2I0TA

Crystal structure of phenylacetaldehyde derived r-carbinolamine adduct of aromatic amine dehydrogenase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
359
structure length
359
Chain Sequence
b'EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 104
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i0tA01
3EWEA 4J87A 2YNOA 2EBSA 5EARA 5TF2A 4UI9R 2J55H 5GSAA 4J82A 1JMZB 3FGBA 2IAAA 2CE8A 4A7JA 2J56H 2IUVA 5FLXg 4ERYA 4J0WA 2AGYA 5FKQA 4AOWA 3J81g 4L9OA 2GC7A 1Q47A 3RRMC 3B7FA 4Z8LA 4CI3A 4PBYA 1TBGA 2H9MA 3PSCB 1A0RB 2HXCA 2H6NA 4X3EA 1R5MA 4TZ4A 2Z2OA 4O1QD 3F3GA 2H9PA 3J80g 3SLED 2CN3A 1L0QA 4A09A 2AGLA 4HDJA 2H14A 2HKRA 3VH0A 4J73A 3ODTA 5FQDA 5GXHA 2YNPA 3FM0A 3IIYA 4O9DA 4A0AB 4JT5C 2HJ4A 3K27A 4KFMB 2BCJB 3JZHA 2CNXA 2P9SC 1SQJA 5AJAA 4GQ2P 4FA1D 4OZUA 3F3PA 5HE3B 3SBQA 3HFQA 3SHFA 2P9NC 3EI1A 4CZXA 4GM9A 3BG0A 4JSNC 1PI6A 2I3TA 4E5ZB 4GM3A 3DXKC 3SMRA 3VA6A 2IWFA 4FWWA 4NSXA 4YVDA 4L3HD 3JAMg 5GMKn 1PGUA 2H13A 3I89A 4GZ8A 2XU7A 4L1QD 5HE1B 3L4OD 5EAMA 5C2VB 4CY2A 4JXMA 4CC9A 4CY3A 2UZXB 4R7AB 5I5IA 3BG1A 4K3ID 4CZVA 3KRWB 1B9YA 3EI3B 3AL8B 4J84A 4Y7RA 4ZOXA 2IUQA 2OJYA 2H6QA 2CO0C 3PSLA 3MZKA 3EI3A 4PNKB 5AMSA 2HJBA 4GQBB 2P9KC 4CY5A 3E0CA 3MKQA 4CI2A 4A11B 3N0DA 5FKTA 2AH1A 3OL2A 5EM2B 3UVKA 3VGZA 4IMMA 5K19A 4J8BA 3SCYA 3V7DB 3I8CA 4A11A 3C9CA 1K32A 3DM0A 5EM2A 4A2LA 4ES0A 4J77A 3I7LA 3C5MA 3U4YA 1MG3A 4G56B 3PE7A 2AQ5A 4JSVC 3UVMA 4ZOVA 2G99A 3NVQA 2PM9B 1JJUB 5CXBB 3MZLA 2CE9A 2PM9A 3OTTA 4A09B 5EMLB 4CZYA 1PEVA 1N6EA 2OVRB 5CXBA 3SWSD 3JRPA 5FKSA 4X63B 4ERQA 4ERZA 1GXRA 1MG2A 1OMWB 5H1MA 3NVXA 2YNNA 4E54B 3CIKB 2YBAA 4O3UB 4QT8A 3IJCA 5CXCB 2UZYB 2OIZA 3V5WB 2TRCB 4E54A 1ERJA 5CXCA 4LGNA 2PM6B 3FRXA 4PBZA 2B5MA 3AFCA 3DWLC 3ZWLB 5A2Qg 2QXVA 5I5MA 4A08B 3KRXB 3EI1B 2B5NA 4J79A 1MDAH 3F3FA 5IC7A 3MKSB 4JSPC 4PC0A 1GG2B 3EI2B 3IJ0A 4A08A 1RI6A 1U4CA 3PXSD 1GOTB 3RSEC 2Z2PA 4D0KA 5TEEA 3UVLA 1XHMA 3EI2A 2HESX 3I7HA 2I0TA 3CFSB 2CO0A 3SFZA 3UVOA 5EAPA 2H47A 4FA4D 3RN0D 4ZOYA 3I8EA 3I7KA 2OK6A 5HQGA 5K1CC 4A2MA 4FB1D 2YMUA 4LG8A 4LG9A 5IJ7E 3SN6B 2Z2NA 4PSWB 1GP2B 2B5LA 3ULEC 1VYHC 5FA5B 5EMKB 5SXMA 4IA9A 3I7OA 3PXTD 3GREA 5CYKA 3NVNA 1N6FA 3N0EA 4AEZA 5FXYA 4JSXC 2HKMA 2I0SA 2PM7B 3SJLD 5HE0B 3AH8B 3OL2B 4Y5RD 4ZN4A 4K3JB 3JPXA 5IGOA 3JROA 5B4WA 3RLMD 4ESGA 5TDHB 2XL2A 4BUJC 4CI1A 3I2NA 4PXWA 4XYHA 4FAVD 3C75H 2PBIB 1TYQC 3IIWA 5AFU3 3JZGA 4O3TB 3OKTA 4XEIC 2GNQA 3GFCA 4MK0B 3SBRA 5EMMB 4A0BA 3OKYA 3L4MD 5EMJB 3EMHA 2B4EA 4I79A 5EALA 2P9UC 1NEXB 2Q7QA 5JWZA 2IURA 1JMXB 4GM8A 3DXMC 3RMZD 3EU7A 2OVPB 4PSXB 5IT9g 4U7AA 2IWKA 3I7PA 5H14A 3OKWA 2CN2A 3PVWB 1XIPA 4U1EI 4BL0A 5I5JA 4D6VA 1PBYB 3PVUB 4J8GA 4ZOZA 3UKRC 4OWRA 5KDOB 2O9KA 4H5JA 3EG6A 2J57G 5THAA 3RFGA 2YB8B 5IGQA 3IJ1A 4J81A 2XL3A 5HYNB 2OK4A 3BWSA 4X60B 3ORVD 2H9NA 2AH0A 3RFHA 4EWRA 2BBKH 3IKOA 1YFQA 4JT6C 3PXWD 4GQ1A 1B9XA 4QL1A 1N6DA 2W18A 4N14A 1P22A 2IUPA 2GC4A 4QRJA 4BH6A 4FAND 5H17A 4A0AA 1SHYB 3EI4B 3K26A 2H9LA 3CFVA 4GMBA 3JZNA 5HE2B 4GGDA 5FKRA 2H3XA 2MTAH 5IJ8E 3V9FA 3SXTD 4O45A 4QQEA 3P4FA 3EI4A 1OLZA 1S4UX 2H6KA 4X61B 3SBPA 2XYIA 5CYKB 1K8KC 2H68A 1FWXA 4J78A 5TEFA 4JD2C 2AGZA 1JOFA 1SQ9A 1XKSA 3AL9A 4E5ZA 3UVNA 2G9AA 2AGXA 2P9IC 4CY1A 2I0RA 2QC5A 3MXXA 4FHLA 3A0FA 5C2WB 3SVWD 2OVQB 5GXIA 5C9ZB 1QNIA 2HYEA 4L3GD 3W15A 2AGWA 3MMYA 4H5IA 3UR4A 4J0XA 4A0BB 4GGAA 4CI8A 3OKYB 3C99A 3I7NA 4J86A 4XYIA 3AL8A 3RN1D 2P9LC 4FA5D 3UKUC 2P9PC 3JB9L 1U2VC 3OW8A 1NR0A 3DSMA 2I3SA 4FA9D 4GGCA
