5HQGA

Wd40 domain of human e3 ubiquitin ligase cop1 (rfwd2)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
341
structure length
324
Chain Sequence
b'EFQECLSKFTRYNSVRPLATLSYALYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RFWD2
publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 324
sequence length 341
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5hqgA00
5TF2A 1JJUB 5B4WA 5FQDA 4PXWA 1XIPA 4CC9A 4CI8A 4LG8A 3PVWB 3V5WB 1FWXA 3PXTD 4PSWB 1MG3A 4J81A 3CIKB 4ZOZA 2I0TA 2J55H 4GM8A 3UVLA 5H1MA 4CI1A 4GGDA 3KRXB 4PNKB 2H9MA 5C2VB 4O9DA 2AH0A 2H47A 5TEEA 5IJ8E 4X61B 4NSXA 2AQ5A 3ORVD 2P9IC 4J82A 2QXVA 3EWEA 2H9PA 2BCJB 5HE1B 3OKTA 5C9ZB 2OVRB 5FA5B 1PI6A 3SLED 1S4UX 5H14A 3RN1D 3MXXA 4FAND 4GQBB 4FA1D 3K26A 4GMBA 2HKMA 4A11A 4ES0A 2H6NA 5EAMA 4G56B 3MZLA 2XL2A 3GREA 1TBGA 3EI2A 5AFU3 3RLMD 5EMMB 4H5JA 2H6QA 2Z2OA 2I0SA 3SHFA 3VH0A 3ULEC 1YFQA 1TYQC 5GSAA 3C75H 3I7OA 4CI3A 2HJ4A 3JAMg 2I3SA 4J87A 4PBZA 5EMJB 3RMZD 2Z2PA 1PGUA 5THAA 3PE7A 3J81g 2J57G 5CXBA 2EBSA 4A09B 2BBKH 4CZXA 2H6KA 3I7PA 4O45A 4JSVC 1A0RB 4FWWA 5CYKB 2HESX 4GM3A 2IWKA 3IIWA 3N0DA 4JT5C 3C99A 4IMMA 5HE2B 3U4YA 4LG9A 3EI3A 1MDAH 1VYHC 5I5MA 4A11B 3W15A 3OKYA 5GMKn 3L4MD 3EI4B 3EI1A 3DSMA 2CE9A 1MG2A 4GGCA 3PVUB 4CZYA 5C2WB 2PM9A 2TRCB 1XKSA 2GC7A 4JD2C 5CXCA 3IJ0A 3BWSA 3MZKA 1B9XA 4R7AB 4JXMA 1K32A 3I7KA 3UKUC 1R5MA 5JWZA 4CY3A 4XEIC 3JB9L 2CN2A 1PEVA 4OZUA 4PBYA 1GOTB 4J79A 4X60B 4A0AB 4JSPC 4QQEA 5K19A 3OL2B 2O9KA 3V9FA 4MK0B 2W18A 2GC4A 3VGZA 2CN3A 2H3XA 5K1CC 3J80g 2OVQB 2PM7B 1U4CA 3AL8B 3OTTA 3UR4A 4KFMB 4OWRA 4EWRA 1GP2B 4A08B 4ZOYA 3EI1B 4J0XA 2HXCA 5EALA 4FHLA 2B4EA 2I3TA 3IKOA 4U7AA 1SHYB 5EM2B 1RI6A 2YB8B 3B7FA 2AGXA 3UVKA 2HJBA 4A2LA 1B9YA 2H9NA 2P9NC 3IJ1A 4JSXC 3K27A 3SMRA 3F3PA 4XYHA 3FRXA 1SQ9A 4ERZA 3NVXA 4FB1D 2HYEA 4E54A 1GXRA 3MMYA 4CY2A 4J86A 4O3TB 4AEZA 3CFSB 4D6VA 2P9SC 5A2Qg 5FKRA 4J78A 3RRMC 5SXMA 3HFQA 2IUQA 3ZWLB 2P9KC 4Y7RA 1QNIA 5TEFA 3FGBA 3EG6A 4K3ID 3A0FA 1U2VC 4CY5A 3SCYA 2YMUA 3RSEC 5EAPA 4Y5RD 3PXWD 2YNPA 4BL0A 1NEXB 3DXMC 3I8CA 3PXSD 1JMZB 1N6DA 3NVNA 3JPXA 2H13A 2XYIA 5FKSA 5KDOB 2UZXB 4YVDA 4A7JA 3DWLC 5GXIA 3RFGA 2OK6A 4J73A 5EMKB 1Q47A 4CI2A 3DM0A 4J0WA 3EI2B 3BG0A 4E54B 4FA9D 3UVMA 4CY1A 4ZN4A 4J8BA 4TZ4A 4QRJA 2YNNA 2H9LA 4QL1A 1N6EA 3RN0D 2PBIB 4K3JB 4PC0A 4J8GA 3CFVA 3GFCA 5IJ7E 3FM0A 5EARA 4ERQA 5CXBB 5AJAA 3E0CA 4JSNC 1N6FA 2P9LC 2AGYA 3JZHA 4H5IA 5FLXg 4E5ZA 3NVQA 1K8KC 2Q7QA 4U1EI 5HE3B 3IIYA 3PSCB 1PBYB 3UKRC 4LGNA 3N0EA 3I7NA 4GQ2P 2GNQA 5H17A 4Z8LA 4GZ8A 3MKQA 1XHMA 1JOFA 2AH1A 3EU7A 3SVWD 3EI3B 3UVNA 3C9CA 4BUJC 3I2NA 2HKRA 3OKYB 1SQJA 4AOWA 5GXHA 4ESGA 2B5LA 2IUPA 2PM9B 3KRWB 4XYIA 4HDJA 2B5MA 5CXCB 2XU7A 3I7LA 2IWFA 2AGWA 3AFCA 4A09A 1NR0A 2AGLA 4FA5D 2P9PC 3OW8A 3P4FA 3RFHA 3OKWA 1P22A 4A2MA 5IT9g 5HE0B 5CYKA 4J77A 5I5JA 4E5ZB 5HQGA 2CO0A 4GGAA 2UZYB 3EMHA 3SWSD 4L3HD 3BG1A 5HYNB 4J84A 3SFZA 2H14A 4ZOVA 4ZOXA 4L3GD 3VA6A 4FA4D 4JT6C 3UVOA 5I5IA 2G99A 3C5MA 4X63B 4A0BA 3EI4A 3JROA 2B5NA 2P9UC 4BH6A 5FKTA 4O1QD 2OK4A 2Z2NA 1OMWB 5IC7A 3IJCA 5TDHB 2AGZA 2MTAH 3F3GA 2YNOA 4GQ1A 2IUVA 3V7DB 3SBPA 4FAVD 2H68A 2J56H 2QC5A 2PM6B 2YBAA 5EMLB 3AL9A 2IAAA 3MKSB 4A0AA 3PSLA 2XL3A 3JRPA 3L4OD 5IGQA 3OL2A 3I8EA 1JMXB 3I7HA 5IGOA 2CE8A 5AMSA 1OLZA 3SBRA 4PSXB 2OIZA 1GG2B 2G9AA 2OJYA 5FKQA 3AL8A 4UI9R 2CO0C 1ERJA 3F3FA 3JZNA 3ODTA 3SXTD 4N14A 2I0RA 4QT8A 4D0KA 2CNXA 3DXKC 4GM9A 4A0BB 4A08A 4I79A 1L0QA 3SBQA 3AH8B 4ERYA 2IURA 5FXYA 4L9OA 4CZVA 5EM2A 4IA9A 3SN6B 3SJLD 4O3UB 2OVPB 3JZGA 4L1QD 3I89A 4X3EA
