5HQGA

Wd40 domain of human e3 ubiquitin ligase cop1 (rfwd2)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
341
structure length
324
Chain Sequence
EFQECLSKFTRYNSVRPLATLSYALYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RFWD2
publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 324
sequence length 341
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5hqgA00
2B5NA 3AL9A 3IJ1A 3JZNA 3UVOA 4FB1D 1YFQA 3AL8A 1VYHC 2P9UC 3VGZA 1GOTB 5EMLB 2I0SA 4CZYA 3JZGA 4O3TB 2J56H 1NR0A 1XKSA 4A08B 2AQ5A 5EMMB 4HDJA 4PBYA 3L4OD 4QRJA 4FA4D 3DSMA 3CIKB 1JJUB 4J79A 5K19A 3SHFA 3OTTA 3J80g 4H5JA 2MTAH 2YBAA 3PXWD 3JROA 4FAND 3SMRA 4PSWB 1MG2A 2YNNA 3UR4A 3V7DB 4CY1A 3OKYA 3A0FA 5HE3B 4ZOYA 2CN3A 2H9LA 3JZHA 3I7PA 4A2LA 1B9XA 5AJAA 4Y5RD 4YVDA 4ESGA 3DXMC 2OK6A 4ERZA 2BCJB 3EWEA 2IAAA 4CZXA 3FM0A 4K3ID 2H9NA 4GGDA 5FLXg 5THAA 4K3JB 4R7AB 4CI1A 3B7FA 4GM9A 4Z8LA 4IMMA 1TBGA 2OVRB 2GNQA 3RN1D 3UKUC 2J55H 3IKOA 2H47A 4CC9A 1PEVA 3SJLD 1B9YA 3SVWD 2XU7A 3FGBA 2AH1A 2IUVA 3AH8B 2P9SC 3MZKA 4E5ZB 4JSXC 1TYQC 3C9CA 1PGUA 5SXMA 3UVLA 4X60B 4CY2A 5JWZA 5C2VB 4JSNC 4A09B 3I7NA 3RFHA 3OKTA 3BG0A 5IT9g 2IUPA 2OVPB 4A0BB 5FKTA 2GC4A 1OLZA 2QXVA 3I89A 5FKRA 5CXBA 2G9AA 4ZOVA 1PI6A 5AFU3 2YB8B 1Q47A 4I79A 4XYHA 2HJBA 2I0TA 2YNPA 4J73A 4Y7RA 2H6QA 2P9PC 1XHMA 3UVMA 2H68A 3KRXB 3ODTA 3EI4A 1MG3A 4E54A 1A0RB 2I3TA 4A2MA 5I5MA 3J81g 4GMBA 3OL2B 5CYKB 4A7JA 4CY5A 1P22A 2AH0A 4X61B 4A11A 3EU7A 5B4WA 3C99A 3GREA 4G56B 2P9NC 2Z2OA 3L4MD 1JOFA 2B5LA 4FHLA 3IIYA 3NVXA 3EI2B 3RLMD 3ULEC 3EI1A 5H17A 4XYIA 3MKSB 2IURA 5AMSA 2PM9B 5CXCB 4ZN4A 3JRPA 2G99A 4FA9D 5HYNB 2H6NA 2H6KA 3F3GA 4A0AA 4XEIC 2PBIB 2EBSA 4PBZA 3N0DA 5TEEA 5I5IA 1JMZB 2OIZA 2Z2NA 4L9OA 5TDHB 4N14A 5FQDA 2I0RA 4A0BA 3MZLA 1GP2B 2PM7B 3CFVA 4ZOZA 5EMJB 1L0QA 4PC0A 4GZ8A 4OZUA 4QT8A 3SBQA 2Z2PA 5EM2B 4JD2C 4BH6A 3OW8A 3FRXA 3EI3A 5C9ZB 3AL8B 3I7HA 1QNIA 3V9FA 5H1MA 2AGLA 3UKRC 4L3GD 4L1QD 1XIPA 3I7KA 3SBPA 4CZVA 4D6VA 2IWKA 3RSEC 4IA9A 4BUJC 3F3PA 1JMXB 1PBYB 3UVNA 4L3HD 4A08A 5FKSA 4GM3A 4D0KA 3DM0A 1K8KC 4LG9A 5GSAA 4J0XA 3UVKA 5C2WB 3DXKC 3IJ0A 2CO0C 4PSXB 3SBRA 4BL0A 3I8EA 4UI9R 3I2NA 3PSLA 2HESX 3OKYB 4O9DA 4EWRA 4J77A 4LGNA 3PVWB 2BBKH 2AGXA 3NVNA 2CN2A 3P4FA 5HQGA 4U1EI 3SWSD 4JT5C 4AOWA 2YNOA 5K1CC 3HFQA 1N6FA 2GC7A 3NVQA 2J57G 1N6DA 2XL3A 2O9KA 4KFMB 2H3XA 5IJ7E 4ZOXA 3I7LA 4LG8A 3OKWA 1OMWB 4U7AA 3I8CA 4JSVC 3BG1A 2H13A 2AGZA 2H14A 4CI8A 4J87A 3EG6A 4FAVD 1GXRA 5GMKn 3PVUB 5I5JA 2XYIA 3K26A 5FA5B 3IJCA 2TRCB 3ORVD 2AGWA 4AEZA 5IC7A 2I3SA 4X63B 3C5MA 3K27A 2OJYA 5HE1B 3F3FA 3W15A 2CNXA 4J84A 4J8BA 5HE2B 4FA1D 4E5ZA 3RRMC 3PSCB 1SHYB 1K32A 3PXTD 5IGOA 1U2VC 2H9MA 2P9IC 3IIWA 3VA6A 5A2Qg 4A09A 5EAPA 4O3UB 2HKMA 5FXYA 4MK0B 4GQ1A 4CY3A 2CO0A 3CFSB 4J0WA 2HYEA 5IJ8E 4OWRA 4X3EA 4CI3A 3VH0A 2QC5A 2P9LC 5CXBB 5EMKB 2HXCA 2CE8A 3BWSA 4J81A 1ERJA 4GQ2P 1SQ9A 3JPXA 1U4CA 2OK4A 2UZYB 3MMYA 3MXXA 4O1QD 5FKQA 3EI4B 3SLED 4NSXA 4J78A 5GXHA 4E54B 5KDOB 3SN6B 2Q7QA 5TEFA 1FWXA 2H9PA 