2I0TA

Crystal structure of phenylacetaldehyde derived r-carbinolamine adduct of aromatic amine dehydrogenase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 104
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i0tA01
2YNPA 5EMLB 3I89A 2TRCB 3EG6A 1MG2A 4FA9D 2QXVA 3GFCA 3CIKB 4A0AB 4PC0A 2P9IC 4QRJA 4GM9A 3I7HA 5EAPA 2H9MA 3C9CA 4FWWA 1N6EA 1JMZB 3SHFA 1XKSA 3ORVD 4H5IA 1MG3A 2B4EA 5THAA 3I7OA 3SN6B 2PBIB 3SVWD 5IGQA 5FLXg 1ERJA 2H6KA 5FXYA 5EALA 3GREA 4ES0A 3JB9L 2OJYA 3JZNA 3B7FA 3MKQA 3AFCA 3RFGA 3V5WB 3NVXA 1TYQC 4L9OA 1OMWB 2OK4A 4K3ID 3MMYA 2I0SA 3CFSB 2PM9A 4A2MA 4J79A 4PBZA 3C5MA 5GXHA 4H5JA 2PM9B 3VGZA 3RSEC 5I5JA 4GM8A 3UKUC 3UVNA 3EI4B 5EARA 4GZ8A 2HJBA 4EWRA 3NVQA 3PSCB 3J80g 3EI3B 3EMHA 2I3SA 3OKYA 3OKWA 5CXBA 4A0BA 5AMSA 3UKRC 3SBRA 3FRXA 4D0KA 4A0BB 1K8KC 4IMMA 5EMMB 5HYNB 5TF2A 2P9PC 5GXIA 4X3EA 1JMXB 4ERZA 4CI8A 4N14A 5FA5B 2P9NC 3F3FA 5CXCA 2H47A 2B5NA 2P9SC 2AH1A 3HFQA 5AJAA 3JAMg 1OLZA 3I7NA 1GXRA 4A11B 3EI2B 2CN2A 3OKTA 4GMBA 2G99A 1PBYB 4ESGA 2HJ4A 3AL8A 1S4UX 2PM6B 3PSLA 2AH0A 4CC9A 2I0TA 2AGLA 3AL8B 2AGZA 4O45A 2I3TA 5H17A 1U2VC 4G56B 4O9DA 4CY2A 2IUVA 3ODTA 4J81A 2UZYB 3KRXB 3SLED 2I0RA 4GQBB 2IWFA 2YBAA 5FKQA 2CO0C 4OZUA 4BL0A 4U1EI 3I8EA 2Q7QA 3PXWD 2GNQA 3UVMA 4CI1A 2OIZA 3ZWLB 3BG0A 5H14A 2H9PA 4CI3A 1R5MA 2CE9A 2B5LA 3DWLC 2HXCA 3I7PA 4PNKB 3J81g 1B9XA 3DXKC 1K32A 4FB1D 3MKSB 4J77A 4JSXC 4XYHA 3MXXA 1MDAH 4E54A 3W15A 1JJUB 2YB8B 4E54B 4FA5D 3K26A 4J0WA 3BG1A 4GQ2P 2BBKH 3JRPA 4CY5A 3RLMD 5KDOB 5FKSA 3SBPA 1PEVA 3DXMC 2AGYA 4CI2A 2MTAH 2AGWA 2HESX 5AFU3 5B4WA 4FAND 2CO0A 2H14A 3I7KA 3IKOA 4CZVA 3PXTD 3V9FA 3PE7A 4LG8A 4TZ4A 1P22A 3VA6A 4X63B 5IJ8E 4A09A 2Z2OA 3I2NA 3N0EA 3FGBA 2HKMA 3OKYB 2J55H 5CXBB 3EI1A 3IIWA 2IURA 3V7DB 1XIPA 1NEXB 5TEFA 4L3HD 4A2LA 5FKTA 5HE0B 4ZN4A 4FA1D 4JSNC 4ERYA 3I7LA 5SXMA 4GQ1A 5IJ7E 4XYIA 4PSWB 3DM0A 5EAMA 2HYEA 5CXCB 4GM3A 2YMUA 3RN1D 2P9KC 1VYHC 5C2WB 2J57G 4AOWA 3UVOA 4Y7RA 3PXSD 4K3JB 2HKRA 3RN0D 4A7JA 5I5IA 4IA9A 4O3UB 3UR4A 4PSXB 3VH0A 3RFHA 4J82A 2H68A 3E0CA 5GSAA 5CYKA 1N6DA 2CN3A 4U7AA 2YNOA 4GGDA 4PBYA 3F3GA 4O1QD 4HDJA 4J78A 5HE1B 3JROA 2CE8A 2Z2PA 4JSVC 4ZOVA 4PXWA 1B9YA 1U4CA 4QQEA 3U4YA 4Z8LA 1GP2B 4JXMA 2O9KA 4AEZA 2AQ5A 4JD2C 4CY3A 4ZOYA 4J84A 3BWSA 2G9AA 2H6NA 1SQJA 5IC7A 2OVQB 3UVLA 1NR0A 4D6VA 4A0AA 4JT6C 4O3TB 2J56H 3UVKA 1PGUA 1N6FA 2EBSA 1Q47A 2GC4A 2CNXA 3OW8A 4MK0B 2H13A 2B5MA 3SJLD 4L3GD 2XL3A 2AGXA 1TBGA 4J8GA 4OWRA 3EWEA 5C9ZB 3IJ0A 5HE2B 5TDHB 4J87A 4QT8A 2QC5A 2W18A 3MZKA 3MZLA 5K19A 5TEEA 4FHLA 3C99A 5FQDA 2OVPB 3SCYA 4I79A 2BCJB 3IJ1A 4BUJC 3A0FA 3C75H 2P9LC 5GMKn 3RMZD 3SWSD 1GG2B 3CFVA 1YFQA 2YNNA 3JZGA 1JOFA 3L4OD 4LG9A 1PI6A 5EMKB 5H1MA 3PVUB 4UI9R 5C2VB 2PM7B 4A09B 4CZYA 2OVRB 2P9UC 5K1CC 3I8CA 3EI4A 2XL2A 1A0RB 1XHMA 3ULEC 1SHYB 4YVDA 3F3PA 3EI3A 3NVNA 5FKRA 4CY1A 2OK6A 3EI1B 2IWKA 4XEIC 4X60B 4KFMB 4Y5RD 2Z2NA 4X61B 2UZXB 5A2Qg 2GC7A 5HQGA 4ZOXA 3SBQA 4QL1A 2IUQA 1SQ9A 3SFZA 3AL9A 5HE3B 4JT5C 3DSMA 3SXTD 4ZOZA 4BH6A 4E5ZA 4J8BA 2H3XA 2XU7A 2H9NA 4L1QD 4J86A 3AH8B 2H6QA 3EU7A 5IGOA 4NSXA 2XYIA 4E5ZB 4J73A 3PVWB 3L4MD 4A11A 4FAVD 3EI2A 4ERQA 4CZXA 4A08A 4J0XA 5I5MA 1GOTB 4LGNA 3SMRA 4A08B 1FWXA 4FA4D 5EM2A 5JWZA 3IIYA 3JPXA 3IJCA 1L0QA 1RI6A 2H9LA 5CYKB 1QNIA 3FM0A 5EMJB 5EM2B 3OL2A 2IUPA 4GGAA 4R7AB 3RRMC 5IT9g 3JZHA 3K27A 4JSPC 3N0DA 3OL2B 3P4FA 3KRWB 2IAAA 3OTTA 4GGCA