chains in the Genus database with same CATH superfamily
5TF2A 2VDQA 1JJUB 5B4WA 5FQDA 4PXWA 1YR2A 1XIPA 4CC9A 4CI8A 4LG8A 3PVWB 3V5WB 1FWXA 3PXTD 4RE6A 4PSWB 4WJKA 1MG3A 4J81A 1VE6A 5M5RA 1A12A 3CIKB 4ZOZA 2I0TA 2J55H 4GM8A 3UVLA 5H1MA 4CI1A 4GGDA 3KRXB 4PNKB 3IUQA 2H9MA 5C2VB 4O9DA 2AH0A 2H47A 5TEEA 5IJ8E 4X61B 3EQ9A 4NSXA 2AQ5A 3ORVD 2P9IC 4J82A 2QXVA 3EWEA 4IRZA 2H9PA 2BCJB 5HE1B 3OKTA 5C9ZB 2OVRB 5FA5B 1PI6A 1C9LA 2VDRA 3SLED 1S4UX 5H14A 3RN1D 3MXXA 4FAND 4GQBB 4FA1D 3K26A 4GMBA 4NC4A 3KCIA 2HKMA 4AMZA 4A11A 4ES0A 1JV2A 2H6NA 5EAMA 4G56B 3MZLA 2XL2A 3GREA 1TBGA 3EI2A 5AFU3 3RLMD 5EMMB 4H5JA 1GOGA 2H6QA 4JHNA 2Z2OA 2I0SA 3SHFA 3T3PA 3VH0A 3ULEC 1YFQA 1TYQC 5GSAA 1E8NA 3C75H 3I7OA 4CI3A 1H2ZA 2HJ4A 3JAMg 2I3SA 4J87A 4PBZA 5EMJB 3RMZD 2XE4A 5M5VA 2Z2PA 1PGUA 4BCDA 5THAA 3PE7A 3J81g 2J57G 5CXBA 1U8CA 2EBSA 4A09B 2BBKH 4CZXA 3ZDYA 2H6KA 3I7PA 4O45A 2VC2A 4JSVC 1A0RB 1VZ2A 4FWWA 3O4GA 5CYKB 2HESX 4GM3A 1GOHA 4G1EA 2IWKA 3IIWA 3K6SA 3N0DA 4JT5C 3C99A 4IMMA 5HE2B 3U4YA 4LG9A 2HU7A 3EI3A 1MDAH 1VYHC 3EQ8A 5I5MA 4A11B 3W15A 3OKYA 5GMKn 3L4MD 3EI4B 3EI1A 3DSMA 2CE9A 1MG2A 4GGCA 3PVUB 4CZYA 5C2WB 2PM9A 2TRCB 1XKSA 2GC7A 4JD2C 5CXCA 3IJ0A 4BCCA 3BWSA 4BP8A 3MZKA 1B9XA 2EIEA 4R7AB 4JXMA 1K32A 3I7KA 3UKUC 1R5MA 3OF7A 5JWZA 4JHPC 4CY3A 4XEIC 3JB9L 4WK2A 2CN2A 1PEVA 4OZUA 4PBYA 3MUNA 1GOTB 4J79A 4X60B 4A0AB 1M1XA 2VDMA 4JSPC 4QQEA 5K19A 3MUOA 3OL2B 2O9KA 3V9FA 3O4IA 4MK0B 2W18A 2GC4A 3VGZA 1I2MB 4O02A 2CN3A 2H3XA 5K1CC 4G55A 4O2WA 3J80g 2OVQB 2PM7B 1U4CA 3AL8B 3OTTA 4MMZA 3UR4A 4KFMB 5E6RA 4OWRA 3FCSA 4EWRA 2VDPA 1GP2B 4A08B 4UM8A 2EIDA 4ZOYA 3EI1B 4J0XA 2HXCA 5EALA 4FHLA 2B4EA 2I3TA 3IKOA 4AX4A 4U7AA 1SHYB 5FFOA 5EM2B 4RE5A 1RI6A 2YB8B 3B7FA 3IUMA 2AGXA 3UVKA 2HJBA 4A2LA 2VZ1A 1B9YA 2H9NA 2P9NC 3IJ1A 4JSXC 3VI3A 3K27A 3SMRA 3F3PA 3ZE1A 5C86A 1UOPA 4XYHA 3FRXA 2VDLA 1SQ9A 5C92A 4ERZA 3NVXA 4FB1D 2HYEA 4E54A 4DNWA 1GXRA 3MMYA 4CY2A 4J86A 4O3TB 4AEZA 3CFSB 4D6VA 2P9SC 5A2Qg 5FKRA 4J78A 3RRMC 5SXMA 3HFQA 2IUQA 3ZWLB 3QHYB 2P9KC 4Y7RA 4BCBA 1QNIA 5TEFA 3FGBA 2QR5A 3V4PA 2HU8A 3EG6A 4K3ID 3A0FA 1U2VC 4CY5A 3SCYA 2YMUA 3RSEC 5EAPA 4Y5RD 1VE7A 1GOFA 2YNPA 3PXWD 4BL0A 1NEXB 3DXMC 3I8CA 3PXSD 5M5TA 1JMZB 1N6DA 3NVNA 3JPXA 3ZDXA 2H13A 2XYIA 5FKSA 5KDOB 3IVMA 3V4VA 2UZXB 3FCUA 4QAMA 4YVDA 4A7JA 3DWLC 5M5SA 4UM9A 1H2XA 5GXIA 3RFGA 2OK6A 4J73A 5EMKB 1Q47A 1O6FA 4CI2A 3DM0A 3IJEA 3DDUA 4J0WA 4WK4A 3EI2B 3NIDA 3BG0A 5E6UA 4E54B 5FFGA 4DNUA 4FA9D 3UVMA 4CY1A 4ZN4A 4J8BA 4TZ4A 3IUNA 2XZGA 4QRJA 4MMXA 3NIFA 2YNNA 2H9LA 4QL1A 1O6GA 1N6EA 3RN0D 3IUJA 2PBIB 4K3JB 4PC0A 4Z7OA 1L5GA 4J8GA 3CFVA 3GFCA 5IJ7E 3FM0A 5EARA 4ERQA 5CXBB 5AJAA 3E0CA 4JSNC 1N6FA 3ZDZA 2P9LC 2AGYA 3IURA 2VDOA 3JZHA 5M61A 1T2XA 4H5IA 5FLXg 4E5ZA 3NVQA 1K8KC 2Q7QA 4MMYA 4AN1A 4U1EI 5HE3B 3IIYA 3ZE2A 3PSCB 1PBYB 3UKRC 4LGNA 3N0EA 3I7NA 4GQ2P 3GC3B 2GNQA 5H17A 4Z8LA 4GZ8A 3MKQA 1XHMA 1JOFA 2AH1A 3EU7A 3SVWD 4WK0A 3EI3B 3UVNA 3C9CA 4BUJC 3I2NA 2HKRA 3OKYB 1SQJA 4AOWA 5GXHA 3O4HA 2VZ3A 4ESGA 2B5LA 2IUPA 2PM9B 3KRWB 4XYIA 4HDJA 4Z7NA 2B5MA 2WQ8A 3QI0A 5CXCB 2XU7A 3I7LA 2XDWA 3GD1I 1BPOA 2IWFA 3O4JA 2AGWA 4G1MA 3AFCA 1UOQA 4A09A 1NR0A 2AGLA 4FA5D 