5EALA 3U4YA 3RN0D 5GXIA 4A11B 2P9KC 3MKQA 2HJ4A 3OL2A 4O45A 5CYKA 4ES0A 5TF2A 2W18A 2PM6B 1GG2B 3JAMg 1R5MA 4GGCA 4GQBB 3GFCA 1MDAH 3I7OA 3E0CA 4TZ4A 3EI1B 3EI2A 2B5MA 2UZXB 4ERYA 3EMHA 3N0EA 4QL1A 5H14A 1NEXB 1RI6A 3RMZD 4ERQA 4PXWA 2AGYA 3PXSD 3SFZA 2PM9A 4A0AB 5CXCA 3AFCA 5EAMA 5HE0B 3JB9L 4JT6C 4PNKB 2XL2A 3V5WB 4FWWA 4JXMA 5EARA 3SCYA 2IUQA 2HKRA 3SXTD 2YMUA 3DWLC 4J82A 5IGQA 1N6EA 4CI2A 1S4UX 4GGAA 2B4EA 3PE7A 4H5IA 4JSPC 3RFGA 4FA5D 2IWFA 3KRWB 1SQJA 4QQEA 3ZWLB 2CE9A 3C75H 3EI3B 5EM2A 4J86A 2OVQB 4GM8A 4J8GA
chains in the Genus database with same CATH superfamily
2B5NA 3AL9A 3IJ1A 3JZNA 3UVOA 4FB1D 1YFQA 3AL8A 1VYHC 2P9UC 3VGZA 1GOFA 1GOTB 3EQ9A 4AX4A 5EMLB 4NAAA 2I0SA 4CZYA 3JZGA 4O3TB 1QFSA 3IUQA 2J56H 1NR0A 1XKSA 4A08B 1E5TA 2AQ5A 3VI3A 5EMMB 1E8NA 4HDJA 4G1EA 4PBYA 3L4OD 4QRJA 4AN0A 4FA4D 4WK4A 3DSMA 3CIKB 1JJUB 4J79A 3QI0A 5K19A 3SHFA 3OTTA 3ZE1A 3J80g 4H5JA 2MTAH 1QFMA 2YBAA 3PXWD 3JROA 4FAND 5HDBA 3SMRA 4PSWB 1MG2A 2YNNA 3UR4A 3V7DB 4CY1A 3OKYA 3O4GA 3A0FA 5HE3B 4ZOYA 2CN3A 2H9LA 3JZHA 4IRZA 3I7PA 4A2LA 1B9XA 5AJAA 4Y5RD 3V4PA 4YVDA 3IUMA 4ESGA 3DXMC 2OK6A 1BPOA 1C9LA 4ERZA 2BCJB 3EWEA 2IAAA 3MUNA 3IVMA 4DNVA 4CZXA 3FM0A 4K3ID 2H9NA 4GGDA 1H2YA 5FLXg 5THAA 4K3JB 4R7AB 4CI1A 3B7FA 4GM9A 4Z8LA 4IMMA 1TBGA 2VZ1A 5M5VA 2EIEA 2OVRB 3IURA 2GNQA 3RN1D 3UKUC 3NIGA 2J55H 3IKOA 2H47A 4CC9A 1PEVA 3SJLD 1B9YA 3SVWD 2XU7A 3FGBA 2AH1A 2IUVA 5M5RA 1VE7A 3AH8B 2P9SC 3IJEA 3MZKA 4E5ZB 4JSXC 1TYQC 3C9CA 1PGUA 5SXMA 3UVLA 4X60B 4CY2A 5JWZA 5C2VB 1GOGA 2HU7A 4JSNC 4A09B 2VDLA 3I7NA 5FFOA 3RFHA 3OKTA 3BG0A 4BCBA 5IT9g 2IUPA 2OVPB 4A0BB 3MUOA 2XZGA 1E8MA 5FKTA 1H2ZA 4D9SA 3O4JA 2GC4A 4DNUA 1OLZA 2QXVA 3I89A 5FKRA 5CXBA 2G9AA 3IUJA 4ZOVA 1PI6A 1T2XA 5AFU3 2YB8B 1Q47A 4I79A 4XYHA 2HJBA 2I0TA 2YNPA 4J73A 4Y7RA 2H6QA 2P9PC 1XHMA 3UVMA 2H68A 3KRXB 3ODTA 3EI4A 1MG3A 2QZPA 4E54A 1A0RB 2I3TA 4A2MA 5I5MA 3DDUA 3J81g 4GMBA 4WK0A 3OL2B 5CYKB 4UM9A 4A7JA 4CY5A 3NIFA 1P22A 2AH0A 4X61B 4A11A 1M1XA 3EU7A 5B4WA 3ZDYA 2XDWA 3GREA 3C99A 4G56B 2P9NC 3L4MD 2Z2OA 4UM8A 1JOFA 1TYEA 2B5LA 4FHLA 3IIYA 3NVXA 3EI2B 3RLMD 3ULEC 3EI1A 5H17A 4XYIA 3MKSB 2IURA 3GC3B 5AMSA 2XE4A 2PM9B 5CXCB 4ZN4A 3JRPA 2G99A 4FA9D 5HYNB 2H6NA 2H6KA 3F3GA 2VC2A 4A0AA 4XEIC 2PBIB 1VZ3A 2EBSA 4PBZA 3N0DA 5TEEA 5I5IA 1JMZB 1UOQA 2OIZA 2Z2NA 4L9OA 4MMZA 5TDHB 1H2WA 2HU8A 4N14A 4BP8A 5FQDA 2I0RA 1JV2A 4A0BA 2VDMA 3MZLA 1GP2B 2PM7B 4G55A 3CFVA 4ZOZA 4DNWA 5EMJB 1L0QA 4PC0A 4NENA 4GZ8A 4OZUA 4QT8A 3SBQA 2Z2PA 5EM2B 1H2XA 4JD2C 4BH6A 3OW8A 3FRXA 3T3MA 3GD1I 3EI3A 5C9ZB 3AL8B 3I7HA 1QNIA 3V9FA 5H1MA 2AGLA 3UKRC 4L3GD 4L1QD 5M5SA 1XIPA 3I7KA 3SBPA 4CZVA 4D6VA 4QAMA 4WJKA 1UOPA 2IWKA 5E6RA 3RSEC 4IA9A 4BUJC 3FCSA 3F3PA 1GOHA 1JMXB 1PBYB 2BKLA 3MVDK 3QHYB 3UVNA 4L3HD 4A08A 5FKSA 4JHNA 4GM3A 4D0KA 3DM0A 5M5TA 1K8KC 4LG9A 5GSAA 4J0XA 3UVKA 1YR2A 5C2WB 1I2MB 1VE6A 3DXKC 3IJ0A 2CO0C 4PSXB 3SBRA 3T3PA 3I8EA 4BL0A 4UI9R 3I2NA 3PSLA 2HESX 3OKYB 4O9DA 4EWRA 4J77A 4LGNA 3PVWB 2BBKH 