2I0TA

Crystal structure of phenylacetaldehyde derived r-carbinolamine adduct of aromatic amine dehydrogenase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 104
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i0tA01
5AFU3 3GFCA 3C9CA 4E54A 4J77A 5EALA 3SMRA 3I7OA 3NVQA 1R5MA 1JJUB 4J78A 3OKYB 5EMKB 3FM0A 3I7KA 1K32A 1S4UX 3B7FA 2H13A 4YVDA 4ERYA 2PBIB 2YBAA 3PXSD 3JZHA 3KRWB 5FKTA 4QRJA 4GQ1A 4XYHA 1SQ9A 4CI2A 3FGBA 3UVNA 4XEIC 3F3PA 4O45A 3PXTD 2HJ4A 5EM2B 5K19A 3SHFA 2P9IC 4XYIA 3V5WB 4CY3A 3FRXA 2HXCA 3RN0D 2AQ5A 1XKSA 3OKTA 4CZVA 3RSEC 4R7AB 1MDAH 2P9NC 3EI3B 2AGWA 4QL1A 4ZOXA 4L9OA 3J81g 4Y7RA 2B5MA 2CE8A 1N6EA 3IJ0A 4A09A 3UVKA 4A08A 3EMHA 2H3XA 4ERQA 4FAND 4FA9D 4LG8A 4ESGA 5EMMB 3MZKA 4J86A 4JSXC 4PSWB 4QT8A 2GNQA 5K1CC 3RFHA 4PC0A 5C2WB 3IJ1A 3RMZD 2P9UC 5HE2B 3F3FA 4FA4D 5I5IA 3AL8B 3U4YA 3I8EA 3CFVA 3EI2A 2HESX 2XL3A 3OL2A 3DM0A 2HKRA 5CXCA 3I8CA 3MMYA 3EU7A 5H17A 4GM3A 1PGUA 4CI3A 4A0BB 5C9ZB 2H9PA 2YNPA 3IJCA 3JB9L 2P9PC 5TDHB 2I0RA 2IUPA 2Z2NA 2H14A 3BG0A 3K27A 4NSXA 1JMXB 2P9KC 4X60B 3SCYA 2I0TA 5AMSA 4K3JB 4ES0A 1OLZA 1PI6A 2AH0A 3EI1A 5HYNB 1VYHC 4K3ID 3ZWLB 2OVPB 4JD2C 3IKOA 3DWLC 4Z8LA 3SJLD 5JWZA 3DXMC 1QNIA 5TEEA 3V9FA 2G99A 1A0RB 2YNOA 2PM7B 2J55H 3SLED 2AGYA 1Q47A 5THAA 4A2LA 4A7JA 2Z2OA 4CY5A 3BWSA 5GXHA 3K26A 4J82A 3SWSD 4FA5D 4PXWA 2OIZA 3RFGA 1SQJA 2P9SC 5TF2A 4ERZA 5C2VB 5CYKA 2XYIA 4TZ4A 4CC9A 3OTTA 3J80g 3CIKB 3MZLA 4ZOVA 5EMLB 2OK6A 2Q7QA 5EM2A 3SXTD 5AJAA 1JOFA 3C5MA 4FA1D 5FLXg 3AL8A 4LGNA 3JPXA 2H6NA 4IA9A 3UR4A 3MKSB 4GGCA 3W15A 4H5JA 3JZNA 4A09B 4CY2A 3C75H 4L3HD 5H14A 4A0AA 1PEVA 3AFCA 4GQ2P 4L3GD 1B9XA 3ULEC 5TEFA 4PBYA 5KDOB 3PVUB 5IGOA 3PXWD 2AGZA 3IIWA 3I89A 5EAPA 5I5JA 4GM9A 3OKWA 4GZ8A 5FKQA 3PVWB 4QQEA 4AOWA 5A2Qg 5GXIA 3RRMC 2PM6B 4KFMB 3I2NA 4J81A 4J73A 4BL0A 5IT9g 4IMMA 2B5NA 5HE0B 2IAAA 3N0DA 5GMKn 4O1QD 2OVRB 4J8BA 2PM9B 2OJYA 2UZXB 3I7HA 4AEZA 3OL2B 3V7DB 4X61B 2CN2A 4U7AA 4GGDA 2QC5A 5CXCB 3UKRC 1PBYB 4E5ZA 4MK0B 4FWWA 3UVLA 4J0XA 4JSVC 3SFZA 3MXXA 4A0BA 1B9YA 3PSCB 2J57G 5EMJB 1NR0A 5SXMA 2BCJB 4X63B 3SBRA 2H6QA 1GXRA 4CZYA 2EBSA 3F3GA 2IWFA 2B4EA 2HJBA 1RI6A 4ZN4A 2CNXA 1TYQC 5IC7A 3UKUC 1N6DA 4J84A 4G56B 1SHYB 4L1QD 5B4WA 4CI8A 1P22A 4D0KA 2CN3A 5EARA 2QXVA 5CXBB 2GC4A 3MKQA 2H68A 2TRCB 3KRXB 1K8KC 3UVOA 2AGLA 2IUQA 2OVQB 2I3TA 2AH1A 2BBKH 1U4CA 5CYKB 5IGQA 3N0EA 4PSXB 3DSMA 5HE1B 3CFSB 4E5ZB 2AGXA 4OZUA 1OMWB 1N6FA 2GC7A 3EI4B 4O3TB 3VH0A 5FKSA 4X3EA 3JROA 3JZGA 1MG3A 2IUVA 4CY1A 2PM9A 2H47A 4OWRA 3OKYA 3E0CA 3RN1D 4O3UB 5H1MA 2CO0A 3SBPA 1JMZB 2I3SA 3SBQA 4JSNC 3VGZA 3UVMA 2OK4A 5GSAA 4A0AB 4J8GA 4GMBA 4N14A 5FA5B 1FWXA 1XHMA 3EG6A 3I7PA 2H9MA 3AH8B 3L4MD 4A11A 4FAVD 3P4FA 4HDJA 4CI1A 5HE3B 1YFQA 4GQBB 4JXMA 3SVWD 3DXKC 4D6VA 3EI3A 5CXBA 2XU7A 3I7NA 1ERJA 2W18A 3VA6A 3A0FA 3HFQA 5FQDA 4J87A 5I5MA 4A08B 2YB8B 3GREA 2IWKA 4E54B 1TBGA 3EWEA 4GM8A 5FXYA 2H6KA 4CZXA 2MTAH 5EAMA 3L4OD 4JSPC 4I79A 3BG1A 4FHLA 1U2VC 2H9LA 3NVXA 4PNKB 4Y5RD 5HQGA 4JT5C 4O9DA 4FB1D 2G9AA 3ODTA 3AL9A 2Z2PA 3JAMg 4GGAA 3OW8A 4ZOZA 3EI2B 2HYEA 3IIYA 5IJ7E 2CO0C 3EI1B 4BUJC 4ZOYA 2YNNA 2UZYB 4UI9R 4BH6A 3EI4A 4A2MA 2P9LC 4J79A 4PBZA 4LG9A 3C99A 3JRPA 3RLMD 2H9NA 1GP2B 1L0QA 2O9KA 3PE7A 1MG2A 1XIPA 2CE9A 3SN6B 2I0SA 2HKMA 4A11B 5FKRA 1NEXB 4EWRA 2XL2A 2YMUA 4J0WA 4JT6C 3NVNA 4U1EI 1GG2B 2B5LA 2IURA 3PSLA 5IJ8E 3ORVD 1GOTB 2J56H 4H5IA 3I7LA