2P9PC 3OW8A 3P4FA 3RFHA 3OKWA 1P22A 4A2MA 3VI4A 5IT9g 3EQ7A 5HE0B 2JKXA 5CYKA 4J77A 2EIBA 5I5JA 4E5ZB 2VDKA 5HQGA 2CO0A 4GGAA 4NBMA 2UZYB 1K3IA 3EMHA 3SWSD 4L3HD 3BG1A 5HYNB 4J84A 3SFZA 2H14A 1UOOA 4ZOVA 4ZOXA 4L3GD 3VA6A 4AN0A 4JT6C 3UVOA 4FA4D 5I5IA 2G99A 3C5MA 4X63B 4A0BA 3EI4A 3JROA 2B5NA 5HDBA 2P9UC 4BH6A 2VDNA 5FKTA 4O1QD 2QZPA 2OK4A 4DNVA 2Z2NA 1OMWB 5IC7A 3IJCA 5TDHB 2AGZA 2MTAH 1JTDB 3F3GA 2YNOA 4GQ1A 2IUVA 3V7DB 3SBPA 4FAVD 2H68A 2J56H 2QC5A 4NAAA 2PM6B 2YBAA 5M5UA 3T3MA 5EMLB 3AL9A 2IAAA 3MKSB 3ZE0A 1QFMA 4A0AA 3PSLA 2XL3A 3JRPA 2HU5A 3K72A 3L4OD 5IGQA 3OL2A 3I8EA 1JMXB 1E8MA 3I7HA 2CE8A 5IGOA 1QFSA 4L1MA 5AMSA 1OLZA 3SBRA 4BP9A 4PSXB 2OIZA 1GG2B 3IULA 2G9AA 2OJYA 5FKQA 4D9SA 3AL8A 4UI9R 4AMYA 2CO0C 4NENA 1ERJA 3F3FA 3JZNA 3ODTA 3SXTD 4N14A 2I0RA 4QT8A 4D0KA 2CNXA 1E5TA 3DXKC 4GM9A 4A0BB 4A08A 4I79A 1L0QA 1TYEA 3NIGA 3SBQA 3AH8B 1H2YA 2EICA 4ERYA 1VZ3A 2IURA 4Z7QA 5FXYA 4L9OA 4CZVA 5EM2A 4IA9A 5E6SA 3SN6B 1H2WA 2BKLA 3SJLD 3MVDK 4O3UB 2OVPB 1C9IA 3JZGA 4L1QD 3I89A 4X3EA 3K71A 1UTCA
chains in the Genus database with same CATH topology
5TF2A 1JJUB 5B4WA 5FQDA 4PXWA 1XIPA 4CC9A 4CI8A 4LG8A 3PVWB 3V5WB 1FWXA 3PXTD 4PSWB 1MG3A 4J81A 3CIKB 4ZOZA 2I0TA 2J55H 4GM8A 3UVLA 5H1MA 4CI1A 4GGDA 3KRXB 4PNKB 2H9MA 5C2VB 4O9DA 2AH0A 2H47A 5TEEA 5IJ8E 4X61B 4NSXA 2AQ5A 3ORVD 2P9IC 4J82A 2QXVA 3EWEA 2H9PA 2BCJB 5HE1B 3OKTA 5C9ZB 2OVRB 5FA5B 1PI6A 3SLED 1S4UX 5H14A 3RN1D 3MXXA 4FAND 4GQBB 4FA1D 3K26A 4GMBA 2HKMA 4A11A 4ES0A 2H6NA 5EAMA 4G56B 3MZLA 2XL2A 3GREA 1TBGA 3EI2A 5AFU3 3RLMD 5EMMB 4H5JA 2H6QA 2Z2OA 2I0SA 3SHFA 3VH0A 3ULEC 1YFQA 1TYQC 5GSAA 3C75H 3I7OA 4CI3A 2HJ4A 3JAMg 2I3SA 4J87A 4PBZA 5EMJB 3RMZD 2Z2PA 1PGUA 5THAA 3PE7A 3J81g 2J57G 5CXBA 2EBSA 4A09B 2BBKH 4CZXA 2H6KA 3I7PA 4O45A 4JSVC 1A0RB 4FWWA 5CYKB 2HESX 4GM3A 2IWKA 3IIWA 3N0DA 4JT5C 3C99A 4IMMA 5HE2B 3U4YA 4LG9A 3EI3A 1MDAH 1VYHC 5I5MA 4A11B 3W15A 3OKYA 5GMKn 3L4MD 3EI4B 3EI1A 3DSMA 2CE9A 1MG2A 4GGCA 3PVUB 4CZYA 5C2WB 2PM9A 2TRCB 1XKSA 2GC7A 4JD2C 5CXCA 3IJ0A 3BWSA 3MZKA 1B9XA 4R7AB 4JXMA 1K32A 3I7KA 3UKUC 1R5MA 5JWZA 4CY3A 4XEIC 3JB9L 2CN2A 1PEVA 4OZUA 4PBYA 1GOTB 4J79A 4X60B 4A0AB 4JSPC 4QQEA 5K19A 3OL2B 2O9KA 3V9FA 4MK0B 2W18A 2GC4A 3VGZA 2CN3A 2H3XA 5K1CC 3J80g 2OVQB 2PM7B 1U4CA 3AL8B 3OTTA 3UR4A 4KFMB 4OWRA 4EWRA 1GP2B 4A08B 4ZOYA 3EI1B 4J0XA 2HXCA 5EALA 4FHLA 2B4EA 2I3TA 3IKOA 4U7AA 1SHYB 5EM2B 1RI6A 2YB8B 3B7FA 2AGXA 3UVKA 2HJBA 4A2LA 1B9YA 2H9NA 2P9NC 3IJ1A 4JSXC 3K27A 3SMRA 3F3PA 4XYHA 3FRXA 1SQ9A 4ERZA 3NVXA 4FB1D 2HYEA 4E54A 1GXRA 3MMYA 4CY2A 4J86A 4O3TB 4AEZA 3CFSB 4D6VA 2P9SC 5A2Qg 5FKRA 4J78A 3RRMC 5SXMA 3HFQA 2IUQA 3ZWLB 2P9KC 4Y7RA 1QNIA 5TEFA 3FGBA 3EG6A 4K3ID 3A0FA 1U2VC 4CY5A 3SCYA 2YMUA 3RSEC 5EAPA 4Y5RD 3PXWD 2YNPA 4BL0A 1NEXB 3DXMC 3I8CA 3PXSD 1JMZB 1N6DA 3NVNA 3JPXA 2H13A 2XYIA 5FKSA 5KDOB 2UZXB 4YVDA 4A7JA 3DWLC 5GXIA 3RFGA 2OK6A 4J73A 5EMKB 1Q47A 4CI2A 3DM0A 4J0WA 3EI2B 3BG0A 4E54B 4FA9D 3UVMA 4CY1A 4ZN4A 4J8BA 4TZ4A 4QRJA 2YNNA 2H9LA 4QL1A 1N6EA 3RN0D 2PBIB 4K3JB 4PC0A 4J8GA 3CFVA 3GFCA 5IJ7E 3FM0A 5EARA 4ERQA 5CXBB 5AJAA 3E0CA 4JSNC 1N6FA 2P9LC 2AGYA 3JZHA 4H5IA 5FLXg 4E5ZA 3NVQA 1K8KC 2Q7QA 4U1EI 5HE3B 3IIYA 3PSCB 1PBYB 3UKRC 4LGNA 3N0EA 3I7NA 4GQ2P 2GNQA 5H17A 4Z8LA 4GZ8A 3MKQA 1XHMA 1JOFA 2AH1A 3EU7A 3SVWD 3EI3B 3UVNA 3C9CA 4BUJC 3I2NA 2HKRA 3OKYB 1SQJA 4AOWA 5GXHA 4ESGA 