2AGXA 3O4IA 1A12A 3NVNA 2CN2A 3P4FA 4RE6A 1U8CA 4U1EI 5HQGA 4RE5A 3SWSD 4JT5C 4AOWA 2YNOA 5K1CC 3HFQA 1N6FA 4AN1A 2GC7A 3NVQA 2J57G 1N6DA 2XL3A 4Z7QA 2O9KA 2VDPA 4KFMB 5E6UA 4AMYA 5IJ7E 4ZOXA 2VDNA 3I7LA 4LG8A 3OKWA 1OMWB 4NBMA 4U7AA 3I8CA 4JSVC 3BG1A 2H13A 2AGZA 2H14A 4CI8A 4J87A 3VI4A 2VDRA 3EG6A 4FAVD 1GXRA 5GMKn 3PVUB 5I5JA 4AMZA 2XYIA 3K26A 4BCCA 5FA5B 5M61A 3IJCA 2TRCB 4BP9A 3ORVD 4MMYA 2VDKA 5C86A 2VZ3A 2AGWA 4AEZA 5IC7A 2I3SA 4X63B 3C5MA 3K27A 2OJYA 5HE1B 3F3FA 3W15A 3FCUA 2CNXA 4J84A 4J8BA 5HE2B 4FA1D 4E5ZA 3RRMC 3PSCB 1SHYB 1K32A 1O6GA 3PXTD 5IGOA 1U2VC 2H9MA 2P9IC 3IIWA 3VA6A 5A2Qg 4A09A 5EAPA 2VDOA 1L5GA 4O3UB 2HKMA 5FXYA 4J8GA 4MK0B 4GQ1A 4CY3A 2CO0A 5FFGA 3CFSB 4J0WA 2HYEA 5IJ8E 4OWRA 4X3EA 4WK2A 4CI3A 3VH0A 2QC5A 2EIDA 2P9LC 5CXBB 5E6SA 5EMKB 4MMXA 4NC4A 2HXCA 2CE8A 3BWSA 4L1MA 4J81A 1ERJA 1C9IA 1SQ9A 3JPXA 1U4CA 3MXXA 2OK4A 2UZYB 3MMYA 4GQ2P 4O1QD 3K71A 5FKQA 3EI4B 3SLED 4NSXA 4J78A 5GXHA 4E54B 5KDOB 4O2WA 3SN6B 2Q7QA 2VDQA 5TEFA 3ZDXA 1FWXA 4O02A 2H9PA 5EALA 3U4YA 3RN0D 3K72A 5GXIA 2HU5A 4A11B 2P9KC 3MKQA 2HJ4A 3OL2A 4O45A 5CYKA 4BCDA 4ES0A 3ZDZA 5TF2A 4JHPC 3NIDA 2W18A 2PM6B 1K3IA 1GG2B 3JAMg 1R5MA 2JKXA 1UTCA 4GGCA 4GQBB 3GFCA 1MDAH 3I7OA 3E0CA 3KCIA 4TZ4A 5M5UA 3EI1B 1O6FA 3EI2A 2B5MA 2UZXB 3EQ7A 4ERYA 3EMHA 3N0EA 4QL1A 3K6SA 3OF7A 5H14A 1NEXB 1RI6A 3RMZD 4G1MA 4ERQA 4PXWA 2AGYA 3PXSD 3SFZA 2PM9A 4A0AB 5CXCA 3AFCA 5EAMA 5C92A 5HE0B 1JTDB 3JB9L 4JT6C 1UOOA 4PNKB 2XL2A 3V5WB 4FWWA 1VZ2A 4JXMA 5EARA 3SCYA 2IUQA 4Z7OA 2HKRA 2EIBA 3IULA 3ZE0A 3SXTD 3EQ8A 2EICA 2YMUA 3DWLC 4J82A 5IGQA 1N6EA 4CI2A 4Z7NA 1S4UX 2WQ8A 2B4EA 4GGAA 3PE7A 4H5IA 3O4HA 4JSPC 3RFGA 4FA5D 2IWFA 3IUNA 3V4VA 2QR5A 3KRWB 1SQJA 4QQEA 3ZWLB 2CE9A 3C75H 3EI3B 5EM2A 3ZE2A 4J86A 2OVQB 4GM8A 2H3XA
chains in the Genus database with same CATH topology
2B5NA 3AL9A 3IJ1A 3JZNA 3UVOA 4FB1D 1YFQA 3AL8A 1VYHC 2P9UC 3VGZA 1GOTB 5EMLB 2I0SA 4CZYA 3JZGA 4O3TB 2J56H 1NR0A 1XKSA 4A08B 2AQ5A 5EMMB 4HDJA 4PBYA 3L4OD 4QRJA 4FA4D 3DSMA 3CIKB 1JJUB 4J79A 5K19A 3SHFA 3OTTA 3J80g 4H5JA 2MTAH 2YBAA 3PXWD 3JROA 4FAND 3SMRA 4PSWB 1MG2A 2YNNA 3UR4A 3V7DB 4CY1A 3OKYA 3A0FA 5HE3B 4ZOYA 2CN3A 2H9LA 3JZHA 3I7PA 4A2LA 1B9XA 5AJAA 4Y5RD 4YVDA 4ESGA 3DXMC 2OK6A 4ERZA 2BCJB 3EWEA 2IAAA 4CZXA 3FM0A 4K3ID 2H9NA 4GGDA 5FLXg 5THAA 4K3JB 4R7AB 4CI1A 3B7FA 4GM9A 4Z8LA 4IMMA 1TBGA 2OVRB 2GNQA 3RN1D 3UKUC 2J55H 3IKOA 2H47A 4CC9A 1PEVA 3SJLD 1B9YA 3SVWD 2XU7A 3FGBA 2AH1A 2IUVA 3AH8B 2P9SC 3MZKA 4E5ZB 4JSXC 1TYQC 3C9CA 1PGUA 5SXMA 3UVLA 4X60B 4CY2A 5JWZA 5C2VB 4JSNC 4A09B 3I7NA 3RFHA 3OKTA 3BG0A 5IT9g 2IUPA 2OVPB 4A0BB 5FKTA 2GC4A 1OLZA 2QXVA 3I89A 5FKRA 5CXBA 2G9AA 4ZOVA 1PI6A 5AFU3 2YB8B 1Q47A 4I79A 4XYHA 2HJBA 2I0TA 2YNPA 4J73A 4Y7RA 2H6QA 2P9PC 1XHMA 3UVMA 2H68A 3KRXB 3ODTA 3EI4A 1MG3A 4E54A 1A0RB 2I3TA 4A2MA 5I5MA 3J81g 4GMBA 3OL2B 5CYKB 4A7JA 4CY5A 1P22A 2AH0A 4X61B 4A11A 3EU7A 5B4WA 3C99A 3GREA 4G56B 2P9NC 2Z2OA 3L4MD 1JOFA 2B5LA 4FHLA 3IIYA 3NVXA 3EI2B 3RLMD 3ULEC 3EI1A 