chains in the Genus database with same CATH superfamily
5AFU3 3GFCA 3IULA 3C9CA 4E54A 4J77A 5EALA 3SMRA 3I7OA 3NVQA 1R5MA 1YR2A 4L1MA 1VZ3A 1JJUB 2EICA 4J78A 3OKYB 5EMKB 3FM0A 3I7KA 1K32A 1S4UX 4UM9A 4Z7OA 3B7FA 2H13A 4YVDA 4ERYA 2PBIB 2YBAA 3PXSD 3JZHA 3KRWB 1VZ2A 3GC3B 5FKTA 4QRJA 4GQ1A 4XYHA 1SQ9A 4CI2A 3FGBA 2HU8A 3UVNA 4XEIC 1UOQA 3F3PA 4O45A 3O4JA 3PXTD 2HJ4A 5EM2B 5K19A 3SHFA 2P9IC 4XYIA 3V5WB 4CY3A 3FRXA 2HXCA 3RN0D 2AQ5A 1XKSA 3OKTA 4CZVA 3RSEC 4R7AB 1E8MA 1MDAH 3FCUA 3ZE0A 2P9NC 3EI3B 2AGWA 4QL1A 4ZOXA 4L9OA 3J81g 4DNUA 1C9LA 1TYEA 4Y7RA 2B5MA 2CE8A 1N6EA 3IJ0A 4AMYA 1O6GA 3UVKA 4A08A 4A09A 3EMHA 2H3XA 4ERQA 4FAND 3EQ9A 4FA9D 4LG8A 4ESGA 5EMMB 3MZKA 3MVDK 2VDLA 4J86A 4JSXC 4PSWB 4QT8A 2GNQA 5K1CC 3RFHA 4PC0A 5C2WB 3IJ1A 3K6SA 3RMZD 2P9UC 5M5TA 5HE2B 3F3FA 4FA4D 5I5IA 3AL8B 4BCDA 3U4YA 3I8EA 3CFVA 3O4IA 3EI2A 2HESX 2XL3A 3OL2A 3DM0A 5M61A 1E5TA 2HKRA 5CXCA 3I8CA 3MMYA 2VDMA 3EU7A 5H17A 4GM3A 1PGUA 1JTDB 4BCBA 4CI3A 4A0BB 5C9ZB 2H9PA 4G1EA 2YNPA 3IJCA 3JB9L 4MMYA 2P9PC 5TDHB 4AMZA 2I0RA 2IUPA 2Z2NA 3K27A 2H14A 3BG0A 4NSXA 1JMXB 2P9KC 4X60B 3SCYA 2I0TA 5AMSA 4K3JB 5M5VA 4ES0A 4BP9A 1OLZA 2VDPA 3V4VA 1PI6A 2AH0A 2VDQA 3EI1A 3IUMA 5HYNB 1VYHC 4K3ID 3ZWLB 2OVPB 4JD2C 1JV2A 3IKOA 3DWLC 4Z8LA 3SJLD 5JWZA 3DXMC 1QNIA 5TEEA 3V9FA 2G99A 1A0RB 2YNOA 1UOPA 2VDNA 2PM7B 2J55H 3SLED 4UM8A 2AGYA 1Q47A 5THAA 2VZ1A 4A2LA 4A7JA 2Z2OA 3ZDYA 4CY5A 3BWSA 5GXHA 1H2XA 3K26A 4J82A 3SWSD 4FA5D 4PXWA 4JHNA 4O02A 3O4HA 2OIZA 3RFGA 1SQJA 2P9SC 4RE5A 5TF2A 4ERZA 5C2VB 5CYKA 2XYIA 4TZ4A 3DDUA 4CC9A 3OTTA 3J80g 3CIKB 3MZLA 2QZPA 4ZOVA 1H2YA 5EMLB 5E6RA 2OK6A 2Q7QA 5EM2A 3SXTD 4WK2A 4G1MA 5AJAA 1JOFA 3C5MA 4FA1D 5FLXg 2VC2A 3AL8A 3OF7A 2HU7A 4LGNA 1I2MB 1UOOA 4NBMA 3JPXA 2H6NA 4IA9A 3UR4A 3MKSB 4GGCA 3W15A 4H5JA 3JZNA 4A09B 3VI3A 1GOFA 1O6FA 4BP8A 4CY2A 3C75H 4L3HD 4WK0A 5H14A 4A0AA 1PEVA 3AFCA 4GQ2P 4L3GD 5HDBA 1B9XA 3ULEC 5TEFA 4PBYA 5KDOB 3NIGA 3PVUB 5IGOA 3GD1I 3PXWD 2AGZA 3IIWA 3I89A 5EAPA 5I5JA 4GM9A 4QAMA 3OKWA 4GZ8A 2XDWA 5FKQA 3PVWB 4QQEA 3EQ8A 4AOWA 4BCCA 5A2Qg 5GXIA 5C86A 3FCSA 3RRMC 3QI0A 2PM6B 4KFMB 3I2NA 4J81A 4J73A 4BL0A 5IT9g 4MMZA 4IRZA 4IMMA 2B5NA 5HE0B 2IAAA 3N0DA 5GMKn 3K71A 2HU5A 4O1QD 1H2ZA 2OVRB 4J8BA 2VDOA 5E6SA 2PM9B 2VDKA 3ZDXA 2OJYA 2UZXB 3I7HA 4AEZA 3OL2B 3V7DB 4X61B 2CN2A 4U7AA 4GGDA 4NC4A 2QC5A 2EIEA 5CXCB 2EIBA 3UKRC 1PBYB 4E5ZA 4MK0B 4NENA 4FWWA 1UTCA 5M5RA 3UVLA 4J0XA 4JSVC 3SFZA 3MXXA 4A0BA 1B9YA 3PSCB 2J57G 5EMJB 1NR0A 4Z7QA 5SXMA 2BCJB 4X63B 3SBRA 2H6QA 3T3PA 1QFSA 3K72A 1GXRA 3IUQA 4DNVA 4CZYA 3ZDZA 2EBSA 3F3GA 2IWFA 2B4EA 1GOGA 2HJBA 1RI6A 4ZN4A 2CNXA 3IUNA 1TYQC 4MMXA 3EQ7A 5IC7A 2XE4A 3UKUC 2EIDA 1N6DA 4J84A 4G56B 1C9IA 2VZ3A 1SHYB 4G55A 3T3MA 4L1QD 5B4WA 4CI8A 1U8CA 1P22A 4D0KA 5C92A 4JHPC 2CN3A 5EARA 1BPOA 2QXVA 5CXBB 2GC4A 3MKQA 2H68A 2JKXA 2TRCB 3KRXB 4O2WA 1K8KC 4AX4A 3UVOA 2AGLA 4WK4A 2IUQA 2OVQB 2I3TA 2AH1A 2BBKH 1U4CA 5CYKB 5IGQA 2BKLA 2WQ8A 3N0EA 1E8NA 4NAAA 4PSXB 3DSMA 5HE1B 3CFSB 4E5ZB 2AGXA 4OZUA 1OMWB 1N6FA 2GC7A 3V4PA 3EI4B 4O3TB 3NIFA 3VH0A 1L5GA 5FKSA 4X3EA 3JROA 3JZGA 1MG3A 2IUVA 4CY1A 2PM9A 5M5SA 2H47A 4OWRA 3OKYA 4AN1A 3E0CA 3ZE2A 3RN1D 4O3UB 5H1MA 2CO0A 3SBPA 5FFOA 1JMZB 2I3SA 3SBQA 4JSNC 3VGZA 3UVMA 2OK4A 5GSAA 5E6UA 4AN0A 4A0AB 4J8GA 4GMBA 4N14A 3MUNA 5FA5B 