2B5LA 2IUPA 2PM9B 3KRWB 4XYIA 4HDJA 2B5MA 5CXCB 2XU7A 3I7LA 2IWFA 2AGWA 3AFCA 4A09A 1NR0A 2AGLA 4FA5D 2P9PC 3OW8A 3P4FA 3RFHA 3OKWA 1P22A 4A2MA 5IT9g 5HE0B 5CYKA 4J77A 5I5JA 4E5ZB 5HQGA 2CO0A 4GGAA 2UZYB 3EMHA 3SWSD 4L3HD 3BG1A 5HYNB 4J84A 3SFZA 2H14A 4ZOVA 4ZOXA 4L3GD 3VA6A 4FA4D 4JT6C 3UVOA 5I5IA 2G99A 3C5MA 4X63B 4A0BA 3EI4A 3JROA 2B5NA 2P9UC 4BH6A 5FKTA 4O1QD 2OK4A 2Z2NA 1OMWB 5IC7A 3IJCA 5TDHB 2AGZA 2MTAH 3F3GA 2YNOA 4GQ1A 2IUVA 3V7DB 3SBPA 4FAVD 2H68A 2J56H 2QC5A 2PM6B 2YBAA 5EMLB 3AL9A 2IAAA 3MKSB 4A0AA 3PSLA 2XL3A 3JRPA 3L4OD 5IGQA 3OL2A 3I8EA 1JMXB 3I7HA 5IGOA 2CE8A 5AMSA 1OLZA 3SBRA 4PSXB 2OIZA 1GG2B 2G9AA 2OJYA 5FKQA 3AL8A 4UI9R 2CO0C 1ERJA 3F3FA 3JZNA 3ODTA 3SXTD 4N14A 2I0RA 4QT8A 4D0KA 2CNXA 3DXKC 4GM9A 4A0BB 4A08A 4I79A 1L0QA 3SBQA 3AH8B 4ERYA 2IURA 5FXYA 4L9OA 4CZVA 5EM2A 4IA9A 3SN6B 3SJLD 4O3UB 2OVPB 3JZGA 4L1QD 3I89A 4X3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TF2 A;  1JJU B;  5B4W A;  5FQD A;  4PXW A;  1XIP A;  4CC9 A;  4CI8 A;  4LG8 A;  3PVW B;  3V5W B;  1FWX A;  3PXT D;  4PSW B;  1MG3 A;  4J81 A;  3CIK B;  4ZOZ A;  2I0T A;  2J55 H;  4GM8 A;  3UVL A;  5H1M A;  4CI1 A;  4GGD A;  3KRX B;  4PNK B;  2H9M A;  5C2V B;  4O9D A;  2AH0 A;  2H47 A;  5TEE A;  5IJ8 E;  4X61 B;  4NSX A;  2AQ5 A;  3ORV D;  2P9I C;  4J82 A;  2QXV A;  3EWE A;  2H9P A;  2BCJ B;  5HE1 B;  3OKT A;  5C9Z B;  2OVR B;  5FA5 B;  1PI6 A;  3SLE D;  1S4U X;  5H14 A;  3RN1 D;  3MXX A;  4FAN D;  4GQB B;  4FA1 D;  3K26 A;  4GMB A;  2HKM A;  4A11 A;  4ES0 A;  2H6N A;  5EAM A;  4G56 B;  3MZL A;  2XL2 A;  3GRE A;  1TBG A;  3EI2 A;  5AFU 3;  3RLM D;  5EMM B;  4H5J A;  2H6Q A;  2Z2O A;  2I0S A;  3SHF A;  3VH0 A;  3ULE C;  1YFQ A;  1TYQ C;  5GSA A;  3C75 H;  3I7O A;  4CI3 A;  2HJ4 A;  3JAM g;  2I3S A;  4J87 A;  4PBZ A;  5EMJ B;  3RMZ D;  2Z2P A;  1PGU A;  5THA A;  3PE7 A;  3J81 g;  2J57 G;  5CXB A;  2EBS A;  4A09 B;  2BBK H;  4CZX A;  2H6K A;  3I7P A;  4O45 A;  4JSV C;  1A0R B;  4FWW A;  5CYK B;  2HES X;  4GM3 A;  2IWK A;  3IIW A;  3N0D A;  4JT5 C;  3C99 A;  4IMM A;  5HE2 B;  3U4Y A;  4LG9 A;  3EI3 A;  1MDA H;  1VYH C;  5I5M A;  4A11 B;  3W15 A;  3OKY A;  5GMK n;  3L4M D;  3EI4 B;  3EI1 A;  3DSM A;  2CE9 A;  1MG2 A;  4GGC A;  3PVU B;  4CZY A;  5C2W B;  2PM9 A;  2TRC B;  1XKS A;  2GC7 A;  4JD2 C;  5CXC A;  3IJ0 A;  3BWS A;  3MZK A;  1B9X A;  4R7A B;  4JXM A;  1K32 A;  3I7K A;  3UKU C;  1R5M A;  5JWZ A;  4CY3 A;  4XEI C;  3JB9 L;  2CN2 A;  1PEV A;  4OZU A;  4PBY A;  1GOT B;  4J79 A;  4X60 B;  4A0A B;  4JSP C;  4QQE A;  5K19 A;  3OL2 B;  2O9K A;  3V9F A;  4MK0 B;  2W18 A;  2GC4 A;  3VGZ A;  2CN3 A;  2H3X A;  5K1C C;  3J80 g;  2OVQ B;  2PM7 B;  1U4C A;  3AL8 B;  3OTT A;  3UR4 A;  4KFM B;  4OWR A;  4EWR A;  1GP2 B;  4A08 B;  4ZOY A;  3EI1 B;  4J0X A;  2HXC A;  5EAL A;  4FHL A;  2B4E A;  2I3T A;  3IKO A;  4U7A A;  1SHY B;  5EM2 B;  1RI6 A;  2YB8 B;  3B7F A;  2AGX A;  3UVK A;  2HJB A;  4A2L A;  1B9Y A;  2H9N A;  2P9N C;  3IJ1 A;  4JSX C;  3K27 A;  3SMR A;  3F3P A;  4XYH A;  3FRX A;  1SQ9 A;  4ERZ A;  3NVX A;  4FB1 D;  2HYE A;  4E54 A;  1GXR A;  3MMY A;  4CY2 A;  4J86 A;  4O3T B;  4AEZ A;  3CFS B;  4D6V A;  2P9S C;  5A2Q g;  5FKR A;  4J78 A;  3RRM C;  5SXM A;  3HFQ A;  2IUQ A;  3ZWL B;  2P9K C;  4Y7R A;  1QNI A;  5TEF A;  3FGB A;  3EG6 A;  4K3I D;  3A0F A;  1U2V C;  4CY5 A;  3SCY