chains in the Genus database with same CATH superfamily
4WJKA 3V4VA 4RE6A 1H2XA 2YNPA 5EMLB 5M5RA 3I89A 4MMZA 2TRCB 3EG6A 1MG2A 4G1MA 4FA9D 2VDKA 2QXVA 3GFCA 3CIKB 4A0AB 3IUQA 4NC4A 3T3MA 4PC0A 4L1MA 2P9IC 3O4IA 4QRJA 4DNVA 4GM9A 3K72A 1I2MB 3I7HA 5EAPA 2H9MA 1VZ3A 3C9CA 4FWWA 1N6EA 1JMZB 2VC2A 1XKSA 3ORVD 4MMXA 5E6UA 3SHFA 4H5IA 1MG3A 2B4EA 5THAA 3I7OA 3SN6B 2PBIB 1O6FA 3SVWD 5IGQA 5FLXg 1ERJA 2H6KA 5FXYA 5EALA 3GREA 4ES0A 3JB9L 2OJYA 3JZNA 3B7FA 3MKQA 2QR5A 3EQ9A 3AFCA 3RFGA 3V5WB 3NVXA 1TYQC 3ZDXA 4L9OA 2XDWA 5C86A 2WQ8A 1T2XA 1OMWB 2OK4A 4K3ID 3MMYA 2I0SA 3CFSB 2PM9A 4A2MA 4J79A 4PBZA 3C5MA 5GXHA 4H5JA 2VDPA 2PM9B 1VE6A 3VGZA 3RSEC 5I5JA 4GM8A 3UKUC 1VZ2A 4BCDA 3UVNA 3EI4B 5EARA 4GZ8A 1VE7A 2HJBA 2BKLA 2VDQA 3NVQA 3PSCB 4EWRA 3J80g 3EI3B 3EMHA 1M1XA 4O2WA 2I3SA 1BPOA 3OKYA 4D9SA 3OKWA 4Z7NA 5M5VA 4RE5A 2HU7A 5CXBA 4A0BA 5AMSA 3UKRC 3SBRA 3FRXA 2VDMA 4D0KA 4A0BB 1K8KC 4IMMA 5EMMB 4AMYA 5HYNB 5TF2A 2P9PC 5GXIA 3IUNA 3O4HA 4X3EA 3QI0A 4WK4A 1JMXB 4ERZA 4CI8A 4N14A 5FA5B 2P9NC 3F3FA 5CXCA 2H47A 2B5NA 2P9SC 2AH1A 3HFQA 5AJAA 3JAMg 1OLZA 3I7NA 1GXRA 1K3IA 4A11B 2QZPA 3EI2B 3KCIA 2CN2A 3OKTA 4GMBA 2G99A 1PBYB 4ESGA 2HJ4A 3AL8A 1S4UX 2PM6B 3PSLA 2AH0A 4BCBA 3EQ7A 4CC9A 2I0TA 2AGLA 3AL8B 2AGZA 4O45A 3IULA 2I3TA 5H17A 1UOOA 4O02A 1U2VC 3T3PA 4G56B 4O9DA 4CY2A 2IUVA 3ODTA 4J81A 2UZYB 3KRXB 3SLED 2I0RA 1GOHA 1L5GA 4GQBB 2IWFA 2YBAA 5E6SA 5FKQA 2CO0C 4OZUA 4BL0A 4U1EI 3I8EA 1C9LA 2Q7QA 3PXWD 2GNQA 3UVMA 4CI1A 2OIZA 3ZWLB 1UOQA 3BG0A 5H14A 2H9PA 4CI3A 1R5MA 2CE9A 2B5LA 3DWLC 2HXCA 3I7PA 4PNKB 4JHNA 3J81g 1B9XA 3DXKC 3K71A 1K32A 4FB1D 3MKSB 4J77A 4JSXC 4XYHA 3MXXA 1MDAH 3O4JA 4E54A 3VI3A 3W15A 1JJUB 2YB8B 4IRZA 2VDRA 2VZ3A 4E54B 4FA5D 3K26A 3O4GA 4J0WA 1GOFA 3BG1A 4GQ2P 2BBKH 3JRPA 4CY5A 2JKXA 3RLMD 5KDOB 5FKSA 3SBPA 1PEVA 3DXMC 2AGYA 4CI2A 1C9IA 3QHYB 4NENA 1UTCA 2MTAH 2AGWA 3ZDYA 2HESX 2VDLA 5AFU3 5C92A 5B4WA 3ZE1A 4FAND 2CO0A 2H14A 5FFOA 4BP8A 3I7KA 3IKOA 4G55A 1U8CA 4NBMA 4CZVA 3PXTD 3V9FA 3PE7A 4LG8A 2VDOA 4UM9A 3MUNA 3ZE2A 1YR2A 4TZ4A 1P22A 3VA6A 4X63B 1O6GA 4Z7OA 5IJ8E 4A09A 2Z2OA 3I2NA 3N0EA 3FGBA 3NIDA 2HKMA 3OKYB 3ZDZA 2J55H 4BCCA 3K6SA 5CXBB 3EI1A 3IIWA 2IURA 3V7DB 1XIPA 1NEXB 5TEFA 4L3HD 4A2LA 5FKTA 3MUOA 5HE0B 4ZN4A 4FA1D 4JSNC 4ERYA 3I7LA 5SXMA 4GQ1A 5IJ7E 4XYIA 4PSWB 3DM0A 5EAMA 3FCSA 2HYEA 5CXCB 4GM3A 2YMUA 3RN1D 1QFSA 2P9KC 1TYEA 1VYHC 4WK2A 5C2WB 2J57G 4AOWA 1A12A 3UVOA 4Y7RA 3PXSD 3GC3B 4K3JB 2HKRA 2EIBA 3RN0D 4A7JA 5I5IA 4IA9A 4O3UB 3UR4A 4PSXB 3VH0A 3RFHA 4WK0A 1UOPA 2H68A 3E0CA 4J82A 5GSAA 5CYKA 4Z7QA 1N6DA 2CN3A 4U7AA 2YNOA 4GGDA 4PBYA 3F3GA 4AMZA 4O1QD 4HDJA 3NIGA 4J78A 5HE1B 3JROA 4MMYA 2CE8A 2Z2PA 4JSVC 4ZOVA 4PXWA 1B9YA 2XE4A 1U4CA 4QQEA 4QAMA 3U4YA 4Z8LA 5FFGA 1QFMA 1GP2B 4JXMA 2O9KA 4AEZA 2AQ5A 4JD2C 3IUMA 4CY3A 4ZOYA 2XZGA 3BWSA 4J84A 2G9AA 2H6NA 1SQJA 5IC7A 2OVQB 3UVLA 1NR0A 4D6VA 4A0AA 4JT6C 4O3TB 2EICA 2J56H 3IVMA 3UVKA 1PGUA 1E8NA 1N6FA 3EQ8A 2EBSA 1Q47A 2GC4A 2CNXA 3GD1I 3OW8A 4MK0B 4BP9A 1E5TA 2EIEA 2H13A 2B5MA 1JTDB 3SJLD 4L3GD 2XL3A 5M5TA 2AGXA 1TBGA 3V4PA 3IUJA 2VZ1A 4J8GA 4OWRA 3EWEA 5C9ZB 2HU8A 3IJ0A 5HE2B 5TDHB 4J87A 4QT8A 2QC5A 2W18A 3MZKA 3MZLA 5K19A 5TEEA 5M5SA 4FHLA 3C99A 5FQDA 2OVPB 3SCYA 4I79A 5HDBA 2BCJB 3IJ1A 4DNWA 2VDNA 4BUJC 3A0FA 3C75H 2P9LC 4AN0A 5GMKn 