;  4H5I A;  4J0X A;  5TEF A;  2YNN A;  4FAN D;  5EMJ B;  3J80 g;  2H3X A;  3AH8 B;  2YMU A;  4FB1 D;  4PBY A;  3UVM A;  3NVQ A;  2EBS A;  3MMY A;  3U4Y A;  3NVX A;  5IJ7 E;  5EAL A;  3EG6 A;  3B7F A;  2H14 A;  3SXT D;  4A08 B;  4JXM A;  2HJB A;  3OKY A;  4OWR A;  4O45 A;  4FA9 D;  1YFQ A;  5GXI A;  4JSN C;  5K19 A;  4D0K A;  4J86 A;  3SBP A;  2UZY B;  4A11 A;  3MKS B;  3SBQ A;  1MG2 A;  2IUQ A;  2B5N A;  3BWS A;  4ESG A;  4R7A B;  5GMK n;  4ZOX A;  2OVQ B;  4L9O A;  3SMR A;  3I8E A;  4OZU A;  4GGC A;  2IUP A;  3I89 A;  3A0F A;  3RMZ D;  3SLE D;  4FAV D;  1GP2 B;  5JWZ A;  3CFS B;  4A0A A;  3N0D A;  2HJ4 A;  4X3E A;  4JSV C;  3K27 A;  3C99 A;  4U1E I;  2CN3 A;  5I5J A;  3SVW D;  3UR4 A;  4L3H D;  2I3S A;  2XL3 A;  2OVP B;  4ZOV A;  5FKR A;  3ODT A;  5B4W A;  3I8C A;  1B9X A;  3P4F A;  4L3G D;  5TF2 A;  3DXK C;  4GM9 A;  2YNO A;  3OTT A;  5GSA A;  3SHF A;  5HE2 B;  4J78 A;  2YNP A;  4E5Z A;  2OVR B;  3MZL A;  4GM8 A;  3UKR C;  4CI3 A;  1VYH C;  3MXX A;  2P9L C;  3DXM C;  3VH0 A;  2H6N A;  5FXY A;  3RFH A;  2HES X;  4Y7R A;  3AL8 B;  4A0B B;  4KFM B;  2P9I C;  3PXT D;  4A2L A;  3EWE A;  1NR0 A;  5C9Z B;  4HDJ A;  1TYQ C;  1FWX A;  4AOW A;  3F3F A;  4PC0 A;  4GGA A;  3BG1 A;  3EI2 A;  4A09 A;  5IGO A;  4J0W A;  5HQG A;  3EI1 A;  4A7J A;  5EML B;  4E54 A;  4QQE A;  2IUR A;  1L0Q A;  5GXH A;  3KRW B;  3RSE C;  4XYI A;  3I7N A;  2H9M A;  2Z2O A;  5KDO B;  3OKY B;  3L4O D;  4J73 A;  5CXC A;  3JZG A;  3C5M A;  2H9N A;  3CIK B;  4MK0 B;  5A2Q g;  4O3U B;  4D6V A;  4CZY A;  4J81 A;  2I0R A;  4X61 B;  4IMM A;  5EMK B;  2HKM A;  3MZK A;  2OJY A;  1XIP A;  3DWL C;  4JSP C;  4PNK B;  1MG3 A;  2QXV A;  5EM2 B;  2P9N C;  3EI3 B;  3FM0 A;  3RN0 D;  4A0A B;  5THA A;  4CZX A;  3PVU B;  2AGX A;  4CY2 A;  5CYK A;  2AGL A;  1JMX B;  1GXR A;  2H6K A;  4GQ1 A;  4ZOZ A;  5C2W B;  5HE1 B;  2G99 A;  4GGD A;  2CE9 A;  5FKQ A;  3C9C A;  3RLM D;  2J55 H;  4ERQ A;  5EMM B;  3ORV D;  4J84 A;  4J87 A;  5FKT A;  1SQ9 A;  2O9K A;  5EAM A;  3V5W B;  2BCJ B;  2GC4 A;  3EI4 A;  4X60 B;  1JOF A;  3PE7 A;  3RRM C;  2HXC A;  3IIY A;  4ES0 A;  1N6F A;  1K8K C;  4GM3 A;  4JT5 C;  3JRP A;  4U7A A;  3UKU C;  5AMS