A;  2YMU A;  3RSE C;  5EAP A;  4Y5R D;  3PXW D;  2YNP A;  4BL0 A;  1NEX B;  3DXM C;  3I8C A;  3PXS D;  1JMZ B;  1N6D A;  3NVN A;  3JPX A;  2H13 A;  2XYI A;  5FKS A;  5KDO B;  2UZX B;  4YVD A;  4A7J A;  3DWL C;  5GXI A;  3RFG A;  2OK6 A;  4J73 A;  5EMK B;  1Q47 A;  4CI2 A;  3DM0 A;  4J0W A;  3EI2 B;  3BG0 A;  4E54 B;  4FA9 D;  3UVM A;  4CY1 A;  4ZN4 A;  4J8B A;  4TZ4 A;  4QRJ A;  2YNN A;  2H9L A;  4QL1 A;  1N6E A;  3RN0 D;  2PBI B;  4K3J B;  4PC0 A;  4J8G A;  3CFV A;  3GFC A;  5IJ7 E;  3FM0 A;  5EAR A;  4ERQ A;  5CXB B;  5AJA A;  3E0C A;  4JSN C;  1N6F A;  2P9L C;  2AGY A;  3JZH A;  4H5I A;  5FLX g;  4E5Z A;  3NVQ A;  1K8K C;  2Q7Q A;  4U1E I;  5HE3 B;  3IIY A;  3PSC B;  1PBY B;  3UKR C;  4LGN A;  3N0E A;  3I7N A;  4GQ2 P;  2GNQ A;  5H17 A;  4Z8L A;  4GZ8 A;  3MKQ A;  1XHM A;  1JOF A;  2AH1 A;  3EU7 A;  3SVW D;  3EI3 B;  3UVN A;  3C9C A;  4BUJ C;  3I2N A;  2HKR A;  3OKY B;  1SQJ A;  4AOW A;  5GXH A;  4ESG A;  2B5L A;  2IUP A;  2PM9 B;  3KRW B;  4XYI A;  4HDJ A;  2B5M A;  5CXC B;  2XU7 A;  3I7L A;  2IWF A;  2AGW A;  3AFC A;  4A09 A;  1NR0 A;  2AGL A;  4FA5 D;  2P9P C;  3OW8 A;  3P4F A;  3RFH A;  3OKW A;  1P22 A;  4A2M A;  5IT9 g;  5HE0 B;  5CYK A;  4J77 A;  5I5J A;  4E5Z B;  5HQG A;  2CO0 A;  4GGA A;  2UZY B;  3EMH A;  3SWS D;  4L3H D;  3BG1 A;  5HYN B;  4J84 A;  3SFZ A;  2H14 A;  4ZOV A;  4ZOX A;  4L3G D;  3VA6 A;  4FA4 D;  4JT6 C;  3UVO A;  5I5I A;  2G99 A;  3C5M A;  4X63 B;  4A0B A;  3EI4 A;  3JRO A;  2B5N A;  2P9U C;  4BH6 A;  5FKT A;  4O1Q D;  2OK4 A;  2Z2N A;  1OMW B;  5IC7 A;  3IJC A;  5TDH B;  2AGZ A;  2MTA H;  3F3G A;  2YNO A;  4GQ1 A;  2IUV A;  3V7D B;  3SBP A;  4FAV D;  2H68 A;  2J56 H;  2QC5 A;  2PM6 B;  2YBA A;  5EML B;  3AL9 A;  2IAA A;  3MKS B;  4A0A A;  3PSL A;  2XL3 A;  3JRP A;  3L4O D;  5IGQ A;  3OL2 A;  3I8E A;  1JMX B;  3I7H A;  5IGO A;  2CE8 A;  5AMS A;  1OLZ A;  3SBR A;  4PSX B;  2OIZ A;  1GG2 B;  2G9A A;  2OJY A;  5FKQ A;  3AL8 A;  4UI9 R;  2CO0 C;  1ERJ A;  3F3F A;  3JZN A;  3ODT A;  3SXT D;  4N14 A;  2I0R A;  4QT8 A;  4D0K A;  2CNX A;  3DXK C;  4GM9 A;  4A0B B;  4A08 A;  4I79 A;  1L0Q A;  3SBQ A;  3AH8 B;  4ERY A;  2IUR A;  5FXY A;  4L9O A;  4CZV A;  5EM2 A;  4IA9 A;  3SN6 B;  3SJL D;  4O3U B;  2OVP B;  3JZG A;  4L1Q D;  3I89 A;  4X3E A; 
#chains in the Genus database with same CATH topology
 5TF2 A;  2VDQ A;  1JJU B;  5B4W A;  5FQD A;  4PXW A;  1YR2 A;  1XIP A;  4CC9 A;  4CI8 A;  4LG8 A;  3PVW B;  3V5W B;  1FWX A;  3PXT D;  4RE6 A;  4PSW B;  4WJK A;  1MG3 A;  4J81 A;  1VE6 A;  5M5R A;  1A12 A;  3CIK B;  4ZOZ A;  2I0T A;  2J55 H;  4GM8 A;  3UVL A;  5H1M A;  4CI1 A;  4GGD A;  3KRX B;  4PNK B;  3IUQ A;  2H9M A;  5C2V B;  4O9D A;  2AH0 A;  2H47 A;  5TEE A;  5IJ8 E;  4X61 B;  3EQ9 A;  4NSX A;  2AQ5 A;  3ORV D;  2P9I C;  4J82 A;  2QXV A;  3EWE A;  4IRZ A;  2H9P A;  2BCJ B;  5HE1 B;  3OKT A;  5C9Z B;  2OVR B;  5FA5 B;  1PI6 A;  1C9L A;  2VDR A;  3SLE D;  1S4U X;  5H14 A;  3RN1 D;  3MXX A;  4FAN D;  4GQB B;  4FA1 D;  3K26 A;  4GMB A;  4NC4 A;  3KCI A;  2HKM A;  4AMZ A;  4A11 A;  4ES0 A;  1JV2 A;  2H6N A;  5EAM A;  4G56 B;  3MZL A;  2XL2 A;  3GRE A;  1TBG A;  3EI2 A;  5AFU 3;  3RLM D;  5EMM B;  4H5J A;  1GOG A;  2H6Q A;  4JHN A;  2Z2O A;  2I0S A;  3SHF A;  3T3P A;  3VH0 A;  3ULE C;  1YFQ A;  1TYQ C;  5GSA A;  1E8N A;  3C75 H;  3I7O A;  