3RMZD 3SWSD 1GG2B 3CFVA 1YFQA 2YNNA 3JZGA 1JOFA 2HU5A 3L4OD 4LG9A 5M61A 1PI6A 5EMKB 5H1MA 3PVUB 1H2WA 4UI9R 1E8MA 5C2VB 2PM7B 3DDUA 3IURA 3OF7A 4A09B 4CZYA 2OVRB 2P9UC 5K1CC 2EIDA 3I8CA 3EI4A 2XL2A 1A0RB 3ZE0A 1XHMA 3ULEC 1SHYB 4YVDA 3F3PA 3EI3A 3NVNA 5FKRA 4CY1A 2OK6A 3EI1B 2IWKA 4XEIC 4X60B 1H2ZA 4KFMB 4Y5RD 2Z2NA 4X61B 1GOGA 2UZXB 5A2Qg 2GC7A 1JV2A 5HQGA 4ZOXA 3SBQA 4QL1A 2IUQA 1SQ9A 3SFZA 3AL9A 5HE3B 4JT5C 3DSMA 3SXTD 4DNUA 3FCUA 4JHPC 4ZOZA 4BH6A 4E5ZA 4J8BA 2H3XA 2XU7A 3IJEA 4NAAA 2H9NA 4L1QD 4J86A 4UM8A 5E6RA 3AH8B 2H6QA 3EU7A 5IGOA 4NSXA 2XYIA 4E5ZB 4J73A 3NIFA 3PVWB 3L4MD 4A11A 4FAVD 3EI2A 4ERQA 4CZXA 4A08A 4AN1A 4J0XA 3VI4A 5I5MA 3MVDK 1GOTB 4LGNA 3SMRA 4A08B 1FWXA 4FA4D 5EM2A 5JWZA 3IIYA 3JPXA 3IJCA 1L0QA 1H2YA 1RI6A 2H9LA 5CYKB 1QNIA 3FM0A 5EMJB 5EM2B 3OL2A 2IUPA 4GGAA 4R7AB 3RRMC 5IT9g 4G1EA 3JZHA 3K27A 4JSPC 3N0DA 3OL2B 3P4FA 3KRWB 2IAAA 5M5UA 4AX4A 3OTTA 4GGCA
chains in the Genus database with same CATH topology
2YNPA 5EMLB 3I89A 2TRCB 3EG6A 1MG2A 4FA9D 2QXVA 3GFCA 3CIKB 4A0AB 4PC0A 2P9IC 4QRJA 4GM9A 3I7HA 5EAPA 2H9MA 3C9CA 4FWWA 1N6EA 1JMZB 3SHFA 1XKSA 3ORVD 4H5IA 1MG3A 2B4EA 5THAA 3I7OA 3SN6B 2PBIB 3SVWD 5IGQA 5FLXg 1ERJA 2H6KA 5FXYA 5EALA 3GREA 4ES0A 3JB9L 2OJYA 3JZNA 3B7FA 3MKQA 3AFCA 3RFGA 3V5WB 3NVXA 1TYQC 4L9OA 1OMWB 2OK4A 4K3ID 3MMYA 2I0SA 3CFSB 2PM9A 4A2MA 4J79A 4PBZA 3C5MA 5GXHA 4H5JA 2PM9B 3VGZA 3RSEC 5I5JA 4GM8A 3UKUC 3UVNA 3EI4B 5EARA 4GZ8A 2HJBA 4EWRA 3NVQA 3PSCB 3J80g 3EI3B 3EMHA 2I3SA 3OKYA 3OKWA 5CXBA 4A0BA 5AMSA 3UKRC 3SBRA 3FRXA 4D0KA 4A0BB 1K8KC 4IMMA 5EMMB 5HYNB 5TF2A 2P9PC 5GXIA 4X3EA 1JMXB 4ERZA 4CI8A 4N14A 5FA5B 2P9NC 3F3FA 5CXCA 2H47A 2B5NA 2P9SC 2AH1A 3HFQA 5AJAA 3JAMg 1OLZA 3I7NA 1GXRA 4A11B 3EI2B 2CN2A 3OKTA 4GMBA 2G99A 1PBYB 4ESGA 2HJ4A 3AL8A 1S4UX 2PM6B 3PSLA 2AH0A 4CC9A 2I0TA 2AGLA 3AL8B 2AGZA 4O45A 2I3TA 5H17A 1U2VC 4G56B 4O9DA 4CY2A 2IUVA 3ODTA 4J81A 2UZYB 3KRXB 3SLED 2I0RA 4GQBB 2IWFA 2YBAA 5FKQA 2CO0C 4OZUA 4BL0A 4U1EI 3I8EA 2Q7QA 3PXWD 2GNQA 3UVMA 4CI1A 2OIZA 3ZWLB 3BG0A 5H14A 2H9PA 4CI3A 1R5MA 2CE9A 2B5LA 3DWLC 2HXCA 3I7PA 4PNKB 3J81g 1B9XA 3DXKC 1K32A 4FB1D 3MKSB 4J77A 4JSXC 4XYHA 3MXXA 1MDAH 4E54A 3W15A 1JJUB 2YB8B 4E54B 4FA5D 3K26A 4J0WA 3BG1A 4GQ2P 2BBKH 3JRPA 4CY5A 3RLMD 5KDOB 5FKSA 3SBPA 1PEVA 3DXMC 2AGYA 4CI2A 2MTAH 2AGWA 2HESX 5AFU3 5B4WA 4FAND 2CO0A 2H14A 3I7KA 3IKOA 4CZVA 3PXTD 3V9FA 3PE7A 4LG8A 4TZ4A 1P22A 3VA6A 4X63B 5IJ8E 4A09A 2Z2OA 3I2NA 3N0EA 3FGBA 2HKMA 3OKYB 2J55H 5CXBB 3EI1A 3IIWA 2IURA 3V7DB 1XIPA 1NEXB 5TEFA 4L3HD 4A2LA 5FKTA 5HE0B 4ZN4A 4FA1D 4JSNC 4ERYA 3I7LA 5SXMA 4GQ1A 5IJ7E 4XYIA 4PSWB 3DM0A 5EAMA 2HYEA 5CXCB 4GM3A 2YMUA 3RN1D 2P9KC 1VYHC 5C2WB 2J57G 4AOWA 3UVOA 4Y7RA 3PXSD 4K3JB 2HKRA 3RN0D 4A7JA 5I5IA 4IA9A 4O3UB 3UR4A 4PSXB 3VH0A 3RFHA 4J82A 2H68A 3E0CA 5GSAA 5CYKA 1N6DA 2CN3A 4U7AA 2YNOA 4GGDA 4PBYA 3F3GA 4O1QD 4HDJA 4J78A 5HE1B 3JROA 2CE8A 2Z2PA 4JSVC 4ZOVA 4PXWA 1B9YA 1U4CA 4QQEA 3U4YA 4Z8LA 1GP2B 4JXMA 2O9KA 4AEZA 2AQ5A 4JD2C 4CY3A 4ZOYA 4J84A 3BWSA 2G9AA 2H6NA 1SQJA 5IC7A 2OVQB 3UVLA 1NR0A 4D6VA 4A0AA 4JT6C 4O3TB 2J56H 3UVKA 1PGUA 1N6FA 2EBSA 1Q47A 2GC4A 2CNXA 3OW8A 4MK0B 2H13A 2B5MA 3SJLD 4L3GD 2XL3A 2AGXA 1TBGA 4J8GA 4OWRA 3EWEA 5C9ZB 3IJ0A 5HE2B 5TDHB 4J87A 4QT8A 2QC5A 2W18A 3MZKA 3MZLA 5K19A 5TEEA 4FHLA 3C99A 5FQDA 2OVPB 3SCYA 4I79A 2BCJB 3IJ1A 