chains in the Genus database with same CATH superfamily
3EWEA 4J87A 2YNOA 2EBSA 5EARA 5TF2A 2WQ8A 4UI9R 2J55H 5GSAA 4J82A 4BCCA 1JMZB 3FGBA 5HDBA 2IAAA 2CE8A 3IUMA 3GD1I 4A7JA 2J56H 3QHYB 3ZDYA 2IUVA 1A12A 5FLXg 4DNWA 4ERYA 4J0WA 3GC3B 1JTDB 3IURA 2XDWA 2AGYA 5FKQA 4AOWA 3J81g 4L9OA 2GC7A 3K6SA 1Q47A 3RRMC 2VDLA 3B7FA 1E8MA 4AMZA 4UM9A 4Z8LA 4CI3A 1BPOA 4PBYA 1TBGA 2H9MA 4O02A 4WK4A 3PSCB 1A0RB 1UOOA 2HXCA 1UOPA 2H6NA 4X3EA 3IULA 1R5MA 4L1MA 1QFSA 4TZ4A 2Z2OA 4O1QD 3F3GA 2H9PA 3J80g 3SLED 2CN3A 1L0QA 3IUQA 4A09A 2AGLA 4HDJA 2H14A 2HKRA 4IRZA 3VH0A 4J73A 3ODTA 5FQDA 5GXHA 2YNPA 3FM0A 3IIYA 4MMXA 4O9DA 4A0AB 5M5UA 4JT5C 4DNUA 2HJ4A 3K27A 4D9SA 5M5TA 4KFMB 2BCJB 3NIGA 3JZHA 2CNXA 2P9SC 1SQJA 5AJAA 4GQ2P 2VDKA 4FA1D 4OZUA 3F3PA 5HE3B 3SBQA 4WK2A 3HFQA 5M5RA 3SHFA 2P9NC 3EI1A 4CZXA 4GM9A 3BG0A 4JSNC 5C92A 1H2XA 1O6GA 1PI6A 2I3TA 4E5ZB 4GM3A 4JHPC 3DXKC 3SMRA 3VA6A 2IWFA 4FWWA 4NSXA 4YVDA 4L3HD 5I5MA 3JAMg 1QFMA 5GMKn 1PGUA 2H13A 3I89A 4GZ8A 2XU7A 4L1QD 5HE1B 3L4OD 2EICA 5EAMA 5C2VB 4CY2A 4MMZA 4JXMA 4CC9A 4CY3A 3MUOA 2UZXB 4R7AB 5I5IA 3BG1A 4K3ID 5E6UA 4CZVA 4G1EA 3KRWB 1B9YA 5FFGA 3EI3B 3AL8B 4J84A 4Y7RA 4ZOXA 2XE4A 4DNVA 2IUQA 2OJYA 1TYEA 2H6QA 2CO0C 3ZDZA 3PSLA 3MZKA 3EI3A 4PNKB 5AMSA 2HJBA 4GQBB 2P9KC 4CY5A 3MVDK 3E0CA 3MKQA 4CI2A 4A11B 3N0DA 5FKTA 2AH1A 3OL2A 3VI4A 5EM2B 4QAMA 3UVKA 3EQ9A 3VGZA 4IMMA 5K19A 4J8BA 3SCYA 3V7DB 3I8CA 4A11A 3C9CA 3FCUA 1K32A 3DM0A 5EM2A 2HU8A 4A2LA 4ES0A 4J77A 3DDUA 3I7LA 3C5MA 3U4YA 1MG3A 4G56B 3PE7A 2AQ5A 2VDPA 4JSVC 3UVMA 4ZOVA 2G99A 3NVQA 4Z7OA 2PM9B 1JJUB 4WJKA 3IVMA 5CXBB 3O4IA 3MZLA 4AN0A 1VZ2A 2CE9A 2PM9A 3OTTA 2EIBA 2VDMA 5EMLB 4A09B 4CZYA 3V4VA 1PEVA 1N6EA 2OVRB 4MMYA 5CXBA 2VDNA 3SWSD 4NENA 3JRPA 5FKSA 4X63B 4ERQA 1E8NA 4ERZA 1GXRA 1MG2A 1OMWB 5H1MA 3NVXA 2YNNA 3NIFA 3ZE1A 4E54B 3CIKB 2YBAA 4O3UB 4QT8A 3IJCA 5CXCB 1E5TA 2UZYB 2OIZA 3V5WB 1UTCA 2HU7A 4BCBA 2TRCB 4E54A 1ERJA 5CXCA 4LGNA 5C86A 2PM6B 4JHNA 3FRXA 4PBZA 1C9IA 2B5MA 3AFCA 3DWLC 3ZWLB 2QXVA 5A2Qg 1UOQA 4A08B 3KRXB 3EI1B 2B5NA 1VZ3A 4J79A 1MDAH 4BCDA 3F3FA 5FFOA 5IC7A 3MKSB 4JSPC 4PC0A 1GG2B 3EI2B 3EQ7A 3IJ0A 4A08A 1RI6A 3NIDA 1U4CA 3PXSD 1GOTB 3RSEC 2Z2PA 4D0KA 3OF7A 1GOHA 5TEEA 3UVLA 1XHMA 3EI2A 2HESX 3I7HA 2I0TA 3CFSB 2CO0A 3SFZA 3UVOA 5EAPA 2H47A 4FA4D 3RN0D 4ZOYA 3I8EA 3I7KA 2OK6A 4G1MA 5HQGA 5K1CC 4A2MA 1I2MB 4FB1D 2YMUA 4Z7NA 4LG8A 4AMYA 4AX4A 4LG9A 3T3MA 5IJ7E 3SN6B 2Z2NA 4PSWB 1GP2B 1C9LA 2B5LA 3ULEC 5M61A 2VDOA 1VYHC 5FA5B 5EMKB 5SXMA 4IA9A 3I7OA 1YR2A 3ZE0A 3PXTD 3GREA 5CYKA 3NVNA 1N6FA 3N0EA 4AEZA 5FXYA 1GOFA 2HKMA 3IUJA 4JSXC 2I0SA 2PM7B 1H2WA 3SJLD 5HE0B 3AH8B 3OL2B 4Y5RD 5E6RA 4ZN4A 3FCSA 4K3JB 3JPXA 5IGOA 3JROA 5B4WA 3RLMD 4ESGA 5TDHB 2XL2A 1JV2A 3ZE2A 4NBMA 4BUJC 4CI1A 3I2NA 3QI0A 4PXWA 4XYHA 4FAVD 3C75H 2PBIB 1TYQC 3IIWA 5AFU3 3JZGA 4O3TB 3OKTA 4XEIC 2GNQA 2VZ3A 3GFCA 4MK0B 3SBRA 5EMMB 4A0BA 3OKYA 3L4MD 5EMJB 3EMHA 3O4JA 2B4EA 4I79A 5EALA 2P9UC 2EIEA 3KCIA 2VZ1A 1NEXB 2Q7QA 2QZPA 5JWZA 3IUNA 2IURA 1JMXB 3T3PA 4GM8A 3DXMC 1L5GA 3RMZD 3EU7A 2OVPB 4PSXB 5IT9g 4U7AA 2IWKA 3I7PA 5H14A 3OKWA 2CN2A 3PVWB 1XIPA 4U1EI 4BL0A 5I5JA 2VC2A 4D6VA 1PBYB 4G55A 3V4PA 3PVUB 4J8GA 4ZOZA 3UKRC 4OWRA 5KDOB 2O9KA 4H5JA 3EG6A 2J57G 