5H17A 4XYIA 3MKSB 2IURA 5AMSA 2PM9B 5CXCB 4ZN4A 3JRPA 2G99A 4FA9D 5HYNB 2H6NA 2H6KA 3F3GA 4A0AA 4XEIC 2PBIB 2EBSA 4PBZA 3N0DA 5TEEA 5I5IA 1JMZB 2OIZA 2Z2NA 4L9OA 5TDHB 4N14A 5FQDA 2I0RA 4A0BA 3MZLA 1GP2B 2PM7B 3CFVA 4ZOZA 5EMJB 1L0QA 4PC0A 4GZ8A 4OZUA 4QT8A 3SBQA 2Z2PA 5EM2B 4JD2C 4BH6A 3OW8A 3FRXA 3EI3A 5C9ZB 3AL8B 3I7HA 1QNIA 3V9FA 5H1MA 2AGLA 3UKRC 4L3GD 4L1QD 1XIPA 3I7KA 3SBPA 4CZVA 4D6VA 2IWKA 3RSEC 4IA9A 4BUJC 3F3PA 1JMXB 1PBYB 3UVNA 4L3HD 4A08A 5FKSA 4GM3A 4D0KA 3DM0A 1K8KC 4LG9A 5GSAA 4J0XA 3UVKA 5C2WB 3DXKC 3IJ0A 2CO0C 4PSXB 3SBRA 4BL0A 3I8EA 4UI9R 3I2NA 3PSLA 2HESX 3OKYB 4O9DA 4EWRA 4J77A 4LGNA 3PVWB 2BBKH 2AGXA 3NVNA 2CN2A 3P4FA 5HQGA 4U1EI 3SWSD 4JT5C 4AOWA 2YNOA 5K1CC 3HFQA 1N6FA 2GC7A 3NVQA 2J57G 1N6DA 2XL3A 2O9KA 4KFMB 2H3XA 5IJ7E 4ZOXA 3I7LA 4LG8A 3OKWA 1OMWB 4U7AA 3I8CA 4JSVC 3BG1A 2H13A 2AGZA 2H14A 4CI8A 4J87A 3EG6A 4FAVD 1GXRA 5GMKn 3PVUB 5I5JA 2XYIA 3K26A 5FA5B 3IJCA 2TRCB 3ORVD 2AGWA 4AEZA 5IC7A 2I3SA 4X63B 3C5MA 3K27A 2OJYA 5HE1B 3F3FA 3W15A 2CNXA 4J84A 4J8BA 5HE2B 4FA1D 4E5ZA 3RRMC 3PSCB 1SHYB 1K32A 3PXTD 5IGOA 1U2VC 2H9MA 2P9IC 3IIWA 3VA6A 5A2Qg 4A09A 5EAPA 4O3UB 2HKMA 5FXYA 4MK0B 4GQ1A 4CY3A 2CO0A 3CFSB 4J0WA 2HYEA 5IJ8E 4OWRA 4X3EA 4CI3A 3VH0A 2QC5A 2P9LC 5CXBB 5EMKB 2HXCA 2CE8A 3BWSA 4J81A 1ERJA 4GQ2P 1SQ9A 3JPXA 1U4CA 2OK4A 2UZYB 3MMYA 3MXXA 4O1QD 5FKQA 3EI4B 3SLED 4NSXA 4J78A 5GXHA 4E54B 5KDOB 3SN6B 2Q7QA 5TEFA 1FWXA 2H9PA 5EALA 3U4YA 3RN0D 5GXIA 4A11B 2P9KC 3MKQA 2HJ4A 3OL2A 4O45A 5CYKA 4ES0A 5TF2A 2W18A 2PM6B 1GG2B 3JAMg 1R5MA 4GGCA 4GQBB 3GFCA 1MDAH 3I7OA 3E0CA 4TZ4A 3EI1B 3EI2A 2B5MA 2UZXB 4ERYA 3EMHA 3N0EA 4QL1A 5H14A 1NEXB 1RI6A 3RMZD 4ERQA 4PXWA 2AGYA 3PXSD 3SFZA 2PM9A 4A0AB 5CXCA 3AFCA 5EAMA 5HE0B 3JB9L 4JT6C 4PNKB 2XL2A 3V5WB 4FWWA 4JXMA 5EARA 3SCYA 2IUQA 2HKRA 3SXTD 2YMUA 3DWLC 4J82A 5IGQA 1N6EA 4CI2A 1S4UX 4GGAA 2B4EA 3PE7A 4H5IA 4JSPC 3RFGA 4FA5D 2IWFA 3KRWB 1SQJA 4QQEA 3ZWLB 2CE9A 3C75H 3EI3B 5EM2A 4J86A 2OVQB 4GM8A 4J8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5N A;  3AL9 A;  3IJ1 A;  3JZN A;  3UVO A;  4FB1 D;  1YFQ A;  3AL8 A;  1VYH C;  2P9U C;  3VGZ A;  1GOT B;  5EML B;  2I0S A;  4CZY A;  3JZG A;  4O3T B;  2J56 H;  1NR0 A;  1XKS A;  4A08 B;  2AQ5 A;  5EMM B;  4HDJ A;  4PBY A;  3L4O D;  4QRJ A;  4FA4 D;  3DSM A;  3CIK B;  1JJU B;  4J79 A;  5K19 A;  3SHF A;  3OTT A;  3J80 g;  4H5J A;  2MTA H;  2YBA A;  3PXW D;  3JRO A;  4FAN D;  3SMR A;  4PSW B;  1MG2 A;  2YNN A;  3UR4 A;  3V7D B;  4CY1 A;  3OKY A;  3A0F A;  5HE3 B;  4ZOY A;  2CN3 A;  2H9L A;  3JZH A;  3I7P A;  4A2L A;  1B9X A;  5AJA A;  4Y5R D;  4YVD A;  4ESG A;  3DXM C;  2OK6 A;  4ERZ A;  2BCJ B;  3EWE A;  2IAA A;  4CZX A;  3FM0 A;  4K3I D;  2H9N A;  4GGD A;  5FLX g;  5THA A;  4K3J B;  4R7A B;  4CI1 A;  3B7F A;  4GM9 A;  4Z8L A;  4IMM A;  1TBG A;  2OVR B;  2GNQ A;  3RN1 D;  3UKU C;  2J55 H;  3IKO A;  2H47 A;  4CC9 A;  1PEV A;  3SJL D;  1B9Y A;  3SVW D;  2XU7 A;  3FGB A;  2AH1 A;  2IUV A;  3AH8 B;  2P9S C;  