4BUJC 3A0FA 3C75H 2P9LC 5GMKn 3RMZD 3SWSD 1GG2B 3CFVA 1YFQA 2YNNA 3JZGA 1JOFA 3L4OD 4LG9A 1PI6A 5EMKB 5H1MA 3PVUB 4UI9R 5C2VB 2PM7B 4A09B 4CZYA 2OVRB 2P9UC 5K1CC 3I8CA 3EI4A 2XL2A 1A0RB 1XHMA 3ULEC 1SHYB 4YVDA 3F3PA 3EI3A 3NVNA 5FKRA 4CY1A 2OK6A 3EI1B 2IWKA 4XEIC 4X60B 4KFMB 4Y5RD 2Z2NA 4X61B 2UZXB 5A2Qg 2GC7A 5HQGA 4ZOXA 3SBQA 4QL1A 2IUQA 1SQ9A 3SFZA 3AL9A 5HE3B 4JT5C 3DSMA 3SXTD 4ZOZA 4BH6A 4E5ZA 4J8BA 2H3XA 2XU7A 2H9NA 4L1QD 4J86A 3AH8B 2H6QA 3EU7A 5IGOA 4NSXA 2XYIA 4E5ZB 4J73A 3PVWB 3L4MD 4A11A 4FAVD 3EI2A 4ERQA 4CZXA 4A08A 4J0XA 5I5MA 1GOTB 4LGNA 3SMRA 4A08B 1FWXA 4FA4D 5EM2A 5JWZA 3IIYA 3JPXA 3IJCA 1L0QA 1RI6A 2H9LA 5CYKB 1QNIA 3FM0A 5EMJB 5EM2B 3OL2A 2IUPA 4GGAA 4R7AB 3RRMC 5IT9g 3JZHA 3K27A 4JSPC 3N0DA 3OL2B 3P4FA 3KRWB 2IAAA 3OTTA 4GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNP A;  5EML B;  3I89 A;  2TRC B;  3EG6 A;  1MG2 A;  4FA9 D;  2QXV A;  3GFC A;  3CIK B;  4A0A B;  4PC0 A;  2P9I C;  4QRJ A;  4GM9 A;  3I7H A;  5EAP A;  2H9M A;  3C9C A;  4FWW A;  1N6E A;  1JMZ B;  3SHF A;  1XKS A;  3ORV D;  4H5I A;  1MG3 A;  2B4E A;  5THA A;  3I7O A;  3SN6 B;  2PBI B;  3SVW D;  5IGQ A;  5FLX g;  1ERJ A;  2H6K A;  5FXY A;  5EAL A;  3GRE A;  4ES0 A;  3JB9 L;  2OJY A;  3JZN A;  3B7F A;  3MKQ A;  3AFC A;  3RFG A;  3V5W B;  3NVX A;  1TYQ C;  4L9O A;  1OMW B;  2OK4 A;  4K3I D;  3MMY A;  2I0S A;  3CFS B;  2PM9 A;  4A2M A;  4J79 A;  4PBZ A;  3C5M A;  5GXH A;  4H5J A;  2PM9 B;  3VGZ A;  3RSE C;  5I5J A;  4GM8 A;  3UKU C;  3UVN A;  3EI4 B;  5EAR A;  4GZ8 A;  2HJB A;  4EWR A;  3NVQ A;  3PSC B;  3J80 g;  3EI3 B;  3EMH A;  2I3S A;  3OKY A;  3OKW A;  5CXB A;  4A0B A;  5AMS A;  3UKR C;  3SBR A;  3FRX A;  4D0K A;  4A0B B;  1K8K C;  4IMM A;  5EMM B;  5HYN B;  5TF2 A;  2P9P C;  5GXI A;  4X3E A;  1JMX B;  4ERZ A;  4CI8 A;  4N14 A;  5FA5 B;  2P9N C;  3F3F A;  5CXC A;  2H47 A;  2B5N A;  2P9S C;  2AH1 A;  3HFQ A;  5AJA A;  3JAM g;  1OLZ A;  3I7N A;  1GXR A;  4A11 B;  3EI2 B;  2CN2 A;  3OKT A;  4GMB A;  2G99 A;  1PBY B;  4ESG A;  2HJ4 A;  3AL8 A;  1S4U X;  2PM6 B;  3PSL A;  2AH0 A;  4CC9 A;  2I0T A;  2AGL A;  3AL8 B;  2AGZ A;  4O45 A;  2I3T A;  5H17 A;  1U2V C;  4G56 B;  4O9D A;  4CY2 A;  2IUV A;  3ODT A;  4J81 A;  2UZY B;  3KRX B;  3SLE D;  2I0R A;  4GQB B;  2IWF A;  2YBA A;  5FKQ A;  2CO0 C;  4OZU A;  4BL0 A;  4U1E I;  3I8E A;  2Q7Q A;  3PXW D;  2GNQ A;  3UVM A;  4CI1 A;  2OIZ A;  3ZWL B;  3BG0 A;  5H14 A;  2H9P A;  4CI3 A;  1R5M A;  2CE9 A;  2B5L A;  3DWL C;  2HXC A;  3I7P A;  4PNK B;  3J81 g;  1B9X A;  3DXK C;  1K32 A;  4FB1 D;  3MKS B;  4J77 A;  4JSX C;  4XYH A;  3MXX A;  1MDA H;  4E54 A;  3W15 A;  1JJU B;  2YB8 B;  4E54 B;  4FA5 D;  3K26 A;  4J0W A;  3BG1 A;  4GQ2 P;  2BBK H;  3JRP A;  4CY5 A;  3RLM D;  5KDO B;  5FKS A;  3SBP A;  1PEV A;  3DXM C;  2AGY A;  4CI2 A;  2MTA H;  2AGW A;  2HES X;  5AFU 3;  5B4W A;  4FAN D;  2CO0 A;  2H14 A;  3I7K A;  3IKO A;  4CZV A;  3PXT D;  3V9F A;  3PE7 A;  4LG8 A;  4TZ4 A;  1P22 A;  3VA6 A;  4X63 B;  5IJ8 E;  4A09 A;  2Z2O A;  3I2N A;  3N0E A;  3FGB A;  2HKM A;  3OKY B;  2J55 H;  5CXB B;  3EI1 A;  3IIW A;  2IUR A;  3V7D B;  1XIP A;  1NEX B;  5TEF A;  4L3H D;  4A2L A;  5FKT A;  5HE0 B;  4ZN4 A;  4FA1 D;  4JSN C;  4ERY A;  3I7L A;  5SXM A;  4GQ1 A;  5IJ7 E;  4XYI A;  4PSW B;  3DM0 A;  5EAM A;  2HYE A;  5CXC B;  