4DNWA 1FWXA 1H2WA 3IVMA 1XHMA 3IURA 3EG6A 3I7PA 2H9MA 3AH8B 3L4MD 4A11A 4FAVD 3P4FA 4HDJA 4CI1A 3IUJA 5HE3B 1YFQA 4GQBB 4JXMA 3SVWD 3DXKC 4D6VA 3EI3A 5CXBA 3O4GA 2XU7A 3KCIA 3I7NA 1ERJA 2W18A 2VDRA 3VA6A 3A0FA 3VI4A 4Z7NA 3HFQA 2QR5A 5FQDA 4J87A 5I5MA 4A08B 5FFGA 2YB8B 3GREA 2IWKA 4E54B 1TBGA 3EWEA 4GM8A 5FXYA 2H6KA 3IJEA 4CZXA 2MTAH 1GOHA 5EAMA 3L4OD 4JSPC 4I79A 3BG1A 3MUOA 4FHLA 1U2VC 2H9LA 3NVXA 4PNKB 4Y5RD 5HQGA 4JT5C 4O9DA 4FB1D 1K3IA 1VE6A 2G9AA 3ODTA 3AL9A 4D9SA 2Z2PA 3JAMg 4GGAA 3OW8A 4ZOZA 3EI2B 4RE6A 1VE7A 2HYEA 3NIDA 1T2XA 3IIYA 5IJ7E 2CO0C 3EI1B 5M5UA 4BUJC 4ZOYA 2YNNA 2XZGA 2UZYB 4UI9R 4WJKA 4BH6A 3EI4A 4A2MA 2P9LC 4J79A 4PBZA 4LG9A 3C99A 3JRPA 1A12A 3RLMD 1M1XA 2H9NA 1GP2B 1L0QA 2O9KA 3PE7A 1MG2A 1XIPA 2CE9A 3SN6B 2I0SA 2HKMA 4A11B 5FKRA 1NEXB 1QFMA 4EWRA 2XL2A 2YMUA 3ZE1A 4J0WA 4JT6C 3NVNA 4U1EI 3QHYB 1GG2B 2B5LA 2IURA 3PSLA 5IJ8E 3ORVD 1GOTB 2J56H 4H5IA 3I7LA
chains in the Genus database with same CATH topology
5AFU3 3GFCA 3C9CA 4E54A 4J77A 5EALA 3SMRA 3I7OA 3NVQA 1R5MA 1JJUB 4J78A 3OKYB 5EMKB 3FM0A 3I7KA 1K32A 1S4UX 3B7FA 2H13A 4YVDA 4ERYA 2PBIB 2YBAA 3PXSD 3JZHA 3KRWB 5FKTA 4QRJA 4GQ1A 4XYHA 1SQ9A 4CI2A 3FGBA 3UVNA 4XEIC 3F3PA 4O45A 3PXTD 2HJ4A 5EM2B 5K19A 3SHFA 2P9IC 4XYIA 3V5WB 4CY3A 3FRXA 2HXCA 3RN0D 2AQ5A 1XKSA 3OKTA 4CZVA 3RSEC 4R7AB 1MDAH 2P9NC 3EI3B 2AGWA 4QL1A 4ZOXA 4L9OA 3J81g 4Y7RA 2B5MA 2CE8A 1N6EA 3IJ0A 4A09A 3UVKA 4A08A 3EMHA 2H3XA 4ERQA 4FAND 4FA9D 4LG8A 4ESGA 5EMMB 3MZKA 4J86A 4JSXC 4PSWB 4QT8A 2GNQA 5K1CC 3RFHA 4PC0A 5C2WB 3IJ1A 3RMZD 2P9UC 5HE2B 3F3FA 4FA4D 5I5IA 3AL8B 3U4YA 3I8EA 3CFVA 3EI2A 2HESX 2XL3A 3OL2A 3DM0A 2HKRA 5CXCA 3I8CA 3MMYA 3EU7A 5H17A 4GM3A 1PGUA 4CI3A 4A0BB 5C9ZB 2H9PA 2YNPA 3IJCA 3JB9L 2P9PC 5TDHB 2I0RA 2IUPA 2Z2NA 2H14A 3BG0A 3K27A 4NSXA 1JMXB 2P9KC 4X60B 3SCYA 2I0TA 5AMSA 4K3JB 4ES0A 1OLZA 1PI6A 2AH0A 3EI1A 5HYNB 1VYHC 4K3ID 3ZWLB 2OVPB 4JD2C 3IKOA 3DWLC 4Z8LA 3SJLD 5JWZA 3DXMC 1QNIA 5TEEA 3V9FA 2G99A 1A0RB 2YNOA 2PM7B 2J55H 3SLED 2AGYA 1Q47A 5THAA 4A2LA 4A7JA 2Z2OA 4CY5A 3BWSA 5GXHA 3K26A 4J82A 3SWSD 4FA5D 4PXWA 2OIZA 3RFGA 1SQJA 2P9SC 5TF2A 4ERZA 5C2VB 5CYKA 2XYIA 4TZ4A 4CC9A 3OTTA 3J80g 3CIKB 3MZLA 4ZOVA 5EMLB 2OK6A 2Q7QA 5EM2A 3SXTD 5AJAA 1JOFA 3C5MA 4FA1D 5FLXg 3AL8A 4LGNA 3JPXA 2H6NA 4IA9A 3UR4A 3MKSB 4GGCA 3W15A 4H5JA 3JZNA 4A09B 4CY2A 3C75H 4L3HD 5H14A 4A0AA 1PEVA 3AFCA 4GQ2P 4L3GD 1B9XA 3ULEC 5TEFA 4PBYA 5KDOB 3PVUB 5IGOA 3PXWD 2AGZA 3IIWA 3I89A 5EAPA 5I5JA 4GM9A 3OKWA 4GZ8A 5FKQA 3PVWB 4QQEA 4AOWA 5A2Qg 5GXIA 3RRMC 2PM6B 4KFMB 3I2NA 4J81A 4J73A 4BL0A 5IT9g 4IMMA 2B5NA 5HE0B 2IAAA 3N0DA 5GMKn 4O1QD 2OVRB 4J8BA 2PM9B 2OJYA 2UZXB 3I7HA 4AEZA 3OL2B 3V7DB 4X61B 2CN2A 4U7AA 4GGDA 2QC5A 5CXCB 3UKRC 1PBYB 4E5ZA 4MK0B 4FWWA 3UVLA 4J0XA 4JSVC 3SFZA 3MXXA 4A0BA 1B9YA 3PSCB 2J57G 5EMJB 1NR0A 5SXMA 2BCJB 4X63B 3SBRA 2H6QA 1GXRA 4CZYA 2EBSA 3F3GA 2IWFA 2B4EA 2HJBA 1RI6A 4ZN4A 2CNXA 1TYQC 5IC7A 3UKUC 1N6DA 4J84A 4G56B 1SHYB 4L1QD 5B4WA 4CI8A 1P22A 4D0KA 2CN3A 5EARA 2QXVA 5CXBB 2GC4A 3MKQA 2H68A 2TRCB 3KRXB 1K8KC 3UVOA 2AGLA 2IUQA 2OVQB 2I3TA 2AH1A 2BBKH 1U4CA 5CYKB 5IGQA 3N0EA 4PSXB 3DSMA 5HE1B 3CFSB 4E5ZB 2AGXA 4OZUA 1OMWB 1N6FA 2GC7A 3EI4B 4O3TB 3VH0A 5FKSA 4X3EA 3JROA 3JZGA 1MG3A 2IUVA 4CY1A 2PM9A 2H47A 4OWRA 3OKYA 3E0CA 3RN1D 4O3UB 5H1MA 2CO0A 3SBPA 1JMZB 2I3SA 3SBQA 4JSNC 3VGZA 