5THAA 1VE7A 3RFGA 2YB8B 5IGQA 3IJ1A 2EIDA 4J81A 2XL3A 5HYNB 2OK4A 3BWSA 1H2ZA 4X60B 3IJEA 4RE5A 3ORVD 2H9NA 2AH0A 3RFHA 4EWRA 2BBKH 3IKOA 1YFQA 4JT6C 3EQ8A 3PXWD 4GQ1A 1U8CA 1B9XA 4QL1A 3O4HA 1N6DA 2W18A 3ZDXA 4N14A 1P22A 2XZGA 5E6SA 2IUPA 1VE6A 2GC4A 4QRJA 4AN1A 4BH6A 1O6FA 3MUNA 4FAND 5H17A 4Z7QA 4A0AA 1SHYB 3EI4B 3K26A 2H9LA 3CFVA 4GMBA 2HU5A 3JZNA 5HE2B 1M1XA 4GGDA 5FKRA 2H3XA 2MTAH 5IJ8E 2VDQA 3SXTD 3V9FA 4O45A 4QQEA 1GOGA 3P4FA 3EI4A 1OLZA 1S4UX 2H6KA 4X61B 3SBPA 2XYIA 4NAAA 5CYKB 5M5SA 4UM8A 1K8KC 2H68A 1FWXA 4J78A 5TEFA 4JD2C 2AGZA 1JOFA 1SQ9A 4BP8A 1XKSA 3AL9A 4E5ZA 3UVNA 2G9AA 4RE6A 4BP9A 2AGXA 2P9IC 4CY1A 2I0RA 2QC5A 3MXXA 4FHLA 1K3IA 3VI3A 3A0FA 2VDRA 4O2WA 5C2WB 3O4GA 3SVWD 2OVQB 5GXIA 5C9ZB 1QNIA 2HYEA 4L3GD 3W15A 2AGWA 3MMYA 4H5IA 3UR4A 4J0XA 4A0BB 4GGAA 4CI8A 2JKXA 3OKYB 3C99A 3I7NA 4J86A 4WK0A 3K72A 2BKLA 4XYIA 4NC4A 3AL8A 3RN1D 2P9LC 4FA5D 3UKUC 2QR5A 3K71A 1H2YA 2P9PC 3JB9L 1U2VC 3OW8A 1NR0A 3DSMA 2I3SA 4FA9D 4GGCA 1T2XA 5M5VA
chains in the Genus database with same CATH topology
3EWEA 4J87A 2YNOA 2EBSA 5EARA 5TF2A 4UI9R 2J55H 5GSAA 4J82A 1JMZB 3FGBA 2IAAA 2CE8A 4A7JA 2J56H 2IUVA 5FLXg 4ERYA 4J0WA 2AGYA 5FKQA 4AOWA 3J81g 4L9OA 2GC7A 1Q47A 3RRMC 3B7FA 4Z8LA 4CI3A 4PBYA 1TBGA 2H9MA 3PSCB 1A0RB 2HXCA 2H6NA 4X3EA 1R5MA 4TZ4A 2Z2OA 4O1QD 3F3GA 2H9PA 3J80g 3SLED 2CN3A 1L0QA 4A09A 2AGLA 4HDJA 2H14A 2HKRA 3VH0A 4J73A 3ODTA 5FQDA 5GXHA 2YNPA 3FM0A 3IIYA 4O9DA 4A0AB 4JT5C 2HJ4A 3K27A 4KFMB 2BCJB 3JZHA 2CNXA 2P9SC 1SQJA 5AJAA 4GQ2P 4FA1D 4OZUA 3F3PA 5HE3B 3SBQA 3HFQA 3SHFA 2P9NC 3EI1A 4CZXA 4GM9A 3BG0A 4JSNC 1PI6A 2I3TA 4E5ZB 4GM3A 3DXKC 3SMRA 3VA6A 2IWFA 4FWWA 4NSXA 4YVDA 4L3HD 3JAMg 5GMKn 1PGUA 2H13A 3I89A 4GZ8A 2XU7A 4L1QD 5HE1B 3L4OD 5EAMA 5C2VB 4CY2A 4JXMA 4CC9A 4CY3A 2UZXB 4R7AB 5I5IA 3BG1A 4K3ID 4CZVA 3KRWB 1B9YA 3EI3B 3AL8B 4J84A 4Y7RA 4ZOXA 2IUQA 2OJYA 2H6QA 2CO0C 3PSLA 3MZKA 3EI3A 4PNKB 5AMSA 2HJBA 4GQBB 2P9KC 4CY5A 3E0CA 3MKQA 4CI2A 4A11B 3N0DA 5FKTA 2AH1A 3OL2A 5EM2B 3UVKA 3VGZA 4IMMA 5K19A 4J8BA 3SCYA 3V7DB 3I8CA 4A11A 3C9CA 1K32A 3DM0A 5EM2A 4A2LA 4ES0A 4J77A 3I7LA 3C5MA 3U4YA 1MG3A 4G56B 3PE7A 2AQ5A 4JSVC 3UVMA 4ZOVA 2G99A 3NVQA 2PM9B 1JJUB 5CXBB 3MZLA 2CE9A 2PM9A 3OTTA 4A09B 5EMLB 4CZYA 1PEVA 1N6EA 2OVRB 5CXBA 3SWSD 3JRPA 5FKSA 4X63B 4ERQA 4ERZA 1GXRA 1MG2A 1OMWB 5H1MA 3NVXA 2YNNA 4E54B 3CIKB 2YBAA 4O3UB 4QT8A 3IJCA 5CXCB 2UZYB 2OIZA 3V5WB 2TRCB 4E54A 1ERJA 5CXCA 4LGNA 2PM6B 3FRXA 4PBZA 2B5MA 3AFCA 3DWLC 3ZWLB 5A2Qg 2QXVA 5I5MA 4A08B 3KRXB 3EI1B 2B5NA 4J79A 1MDAH 3F3FA 5IC7A 3MKSB 4JSPC 4PC0A 1GG2B 3EI2B 3IJ0A 4A08A 1RI6A 1U4CA 3PXSD 1GOTB 3RSEC 2Z2PA 4D0KA 5TEEA 3UVLA 1XHMA 3EI2A 2HESX 3I7HA 2I0TA 3CFSB 2CO0A 3SFZA 3UVOA 5EAPA 2H47A 4FA4D 3RN0D 4ZOYA 3I8EA 3I7KA 2OK6A 5HQGA 5K1CC 4A2MA 4FB1D 2YMUA 4LG8A 4LG9A 5IJ7E 3SN6B 2Z2NA 4PSWB 1GP2B 2B5LA 3ULEC 1VYHC 5FA5B 5EMKB 5SXMA 4IA9A 3I7OA 3PXTD 3GREA 5CYKA 3NVNA 1N6FA 3N0EA 4AEZA 5FXYA 4JSXC 2HKMA 2I0SA 2PM7B 3SJLD 5HE0B 3AH8B 3OL2B 4Y5RD 4ZN4A 4K3JB 3JPXA 5IGOA 3JROA 5B4WA 3RLMD 4ESGA 5TDHB 2XL2A 4BUJC 4CI1A 3I2NA 4PXWA 4XYHA 4FAVD 3C75H 2PBIB 1TYQC 3IIWA 5AFU3 3JZGA 4O3TB 3OKTA 4XEIC 2GNQA 3GFCA 4MK0B 3SBRA 5EMMB 4A0BA 3OKYA 3L4MD 5EMJB 3EMHA 2B4EA 4I79A 5EALA 2P9UC 1NEXB 2Q7QA 5JWZA 2IURA 1JMXB 4GM8A 3DXMC 3RMZD 3EU7A 2OVPB 4PSXB 5IT9g 4U7AA 2IWKA 3I7PA 5H14A 3OKWA 2CN2A 