A;  4ZOY A;  2IUV A;  2AGW A;  4N14 A;  3ZWL B;  1QNI A;  4A08 A;  5K1C C;  3SBR A;  2TRC B;  2IWF A;  4A09 B;  4GQ2 P;  2I0S A;  5AJA A;  5HYN B;  2OK4 A;  5FA5 B;  5TEE A;  2Q7Q A;  4UI9 R;  1B9Y A;  3OL2 A;  2QC5 A;  1JJU B;  4O9D A;  3IJC A;  4LG9 A;  1PI6 A;  1N6E A;  3PXW D;  2UZX B;  4CZV A;  3IJ1 A;  5CXC B;  2XYI A;  4GQB B;  3PVW B;  4GMB A;  3JPX A;  1PBY B;  5I5M A;  2PM9 A;  1P22 A;  4H5J A;  5IC7 A;  2CNX A;  3PSL A;  4ERY A;  2PM6 B;  1JMZ B;  2H47 A;  4LG8 A;  5H17 A;  3IIW A;  1SQJ A;  4G56 B;  2AGZ A;  1TBG A;  4PSX B;  3F3P A;  4ZN4 A;  5HE3 B;  4O3T B;  4FHL A;  5C2V B;  1A0R B;  4PBZ A;  4CC9 A;  3HFQ A;  2I0T A;  3KRX B;  4L1Q D;  4CI1 A;  2B5M A;  4CY5 A;  1Q47 A;  3FRX A;  4IA9 A;  5I5I A;  3JB9 L;  4NSX A;  5CYK B;  1U4C A;  1GOT B;  4LGN A;  3VGZ A;  4J82 A;  4A11 B;  2GC7 A;  2YB8 B;  2PBI B;  4CI8 A;  3UVN A;  2J56 H;  2Z2P A;  4O1Q D;  4BH6 A;  3GRE A;  3I2N A;  3DM0 A;  5SXM A;  2G9A A;  4GZ8 A;  4CI2 A;  4FA5 D;  3I7K A;  2XL2 A;  5CXB A;  2AGY A;  5FQD A;  1NEX B;  3RFG A;  3AL8 A;  3ULE C;  4JSX C;  2B4E A;  1MDA H;  4J79 A;  1K32 A;  4CY1 A;  3OKT A;  2P9K C;  2W18 A;  3V7D B;  5IGQ A;  4PXW A;  2MTA H;  3EI4 B;  3UVO A;  4JD2 C;  2YBA A;  4YVD A;  1SHY B;  5H14 A;  2H68 A;  3MKQ A;  3AFC A;  2I3T A;  3AL9 A;  2Z2N A;  3DSM A;  1PGU A;  3GFC A;  5IJ8 E;  4QL1 A;  2H9P A;  2PM7 B;  4E5Z B;  5FKS A;  3SWS D;  4K3J B;  3VA6 A;  3J81 g;  3CFV A;  3OL2 B;  3SFZ A;  3SJL D;  1OMW B;  4Y5R D;  3BG0 A;  2AQ5 A;  2H9L A;  2HYE A;  2CO0 A;  3I7H A;  4FWW A;  1XHM A;  3C75 H;  4AEZ A;  5IT9 g;  1XKS A;  4K3I D;  2H13 A;  3PXS D;  2PM9 B;  2P9P C;  5EM2 A;  4BUJ C;  3EMH A;  2AH1 A;  2CN2 A;  3EI3 A;  2CE8 A;  2OIZ A;  2OK6 A;  3UVL A;  4EWR A;  3EI2 B;  3SN6 B;  2AH0 A;  3V9F A;  3EI1 B;  4CY3 A;  4E54 B;  4FA1 D;  5TDH B;  4TZ4 A;  2BBK H;  3IKO A;  4Z8L A;  3I7O A;  5EAP A;  3JZN A;  1GG2 B;  3L4M D;  3I7L A;  1ERJ A;  5HE0 B;  5EAR A;  4QT8 A;  3SCY A;  1PEV A;  5H1M A;  5AFU 3;  3W15 A;  1R5M A;  4XYH A;  5CXB B;  3JAM g;  4A2M A;  4I79 A;  3I7P A;  4J8G A;  3E0C A;  3F3G A;  3K26 A;  3FGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...