3UVMA 2OK4A 5GSAA 4A0AB 4J8GA 4GMBA 4N14A 5FA5B 1FWXA 1XHMA 3EG6A 3I7PA 2H9MA 3AH8B 3L4MD 4A11A 4FAVD 3P4FA 4HDJA 4CI1A 5HE3B 1YFQA 4GQBB 4JXMA 3SVWD 3DXKC 4D6VA 3EI3A 5CXBA 2XU7A 3I7NA 1ERJA 2W18A 3VA6A 3A0FA 3HFQA 5FQDA 4J87A 5I5MA 4A08B 2YB8B 3GREA 2IWKA 4E54B 1TBGA 3EWEA 4GM8A 5FXYA 2H6KA 4CZXA 2MTAH 5EAMA 3L4OD 4JSPC 4I79A 3BG1A 4FHLA 1U2VC 2H9LA 3NVXA 4PNKB 4Y5RD 5HQGA 4JT5C 4O9DA 4FB1D 2G9AA 3ODTA 3AL9A 2Z2PA 3JAMg 4GGAA 3OW8A 4ZOZA 3EI2B 2HYEA 3IIYA 5IJ7E 2CO0C 3EI1B 4BUJC 4ZOYA 2YNNA 2UZYB 4UI9R 4BH6A 3EI4A 4A2MA 2P9LC 4J79A 4PBZA 4LG9A 3C99A 3JRPA 3RLMD 2H9NA 1GP2B 1L0QA 2O9KA 3PE7A 1MG2A 1XIPA 2CE9A 3SN6B 2I0SA 2HKMA 4A11B 5FKRA 1NEXB 4EWRA 2XL2A 2YMUA 4J0WA 4JT6C 3NVNA 4U1EI 1GG2B 2B5LA 2IURA 3PSLA 5IJ8E 3ORVD 1GOTB 2J56H 4H5IA 3I7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFU 3;  3GFC A;  3C9C A;  4E54 A;  4J77 A;  5EAL A;  3SMR A;  3I7O A;  3NVQ A;  1R5M A;  1JJU B;  4J78 A;  3OKY B;  5EMK B;  3FM0 A;  3I7K A;  1K32 A;  1S4U X;  3B7F A;  2H13 A;  4YVD A;  4ERY A;  2PBI B;  2YBA A;  3PXS D;  3JZH A;  3KRW B;  5FKT A;  4QRJ A;  4GQ1 A;  4XYH A;  1SQ9 A;  4CI2 A;  3FGB A;  3UVN A;  4XEI C;  3F3P A;  4O45 A;  3PXT D;  2HJ4 A;  5EM2 B;  5K19 A;  3SHF A;  2P9I C;  4XYI A;  3V5W B;  4CY3 A;  3FRX A;  2HXC A;  3RN0 D;  2AQ5 A;  1XKS A;  3OKT A;  4CZV A;  3RSE C;  4R7A B;  1MDA H;  2P9N C;  3EI3 B;  2AGW A;  4QL1 A;  4ZOX A;  4L9O A;  3J81 g;  4Y7R A;  2B5M A;  2CE8 A;  1N6E A;  3IJ0 A;  4A09 A;  3UVK A;  4A08 A;  3EMH A;  2H3X A;  4ERQ A;  4FAN D;  4FA9 D;  4LG8 A;  4ESG A;  5EMM B;  3MZK A;  4J86 A;  4JSX C;  4PSW B;  4QT8 A;  2GNQ A;  5K1C C;  3RFH A;  4PC0 A;  5C2W B;  3IJ1 A;  3RMZ D;  2P9U C;  5HE2 B;  3F3F A;  4FA4 D;  5I5I A;  3AL8 B;  3U4Y A;  3I8E A;  3CFV A;  3EI2 A;  2HES X;  2XL3 A;  3OL2 A;  3DM0 A;  2HKR A;  5CXC A;  3I8C A;  3MMY A;  3EU7 A;  5H17 A;  4GM3 A;  1PGU A;  4CI3 A;  4A0B B;  5C9Z B;  2H9P A;  2YNP A;  3IJC A;  3JB9 L;  2P9P C;  5TDH B;  2I0R A;  2IUP A;  2Z2N A;  2H14 A;  3BG0 A;  3K27 A;  4NSX A;  1JMX B;  2P9K C;  4X60 B;  3SCY A;  2I0T A;  5AMS A;  4K3J B;  4ES0 A;  1OLZ A;  1PI6 A;  2AH0 A;  3EI1 A;  5HYN B;  1VYH C;  4K3I D;  3ZWL B;  2OVP B;  4JD2 C;  3IKO A;  3DWL C;  4Z8L A;  3SJL D;  5JWZ A;  3DXM C;  1QNI A;  5TEE A;  3V9F A;  2G99 A;  1A0R B;  2YNO A;  2PM7 B;  2J55 H;  3SLE D;  2AGY A;  1Q47 A;  5THA A;  4A2L A;  4A7J A;  2Z2O A;  4CY5 A;  3BWS A;  5GXH A;  3K26 A;  4J82 A;  3SWS D;  4FA5 D;  4PXW A;  2OIZ A;  3RFG A;  1SQJ A;  2P9S C;  5TF2 A;  4ERZ A;  5C2V B;  5CYK A;  2XYI A;  4TZ4 A;  4CC9 A;  3OTT A;  3J80 g;  3CIK B;  3MZL A;  4ZOV A;  5EML B;  2OK6 A;  2Q7Q A;  5EM2 A;  3SXT D;  5AJA A;  1JOF A;  3C5M A;  4FA1 D;  5FLX g;  3AL8 A;  4LGN A;  3JPX A;  2H6N A;  4IA9 A;  3UR4 A;  3MKS B;  4GGC A;  3W15 A;  4H5J A;  3JZN A;  4A09 B;  4CY2 A;  3C75 H;  4L3H D;  5H14 A;  4A0A A;  1PEV A;  3AFC A;  4GQ2 P;  4L3G D;  1B9X A;  3ULE C;  5TEF A;  4PBY A;  5KDO B;  3PVU B;  5IGO A;  3PXW D;  2AGZ A;  3IIW A;  3I89 A;  5EAP A;  5I5J A;  4GM9 A;  3OKW A;  4GZ8 A;  5FKQ A;  3PVW B;  4QQE A;  4AOW A;  5A2Q g;  5GXI A;  3RRM C;  2PM6 B;  4KFM B;  3I2N A;  4J81 A;  4J73 A;  4BL0 A;  5IT9 g;  4IMM A;  2B5N A;  5HE0 B;  2IAA A;  3N0D A;  5GMK n;  4O1Q D;  2OVR B;  4J8B A;  2PM9 B;  2OJY A;  