3MZK A;  4E5Z B;  4JSX C;  1TYQ C;  3C9C A;  1PGU A;  5SXM A;  3UVL A;  4X60 B;  4CY2 A;  5JWZ A;  5C2V B;  4JSN C;  4A09 B;  3I7N A;  3RFH A;  3OKT A;  3BG0 A;  5IT9 g;  2IUP A;  2OVP B;  4A0B B;  5FKT A;  2GC4 A;  1OLZ A;  2QXV A;  3I89 A;  5FKR A;  5CXB A;  2G9A A;  4ZOV A;  1PI6 A;  5AFU 3;  2YB8 B;  1Q47 A;  4I79 A;  4XYH A;  2HJB A;  2I0T A;  2YNP A;  4J73 A;  4Y7R A;  2H6Q A;  2P9P C;  1XHM A;  3UVM A;  2H68 A;  3KRX B;  3ODT A;  3EI4 A;  1MG3 A;  4E54 A;  1A0R B;  2I3T A;  4A2M A;  5I5M A;  3J81 g;  4GMB A;  3OL2 B;  5CYK B;  4A7J A;  4CY5 A;  1P22 A;  2AH0 A;  4X61 B;  4A11 A;  3EU7 A;  5B4W A;  3C99 A;  3GRE A;  4G56 B;  2P9N C;  2Z2O A;  3L4M D;  1JOF A;  2B5L A;  4FHL A;  3IIY A;  3NVX A;  3EI2 B;  3RLM D;  3ULE C;  3EI1 A;  5H17 A;  4XYI A;  3MKS B;  2IUR A;  5AMS A;  2PM9 B;  5CXC B;  4ZN4 A;  3JRP A;  2G99 A;  4FA9 D;  5HYN B;  2H6N A;  2H6K A;  3F3G A;  4A0A A;  4XEI C;  2PBI B;  2EBS A;  4PBZ A;  3N0D A;  5TEE A;  5I5I A;  1JMZ B;  2OIZ A;  2Z2N A;  4L9O A;  5TDH B;  4N14 A;  5FQD A;  2I0R A;  4A0B A;  3MZL A;  1GP2 B;  2PM7 B;  3CFV A;  4ZOZ A;  5EMJ B;  1L0Q A;  4PC0 A;  4GZ8 A;  4OZU A;  4QT8 A;  3SBQ A;  2Z2P A;  5EM2 B;  4JD2 C;  4BH6 A;  3OW8 A;  3FRX A;  3EI3 A;  5C9Z B;  3AL8 B;  3I7H A;  1QNI A;  3V9F A;  5H1M A;  2AGL A;  3UKR C;  4L3G D;  4L1Q D;  1XIP A;  3I7K A;  3SBP A;  4CZV A;  4D6V A;  2IWK A;  3RSE C;  4IA9 A;  4BUJ C;  3F3P A;  1JMX B;  1PBY B;  3UVN A;  4L3H D;  4A08 A;  5FKS A;  4GM3 A;  4D0K A;  3DM0 A;  1K8K C;  4LG9 A;  5GSA A;  4J0X A;  3UVK A;  5C2W B;  3DXK C;  3IJ0 A;  2CO0 C;  4PSX B;  3SBR A;  4BL0 A;  3I8E A;  4UI9 R;  3I2N A;  3PSL A;  2HES X;  3OKY B;  4O9D A;  4EWR A;  4J77 A;  4LGN A;  3PVW B;  2BBK H;  2AGX A;  3NVN A;  2CN2 A;  3P4F A;  5HQG A;  4U1E I;  3SWS D;  4JT5 C;  4AOW A;  2YNO A;  5K1C C;  3HFQ A;  1N6F A;  2GC7 A;  3NVQ A;  2J57 G;  1N6D A;  2XL3 A;  2O9K A;  4KFM B;  2H3X A;  5IJ7 E;  4ZOX A;  3I7L A;  4LG8 A;  3OKW A;  1OMW B;  4U7A A;  3I8C A;  4JSV C;  3BG1 A;  2H13 A;  2AGZ A;  2H14 A;  4CI8 A;  4J87 A;  3EG6 A;  4FAV D;  1GXR A;  5GMK n;  3PVU B;  5I5J A;  2XYI A;  3K26 A;  5FA5 B;  3IJC A;  2TRC B;  3ORV D;  2AGW A;  4AEZ A;  5IC7 A;  2I3S A;  4X63 B;  3C5M A;  3K27 A;  2OJY A;  5HE1 B;  3F3F A;  3W15 A;  2CNX A;  4J84 A;  4J8B A;  5HE2 B;  4FA1 D;  4E5Z A;  3RRM C;  3PSC B;  1SHY B;  1K32 A;  3PXT D;  5IGO A;  1U2V C;  2H9M A;  2P9I C;  3IIW A;  3VA6 A;  5A2Q g;  4A09 A;  5EAP A;  4O3U B;  2HKM A;  5FXY A;  4MK0 B;  4GQ1 A;  4CY3 A;  2CO0 A;  3CFS B;  4J0W A;  2HYE A;  5IJ8 E;  4OWR A;  4X3E A;  4CI3 A;  3VH0 A;  2QC5 A;  2P9L C;  5CXB B;  5EMK B;  2HXC A;  2CE8 A;  3BWS A;  4J81 A;  1ERJ A;  4GQ2 P;  1SQ9 A;  3JPX A;  1U4C A;  2OK4 A;  2UZY B;  3MMY A;  3MXX A;  4O1Q D;  5FKQ A;  3EI4 B;  3SLE D;  4NSX A;  4J78 A;  5GXH A;  4E54 B;  5KDO B;  3SN6 B;  2Q7Q A;  5TEF A;  1FWX A;  2H9P A;  5EAL A;  3U4Y A;  3RN0 D;  5GXI A;  4A11 B;  2P9K C;  