4GM3 A;  2YMU A;  3RN1 D;  2P9K C;  1VYH C;  5C2W B;  2J57 G;  4AOW A;  3UVO A;  4Y7R A;  3PXS D;  4K3J B;  2HKR A;  3RN0 D;  4A7J A;  5I5I A;  4IA9 A;  4O3U B;  3UR4 A;  4PSX B;  3VH0 A;  3RFH A;  4J82 A;  2H68 A;  3E0C A;  5GSA A;  5CYK A;  1N6D A;  2CN3 A;  4U7A A;  2YNO A;  4GGD A;  4PBY A;  3F3G A;  4O1Q D;  4HDJ A;  4J78 A;  5HE1 B;  3JRO A;  2CE8 A;  2Z2P A;  4JSV C;  4ZOV A;  4PXW A;  1B9Y A;  1U4C A;  4QQE A;  3U4Y A;  4Z8L A;  1GP2 B;  4JXM A;  2O9K A;  4AEZ A;  2AQ5 A;  4JD2 C;  4CY3 A;  4ZOY A;  4J84 A;  3BWS A;  2G9A A;  2H6N A;  1SQJ A;  5IC7 A;  2OVQ B;  3UVL A;  1NR0 A;  4D6V A;  4A0A A;  4JT6 C;  4O3T B;  2J56 H;  3UVK A;  1PGU A;  1N6F A;  2EBS A;  1Q47 A;  2GC4 A;  2CNX A;  3OW8 A;  4MK0 B;  2H13 A;  2B5M A;  3SJL D;  4L3G D;  2XL3 A;  2AGX A;  1TBG A;  4J8G A;  4OWR A;  3EWE A;  5C9Z B;  3IJ0 A;  5HE2 B;  5TDH B;  4J87 A;  4QT8 A;  2QC5 A;  2W18 A;  3MZK A;  3MZL A;  5K19 A;  5TEE A;  4FHL A;  3C99 A;  5FQD A;  2OVP B;  3SCY A;  4I79 A;  2BCJ B;  3IJ1 A;  4BUJ C;  3A0F A;  3C75 H;  2P9L C;  5GMK n;  3RMZ D;  3SWS D;  1GG2 B;  3CFV A;  1YFQ A;  2YNN A;  3JZG A;  1JOF A;  3L4O D;  4LG9 A;  1PI6 A;  5EMK B;  5H1M A;  3PVU B;  4UI9 R;  5C2V B;  2PM7 B;  4A09 B;  4CZY A;  2OVR B;  2P9U C;  5K1C C;  3I8C A;  3EI4 A;  2XL2 A;  1A0R B;  1XHM A;  3ULE C;  1SHY B;  4YVD A;  3F3P A;  3EI3 A;  3NVN A;  5FKR A;  4CY1 A;  2OK6 A;  3EI1 B;  2IWK A;  4XEI C;  4X60 B;  4KFM B;  4Y5R D;  2Z2N A;  4X61 B;  2UZX B;  5A2Q g;  2GC7 A;  5HQG A;  4ZOX A;  3SBQ A;  4QL1 A;  2IUQ A;  1SQ9 A;  3SFZ A;  3AL9 A;  5HE3 B;  4JT5 C;  3DSM A;  3SXT D;  4ZOZ A;  4BH6 A;  4E5Z A;  4J8B A;  2H3X A;  2XU7 A;  2H9N A;  4L1Q D;  4J86 A;  3AH8 B;  2H6Q A;  3EU7 A;  5IGO A;  4NSX A;  2XYI A;  4E5Z B;  4J73 A;  3PVW B;  3L4M D;  4A11 A;  4FAV D;  3EI2 A;  4ERQ A;  4CZX A;  4A08 A;  4J0X A;  5I5M A;  1GOT B;  4LGN A;  3SMR A;  4A08 B;  1FWX A;  4FA4 D;  5EM2 A;  5JWZ A;  3IIY A;  3JPX A;  3IJC A;  1L0Q A;  1RI6 A;  2H9L A;  5CYK B;  1QNI A;  3FM0 A;  5EMJ B;  5EM2 B;  3OL2 A;  2IUP A;  4GGA A;  4R7A B;  3RRM C;  5IT9 g;  3JZH A;  3K27 A;  4JSP C;  3N0D A;  3OL2 B;  3P4F A;  3KRW B;  2IAA A;  3OTT A;  4GGC A; 
#chains in the Genus database with same CATH topology
 4WJK A;  3V4V A;  4RE6 A;  1H2X A;  2YNP A;  5EML B;  5M5R A;  3I89 A;  4MMZ A;  2TRC B;  3EG6 A;  1MG2 A;  4G1M A;  4FA9 D;  2VDK A;  2QXV A;  3GFC A;  3CIK B;  4A0A B;  3IUQ A;  4NC4 A;  3T3M A;  4PC0 A;  4L1M A;  2P9I C;  3O4I A;  4QRJ A;  4DNV A;  4GM9 A;  3K72 A;  1I2M B;  3I7H A;  5EAP A;  2H9M A;  1VZ3 A;  3C9C A;  4FWW A;  1N6E A;  1JMZ B;  2VC2 A;  1XKS A;  3ORV D;  4MMX A;  5E6U A;  3SHF A;  4H5I A;  1MG3 A;  2B4E A;  5THA A;  3I7O A;  3SN6 B;  2PBI B;  1O6F A;  3SVW D;  5IGQ A;  5FLX g;  1ERJ A;  2H6K A;  5FXY A;  5EAL A;  3GRE A;  4ES0 A;  3JB9 L;  2OJY A;  3JZN A;  3B7F A;  3MKQ A;  2QR5 A;  3EQ9 A;  3AFC A;  3RFG A;  3V5W B;  3NVX A;  1TYQ C;  3ZDX A;  4L9O A;  2XDW A;  5C86 A;  2WQ8 A;  1T2X A;  1OMW B;  2OK4 A;  4K3I D;  3MMY A;  2I0S A;  3CFS B;  2PM9 A;  4A2M A;  4J79 A;  4PBZ A;  3C5M A;  5GXH A;  4H5J A;  2VDP A;  2PM9 B;  1VE6 A;  3VGZ A;  3RSE C;  5I5J A;  4GM8 A;  3UKU C;  1VZ2 A;  4BCD A;  3UVN A;  3EI4 B;  5EAR A;  4GZ8 A;  1VE7 A;  2HJB A;  2BKL A;  2VDQ A;  3NVQ A;  3PSC