4CI3 A;  1H2Z A;  2HJ4 A;  3JAM g;  2I3S A;  4J87 A;  4PBZ A;  5EMJ B;  3RMZ D;  2XE4 A;  5M5V A;  2Z2P A;  1PGU A;  4BCD A;  5THA A;  3PE7 A;  3J81 g;  2J57 G;  5CXB A;  1U8C A;  2EBS A;  4A09 B;  2BBK H;  4CZX A;  3ZDY A;  2H6K A;  3I7P A;  4O45 A;  2VC2 A;  4JSV C;  1A0R B;  1VZ2 A;  4FWW A;  3O4G A;  5CYK B;  2HES X;  4GM3 A;  1GOH A;  4G1E A;  2IWK A;  3IIW A;  3K6S A;  3N0D A;  4JT5 C;  3C99 A;  4IMM A;  5HE2 B;  3U4Y A;  4LG9 A;  2HU7 A;  3EI3 A;  1MDA H;  1VYH C;  3EQ8 A;  5I5M A;  4A11 B;  3W15 A;  3OKY A;  5GMK n;  3L4M D;  3EI4 B;  3EI1 A;  3DSM A;  2CE9 A;  1MG2 A;  4GGC A;  3PVU B;  4CZY A;  5C2W B;  2PM9 A;  2TRC B;  1XKS A;  2GC7 A;  4JD2 C;  5CXC A;  3IJ0 A;  4BCC A;  3BWS A;  4BP8 A;  3MZK A;  1B9X A;  2EIE A;  4R7A B;  4JXM A;  1K32 A;  3I7K A;  3UKU C;  1R5M A;  3OF7 A;  5JWZ A;  4JHP C;  4CY3 A;  4XEI C;  3JB9 L;  4WK2 A;  2CN2 A;  1PEV A;  4OZU A;  4PBY A;  3MUN A;  1GOT B;  4J79 A;  4X60 B;  4A0A B;  1M1X A;  2VDM A;  4JSP C;  4QQE A;  5K19 A;  3MUO A;  3OL2 B;  2O9K A;  3V9F A;  3O4I A;  4MK0 B;  2W18 A;  2GC4 A;  3VGZ A;  1I2M B;  4O02 A;  2CN3 A;  2H3X A;  5K1C C;  4G55 A;  4O2W A;  3J80 g;  2OVQ B;  2PM7 B;  1U4C A;  3AL8 B;  3OTT A;  4MMZ A;  3UR4 A;  4KFM B;  5E6R A;  4OWR A;  3FCS A;  4EWR A;  2VDP A;  1GP2 B;  4A08 B;  4UM8 A;  2EID A;  4ZOY A;  3EI1 B;  4J0X A;  2HXC A;  5EAL A;  4FHL A;  2B4E A;  2I3T A;  3IKO A;  4AX4 A;  4U7A A;  1SHY B;  5FFO A;  5EM2 B;  4RE5 A;  1RI6 A;  2YB8 B;  3B7F A;  3IUM A;  2AGX A;  3UVK A;  2HJB A;  4A2L A;  2VZ1 A;  1B9Y A;  2H9N A;  2P9N C;  3IJ1 A;  4JSX C;  3VI3 A;  3K27 A;  3SMR A;  3F3P A;  3ZE1 A;  5C86 A;  1UOP A;  4XYH A;  3FRX A;  2VDL A;  1SQ9 A;  5C92 A;  4ERZ A;  3NVX A;  4FB1 D;  2HYE A;  4E54 A;  4DNW A;  1GXR A;  3MMY A;  4CY2 A;  4J86 A;  4O3T B;  4AEZ A;  3CFS B;  4D6V A;  2P9S C;  5A2Q g;  5FKR A;  4J78 A;  3RRM C;  5SXM A;  3HFQ A;  2IUQ A;  3ZWL B;  3QHY B;  2P9K C;  4Y7R A;  4BCB A;  1QNI A;  5TEF A;  3FGB A;  2QR5 A;  3V4P A;  2HU8 A;  3EG6 A;  4K3I D;  3A0F A;  1U2V C;  4CY5 A;  3SCY A;  2YMU A;  3RSE C;  5EAP A;  4Y5R D;  1VE7 A;  1GOF A;  2YNP A;  3PXW D;  4BL0 A;  1NEX B;  3DXM C;  3I8C A;  3PXS D;  5M5T A;  1JMZ B;  1N6D A;  3NVN A;  3JPX A;  3ZDX A;  2H13 A;  2XYI A;  5FKS A;  5KDO B;  3IVM A;  3V4V A;  2UZX B;  3FCU A;  4QAM A;  4YVD A;  4A7J A;  3DWL C;  5M5S A;  4UM9 A;  1H2X A;  5GXI A;  3RFG A;  2OK6 A;  4J73 A;  5EMK B;  1Q47 A;  1O6F A;  4CI2 A;  3DM0 A;  3IJE A;  3DDU A;  4J0W A;  4WK4 A;  3EI2 B;  3NID A;  3BG0 A;  5E6U A;  4E54 B;  5FFG A;  4DNU A;  4FA9 D;  3UVM A;  4CY1 A;  4ZN4 A;  4J8B A;  4TZ4 A;  3IUN A;  2XZG A;  4QRJ A;  4MMX A;  3NIF A;  2YNN A;  2H9L A;  4QL1 A;  1O6G A;  1N6E A;  3RN0 D;  3IUJ A;  2PBI B;  4K3J B;  4PC0 A;  4Z7O A;  1L5G A;  4J8G A;  3CFV A;  3GFC A;  5IJ7 E;  3FM0 A;  5EAR A;  4ERQ A;  5CXB B;  5AJA A;  3E0C A;  4JSN C;  1N6F A;  3ZDZ A;  2P9L C;  2AGY A;  3IUR A;  2VDO A;  3JZH A;  5M61 A;  1T2X A;  4H5I A;  5FLX g;  4E5Z A;  3NVQ A;  1K8K C;  2Q7Q A;  4MMY A;  4AN1 A;  4U1E I;  5HE3 B;  3IIY A;  3ZE2 A;  3PSC B;  1PBY B;  3UKR C;  4LGN A;  3N0E A;  3I7N A;  4GQ2 P;  3GC3 B;  2GNQ A;  5H17 A;  4Z8L A;  4GZ8 A;  3MKQ A;  1XHM A;  1JOF A;  2AH1 A;  3EU7 A;  3SVW D;  4WK0 A;  3EI3 B;  3UVN A;  3C9C A;  4BUJ C;  3I2N A;  2HKR A;  