3MKQ A;  2HJ4 A;  3OL2 A;  4O45 A;  5CYK A;  4ES0 A;  5TF2 A;  2W18 A;  2PM6 B;  1GG2 B;  3JAM g;  1R5M A;  4GGC A;  4GQB B;  3GFC A;  1MDA H;  3I7O A;  3E0C A;  4TZ4 A;  3EI1 B;  3EI2 A;  2B5M A;  2UZX B;  4ERY A;  3EMH A;  3N0E A;  4QL1 A;  5H14 A;  1NEX B;  1RI6 A;  3RMZ D;  4ERQ A;  4PXW A;  2AGY A;  3PXS D;  3SFZ A;  2PM9 A;  4A0A B;  5CXC A;  3AFC A;  5EAM A;  5HE0 B;  3JB9 L;  4JT6 C;  4PNK B;  2XL2 A;  3V5W B;  4FWW A;  4JXM A;  5EAR A;  3SCY A;  2IUQ A;  2HKR A;  3SXT D;  2YMU A;  3DWL C;  4J82 A;  5IGQ A;  1N6E A;  4CI2 A;  1S4U X;  4GGA A;  2B4E A;  3PE7 A;  4H5I A;  4JSP C;  3RFG A;  4FA5 D;  2IWF A;  3KRW B;  1SQJ A;  4QQE A;  3ZWL B;  2CE9 A;  3C75 H;  3EI3 B;  5EM2 A;  4J86 A;  2OVQ B;  4GM8 A;  4J8G A; 
#chains in the Genus database with same CATH topology
 2B5N A;  3AL9 A;  3IJ1 A;  3JZN A;  3UVO A;  4FB1 D;  1YFQ A;  3AL8 A;  1VYH C;  2P9U C;  3VGZ A;  1GOF A;  1GOT B;  3EQ9 A;  4AX4 A;  5EML B;  4NAA A;  2I0S A;  4CZY A;  3JZG A;  4O3T B;  1QFS A;  3IUQ A;  2J56 H;  1NR0 A;  1XKS A;  4A08 B;  1E5T A;  2AQ5 A;  3VI3 A;  5EMM B;  1E8N A;  4HDJ A;  4G1E A;  4PBY A;  3L4O D;  4QRJ A;  4AN0 A;  4FA4 D;  4WK4 A;  3DSM A;  3CIK B;  1JJU B;  4J79 A;  3QI0 A;  5K19 A;  3SHF A;  3OTT A;  3ZE1 A;  3J80 g;  4H5J A;  2MTA H;  1QFM A;  2YBA A;  3PXW D;  3JRO A;  4FAN D;  5HDB A;  3SMR A;  4PSW B;  1MG2 A;  2YNN A;  3UR4 A;  3V7D B;  4CY1 A;  3OKY A;  3O4G A;  3A0F A;  5HE3 B;  4ZOY A;  2CN3 A;  2H9L A;  3JZH A;  4IRZ A;  3I7P A;  4A2L A;  1B9X A;  5AJA A;  4Y5R D;  3V4P A;  4YVD A;  3IUM A;  4ESG A;  3DXM C;  2OK6 A;  1BPO A;  1C9L A;  4ERZ A;  2BCJ B;  3EWE A;  2IAA A;  3MUN A;  3IVM A;  4DNV A;  4CZX A;  3FM0 A;  4K3I D;  2H9N A;  4GGD A;  1H2Y A;  5FLX g;  5THA A;  4K3J B;  4R7A B;  4CI1 A;  3B7F A;  4GM9 A;  4Z8L A;  4IMM A;  1TBG A;  2VZ1 A;  5M5V A;  2EIE A;  2OVR B;  3IUR A;  2GNQ A;  3RN1 D;  3UKU C;  3NIG A;  2J55 H;  3IKO A;  2H47 A;  4CC9 A;  1PEV A;  3SJL D;  1B9Y A;  3SVW D;  2XU7 A;  3FGB A;  2AH1 A;  2IUV A;  5M5R A;  1VE7 A;  3AH8 B;  2P9S C;  3IJE A;  3MZK A;  4E5Z B;  4JSX C;  1TYQ C;  3C9C A;  1PGU A;  5SXM A;  3UVL A;  4X60 B;  4CY2 A;  5JWZ A;  5C2V B;  1GOG A;  2HU7 A;  4JSN C;  4A09 B;  2VDL A;  3I7N A;  5FFO A;  3RFH A;  3OKT A;  3BG0 A;  4BCB A;  5IT9 g;  2IUP A;  2OVP B;  4A0B B;  3MUO A;  2XZG A;  1E8M A;  5FKT A;  1H2Z A;  4D9S A;  3O4J A;  2GC4 A;  4DNU A;  1OLZ A;  2QXV A;  3I89 A;  5FKR A;  5CXB A;  2G9A A;  3IUJ A;  4ZOV A;  1PI6 A;  1T2X A;  5AFU 3;  2YB8 B;  1Q47 A;  4I79 A;  4XYH A;  2HJB A;  2I0T A;  2YNP A;  4J73 A;  4Y7R A;  2H6Q A;  2P9P C;  1XHM A;  3UVM A;  2H68 A;  3KRX B;  3ODT A;  3EI4 A;  1MG3 A;  2QZP A;  4E54 A;  1A0R B;  2I3T A;  4A2M A;  5I5M A;  3DDU A;  3J81 g;  4GMB A;  4WK0 A;  3OL2 B;  5CYK B;  4UM9 A;  4A7J A;  4CY5 A;  3NIF A;  1P22 A;  2AH0 A;  4X61 B;  4A11 A;  1M1X A;  3EU7 A;  5B4W A;  3ZDY A;  2XDW A;  3GRE A;  3C99 A;  4G56 B;  2P9N C;  3L4M D;  