B;  4EWR A;  3J80 g;  3EI3 B;  3EMH A;  1M1X A;  4O2W A;  2I3S A;  1BPO A;  3OKY A;  4D9S A;  3OKW A;  4Z7N A;  5M5V A;  4RE5 A;  2HU7 A;  5CXB A;  4A0B A;  5AMS A;  3UKR C;  3SBR A;  3FRX A;  2VDM A;  4D0K A;  4A0B B;  1K8K C;  4IMM A;  5EMM B;  4AMY A;  5HYN B;  5TF2 A;  2P9P C;  5GXI A;  3IUN A;  3O4H A;  4X3E A;  3QI0 A;  4WK4 A;  1JMX B;  4ERZ A;  4CI8 A;  4N14 A;  5FA5 B;  2P9N C;  3F3F A;  5CXC A;  2H47 A;  2B5N A;  2P9S C;  2AH1 A;  3HFQ A;  5AJA A;  3JAM g;  1OLZ A;  3I7N A;  1GXR A;  1K3I A;  4A11 B;  2QZP A;  3EI2 B;  3KCI A;  2CN2 A;  3OKT A;  4GMB A;  2G99 A;  1PBY B;  4ESG A;  2HJ4 A;  3AL8 A;  1S4U X;  2PM6 B;  3PSL A;  2AH0 A;  4BCB A;  3EQ7 A;  4CC9 A;  2I0T A;  2AGL A;  3AL8 B;  2AGZ A;  4O45 A;  3IUL A;  2I3T A;  5H17 A;  1UOO A;  4O02 A;  1U2V C;  3T3P A;  4G56 B;  4O9D A;  4CY2 A;  2IUV A;  3ODT A;  4J81 A;  2UZY B;  3KRX B;  3SLE D;  2I0R A;  1GOH A;  1L5G A;  4GQB B;  2IWF A;  2YBA A;  5E6S A;  5FKQ A;  2CO0 C;  4OZU A;  4BL0 A;  4U1E I;  3I8E A;  1C9L A;  2Q7Q A;  3PXW D;  2GNQ A;  3UVM A;  4CI1 A;  2OIZ A;  3ZWL B;  1UOQ A;  3BG0 A;  5H14 A;  2H9P A;  4CI3 A;  1R5M A;  2CE9 A;  2B5L A;  3DWL C;  2HXC A;  3I7P A;  4PNK B;  4JHN A;  3J81 g;  1B9X A;  3DXK C;  3K71 A;  1K32 A;  4FB1 D;  3MKS B;  4J77 A;  4JSX C;  4XYH A;  3MXX A;  1MDA H;  3O4J A;  4E54 A;  3VI3 A;  3W15 A;  1JJU B;  2YB8 B;  4IRZ A;  2VDR A;  2VZ3 A;  4E54 B;  4FA5 D;  3K26 A;  3O4G A;  4J0W A;  1GOF A;  3BG1 A;  4GQ2 P;  2BBK H;  3JRP A;  4CY5 A;  2JKX A;  3RLM D;  5KDO B;  5FKS A;  3SBP A;  1PEV A;  3DXM C;  2AGY A;  4CI2 A;  1C9I A;  3QHY B;  4NEN A;  1UTC A;  2MTA H;  2AGW A;  3ZDY A;  2HES X;  2VDL A;  5AFU 3;  5C92 A;  5B4W A;  3ZE1 A;  4FAN D;  2CO0 A;  2H14 A;  5FFO A;  4BP8 A;  3I7K A;  3IKO A;  4G55 A;  1U8C A;  4NBM A;  4CZV A;  3PXT D;  3V9F A;  3PE7 A;  4LG8 A;  2VDO A;  4UM9 A;  3MUN A;  3ZE2 A;  1YR2 A;  4TZ4 A;  1P22 A;  3VA6 A;  4X63 B;  1O6G A;  4Z7O A;  5IJ8 E;  4A09 A;  2Z2O A;  3I2N A;  3N0E A;  3FGB A;  3NID A;  2HKM A;  3OKY B;  3ZDZ A;  2J55 H;  4BCC A;  3K6S A;  5CXB B;  3EI1 A;  3IIW A;  2IUR A;  3V7D B;  1XIP A;  1NEX B;  5TEF A;  4L3H D;  4A2L A;  5FKT A;  3MUO A;  5HE0 B;  4ZN4 A;  4FA1 D;  4JSN C;  4ERY A;  3I7L A;  5SXM A;  4GQ1 A;  5IJ7 E;  4XYI A;  4PSW B;  3DM0 A;  5EAM A;  3FCS A;  2HYE A;  5CXC B;  4GM3 A;  2YMU A;  3RN1 D;  1QFS A;  2P9K C;  1TYE A;  1VYH C;  4WK2 A;  5C2W B;  2J57 G;  4AOW A;  1A12 A;  3UVO A;  4Y7R A;  3PXS D;  3GC3 B;  4K3J B;  2HKR A;  2EIB A;  3RN0 D;  4A7J A;  5I5I A;  4IA9 A;  4O3U B;  3UR4 A;  4PSX B;  3VH0 A;  3RFH A;  4WK0 A;  1UOP A;  2H68 A;  3E0C A;  4J82 A;  5GSA A;  5CYK A;  4Z7Q A;  1N6D A;  2CN3 A;  4U7A A;  2YNO A;  4GGD A;  4PBY A;  3F3G A;  4AMZ A;  4O1Q D;  4HDJ A;  3NIG A;  4J78 A;  5HE1 B;  3JRO A;  4MMY A;  2CE8 A;  2Z2P A;  4JSV C;  4ZOV A;  4PXW A;  1B9Y A;  2XE4 A;  1U4C A;  4QQE A;  4QAM A;  3U4Y A;  4Z8L A;  5FFG A;  1QFM A;  1GP2 B;  4JXM A;  2O9K A;  4AEZ A;  2AQ5 A;  4JD2 C;  3IUM A;  4CY3 A;  4ZOY A;  2XZG A;  3BWS A;  4J84 A;  2G9A A;  2H6N A;  1SQJ A;  5IC7 A;  2OVQ B;  3UVL A;  1NR0 A;  4D6V A;  4A0A A;  4JT6 C;  4O3T B;  2EIC A;  2J56 H;  3IVM A;  3UVK A;  1PGU A;  1E8N A;  1N6F A;  3EQ8 A;  2EBS A;  1Q47 A;  2GC4 A;  2CNX A;  3GD1 I;  3OW8 A;  4MK0 B;  4BP9 