2UZX B;  3I7H A;  4AEZ A;  3OL2 B;  3V7D B;  4X61 B;  2CN2 A;  4U7A A;  4GGD A;  2QC5 A;  5CXC B;  3UKR C;  1PBY B;  4E5Z A;  4MK0 B;  4FWW A;  3UVL A;  4J0X A;  4JSV C;  3SFZ A;  3MXX A;  4A0B A;  1B9Y A;  3PSC B;  2J57 G;  5EMJ B;  1NR0 A;  5SXM A;  2BCJ B;  4X63 B;  3SBR A;  2H6Q A;  1GXR A;  4CZY A;  2EBS A;  3F3G A;  2IWF A;  2B4E A;  2HJB A;  1RI6 A;  4ZN4 A;  2CNX A;  1TYQ C;  5IC7 A;  3UKU C;  1N6D A;  4J84 A;  4G56 B;  1SHY B;  4L1Q D;  5B4W A;  4CI8 A;  1P22 A;  4D0K A;  2CN3 A;  5EAR A;  2QXV A;  5CXB B;  2GC4 A;  3MKQ A;  2H68 A;  2TRC B;  3KRX B;  1K8K C;  3UVO A;  2AGL A;  2IUQ A;  2OVQ B;  2I3T A;  2AH1 A;  2BBK H;  1U4C A;  5CYK B;  5IGQ A;  3N0E A;  4PSX B;  3DSM A;  5HE1 B;  3CFS B;  4E5Z B;  2AGX A;  4OZU A;  1OMW B;  1N6F A;  2GC7 A;  3EI4 B;  4O3T B;  3VH0 A;  5FKS A;  4X3E A;  3JRO A;  3JZG A;  1MG3 A;  2IUV A;  4CY1 A;  2PM9 A;  2H47 A;  4OWR A;  3OKY A;  3E0C A;  3RN1 D;  4O3U B;  5H1M A;  2CO0 A;  3SBP A;  1JMZ B;  2I3S A;  3SBQ A;  4JSN C;  3VGZ A;  3UVM A;  2OK4 A;  5GSA A;  4A0A B;  4J8G A;  4GMB A;  4N14 A;  5FA5 B;  1FWX A;  1XHM A;  3EG6 A;  3I7P A;  2H9M A;  3AH8 B;  3L4M D;  4A11 A;  4FAV D;  3P4F A;  4HDJ A;  4CI1 A;  5HE3 B;  1YFQ A;  4GQB B;  4JXM A;  3SVW D;  3DXK C;  4D6V A;  3EI3 A;  5CXB A;  2XU7 A;  3I7N A;  1ERJ A;  2W18 A;  3VA6 A;  3A0F A;  3HFQ A;  5FQD A;  4J87 A;  5I5M A;  4A08 B;  2YB8 B;  3GRE A;  2IWK A;  4E54 B;  1TBG A;  3EWE A;  4GM8 A;  5FXY A;  2H6K A;  4CZX A;  2MTA H;  5EAM A;  3L4O D;  4JSP C;  4I79 A;  3BG1 A;  4FHL A;  1U2V C;  2H9L A;  3NVX A;  4PNK B;  4Y5R D;  5HQG A;  4JT5 C;  4O9D A;  4FB1 D;  2G9A A;  3ODT A;  3AL9 A;  2Z2P A;  3JAM g;  4GGA A;  3OW8 A;  4ZOZ A;  3EI2 B;  2HYE A;  3IIY A;  5IJ7 E;  2CO0 C;  3EI1 B;  4BUJ C;  4ZOY A;  2YNN A;  2UZY B;  4UI9 R;  4BH6 A;  3EI4 A;  4A2M A;  2P9L C;  4J79 A;  4PBZ A;  4LG9 A;  3C99 A;  3JRP A;  3RLM D;  2H9N A;  1GP2 B;  1L0Q A;  2O9K A;  3PE7 A;  1MG2 A;  1XIP A;  2CE9 A;  3SN6 B;  2I0S A;  2HKM A;  4A11 B;  5FKR A;  1NEX B;  4EWR A;  2XL2 A;  2YMU A;  4J0W A;  4JT6 C;  3NVN A;  4U1E I;  1GG2 B;  2B5L A;  2IUR A;  3PSL A;  5IJ8 E;  3ORV D;  1GOT B;  2J56 H;  4H5I A;  3I7L A; 
#chains in the Genus database with same CATH topology
 5AFU 3;  3GFC A;  3IUL A;  3C9C A;  4E54 A;  4J77 A;  5EAL A;  3SMR A;  3I7O A;  3NVQ A;  1R5M A;  1YR2 A;  4L1M A;  1VZ3 A;  1JJU B;  2EIC A;  4J78 A;  3OKY B;  5EMK B;  3FM0 A;  3I7K A;  1K32 A;  1S4U X;  4UM9 A;  4Z7O A;  3B7F A;  2H13 A;  4YVD A;  4ERY A;  2PBI B;  2YBA A;  3PXS D;  3JZH A;  3KRW B;  1VZ2 A;  3GC3 B;  5FKT A;  4QRJ A;  4GQ1 A;  4XYH A;  1SQ9 A;  4CI2 A;  3FGB A;  2HU8 A;  3UVN A;  4XEI C;  1UOQ A;  3F3P A;  4O45 A;  3O4J A;  3PXT D;  2HJ4 A;  5EM2 B;  5K19 A;  3SHF A;  2P9I C;  4XYI A;  3V5W B;  4CY3 A;  3FRX A;  2HXC A;  3RN0 D;  2AQ5 A;  1XKS A;  3OKT A;  4CZV A;  3RSE C;  4R7A B;  1E8M A;  1MDA H;  3FCU A;  3ZE0 A;  2P9N C;  3EI3 B;  2AGW A;  4QL1 A;  4ZOX A;  4L9O A;  3J81 g;  4DNU A;  1C9L A;  1TYE A;  4Y7R A;  2B5M A;  2CE8 A;  1N6E A;  3IJ0 A;  4AMY A;  1O6G A;  3UVK A;  4A08 A;  4A09 A;  3EMH A;  2H3X A;  4ERQ A;  4FAN D;  3EQ9 A;  4FA9 D;  4LG8 A;  4ESG A;  5EMM B;  3MZK A;  3MVD K;  2VDL A;  4J86 A;  4JSX C;  4PSW B;  4QT8 A;  2GNQ A;  5K1C C;  3RFH A;  4PC0 A;  5C2W