2Z2O A;  4UM8 A;  1JOF A;  1TYE A;  2B5L A;  4FHL A;  3IIY A;  3NVX A;  3EI2 B;  3RLM D;  3ULE C;  3EI1 A;  5H17 A;  4XYI A;  3MKS B;  2IUR A;  3GC3 B;  5AMS A;  2XE4 A;  2PM9 B;  5CXC B;  4ZN4 A;  3JRP A;  2G99 A;  4FA9 D;  5HYN B;  2H6N A;  2H6K A;  3F3G A;  2VC2 A;  4A0A A;  4XEI C;  2PBI B;  1VZ3 A;  2EBS A;  4PBZ A;  3N0D A;  5TEE A;  5I5I A;  1JMZ B;  1UOQ A;  2OIZ A;  2Z2N A;  4L9O A;  4MMZ A;  5TDH B;  1H2W A;  2HU8 A;  4N14 A;  4BP8 A;  5FQD A;  2I0R A;  1JV2 A;  4A0B A;  2VDM A;  3MZL A;  1GP2 B;  2PM7 B;  4G55 A;  3CFV A;  4ZOZ A;  4DNW A;  5EMJ B;  1L0Q A;  4PC0 A;  4NEN A;  4GZ8 A;  4OZU A;  4QT8 A;  3SBQ A;  2Z2P A;  5EM2 B;  1H2X A;  4JD2 C;  4BH6 A;  3OW8 A;  3FRX A;  3T3M A;  3GD1 I;  3EI3 A;  5C9Z B;  3AL8 B;  3I7H A;  1QNI A;  3V9F A;  5H1M A;  2AGL A;  3UKR C;  4L3G D;  4L1Q D;  5M5S A;  1XIP A;  3I7K A;  3SBP A;  4CZV A;  4D6V A;  4QAM A;  4WJK A;  1UOP A;  2IWK A;  5E6R A;  3RSE C;  4IA9 A;  4BUJ C;  3FCS A;  3F3P A;  1GOH A;  1JMX B;  1PBY B;  2BKL A;  3MVD K;  3QHY B;  3UVN A;  4L3H D;  4A08 A;  5FKS A;  4JHN A;  4GM3 A;  4D0K A;  3DM0 A;  5M5T A;  1K8K C;  4LG9 A;  5GSA A;  4J0X A;  3UVK A;  1YR2 A;  5C2W B;  1I2M B;  1VE6 A;  3DXK C;  3IJ0 A;  2CO0 C;  4PSX B;  3SBR A;  3T3P A;  3I8E A;  4BL0 A;  4UI9 R;  3I2N A;  3PSL A;  2HES X;  3OKY B;  4O9D A;  4EWR A;  4J77 A;  4LGN A;  3PVW B;  2BBK H;  2AGX A;  3O4I A;  1A12 A;  3NVN A;  2CN2 A;  3P4F A;  4RE6 A;  1U8C A;  4U1E I;  5HQG A;  4RE5 A;  3SWS D;  4JT5 C;  4AOW A;  2YNO A;  5K1C C;  3HFQ A;  1N6F A;  4AN1 A;  2GC7 A;  3NVQ A;  2J57 G;  1N6D A;  2XL3 A;  4Z7Q A;  2O9K A;  2VDP A;  4KFM B;  5E6U A;  4AMY A;  5IJ7 E;  4ZOX A;  2VDN A;  3I7L A;  4LG8 A;  3OKW A;  1OMW B;  4NBM A;  4U7A A;  3I8C A;  4JSV C;  3BG1 A;  2H13 A;  2AGZ A;  2H14 A;  4CI8 A;  4J87 A;  3VI4 A;  2VDR A;  3EG6 A;  4FAV D;  1GXR A;  5GMK n;  3PVU B;  5I5J A;  4AMZ A;  2XYI A;  3K26 A;  4BCC A;  5FA5 B;  5M61 A;  3IJC A;  2TRC B;  4BP9 A;  3ORV D;  4MMY A;  2VDK A;  5C86 A;  2VZ3 A;  2AGW A;  4AEZ A;  5IC7 A;  2I3S A;  4X63 B;  3C5M A;  3K27 A;  2OJY A;  5HE1 B;  3F3F A;  3W15 A;  3FCU A;  2CNX A;  4J84 A;  4J8B A;  5HE2 B;  4FA1 D;  4E5Z A;  3RRM C;  3PSC B;  1SHY B;  1K32 A;  1O6G A;  3PXT D;  5IGO A;  1U2V C;  2H9M A;  2P9I C;  3IIW A;  3VA6 A;  5A2Q g;  4A09 A;  5EAP A;  2VDO A;  1L5G A;  4O3U B;  2HKM A;  5FXY A;  4J8G A;  4MK0 B;  4GQ1 A;  4CY3 A;  2CO0 A;  5FFG A;  3CFS B;  4J0W A;  2HYE A;  5IJ8 E;  4OWR A;  4X3E A;  4WK2 A;  4CI3 A;  3VH0 A;  2QC5 A;  2EID A;  2P9L C;  5CXB B;  5E6S A;  5EMK B;  4MMX A;  4NC4 A;  2HXC A;  2CE8 A;  3BWS A;  4L1M A;  4J81 A;  1ERJ A;  1C9I A;  1SQ9 A;  3JPX A;  1U4C A;  3MXX A;  2OK4 A;  2UZY B;  3MMY A;  4GQ2 P;  4O1Q D;  3K71 A;  5FKQ A;  3EI4 B;  3SLE D;  4NSX A;  4J78 A;  5GXH A;  4E54 B;  5KDO B;  4O2W A;  3SN6 B;  2Q7Q A;  2VDQ A;  5TEF A;  3ZDX A;  1FWX A;  4O02 A;  2H9P A;  5EAL A;  3U4Y A;  3RN0 D;  3K72 A;  5GXI A;  2HU5 