A;  1E5T A;  2EIE A;  2H13 A;  2B5M A;  1JTD B;  3SJL D;  4L3G D;  2XL3 A;  5M5T A;  2AGX A;  1TBG A;  3V4P A;  3IUJ A;  2VZ1 A;  4J8G A;  4OWR A;  3EWE A;  5C9Z B;  2HU8 A;  3IJ0 A;  5HE2 B;  5TDH B;  4J87 A;  4QT8 A;  2QC5 A;  2W18 A;  3MZK A;  3MZL A;  5K19 A;  5TEE A;  5M5S A;  4FHL A;  3C99 A;  5FQD A;  2OVP B;  3SCY A;  4I79 A;  5HDB A;  2BCJ B;  3IJ1 A;  4DNW A;  2VDN A;  4BUJ C;  3A0F A;  3C75 H;  2P9L C;  4AN0 A;  5GMK n;  3RMZ D;  3SWS D;  1GG2 B;  3CFV A;  1YFQ A;  2YNN A;  3JZG A;  1JOF A;  2HU5 A;  3L4O D;  4LG9 A;  5M61 A;  1PI6 A;  5EMK B;  5H1M A;  3PVU B;  1H2W A;  4UI9 R;  1E8M A;  5C2V B;  2PM7 B;  3DDU A;  3IUR A;  3OF7 A;  4A09 B;  4CZY A;  2OVR B;  2P9U C;  5K1C C;  2EID A;  3I8C A;  3EI4 A;  2XL2 A;  1A0R B;  3ZE0 A;  1XHM A;  3ULE C;  1SHY B;  4YVD A;  3F3P A;  3EI3 A;  3NVN A;  5FKR A;  4CY1 A;  2OK6 A;  3EI1 B;  2IWK A;  4XEI C;  4X60 B;  1H2Z A;  4KFM B;  4Y5R D;  2Z2N A;  4X61 B;  1GOG A;  2UZX B;  5A2Q g;  2GC7 A;  1JV2 A;  5HQG A;  4ZOX A;  3SBQ A;  4QL1 A;  2IUQ A;  1SQ9 A;  3SFZ A;  3AL9 A;  5HE3 B;  4JT5 C;  3DSM A;  3SXT D;  4DNU A;  3FCU A;  4JHP C;  4ZOZ A;  4BH6 A;  4E5Z A;  4J8B A;  2H3X A;  2XU7 A;  3IJE A;  4NAA A;  2H9N A;  4L1Q D;  4J86 A;  4UM8 A;  5E6R A;  3AH8 B;  2H6Q A;  3EU7 A;  5IGO A;  4NSX A;  2XYI A;  4E5Z B;  4J73 A;  3NIF A;  3PVW B;  3L4M D;  4A11 A;  4FAV D;  3EI2 A;  4ERQ A;  4CZX A;  4A08 A;  4AN1 A;  4J0X A;  3VI4 A;  5I5M A;  3MVD K;  1GOT B;  4LGN A;  3SMR A;  4A08 B;  1FWX A;  4FA4 D;  5EM2 A;  5JWZ A;  3IIY A;  3JPX A;  3IJC A;  1L0Q A;  1H2Y A;  1RI6 A;  2H9L A;  5CYK B;  1QNI A;  3FM0 A;  5EMJ B;  5EM2 B;  3OL2 A;  2IUP A;  4GGA A;  4R7A B;  3RRM C;  5IT9 g;  4G1E A;  3JZH A;  3K27 A;  4JSP C;  3N0D A;  3OL2 B;  3P4F A;  3KRW B;  2IAA A;  5M5U A;  4AX4 A;  3OTT A;  4GGC A; 
#chains in the Genus database with same CATH homology
 2YNP A;  5EML B;  3I89 A;  2TRC B;  3EG6 A;  1MG2 A;  4FA9 D;  2QXV A;  3GFC A;  3CIK B;  4A0A B;  4PC0 A;  2P9I C;  4QRJ A;  4GM9 A;  3I7H A;  5EAP A;  2H9M A;  3C9C A;  4FWW A;  1N6E A;  1JMZ B;  3SHF A;  1XKS A;  3ORV D;  4H5I A;  1MG3 A;  2B4E A;  5THA A;  3I7O A;  3SN6 B;  2PBI B;  3SVW D;  5IGQ A;  5FLX g;  1ERJ A;  2H6K A;  5FXY A;  5EAL A;  3GRE A;  4ES0 A;  3JB9 L;  2OJY A;  3JZN A;  3B7F A;  3MKQ A;  3AFC A;  3RFG A;  3V5W B;  3NVX A;  1TYQ C;  4L9O A;  1OMW B;  2OK4 A;  4K3I D;  3MMY A;  2I0S A;  3CFS B;  2PM9 A;  4A2M A;  4J79 A;  4PBZ A;  3C5M A;  5GXH A;  4H5J A;  2PM9 B;  3VGZ A;  3RSE C;  5I5J A;  4GM8 A;  3UKU C;  3UVN A;  3EI4 B;  5EAR A;  4GZ8 A;  2HJB A;  4EWR A;  3NVQ A;  3PSC B;  3J80 g;  3EI3 B;  3EMH A;  2I3S A;  3OKY A;  3OKW A;  5CXB A;  4A0B A;  5AMS A;  3UKR C;  3SBR A;  3FRX A;  4D0K A;  4A0B B;  1K8K C;  4IMM A;  5EMM B;  5HYN B;  5TF2 A;  2P9P C;  5GXI A;  4X3E A;  1JMX B;  4ERZ A;  4CI8 A;  4N14 A;  5FA5 B;  2P9N C;  3F3F A;  5CXC A;  2H47 A;  2B5N A;  2P9S C;  2AH1 A;  3HFQ A;  5AJA A;  3JAM g;  1OLZ A;  3I7N A;  1GXR A;  4A11 B;  3EI2 B;  2CN2 A;  3OKT A;  4GMB A;  2G99 A;  1PBY B;  4ESG A;  2HJ4 A;  3AL8 A;  1S4U X;  2PM6 B;  3PSL A;  2AH0 A;  4CC9 A;  2I0T A;  2AGL A;  3AL8 B;  2AGZ A;  4O45 A;  2I3T A;  5H17 A;  1U2V C;  4G56 B;  4O9D A;  4CY2 A;  2IUV A;  3ODT A;  4J81 A;  2UZY B;  3KRX B;  3SLE D;  2I0R A;  