3OKY B;  1SQJ A;  4AOW A;  5GXH A;  3O4H A;  2VZ3 A;  4ESG A;  2B5L A;  2IUP A;  2PM9 B;  3KRW B;  4XYI A;  4HDJ A;  4Z7N A;  2B5M A;  2WQ8 A;  3QI0 A;  5CXC B;  2XU7 A;  3I7L A;  2XDW A;  3GD1 I;  1BPO A;  2IWF A;  3O4J A;  2AGW A;  4G1M A;  3AFC A;  1UOQ A;  4A09 A;  1NR0 A;  2AGL A;  4FA5 D;  2P9P C;  3OW8 A;  3P4F A;  3RFH A;  3OKW A;  1P22 A;  4A2M A;  3VI4 A;  5IT9 g;  3EQ7 A;  5HE0 B;  2JKX A;  5CYK A;  4J77 A;  2EIB A;  5I5J A;  4E5Z B;  2VDK A;  5HQG A;  2CO0 A;  4GGA A;  4NBM A;  2UZY B;  1K3I A;  3EMH A;  3SWS D;  4L3H D;  3BG1 A;  5HYN B;  4J84 A;  3SFZ A;  2H14 A;  1UOO A;  4ZOV A;  4ZOX A;  4L3G D;  3VA6 A;  4AN0 A;  4JT6 C;  3UVO A;  4FA4 D;  5I5I A;  2G99 A;  3C5M A;  4X63 B;  4A0B A;  3EI4 A;  3JRO A;  2B5N A;  5HDB A;  2P9U C;  4BH6 A;  2VDN A;  5FKT A;  4O1Q D;  2QZP A;  2OK4 A;  4DNV A;  2Z2N A;  1OMW B;  5IC7 A;  3IJC A;  5TDH B;  2AGZ A;  2MTA H;  1JTD B;  3F3G A;  2YNO A;  4GQ1 A;  2IUV A;  3V7D B;  3SBP A;  4FAV D;  2H68 A;  2J56 H;  2QC5 A;  4NAA A;  2PM6 B;  2YBA A;  5M5U A;  3T3M A;  5EML B;  3AL9 A;  2IAA A;  3MKS B;  3ZE0 A;  1QFM A;  4A0A A;  3PSL A;  2XL3 A;  3JRP A;  2HU5 A;  3K72 A;  3L4O D;  5IGQ A;  3OL2 A;  3I8E A;  1JMX B;  1E8M A;  3I7H A;  2CE8 A;  5IGO A;  1QFS A;  4L1M A;  5AMS A;  1OLZ A;  3SBR A;  4BP9 A;  4PSX B;  2OIZ A;  1GG2 B;  3IUL A;  2G9A A;  2OJY A;  5FKQ A;  4D9S A;  3AL8 A;  4UI9 R;  4AMY A;  2CO0 C;  4NEN A;  1ERJ A;  3F3F A;  3JZN A;  3ODT A;  3SXT D;  4N14 A;  2I0R A;  4QT8 A;  4D0K A;  2CNX A;  1E5T A;  3DXK C;  4GM9 A;  4A0B B;  4A08 A;  4I79 A;  1L0Q A;  1TYE A;  3NIG A;  3SBQ A;  3AH8 B;  1H2Y A;  2EIC A;  4ERY A;  1VZ3 A;  2IUR A;  4Z7Q A;  5FXY A;  4L9O A;  4CZV A;  5EM2 A;  4IA9 A;  5E6S A;  3SN6 B;  1H2W A;  2BKL A;  3SJL D;  3MVD K;  4O3U B;  2OVP B;  1C9I A;  3JZG A;  4L1Q D;  3I89 A;  4X3E A;  3K71 A;  1UTC A; 
#chains in the Genus database with same CATH homology
 5TF2 A;  1JJU B;  5B4W A;  5FQD A;  4PXW A;  1XIP A;  4CC9 A;  4CI8 A;  4LG8 A;  3PVW B;  3V5W B;  1FWX A;  3PXT D;  4PSW B;  1MG3 A;  4J81 A;  3CIK B;  4ZOZ A;  2I0T A;  2J55 H;  4GM8 A;  3UVL A;  5H1M A;  4CI1 A;  4GGD A;  3KRX B;  4PNK B;  2H9M A;  5C2V B;  4O9D A;  2AH0 A;  2H47 A;  5TEE A;  5IJ8 E;  4X61 B;  4NSX A;  2AQ5 A;  3ORV D;  2P9I C;  4J82 A;  2QXV A;  3EWE A;  2H9P A;  2BCJ B;  5HE1 B;  3OKT A;  5C9Z B;  2OVR B;  5FA5 B;  1PI6 A;  3SLE D;  1S4U X;  5H14 A;  3RN1 D;  3MXX A;  4FAN D;  4GQB B;  4FA1 D;  3K26 A;  4GMB A;  2HKM A;  4A11 A;  4ES0 A;  2H6N A;  5EAM A;  4G56 B;  3MZL A;  2XL2 A;  3GRE A;  1TBG A;  3EI2 A;  5AFU 3;  3RLM D;  5EMM B;  4H5J A;  2H6Q A;  2Z2O A;  2I0S A;  3SHF A;  3VH0 A;  3ULE C;  1YFQ A;  1TYQ C;  5GSA A;  3C75 H;  3I7O A;  4CI3 A;  2HJ4 A;  3JAM g;  2I3S A;  4J87 A;  4PBZ A;  5EMJ B;  3RMZ D;  2Z2P A;  1PGU A;  5THA A;  3PE7 A;  3J81 g;  2J57 G;  5CXB A;  2EBS A;  4A09 B;  2BBK H;  4CZX A;  2H6K A;  3I7P A;  4O45 A;  4JSV C;  1A0R B;  4FWW A;  5CYK B;  2HES X;  4GM3 A;  2IWK A;  3IIW A;  3N0D A;  4JT5 C;  3C99 A;  4IMM A;  5HE2 B;  3U4Y A;  4LG9 A;  3EI3 A;  1MDA H;  1VYH C;  5I5M A;  4A11 B;  3W15 A;  3OKY A;  5GMK n;  3L4M D;  3EI4 B;  3EI1 A;  3DSM A;  2CE9 A;  1MG2 A;  4GGC A;  3PVU B;  4CZY A;  5C2W B;  2PM9 A;  2TRC B;  1XKS A;  2GC7 A;  4JD2 C;  5CXC A;  3IJ0 A;  3BWS A;  3MZK