3PVWB 1XIPA 4U1EI 4BL0A 5I5JA 4D6VA 1PBYB 3PVUB 4J8GA 4ZOZA 3UKRC 4OWRA 5KDOB 2O9KA 4H5JA 3EG6A 2J57G 5THAA 3RFGA 2YB8B 5IGQA 3IJ1A 4J81A 2XL3A 5HYNB 2OK4A 3BWSA 4X60B 3ORVD 2H9NA 2AH0A 3RFHA 4EWRA 2BBKH 3IKOA 1YFQA 4JT6C 3PXWD 4GQ1A 1B9XA 4QL1A 1N6DA 2W18A 4N14A 1P22A 2IUPA 2GC4A 4QRJA 4BH6A 4FAND 5H17A 4A0AA 1SHYB 3EI4B 3K26A 2H9LA 3CFVA 4GMBA 3JZNA 5HE2B 4GGDA 5FKRA 2H3XA 2MTAH 5IJ8E 3V9FA 3SXTD 4O45A 4QQEA 3P4FA 3EI4A 1OLZA 1S4UX 2H6KA 4X61B 3SBPA 2XYIA 5CYKB 1K8KC 2H68A 1FWXA 4J78A 5TEFA 4JD2C 2AGZA 1JOFA 1SQ9A 1XKSA 3AL9A 4E5ZA 3UVNA 2G9AA 2AGXA 2P9IC 4CY1A 2I0RA 2QC5A 3MXXA 4FHLA 3A0FA 5C2WB 3SVWD 2OVQB 5GXIA 5C9ZB 1QNIA 2HYEA 4L3GD 3W15A 2AGWA 3MMYA 4H5IA 3UR4A 4J0XA 4A0BB 4GGAA 4CI8A 3OKYB 3C99A 3I7NA 4J86A 4XYIA 3AL8A 3RN1D 2P9LC 4FA5D 3UKUC 2P9PC 3JB9L 1U2VC 3OW8A 1NR0A 3DSMA 2I3SA 4FA9D 4GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWE A;  4J87 A;  2YNO A;  2EBS A;  5EAR A;  5TF2 A;  4UI9 R;  2J55 H;  5GSA A;  4J82 A;  1JMZ B;  3FGB A;  2IAA A;  2CE8 A;  4A7J A;  2J56 H;  2IUV A;  5FLX g;  4ERY A;  4J0W A;  2AGY A;  5FKQ A;  4AOW A;  3J81 g;  4L9O A;  2GC7 A;  1Q47 A;  3RRM C;  3B7F A;  4Z8L A;  4CI3 A;  4PBY A;  1TBG A;  2H9M A;  3PSC B;  1A0R B;  2HXC A;  2H6N A;  4X3E A;  1R5M A;  4TZ4 A;  2Z2O A;  4O1Q D;  3F3G A;  2H9P A;  3J80 g;  3SLE D;  2CN3 A;  1L0Q A;  4A09 A;  2AGL A;  4HDJ A;  2H14 A;  2HKR A;  3VH0 A;  4J73 A;  3ODT A;  5FQD A;  5GXH A;  2YNP A;  3FM0 A;  3IIY A;  4O9D A;  4A0A B;  4JT5 C;  2HJ4 A;  3K27 A;  4KFM B;  2BCJ B;  3JZH A;  2CNX A;  2P9S C;  1SQJ A;  5AJA A;  4GQ2 P;  4FA1 D;  4OZU A;  3F3P A;  5HE3 B;  3SBQ A;  3HFQ A;  3SHF A;  2P9N C;  3EI1 A;  4CZX A;  4GM9 A;  3BG0 A;  4JSN C;  1PI6 A;  2I3T A;  4E5Z B;  4GM3 A;  3DXK C;  3SMR A;  3VA6 A;  2IWF A;  4FWW A;  4NSX A;  4YVD A;  4L3H D;  3JAM g;  5GMK n;  1PGU A;  2H13 A;  3I89 A;  4GZ8 A;  2XU7 A;  4L1Q D;  5HE1 B;  3L4O D;  5EAM A;  5C2V B;  4CY2 A;  4JXM A;  4CC9 A;  4CY3 A;  2UZX B;  4R7A B;  5I5I A;  3BG1 A;  4K3I D;  4CZV A;  3KRW B;  1B9Y A;  3EI3 B;  3AL8 B;  4J84 A;  4Y7R A;  4ZOX A;  2IUQ A;  2OJY A;  2H6Q A;  2CO0 C;  3PSL A;  3MZK A;  3EI3 A;  4PNK B;  5AMS A;  2HJB A;  4GQB B;  2P9K C;  4CY5 A;  3E0C A;  3MKQ A;  4CI2 A;  4A11 B;  3N0D A;  5FKT A;  2AH1 A;  3OL2 A;  5EM2 B;  3UVK A;  3VGZ A;  4IMM A;  5K19 A;  4J8B A;  3SCY A;  3V7D B;  3I8C A;  4A11 A;  3C9C A;  1K32 A;  3DM0 A;  5EM2 A;  4A2L A;  4ES0 A;  4J77 A;  3I7L A;  3C5M A;  3U4Y A;  1MG3 A;  4G56 B;  3PE7 A;  2AQ5 A;  4JSV C;  3UVM A;  4ZOV A;  2G99 A;  3NVQ A;  2PM9 B;  1JJU B;  5CXB B;  3MZL A;  2CE9 A;  2PM9 A;  3OTT A;  4A09 B;  5EML B;  4CZY A;  1PEV A;  1N6E A;  2OVR B;  5CXB A;  3SWS D;  3JRP A;  5FKS A;  4X63 B;  4ERQ A;  4ERZ A;  1GXR A;  1MG2 A;  1OMW B;  5H1M A;  3NVX A;  2YNN A;  4E54 B;  3CIK B;  2YBA A;  4O3U B;  4QT8 A;  3IJC A;  5CXC B;  2UZY B;  2OIZ A;  3V5W B;  2TRC B;  4E54 A;  1ERJ A;  5CXC A;  4LGN A;  2PM6 B;  3FRX A;  4PBZ A;  2B5M A;  3AFC A;  3DWL C;  3ZWL B;  5A2Q g;  2QXV A;  5I5M A;  4A08 B;  3KRX B;  3EI1 B;  2B5N A;  4J79 A;  1MDA H;  3F3F A;  5IC7 A;  3MKS B;  4JSP C;  4PC0 A;  1GG2 B;  3EI2 B;  3IJ0 A;  4A08 A;  1RI6 A;  1U4C A;  3PXS D;  1GOT B;  3RSE C;  2Z2P A;  4D0K A;  5TEE A;  3UVL A;  1XHM A;  3EI2 A;  2HES X;  3I7H A;  2I0T A;  3CFS B;  