B;  3IJ1 A;  3K6S A;  3RMZ D;  2P9U C;  5M5T A;  5HE2 B;  3F3F A;  4FA4 D;  5I5I A;  3AL8 B;  4BCD A;  3U4Y A;  3I8E A;  3CFV A;  3O4I A;  3EI2 A;  2HES X;  2XL3 A;  3OL2 A;  3DM0 A;  5M61 A;  1E5T A;  2HKR A;  5CXC A;  3I8C A;  3MMY A;  2VDM A;  3EU7 A;  5H17 A;  4GM3 A;  1PGU A;  1JTD B;  4BCB A;  4CI3 A;  4A0B B;  5C9Z B;  2H9P A;  4G1E A;  2YNP A;  3IJC A;  3JB9 L;  4MMY A;  2P9P C;  5TDH B;  4AMZ A;  2I0R A;  2IUP A;  2Z2N A;  3K27 A;  2H14 A;  3BG0 A;  4NSX A;  1JMX B;  2P9K C;  4X60 B;  3SCY A;  2I0T A;  5AMS A;  4K3J B;  5M5V A;  4ES0 A;  4BP9 A;  1OLZ A;  2VDP A;  3V4V A;  1PI6 A;  2AH0 A;  2VDQ A;  3EI1 A;  3IUM A;  5HYN B;  1VYH C;  4K3I D;  3ZWL B;  2OVP B;  4JD2 C;  1JV2 A;  3IKO A;  3DWL C;  4Z8L A;  3SJL D;  5JWZ A;  3DXM C;  1QNI A;  5TEE A;  3V9F A;  2G99 A;  1A0R B;  2YNO A;  1UOP A;  2VDN A;  2PM7 B;  2J55 H;  3SLE D;  4UM8 A;  2AGY A;  1Q47 A;  5THA A;  2VZ1 A;  4A2L A;  4A7J A;  2Z2O A;  3ZDY A;  4CY5 A;  3BWS A;  5GXH A;  1H2X A;  3K26 A;  4J82 A;  3SWS D;  4FA5 D;  4PXW A;  4JHN A;  4O02 A;  3O4H A;  2OIZ A;  3RFG A;  1SQJ A;  2P9S C;  4RE5 A;  5TF2 A;  4ERZ A;  5C2V B;  5CYK A;  2XYI A;  4TZ4 A;  3DDU A;  4CC9 A;  3OTT A;  3J80 g;  3CIK B;  3MZL A;  2QZP A;  4ZOV A;  1H2Y A;  5EML B;  5E6R A;  2OK6 A;  2Q7Q A;  5EM2 A;  3SXT D;  4WK2 A;  4G1M A;  5AJA A;  1JOF A;  3C5M A;  4FA1 D;  5FLX g;  2VC2 A;  3AL8 A;  3OF7 A;  2HU7 A;  4LGN A;  1I2M B;  1UOO A;  4NBM A;  3JPX A;  2H6N A;  4IA9 A;  3UR4 A;  3MKS B;  4GGC A;  3W15 A;  4H5J A;  3JZN A;  4A09 B;  3VI3 A;  1GOF A;  1O6F A;  4BP8 A;  4CY2 A;  3C75 H;  4L3H D;  4WK0 A;  5H14 A;  4A0A A;  1PEV A;  3AFC A;  4GQ2 P;  4L3G D;  5HDB A;  1B9X A;  3ULE C;  5TEF A;  4PBY A;  5KDO B;  3NIG A;  3PVU B;  5IGO A;  3GD1 I;  3PXW D;  2AGZ A;  3IIW A;  3I89 A;  5EAP A;  5I5J A;  4GM9 A;  4QAM A;  3OKW A;  4GZ8 A;  2XDW A;  5FKQ A;  3PVW B;  4QQE A;  3EQ8 A;  4AOW A;  4BCC A;  5A2Q g;  5GXI A;  5C86 A;  3FCS A;  3RRM C;  3QI0 A;  2PM6 B;  4KFM B;  3I2N A;  4J81 A;  4J73 A;  4BL0 A;  5IT9 g;  4MMZ A;  4IRZ A;  4IMM A;  2B5N A;  5HE0 B;  2IAA A;  3N0D A;  5GMK n;  3K71 A;  2HU5 A;  4O1Q D;  1H2Z A;  2OVR B;  4J8B A;  2VDO A;  5E6S A;  2PM9 B;  2VDK A;  3ZDX A;  2OJY A;  2UZX B;  3I7H A;  4AEZ A;  3OL2 B;  3V7D B;  4X61 B;  2CN2 A;  4U7A A;  4GGD A;  4NC4 A;  2QC5 A;  2EIE A;  5CXC B;  2EIB A;  3UKR C;  1PBY B;  4E5Z A;  4MK0 B;  4NEN A;  4FWW A;  1UTC A;  5M5R A;  3UVL A;  4J0X A;  4JSV C;  3SFZ A;  3MXX A;  4A0B A;  1B9Y A;  3PSC B;  2J57 G;  5EMJ B;  1NR0 A;  4Z7Q A;  5SXM A;  2BCJ B;  4X63 B;  3SBR A;  2H6Q A;  3T3P A;  1QFS A;  3K72 A;  1GXR A;  3IUQ A;  4DNV A;  4CZY A;  3ZDZ A;  2EBS A;  3F3G A;  2IWF A;  2B4E A;  1GOG A;  2HJB A;  1RI6 A;  4ZN4 A;  2CNX A;  3IUN A;  1TYQ C;  4MMX A;  3EQ7 A;  5IC7 A;  2XE4 A;  3UKU C;  2EID A;  1N6D A;  4J84 A;  4G56 B;  1C9I A;  2VZ3 A;  1SHY B;  4G55 A;  3T3M A;  4L1Q D;  5B4W A;  4CI8 A;  1U8C A;  1P22 A;  4D0K A;  5C92 A;  4JHP C;  2CN3 A;  5EAR A;  1BPO A;  2QXV A;  5CXB B;  2GC4 A;  3MKQ A;  2H68 A;  2JKX A;  2TRC B;  3KRX B;  4O2W A;  1K8K C;  4AX4 A;  3UVO A;  2AGL A;  4WK4 A;  2IUQ A;  2OVQ B;  2I3T A;  2AH1 A;  2BBK H;  1U4C A;  5CYK B;  5IGQ A;  2BKL A;  2WQ8 A;  3N0E A;  1E8N A;  4NAA A;  4PSX B;  3DSM A;  5HE1 B;  3CFS B;  4E5Z