4GQB B;  2IWF A;  2YBA A;  5FKQ A;  2CO0 C;  4OZU A;  4BL0 A;  4U1E I;  3I8E A;  2Q7Q A;  3PXW D;  2GNQ A;  3UVM A;  4CI1 A;  2OIZ A;  3ZWL B;  3BG0 A;  5H14 A;  2H9P A;  4CI3 A;  1R5M A;  2CE9 A;  2B5L A;  3DWL C;  2HXC A;  3I7P A;  4PNK B;  3J81 g;  1B9X A;  3DXK C;  1K32 A;  4FB1 D;  3MKS B;  4J77 A;  4JSX C;  4XYH A;  3MXX A;  1MDA H;  4E54 A;  3W15 A;  1JJU B;  2YB8 B;  4E54 B;  4FA5 D;  3K26 A;  4J0W A;  3BG1 A;  4GQ2 P;  2BBK H;  3JRP A;  4CY5 A;  3RLM D;  5KDO B;  5FKS A;  3SBP A;  1PEV A;  3DXM C;  2AGY A;  4CI2 A;  2MTA H;  2AGW A;  2HES X;  5AFU 3;  5B4W A;  4FAN D;  2CO0 A;  2H14 A;  3I7K A;  3IKO A;  4CZV A;  3PXT D;  3V9F A;  3PE7 A;  4LG8 A;  4TZ4 A;  1P22 A;  3VA6 A;  4X63 B;  5IJ8 E;  4A09 A;  2Z2O A;  3I2N A;  3N0E A;  3FGB A;  2HKM A;  3OKY B;  2J55 H;  5CXB B;  3EI1 A;  3IIW A;  2IUR A;  3V7D B;  1XIP A;  1NEX B;  5TEF A;  4L3H D;  4A2L A;  5FKT A;  5HE0 B;  4ZN4 A;  4FA1 D;  4JSN C;  4ERY A;  3I7L A;  5SXM A;  4GQ1 A;  5IJ7 E;  4XYI A;  4PSW B;  3DM0 A;  5EAM A;  2HYE A;  5CXC B;  4GM3 A;  2YMU A;  3RN1 D;  2P9K C;  1VYH C;  5C2W B;  2J57 G;  4AOW A;  3UVO A;  4Y7R A;  3PXS D;  4K3J B;  2HKR A;  3RN0 D;  4A7J A;  5I5I A;  4IA9 A;  4O3U B;  3UR4 A;  4PSX B;  3VH0 A;  3RFH A;  4J82 A;  2H68 A;  3E0C A;  5GSA A;  5CYK A;  1N6D A;  2CN3 A;  4U7A A;  2YNO A;  4GGD A;  4PBY A;  3F3G A;  4O1Q D;  4HDJ A;  4J78 A;  5HE1 B;  3JRO A;  2CE8 A;  2Z2P A;  4JSV C;  4ZOV A;  4PXW A;  1B9Y A;  1U4C A;  4QQE A;  3U4Y A;  4Z8L A;  1GP2 B;  4JXM A;  2O9K A;  4AEZ A;  2AQ5 A;  4JD2 C;  4CY3 A;  4ZOY A;  4J84 A;  3BWS A;  2G9A A;  2H6N A;  1SQJ A;  5IC7 A;  2OVQ B;  3UVL A;  1NR0 A;  4D6V A;  4A0A A;  4JT6 C;  4O3T B;  2J56 H;  3UVK A;  1PGU A;  1N6F A;  2EBS A;  1Q47 A;  2GC4 A;  2CNX A;  3OW8 A;  4MK0 B;  2H13 A;  2B5M A;  3SJL D;  4L3G D;  2XL3 A;  2AGX A;  1TBG A;  4J8G A;  4OWR A;  3EWE A;  5C9Z B;  3IJ0 A;  5HE2 B;  5TDH B;  4J87 A;  4QT8 A;  2QC5 A;  2W18 A;  3MZK A;  3MZL A;  5K19 A;  5TEE A;  4FHL A;  3C99 A;  5FQD A;  2OVP B;  3SCY A;  4I79 A;  2BCJ B;  3IJ1 A;  4BUJ C;  3A0F A;  3C75 H;  2P9L C;  5GMK n;  3RMZ D;  3SWS D;  1GG2 B;  3CFV A;  1YFQ A;  2YNN A;  3JZG A;  1JOF A;  3L4O D;  4LG9 A;  1PI6 A;  5EMK B;  5H1M A;  3PVU B;  4UI9 R;  5C2V B;  2PM7 B;  4A09 B;  4CZY A;  2OVR B;  2P9U C;  5K1C C;  3I8C A;  3EI4 A;  2XL2 A;  1A0R B;  1XHM A;  3ULE C;  1SHY B;  4YVD A;  3F3P A;  3EI3 A;  3NVN A;  5FKR A;  4CY1 A;  2OK6 A;  3EI1 B;  2IWK A;  4XEI C;  4X60 B;  4KFM B;  4Y5R D;  2Z2N A;  4X61 B;  2UZX B;  5A2Q g;  2GC7 A;  5HQG A;  4ZOX A;  3SBQ A;  4QL1 A;  2IUQ A;  1SQ9 A;  3SFZ A;  3AL9 A;  5HE3 B;  4JT5 C;  3DSM A;  3SXT D;  4ZOZ A;  4BH6 A;  4E5Z A;  4J8B A;  2H3X A;  2XU7 A;  2H9N A;  4L1Q D;  4J86 A;  3AH8 B;  2H6Q A;  3EU7 A;  5IGO A;  4NSX A;  2XYI A;  4E5Z B;  4J73 A;  3PVW B;  3L4M D;  4A11 A;  4FAV D;  3EI2 A;  4ERQ A;  4CZX A;  4A08 A;  4J0X A;  5I5M A;  1GOT B;  4LGN A;  3SMR A;  4A08 B;  1FWX A;  4FA4 D;  5EM2 A;  5JWZ A;  3IIY A;  3JPX A;  3IJC A;  1L0Q A;  1RI6 A;  2H9L A;  5CYK B;  1QNI A;  3FM0 A;  5EMJ B;  5EM2 B;  3OL2 A;  2IUP A;  4GGA A;  4R7A B;  3RRM C;  5IT9 g;  3JZH A;  3K27 A;  4JSP C;  3N0D A;  3OL2 B;  3P4F A;  3KRW B;  2IAA A;  3OTT A;  4GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...