2CO0 A;  3SFZ A;  3UVO A;  5EAP A;  2H47 A;  4FA4 D;  3RN0 D;  4ZOY A;  3I8E A;  3I7K A;  2OK6 A;  5HQG A;  5K1C C;  4A2M A;  4FB1 D;  2YMU A;  4LG8 A;  4LG9 A;  5IJ7 E;  3SN6 B;  2Z2N A;  4PSW B;  1GP2 B;  2B5L A;  3ULE C;  1VYH C;  5FA5 B;  5EMK B;  5SXM A;  4IA9 A;  3I7O A;  3PXT D;  3GRE A;  5CYK A;  3NVN A;  1N6F A;  3N0E A;  4AEZ A;  5FXY A;  4JSX C;  2HKM A;  2I0S A;  2PM7 B;  3SJL D;  5HE0 B;  3AH8 B;  3OL2 B;  4Y5R D;  4ZN4 A;  4K3J B;  3JPX A;  5IGO A;  3JRO A;  5B4W A;  3RLM D;  4ESG A;  5TDH B;  2XL2 A;  4BUJ C;  4CI1 A;  3I2N A;  4PXW A;  4XYH A;  4FAV D;  3C75 H;  2PBI B;  1TYQ C;  3IIW A;  5AFU 3;  3JZG A;  4O3T B;  3OKT A;  4XEI C;  2GNQ A;  3GFC A;  4MK0 B;  3SBR A;  5EMM B;  4A0B A;  3OKY A;  3L4M D;  5EMJ B;  3EMH A;  2B4E A;  4I79 A;  5EAL A;  2P9U C;  1NEX B;  2Q7Q A;  5JWZ A;  2IUR A;  1JMX B;  4GM8 A;  3DXM C;  3RMZ D;  3EU7 A;  2OVP B;  4PSX B;  5IT9 g;  4U7A A;  2IWK A;  3I7P A;  5H14 A;  3OKW A;  2CN2 A;  3PVW B;  1XIP A;  4U1E I;  4BL0 A;  5I5J A;  4D6V A;  1PBY B;  3PVU B;  4J8G A;  4ZOZ A;  3UKR C;  4OWR A;  5KDO B;  2O9K A;  4H5J A;  3EG6 A;  2J57 G;  5THA A;  3RFG A;  2YB8 B;  5IGQ A;  3IJ1 A;  4J81 A;  2XL3 A;  5HYN B;  2OK4 A;  3BWS A;  4X60 B;  3ORV D;  2H9N A;  2AH0 A;  3RFH A;  4EWR A;  2BBK H;  3IKO A;  1YFQ A;  4JT6 C;  3PXW D;  4GQ1 A;  1B9X A;  4QL1 A;  1N6D A;  2W18 A;  4N14 A;  1P22 A;  2IUP A;  2GC4 A;  4QRJ A;  4BH6 A;  4FAN D;  5H17 A;  4A0A A;  1SHY B;  3EI4 B;  3K26 A;  2H9L A;  3CFV A;  4GMB A;  3JZN A;  5HE2 B;  4GGD A;  5FKR A;  2H3X A;  2MTA H;  5IJ8 E;  3V9F A;  3SXT D;  4O45 A;  4QQE A;  3P4F A;  3EI4 A;  1OLZ A;  1S4U X;  2H6K A;  4X61 B;  3SBP A;  2XYI A;  5CYK B;  1K8K C;  2H68 A;  1FWX A;  4J78 A;  5TEF A;  4JD2 C;  2AGZ A;  1JOF A;  1SQ9 A;  1XKS A;  3AL9 A;  4E5Z A;  3UVN A;  2G9A A;  2AGX A;  2P9I C;  4CY1 A;  2I0R A;  2QC5 A;  3MXX A;  4FHL A;  3A0F A;  5C2W B;  3SVW D;  2OVQ B;  5GXI A;  5C9Z B;  1QNI A;  2HYE A;  4L3G D;  3W15 A;  2AGW A;  3MMY A;  4H5I A;  3UR4 A;  4J0X A;  4A0B B;  4GGA A;  4CI8 A;  3OKY B;  3C99 A;  3I7N A;  4J86 A;  4XYI A;  3AL8 A;  3RN1 D;  2P9L C;  4FA5 D;  3UKU C;  2P9P C;  3JB9 L;  1U2V C;  3OW8 A;  1NR0 A;  3DSM A;  2I3S A;  4FA9 D;  4GGC A; 
#chains in the Genus database with same CATH topology
 3EWE A;  4J87 A;  2YNO A;  2EBS A;  5EAR A;  5TF2 A;  2WQ8 A;  4UI9 R;  2J55 H;  5GSA A;  4J82 A;  4BCC A;  1JMZ B;  3FGB A;  5HDB A;  2IAA A;  2CE8 A;  3IUM A;  3GD1 I;  4A7J A;  2J56 H;  3QHY B;  3ZDY A;  2IUV A;  1A12 A;  5FLX g;  4DNW A;  4ERY A;  4J0W A;  3GC3 B;  1JTD B;  3IUR A;  2XDW A;  2AGY A;  5FKQ A;  4AOW A;  3J81 g;  4L9O A;  2GC7 A;  3K6S A;  1Q47 A;  3RRM C;  2VDL A;  3B7F A;  1E8M A;  4AMZ A;  4UM9 A;  4Z8L A;  4CI3 A;  1BPO A;  4PBY A;  1TBG A;  2H9M A;  4O02 A;  4WK4 A;  3PSC B;  1A0R B;  1UOO A;  2HXC A;  1UOP A;  2H6N A;  4X3E A;  3IUL A;  1R5M A;  4L1M A;  1QFS A;  4TZ4 A;  2Z2O A;  4O1Q D;  3F3G A;  2H9P A;  3J80 g;  3SLE D;  2CN3 A;  1L0Q A;  3IUQ A;  4A09 A;  2AGL A;  4HDJ A;  2H14 A;  2HKR A;  4IRZ A;  3VH0 A;  4J73 A;  3ODT A;  5FQD A;  5GXH A;  2YNP A;  3FM0 A;  3IIY A;  4MMX A;  4O9D A;  4A0A B;  5M5U A;  4JT5 C;  4DNU A;  2HJ4 A;  3K27 A;  4D9S A;  5M5T A;  4KFM B;  2BCJ B;  3NIG A;  3JZH A;  2CNX A;  2P9S C;  1SQJ A;  5AJA A;  4GQ2 