B;  2AGX A;  4OZU A;  1OMW B;  1N6F A;  2GC7 A;  3V4P A;  3EI4 B;  4O3T B;  3NIF A;  3VH0 A;  1L5G A;  5FKS A;  4X3E A;  3JRO A;  3JZG A;  1MG3 A;  2IUV A;  4CY1 A;  2PM9 A;  5M5S A;  2H47 A;  4OWR A;  3OKY A;  4AN1 A;  3E0C A;  3ZE2 A;  3RN1 D;  4O3U B;  5H1M A;  2CO0 A;  3SBP A;  5FFO A;  1JMZ B;  2I3S A;  3SBQ A;  4JSN C;  3VGZ A;  3UVM A;  2OK4 A;  5GSA A;  5E6U A;  4AN0 A;  4A0A B;  4J8G A;  4GMB A;  4N14 A;  3MUN A;  5FA5 B;  4DNW A;  1FWX A;  1H2W A;  3IVM A;  1XHM A;  3IUR A;  3EG6 A;  3I7P A;  2H9M A;  3AH8 B;  3L4M D;  4A11 A;  4FAV D;  3P4F A;  4HDJ A;  4CI1 A;  3IUJ A;  5HE3 B;  1YFQ A;  4GQB B;  4JXM A;  3SVW D;  3DXK C;  4D6V A;  3EI3 A;  5CXB A;  3O4G A;  2XU7 A;  3KCI A;  3I7N A;  1ERJ A;  2W18 A;  2VDR A;  3VA6 A;  3A0F A;  3VI4 A;  4Z7N A;  3HFQ A;  2QR5 A;  5FQD A;  4J87 A;  5I5M A;  4A08 B;  5FFG A;  2YB8 B;  3GRE A;  2IWK A;  4E54 B;  1TBG A;  3EWE A;  4GM8 A;  5FXY A;  2H6K A;  3IJE A;  4CZX A;  2MTA H;  1GOH A;  5EAM A;  3L4O D;  4JSP C;  4I79 A;  3BG1 A;  3MUO A;  4FHL A;  1U2V C;  2H9L A;  3NVX A;  4PNK B;  4Y5R D;  5HQG A;  4JT5 C;  4O9D A;  4FB1 D;  1K3I A;  1VE6 A;  2G9A A;  3ODT A;  3AL9 A;  4D9S A;  2Z2P A;  3JAM g;  4GGA A;  3OW8 A;  4ZOZ A;  3EI2 B;  4RE6 A;  1VE7 A;  2HYE A;  3NID A;  1T2X A;  3IIY A;  5IJ7 E;  2CO0 C;  3EI1 B;  5M5U A;  4BUJ C;  4ZOY A;  2YNN A;  2XZG A;  2UZY B;  4UI9 R;  4WJK A;  4BH6 A;  3EI4 A;  4A2M A;  2P9L C;  4J79 A;  4PBZ A;  4LG9 A;  3C99 A;  3JRP A;  1A12 A;  3RLM D;  1M1X A;  2H9N A;  1GP2 B;  1L0Q A;  2O9K A;  3PE7 A;  1MG2 A;  1XIP A;  2CE9 A;  3SN6 B;  2I0S A;  2HKM A;  4A11 B;  5FKR A;  1NEX B;  1QFM A;  4EWR A;  2XL2 A;  2YMU A;  3ZE1 A;  4J0W A;  4JT6 C;  3NVN A;  4U1E I;  3QHY B;  1GG2 B;  2B5L A;  2IUR A;  3PSL A;  5IJ8 E;  3ORV D;  1GOT B;  2J56 H;  4H5I A;  3I7L A; 
#chains in the Genus database with same CATH homology
 5AFU 3;  3GFC A;  3C9C A;  4E54 A;  4J77 A;  5EAL A;  3SMR A;  3I7O A;  3NVQ A;  1R5M A;  1JJU B;  4J78 A;  3OKY B;  5EMK B;  3FM0 A;  3I7K A;  1K32 A;  1S4U X;  3B7F A;  2H13 A;  4YVD A;  4ERY A;  2PBI B;  2YBA A;  3PXS D;  3JZH A;  3KRW B;  5FKT A;  4QRJ A;  4GQ1 A;  4XYH A;  1SQ9 A;  4CI2 A;  3FGB A;  3UVN A;  4XEI C;  3F3P A;  4O45 A;  3PXT D;  2HJ4 A;  5EM2 B;  5K19 A;  3SHF A;  2P9I C;  4XYI A;  3V5W B;  4CY3 A;  3FRX A;  2HXC A;  3RN0 D;  2AQ5 A;  1XKS A;  3OKT A;  4CZV A;  3RSE C;  4R7A B;  1MDA H;  2P9N C;  3EI3 B;  2AGW A;  4QL1 A;  4ZOX A;  4L9O A;  3J81 g;  4Y7R A;  2B5M A;  2CE8 A;  1N6E A;  3IJ0 A;  4A09 A;  3UVK A;  4A08 A;  3EMH A;  2H3X A;  4ERQ A;  4FAN D;  4FA9 D;  4LG8 A;  4ESG A;  5EMM B;  3MZK A;  4J86 A;  4JSX C;  4PSW B;  4QT8 A;  2GNQ A;  5K1C C;  3RFH A;  4PC0 A;  5C2W B;  3IJ1 A;  3RMZ D;  2P9U C;  5HE2 B;  3F3F A;  4FA4 D;  5I5I A;  3AL8 B;  3U4Y A;  3I8E A;  3CFV A;  3EI2 A;  2HES X;  2XL3 A;  3OL2 A;  3DM0 A;  2HKR A;  5CXC A;  3I8C A;  3MMY A;  3EU7 A;  5H17 A;  4GM3 A;  1PGU A;  4CI3 A;  4A0B B;  5C9Z B;  2H9P A;  2YNP A;  3IJC A;  3JB9 L;  2P9P C;  5TDH B;  2I0R A;  2IUP A;  2Z2N A;  2H14 A;  3BG0 A;  3K27 A;  4NSX A;  1JMX B;  2P9K C;  4X60 B;  3SCY A;  2I0T A;  5AMS A;  4K3J B;  4ES0 A;  1OLZ A;  1PI6 A;  2AH0 A;  3EI1 A;  5HYN B;  1VYH C;  4K3I D;  3ZWL B;  2OVP B;  4JD2 C;  3IKO A;  3DWL C;  4Z8L A;  3SJL D;  