A;  1B9X A;  4R7A B;  4JXM A;  1K32 A;  3I7K A;  3UKU C;  1R5M A;  5JWZ A;  4CY3 A;  4XEI C;  3JB9 L;  2CN2 A;  1PEV A;  4OZU A;  4PBY A;  1GOT B;  4J79 A;  4X60 B;  4A0A B;  4JSP C;  4QQE A;  5K19 A;  3OL2 B;  2O9K A;  3V9F A;  4MK0 B;  2W18 A;  2GC4 A;  3VGZ A;  2CN3 A;  2H3X A;  5K1C C;  3J80 g;  2OVQ B;  2PM7 B;  1U4C A;  3AL8 B;  3OTT A;  3UR4 A;  4KFM B;  4OWR A;  4EWR A;  1GP2 B;  4A08 B;  4ZOY A;  3EI1 B;  4J0X A;  2HXC A;  5EAL A;  4FHL A;  2B4E A;  2I3T A;  3IKO A;  4U7A A;  1SHY B;  5EM2 B;  1RI6 A;  2YB8 B;  3B7F A;  2AGX A;  3UVK A;  2HJB A;  4A2L A;  1B9Y A;  2H9N A;  2P9N C;  3IJ1 A;  4JSX C;  3K27 A;  3SMR A;  3F3P A;  4XYH A;  3FRX A;  1SQ9 A;  4ERZ A;  3NVX A;  4FB1 D;  2HYE A;  4E54 A;  1GXR A;  3MMY A;  4CY2 A;  4J86 A;  4O3T B;  4AEZ A;  3CFS B;  4D6V A;  2P9S C;  5A2Q g;  5FKR A;  4J78 A;  3RRM C;  5SXM A;  3HFQ A;  2IUQ A;  3ZWL B;  2P9K C;  4Y7R A;  1QNI A;  5TEF A;  3FGB A;  3EG6 A;  4K3I D;  3A0F A;  1U2V C;  4CY5 A;  3SCY A;  2YMU A;  3RSE C;  5EAP A;  4Y5R D;  3PXW D;  2YNP A;  4BL0 A;  1NEX B;  3DXM C;  3I8C A;  3PXS D;  1JMZ B;  1N6D A;  3NVN A;  3JPX A;  2H13 A;  2XYI A;  5FKS A;  5KDO B;  2UZX B;  4YVD A;  4A7J A;  3DWL C;  5GXI A;  3RFG A;  2OK6 A;  4J73 A;  5EMK B;  1Q47 A;  4CI2 A;  3DM0 A;  4J0W A;  3EI2 B;  3BG0 A;  4E54 B;  4FA9 D;  3UVM A;  4CY1 A;  4ZN4 A;  4J8B A;  4TZ4 A;  4QRJ A;  2YNN A;  2H9L A;  4QL1 A;  1N6E A;  3RN0 D;  2PBI B;  4K3J B;  4PC0 A;  4J8G A;  3CFV A;  3GFC A;  5IJ7 E;  3FM0 A;  5EAR A;  4ERQ A;  5CXB B;  5AJA A;  3E0C A;  4JSN C;  1N6F A;  2P9L C;  2AGY A;  3JZH A;  4H5I A;  5FLX g;  4E5Z A;  3NVQ A;  1K8K C;  2Q7Q A;  4U1E I;  5HE3 B;  3IIY A;  3PSC B;  1PBY B;  3UKR C;  4LGN A;  3N0E A;  3I7N A;  4GQ2 P;  2GNQ A;  5H17 A;  4Z8L A;  4GZ8 A;  3MKQ A;  1XHM A;  1JOF A;  2AH1 A;  3EU7 A;  3SVW D;  3EI3 B;  3UVN A;  3C9C A;  4BUJ C;  3I2N A;  2HKR A;  3OKY B;  1SQJ A;  4AOW A;  5GXH A;  4ESG A;  2B5L A;  2IUP A;  2PM9 B;  3KRW B;  4XYI A;  4HDJ A;  2B5M A;  5CXC B;  2XU7 A;  3I7L A;  2IWF A;  2AGW A;  3AFC A;  4A09 A;  1NR0 A;  2AGL A;  4FA5 D;  2P9P C;  3OW8 A;  3P4F A;  3RFH A;  3OKW A;  1P22 A;  4A2M A;  5IT9 g;  5HE0 B;  5CYK A;  4J77 A;  5I5J A;  4E5Z B;  5HQG A;  2CO0 A;  4GGA A;  2UZY B;  3EMH A;  3SWS D;  4L3H D;  3BG1 A;  5HYN B;  4J84 A;  3SFZ A;  2H14 A;  4ZOV A;  4ZOX A;  4L3G D;  3VA6 A;  4FA4 D;  4JT6 C;  3UVO A;  5I5I A;  2G99 A;  3C5M A;  4X63 B;  4A0B A;  3EI4 A;  3JRO A;  2B5N A;  2P9U C;  4BH6 A;  5FKT A;  4O1Q D;  2OK4 A;  2Z2N A;  1OMW B;  5IC7 A;  3IJC A;  5TDH B;  2AGZ A;  2MTA H;  3F3G A;  2YNO A;  4GQ1 A;  2IUV A;  3V7D B;  3SBP A;  4FAV D;  2H68 A;  2J56 H;  2QC5 A;  2PM6 B;  2YBA A;  5EML B;  3AL9 A;  2IAA A;  3MKS B;  4A0A A;  3PSL A;  2XL3 A;  3JRP A;  3L4O D;  5IGQ A;  3OL2 A;  3I8E A;  1JMX B;  3I7H A;  5IGO A;  2CE8 A;  5AMS A;  1OLZ A;  3SBR A;  4PSX B;  2OIZ A;  1GG2 B;  2G9A A;  2OJY A;  5FKQ A;  3AL8 A;  4UI9 R;  2CO0 C;  1ERJ A;  3F3F A;  3JZN A;  3ODT A;  3SXT D;  4N14 A;  2I0R A;  4QT8 A;  4D0K A;  2CNX A;  3DXK C;  4GM9 A;  4A0B B;  4A08 A;  4I79 A;  1L0Q A;  3SBQ A;  3AH8 B;  4ERY A;  2IUR A;  5FXY A;  4L9O A;  4CZV A;  5EM2 A;  4IA9 A;  3SN6 B;  3SJL D;  4O3U B;  2OVP B;  3JZG A;  4L1Q D;  3I89 A;  4X3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...