P;  2VDK A;  4FA1 D;  4OZU A;  3F3P A;  5HE3 B;  3SBQ A;  4WK2 A;  3HFQ A;  5M5R A;  3SHF A;  2P9N C;  3EI1 A;  4CZX A;  4GM9 A;  3BG0 A;  4JSN C;  5C92 A;  1H2X A;  1O6G A;  1PI6 A;  2I3T A;  4E5Z B;  4GM3 A;  4JHP C;  3DXK C;  3SMR A;  3VA6 A;  2IWF A;  4FWW A;  4NSX A;  4YVD A;  4L3H D;  5I5M A;  3JAM g;  1QFM A;  5GMK n;  1PGU A;  2H13 A;  3I89 A;  4GZ8 A;  2XU7 A;  4L1Q D;  5HE1 B;  3L4O D;  2EIC A;  5EAM A;  5C2V B;  4CY2 A;  4MMZ A;  4JXM A;  4CC9 A;  4CY3 A;  3MUO A;  2UZX B;  4R7A B;  5I5I A;  3BG1 A;  4K3I D;  5E6U A;  4CZV A;  4G1E A;  3KRW B;  1B9Y A;  5FFG A;  3EI3 B;  3AL8 B;  4J84 A;  4Y7R A;  4ZOX A;  2XE4 A;  4DNV A;  2IUQ A;  2OJY A;  1TYE A;  2H6Q A;  2CO0 C;  3ZDZ A;  3PSL A;  3MZK A;  3EI3 A;  4PNK B;  5AMS A;  2HJB A;  4GQB B;  2P9K C;  4CY5 A;  3MVD K;  3E0C A;  3MKQ A;  4CI2 A;  4A11 B;  3N0D A;  5FKT A;  2AH1 A;  3OL2 A;  3VI4 A;  5EM2 B;  4QAM A;  3UVK A;  3EQ9 A;  3VGZ A;  4IMM A;  5K19 A;  4J8B A;  3SCY A;  3V7D B;  3I8C A;  4A11 A;  3C9C A;  3FCU A;  1K32 A;  3DM0 A;  5EM2 A;  2HU8 A;  4A2L A;  4ES0 A;  4J77 A;  3DDU A;  3I7L A;  3C5M A;  3U4Y A;  1MG3 A;  4G56 B;  3PE7 A;  2AQ5 A;  2VDP A;  4JSV C;  3UVM A;  4ZOV A;  2G99 A;  3NVQ A;  4Z7O A;  2PM9 B;  1JJU B;  4WJK A;  3IVM A;  5CXB B;  3O4I A;  3MZL A;  4AN0 A;  1VZ2 A;  2CE9 A;  2PM9 A;  3OTT A;  2EIB A;  2VDM A;  5EML B;  4A09 B;  4CZY A;  3V4V A;  1PEV A;  1N6E A;  2OVR B;  4MMY A;  5CXB A;  2VDN A;  3SWS D;  4NEN A;  3JRP A;  5FKS A;  4X63 B;  4ERQ A;  1E8N A;  4ERZ A;  1GXR A;  1MG2 A;  1OMW B;  5H1M A;  3NVX A;  2YNN A;  3NIF A;  3ZE1 A;  4E54 B;  3CIK B;  2YBA A;  4O3U B;  4QT8 A;  3IJC A;  5CXC B;  1E5T A;  2UZY B;  2OIZ A;  3V5W B;  1UTC A;  2HU7 A;  4BCB A;  2TRC B;  4E54 A;  1ERJ A;  5CXC A;  4LGN A;  5C86 A;  2PM6 B;  4JHN A;  3FRX A;  4PBZ A;  1C9I A;  2B5M A;  3AFC A;  3DWL C;  3ZWL B;  2QXV A;  5A2Q g;  1UOQ A;  4A08 B;  3KRX B;  3EI1 B;  2B5N A;  1VZ3 A;  4J79 A;  1MDA H;  4BCD A;  3F3F A;  5FFO A;  5IC7 A;  3MKS B;  4JSP C;  4PC0 A;  1GG2 B;  3EI2 B;  3EQ7 A;  3IJ0 A;  4A08 A;  1RI6 A;  3NID A;  1U4C A;  3PXS D;  1GOT B;  3RSE C;  2Z2P A;  4D0K A;  3OF7 A;  1GOH A;  5TEE A;  3UVL A;  1XHM A;  3EI2 A;  2HES X;  3I7H A;  2I0T A;  3CFS B;  2CO0 A;  3SFZ A;  3UVO A;  5EAP A;  2H47 A;  4FA4 D;  3RN0 D;  4ZOY A;  3I8E A;  3I7K A;  2OK6 A;  4G1M A;  5HQG A;  5K1C C;  4A2M A;  1I2M B;  4FB1 D;  2YMU A;  4Z7N A;  4LG8 A;  4AMY A;  4AX4 A;  4LG9 A;  3T3M A;  5IJ7 E;  3SN6 B;  2Z2N A;  4PSW B;  1GP2 B;  1C9L A;  2B5L A;  3ULE C;  5M61 A;  2VDO A;  1VYH C;  5FA5 B;  5EMK B;  5SXM A;  4IA9 A;  3I7O A;  1YR2 A;  3ZE0 A;  3PXT D;  3GRE A;  5CYK A;  3NVN A;  1N6F A;  3N0E A;  4AEZ A;  5FXY A;  1GOF A;  2HKM A;  3IUJ A;  4JSX C;  2I0S A;  2PM7 B;  1H2W A;  3SJL D;  5HE0 B;  3AH8 B;  3OL2 B;  4Y5R D;  5E6R A;  4ZN4 A;  3FCS A;  4K3J B;  3JPX A;  5IGO A;  3JRO A;  5B4W A;  3RLM D;  4ESG A;  5TDH B;  2XL2 A;  1JV2 A;  3ZE2 A;  4NBM A;  4BUJ C;  4CI1 A;  3I2N A;  3QI0 A;  4PXW A;  4XYH A;  4FAV D;  3C75 H;  2PBI B;  1TYQ C;  3IIW A;  5AFU 3;  3JZG A;  4O3T B;  3OKT A;  4XEI C;  2GNQ A;  2VZ3 A;  3GFC A;  4MK0 B;  3SBR A;  5EMM B;  4A0B A;  3OKY A;  3L4M D;  5EMJ B;  3EMH A;  3O4J A;  2B4E A;  4I79 A;  5EAL A;  2P9U C;  2EIE A;  3KCI A;  2VZ1 A;  1NEX B;  2Q7Q A;  2QZP