5JWZ A;  3DXM C;  1QNI A;  5TEE A;  3V9F A;  2G99 A;  1A0R B;  2YNO A;  2PM7 B;  2J55 H;  3SLE D;  2AGY A;  1Q47 A;  5THA A;  4A2L A;  4A7J A;  2Z2O A;  4CY5 A;  3BWS A;  5GXH A;  3K26 A;  4J82 A;  3SWS D;  4FA5 D;  4PXW A;  2OIZ A;  3RFG A;  1SQJ A;  2P9S C;  5TF2 A;  4ERZ A;  5C2V B;  5CYK A;  2XYI A;  4TZ4 A;  4CC9 A;  3OTT A;  3J80 g;  3CIK B;  3MZL A;  4ZOV A;  5EML B;  2OK6 A;  2Q7Q A;  5EM2 A;  3SXT D;  5AJA A;  1JOF A;  3C5M A;  4FA1 D;  5FLX g;  3AL8 A;  4LGN A;  3JPX A;  2H6N A;  4IA9 A;  3UR4 A;  3MKS B;  4GGC A;  3W15 A;  4H5J A;  3JZN A;  4A09 B;  4CY2 A;  3C75 H;  4L3H D;  5H14 A;  4A0A A;  1PEV A;  3AFC A;  4GQ2 P;  4L3G D;  1B9X A;  3ULE C;  5TEF A;  4PBY A;  5KDO B;  3PVU B;  5IGO A;  3PXW D;  2AGZ A;  3IIW A;  3I89 A;  5EAP A;  5I5J A;  4GM9 A;  3OKW A;  4GZ8 A;  5FKQ A;  3PVW B;  4QQE A;  4AOW A;  5A2Q g;  5GXI A;  3RRM C;  2PM6 B;  4KFM B;  3I2N A;  4J81 A;  4J73 A;  4BL0 A;  5IT9 g;  4IMM A;  2B5N A;  5HE0 B;  2IAA A;  3N0D A;  5GMK n;  4O1Q D;  2OVR B;  4J8B A;  2PM9 B;  2OJY A;  2UZX B;  3I7H A;  4AEZ A;  3OL2 B;  3V7D B;  4X61 B;  2CN2 A;  4U7A A;  4GGD A;  2QC5 A;  5CXC B;  3UKR C;  1PBY B;  4E5Z A;  4MK0 B;  4FWW A;  3UVL A;  4J0X A;  4JSV C;  3SFZ A;  3MXX A;  4A0B A;  1B9Y A;  3PSC B;  2J57 G;  5EMJ B;  1NR0 A;  5SXM A;  2BCJ B;  4X63 B;  3SBR A;  2H6Q A;  1GXR A;  4CZY A;  2EBS A;  3F3G A;  2IWF A;  2B4E A;  2HJB A;  1RI6 A;  4ZN4 A;  2CNX A;  1TYQ C;  5IC7 A;  3UKU C;  1N6D A;  4J84 A;  4G56 B;  1SHY B;  4L1Q D;  5B4W A;  4CI8 A;  1P22 A;  4D0K A;  2CN3 A;  5EAR A;  2QXV A;  5CXB B;  2GC4 A;  3MKQ A;  2H68 A;  2TRC B;  3KRX B;  1K8K C;  3UVO A;  2AGL A;  2IUQ A;  2OVQ B;  2I3T A;  2AH1 A;  2BBK H;  1U4C A;  5CYK B;  5IGQ A;  3N0E A;  4PSX B;  3DSM A;  5HE1 B;  3CFS B;  4E5Z B;  2AGX A;  4OZU A;  1OMW B;  1N6F A;  2GC7 A;  3EI4 B;  4O3T B;  3VH0 A;  5FKS A;  4X3E A;  3JRO A;  3JZG A;  1MG3 A;  2IUV A;  4CY1 A;  2PM9 A;  2H47 A;  4OWR A;  3OKY A;  3E0C A;  3RN1 D;  4O3U B;  5H1M A;  2CO0 A;  3SBP A;  1JMZ B;  2I3S A;  3SBQ A;  4JSN C;  3VGZ A;  3UVM A;  2OK4 A;  5GSA A;  4A0A B;  4J8G A;  4GMB A;  4N14 A;  5FA5 B;  1FWX A;  1XHM A;  3EG6 A;  3I7P A;  2H9M A;  3AH8 B;  3L4M D;  4A11 A;  4FAV D;  3P4F A;  4HDJ A;  4CI1 A;  5HE3 B;  1YFQ A;  4GQB B;  4JXM A;  3SVW D;  3DXK C;  4D6V A;  3EI3 A;  5CXB A;  2XU7 A;  3I7N A;  1ERJ A;  2W18 A;  3VA6 A;  3A0F A;  3HFQ A;  5FQD A;  4J87 A;  5I5M A;  4A08 B;  2YB8 B;  3GRE A;  2IWK A;  4E54 B;  1TBG A;  3EWE A;  4GM8 A;  5FXY A;  2H6K A;  4CZX A;  2MTA H;  5EAM A;  3L4O D;  4JSP C;  4I79 A;  3BG1 A;  4FHL A;  1U2V C;  2H9L A;  3NVX A;  4PNK B;  4Y5R D;  5HQG A;  4JT5 C;  4O9D A;  4FB1 D;  2G9A A;  3ODT A;  3AL9 A;  2Z2P A;  3JAM g;  4GGA A;  3OW8 A;  4ZOZ A;  3EI2 B;  2HYE A;  3IIY A;  5IJ7 E;  2CO0 C;  3EI1 B;  4BUJ C;  4ZOY A;  2YNN A;  2UZY B;  4UI9 R;  4BH6 A;  3EI4 A;  4A2M A;  2P9L C;  4J79 A;  4PBZ A;  4LG9 A;  3C99 A;  3JRP A;  3RLM D;  2H9N A;  1GP2 B;  1L0Q A;  2O9K A;  3PE7 A;  1MG2 A;  1XIP A;  2CE9 A;  3SN6 B;  2I0S A;  2HKM A;  4A11 B;  5FKR A;  1NEX B;  4EWR A;  2XL2 A;  2YMU A;  4J0W A;  4JT6 C;  3NVN A;  4U1E I;  1GG2 B;  2B5L A;  2IUR A;  3PSL A;  5IJ8 E;  3ORV D;  1GOT B;  2J56 H;  4H5I A;  3I7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...