A;  5JWZ A;  3IUN A;  2IUR A;  1JMX B;  3T3P A;  4GM8 A;  3DXM C;  1L5G A;  3RMZ D;  3EU7 A;  2OVP B;  4PSX B;  5IT9 g;  4U7A A;  2IWK A;  3I7P A;  5H14 A;  3OKW A;  2CN2 A;  3PVW B;  1XIP A;  4U1E I;  4BL0 A;  5I5J A;  2VC2 A;  4D6V A;  1PBY B;  4G55 A;  3V4P A;  3PVU B;  4J8G A;  4ZOZ A;  3UKR C;  4OWR A;  5KDO B;  2O9K A;  4H5J A;  3EG6 A;  2J57 G;  5THA A;  1VE7 A;  3RFG A;  2YB8 B;  5IGQ A;  3IJ1 A;  2EID A;  4J81 A;  2XL3 A;  5HYN B;  2OK4 A;  3BWS A;  1H2Z A;  4X60 B;  3IJE A;  4RE5 A;  3ORV D;  2H9N A;  2AH0 A;  3RFH A;  4EWR A;  2BBK H;  3IKO A;  1YFQ A;  4JT6 C;  3EQ8 A;  3PXW D;  4GQ1 A;  1U8C A;  1B9X A;  4QL1 A;  3O4H A;  1N6D A;  2W18 A;  3ZDX A;  4N14 A;  1P22 A;  2XZG A;  5E6S A;  2IUP A;  1VE6 A;  2GC4 A;  4QRJ A;  4AN1 A;  4BH6 A;  1O6F A;  3MUN A;  4FAN D;  5H17 A;  4Z7Q A;  4A0A A;  1SHY B;  3EI4 B;  3K26 A;  2H9L A;  3CFV A;  4GMB A;  2HU5 A;  3JZN A;  5HE2 B;  1M1X A;  4GGD A;  5FKR A;  2H3X A;  2MTA H;  5IJ8 E;  2VDQ A;  3SXT D;  3V9F A;  4O45 A;  4QQE A;  1GOG A;  3P4F A;  3EI4 A;  1OLZ A;  1S4U X;  2H6K A;  4X61 B;  3SBP A;  2XYI A;  4NAA A;  5CYK B;  5M5S A;  4UM8 A;  1K8K C;  2H68 A;  1FWX A;  4J78 A;  5TEF A;  4JD2 C;  2AGZ A;  1JOF A;  1SQ9 A;  4BP8 A;  1XKS A;  3AL9 A;  4E5Z A;  3UVN A;  2G9A A;  4RE6 A;  4BP9 A;  2AGX A;  2P9I C;  4CY1 A;  2I0R A;  2QC5 A;  3MXX A;  4FHL A;  1K3I A;  3VI3 A;  3A0F A;  2VDR A;  4O2W A;  5C2W B;  3O4G A;  3SVW D;  2OVQ B;  5GXI A;  5C9Z B;  1QNI A;  2HYE A;  4L3G D;  3W15 A;  2AGW A;  3MMY A;  4H5I A;  3UR4 A;  4J0X A;  4A0B B;  4GGA A;  4CI8 A;  2JKX A;  3OKY B;  3C99 A;  3I7N A;  4J86 A;  4WK0 A;  3K72 A;  2BKL A;  4XYI A;  4NC4 A;  3AL8 A;  3RN1 D;  2P9L C;  4FA5 D;  3UKU C;  2QR5 A;  3K71 A;  1H2Y A;  2P9P C;  3JB9 L;  1U2V C;  3OW8 A;  1NR0 A;  3DSM A;  2I3S A;  4FA9 D;  4GGC A;  1T2X A;  5M5V A; 
#chains in the Genus database with same CATH homology
 3EWE A;  4J87 A;  2YNO A;  2EBS A;  5EAR A;  5TF2 A;  4UI9 R;  2J55 H;  5GSA A;  4J82 A;  1JMZ B;  3FGB A;  2IAA A;  2CE8 A;  4A7J A;  2J56 H;  2IUV A;  5FLX g;  4ERY A;  4J0W A;  2AGY A;  5FKQ A;  4AOW A;  3J81 g;  4L9O A;  2GC7 A;  1Q47 A;  3RRM C;  3B7F A;  4Z8L A;  4CI3 A;  4PBY A;  1TBG A;  2H9M A;  3PSC B;  1A0R B;  2HXC A;  2H6N A;  4X3E A;  1R5M A;  4TZ4 A;  2Z2O A;  4O1Q D;  3F3G A;  2H9P A;  3J80 g;  3SLE D;  2CN3 A;  1L0Q A;  4A09 A;  2AGL A;  4HDJ A;  2H14 A;  2HKR A;  3VH0 A;  4J73 A;  3ODT A;  5FQD A;  5GXH A;  2YNP A;  3FM0 A;  3IIY A;  4O9D A;  4A0A B;  4JT5 C;  2HJ4 A;  3K27 A;  4KFM B;  2BCJ B;  3JZH A;  2CNX A;  2P9S C;  1SQJ A;  5AJA A;  4GQ2 P;  4FA1 D;  4OZU A;  3F3P A;  5HE3 B;  3SBQ A;  3HFQ A;  3SHF A;  2P9N C;  3EI1 A;  4CZX A;  4GM9 A;  3BG0 A;  4JSN C;  1PI6 A;  2I3T A;  4E5Z B;  4GM3 A;  3DXK C;  3SMR A;  3VA6 A;  2IWF A;  4FWW A;  4NSX A;  4YVD A;  4L3H D;  3JAM g;  5GMK n;  1PGU A;  2H13 A;  3I89 A;  4GZ8 A;  2XU7 A;  4L1Q D;  5HE1 B;  3L4O D;  5EAM A;  5C2V B;  4CY2 A;  4JXM A;  4CC9 A;  4CY3 A;  2UZX B;  4R7A B;  5I5I A;  3BG1 A;  4K3I D;  4CZV A;  3KRW B;  1B9Y A;  3EI3 B;  3AL8 B;  4J84 A;  4Y7R A;  4ZOX A;  2IUQ A;  2OJY A;  2H6Q A;  2CO0 C;  3PSL A;  3MZK A;  3EI3 A;  4PNK B;  5AMS A;  2HJB A;  4GQB B;  2P9K C;  4CY5 A;  3E0C A;  3MKQ A;  4CI2 A;  4A11 B;  3N0D A;  5FKT A;  2AH1 A;  3OL2 A;  5EM2 B;  3UVK A;  3VGZ A;  4IMM A;  5K19 A;  4J8B A;  3SCY A;  3V7D B;  3I8C A;  4A11 A;  3C9C A;  1K32 A;  3DM0 A;  5EM2 A;  4A2L A;  4ES0 A;  4J77 A;  3I7L A;  3C5M A;  3U4Y A;  1MG3 A;  4G56 B;  3PE7 A;  2AQ5 A;  4JSV C;  3UVM A;  4ZOV A;  2G99 A;  3NVQ A;  2PM9 B;  1JJU B;  5CXB B;  3MZL A;  2CE9 A;  2PM9 A;  3OTT A;  4A09 B;  5EML B;  4CZY A;  1PEV A;  1N6E A;  2OVR B;  5CXB A;  3SWS D;  3JRP A;  5FKS A;  4X63 B;  4ERQ A;  4ERZ A;  1GXR A;  1MG2 A;  1OMW B;  5H1M A;  3NVX A;  2YNN A;  4E54 B;  3CIK B;  2YBA A;  4O3U B;  4QT8 A;  3IJC A;  5CXC B;  2UZY B;  2OIZ A;  3V5W B;  2TRC B;  4E54 A;  1ERJ A;  5CXC A;  4LGN A;  2PM6 B;  3FRX A;  4PBZ A;  2B5M A;  3AFC A;  3DWL C;  3ZWL B;  5A2Q g;  2QXV A;  5I5M A;  4A08 B;  3KRX B;  3EI1 B;  2B5N A;  4J79 A;  1MDA H;  3F3F A;  5IC7 A;  3MKS B;  4JSP C;  4PC0 A;  1GG2 B;  3EI2 B;  3IJ0 A;  4A08 A;  1RI6 A;  1U4C A;  3PXS D;  1GOT B;  3RSE C;  2Z2P A;  4D0K A;  5TEE A;  3UVL A;  1XHM A;  3EI2 A;  2HES X;  3I7H A;  2I0T A;  3CFS B;  2CO0 A;  3SFZ A;  3UVO A;  5EAP A;  2H47 A;  4FA4 D;  3RN0 D;  4ZOY A;  3I8E A;  3I7K A;  2OK6 A;  5HQG A;  5K1C C;  4A2M A;  4FB1 D;  2YMU A;  4LG8 A;  4LG9 A;  5IJ7 E;  3SN6 B;  2Z2N A;  4PSW B;  1GP2 B;  2B5L A;  3ULE C;  1VYH C;  5FA5 B;  5EMK B;  5SXM A;  4IA9 A;  3I7O A;  3PXT D;  3GRE A;  5CYK A;  3NVN A;  1N6F A;  3N0E A;  4AEZ A;  5FXY A;  4JSX C;  2HKM A;  2I0S A;  2PM7 B;  3SJL D;  5HE0 B;  3AH8 B;  3OL2 B;  4Y5R D;  4ZN4 A;  4K3J B;  3JPX A;  5IGO A;  3JRO A;  5B4W A;  3RLM D;  4ESG A;  5TDH B;  2XL2 A;  4BUJ C;  4CI1 A;  3I2N A;  4PXW A;  4XYH A;  4FAV D;  3C75 H;  2PBI B;  1TYQ C;  3IIW A;  5AFU 3;  3JZG A;  4O3T B;  3OKT A;  4XEI C;  2GNQ A;  3GFC A;  4MK0 B;  3SBR A;  5EMM B;  4A0B A;  3OKY A;  3L4M D;  5EMJ B;  3EMH A;  2B4E A;  4I79 A;  5EAL A;  2P9U C;  1NEX B;  2Q7Q A;  5JWZ A;  2IUR A;  1JMX B;  4GM8 A;  3DXM C;  3RMZ D;  3EU7 A;  2OVP B;  4PSX B;  5IT9 g;  4U7A A;  2IWK A;  3I7P A;  5H14 A;  3OKW A;  2CN2 A;  3PVW B;  1XIP A;  4U1E I;  4BL0 A;  5I5J A;  4D6V A;  1PBY B;  3PVU B;  4J8G A;  4ZOZ A;  3UKR C;  4OWR A;  5KDO B;  2O9K A;  4H5J A;  3EG6 A;  2J57 G;  5THA A;  3RFG A;  2YB8 B;  5IGQ A;  3IJ1 A;  4J81 A;  2XL3 A;  5HYN B;  2OK4 A;  3BWS A;  4X60 B;  3ORV D;  2H9N A;  2AH0 A;  3RFH A;  4EWR A;  2BBK H;  3IKO A;  1YFQ A;  4JT6 C;  3PXW D;  4GQ1 A;  1B9X A;  4QL1 A;  1N6D A;  2W18 A;  4N14 A;  1P22 A;  2IUP A;  2GC4 A;  4QRJ A;  4BH6 A;  4FAN D;  5H17 A;  4A0A A;  1SHY B;  3EI4 B;  3K26 A;  2H9L A;  3CFV A;  4GMB A;  3JZN A;  5HE2 B;  4GGD A;  5FKR A;  2H3X A;  2MTA H;  5IJ8 E;  3V9F A;  3SXT D;  4O45 A;  4QQE A;  3P4F A;  3EI4 A;  1OLZ A;  1S4U X;  2H6K A;  4X61 B;  3SBP A;  2XYI A;  5CYK B;  1K8K C;  2H68 A;  1FWX A;  4J78 A;  5TEF A;  4JD2 C;  2AGZ A;  1JOF A;  1SQ9 A;  1XKS A;  3AL9 A;  4E5Z A;  3UVN A;  2G9A A;  2AGX A;  2P9I C;  4CY1 A;  2I0R A;  2QC5 A;  3MXX A;  4FHL A;  3A0F A;  5C2W B;  3SVW D;  2OVQ B;  5GXI A;  5C9Z B;  1QNI A;  2HYE A;  4L3G D;  3W15 A;  2AGW A;  3MMY A;  4H5I A;  3UR4 A;  4J0X A;  4A0B B;  4GGA A;  4CI8 A;  3OKY B;  3C99 A;  3I7N A;  4J86 A;  4XYI A;  3AL8 A;  3RN1 D;  2P9L C;  4FA5 D;  3UKU C;  2P9P C;  3JB9 L;  1U2V C;  3OW8 A;  1NR0 A;  3DSM A;  2I3S A;  4FA9 D;  4GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...