A;  4A11 B;  2P9K C;  3MKQ A;  2HJ4 A;  3OL2 A;  4O45 A;  5CYK A;  4BCD A;  4ES0 A;  3ZDZ A;  5TF2 A;  4JHP C;  3NID A;  2W18 A;  2PM6 B;  1K3I A;  1GG2 B;  3JAM g;  1R5M A;  2JKX A;  1UTC A;  4GGC A;  4GQB B;  3GFC A;  1MDA H;  3I7O A;  3E0C A;  3KCI A;  4TZ4 A;  5M5U A;  3EI1 B;  1O6F A;  3EI2 A;  2B5M A;  2UZX B;  3EQ7 A;  4ERY A;  3EMH A;  3N0E A;  4QL1 A;  3K6S A;  3OF7 A;  5H14 A;  1NEX B;  1RI6 A;  3RMZ D;  4G1M A;  4ERQ A;  4PXW A;  2AGY A;  3PXS D;  3SFZ A;  2PM9 A;  4A0A B;  5CXC A;  3AFC A;  5EAM A;  5C92 A;  5HE0 B;  1JTD B;  3JB9 L;  4JT6 C;  1UOO A;  4PNK B;  2XL2 A;  3V5W B;  4FWW A;  1VZ2 A;  4JXM A;  5EAR A;  3SCY A;  2IUQ A;  4Z7O A;  2HKR A;  2EIB A;  3IUL A;  3ZE0 A;  3SXT D;  3EQ8 A;  2EIC A;  2YMU A;  3DWL C;  4J82 A;  5IGQ A;  1N6E A;  4CI2 A;  4Z7N A;  1S4U X;  2WQ8 A;  2B4E A;  4GGA A;  3PE7 A;  4H5I A;  3O4H A;  4JSP C;  3RFG A;  4FA5 D;  2IWF A;  3IUN A;  3V4V A;  2QR5 A;  3KRW B;  1SQJ A;  4QQE A;  3ZWL B;  2CE9 A;  3C75 H;  3EI3 B;  5EM2 A;  3ZE2 A;  4J86 A;  2OVQ B;  4GM8 A;  2H3X A; 
#chains in the Genus database with same CATH homology
 2B5N A;  3AL9 A;  3IJ1 A;  3JZN A;  3UVO A;  4FB1 D;  1YFQ A;  3AL8 A;  1VYH C;  2P9U C;  3VGZ A;  1GOT B;  5EML B;  2I0S A;  4CZY A;  3JZG A;  4O3T B;  2J56 H;  1NR0 A;  1XKS A;  4A08 B;  2AQ5 A;  5EMM B;  4HDJ A;  4PBY A;  3L4O D;  4QRJ A;  4FA4 D;  3DSM A;  3CIK B;  1JJU B;  4J79 A;  5K19 A;  3SHF A;  3OTT A;  3J80 g;  4H5J A;  2MTA H;  2YBA A;  3PXW D;  3JRO A;  4FAN D;  3SMR A;  4PSW B;  1MG2 A;  2YNN A;  3UR4 A;  3V7D B;  4CY1 A;  3OKY A;  3A0F A;  5HE3 B;  4ZOY A;  2CN3 A;  2H9L A;  3JZH A;  3I7P A;  4A2L A;  1B9X A;  5AJA A;  4Y5R D;  4YVD A;  4ESG A;  3DXM C;  2OK6 A;  4ERZ A;  2BCJ B;  3EWE A;  2IAA A;  4CZX A;  3FM0 A;  4K3I D;  2H9N A;  4GGD A;  5FLX g;  5THA A;  4K3J B;  4R7A B;  4CI1 A;  3B7F A;  4GM9 A;  4Z8L A;  4IMM A;  1TBG A;  2OVR B;  2GNQ A;  3RN1 D;  3UKU C;  2J55 H;  3IKO A;  2H47 A;  4CC9 A;  1PEV A;  3SJL D;  1B9Y A;  3SVW D;  2XU7 A;  3FGB A;  2AH1 A;  2IUV A;  3AH8 B;  2P9S C;  3MZK A;  4E5Z B;  4JSX C;  1TYQ C;  3C9C A;  1PGU A;  5SXM A;  3UVL A;  4X60 B;  4CY2 A;  5JWZ A;  5C2V B;  4JSN C;  4A09 B;  3I7N A;  3RFH A;  3OKT A;  3BG0 A;  5IT9 g;  2IUP A;  2OVP B;  4A0B B;  5FKT A;  2GC4 A;  1OLZ A;  2QXV A;  3I89 A;  5FKR A;  5CXB A;  2G9A A;  4ZOV A;  1PI6 A;  5AFU 3;  2YB8 B;  1Q47 A;  4I79 A;  4XYH A;  2HJB A;  2I0T A;  2YNP A;  4J73 A;  4Y7R A;  2H6Q A;  2P9P C;  1XHM A;  3UVM A;  2H68 A;  3KRX B;  3ODT A;  3EI4 A;  1MG3 A;  4E54 A;  1A0R B;  2I3T A;  4A2M A;  5I5M A;  3J81 g;  4GMB A;  3OL2 B;  5CYK B;  4A7J A;  4CY5 A;  1P22 A;  2AH0 A;  4X61 B;  4A11 A;  3EU7 A;  5B4W A;  3C99 A;  3GRE A;  4G56 B;  2P9N C;  2Z2O A;  3L4M D;  1JOF A;  2B5L A;  4FHL A;  3IIY A;  3NVX A;  3EI2 B;  3RLM D;  3ULE C;  3EI1 A;  5H17 A;  4XYI A;  3MKS B;  2IUR A;  5AMS A;  2PM9 B;  5CXC B;  4ZN4 A;  3JRP A;  2G99 A;  4FA9 D;  5HYN B;  2H6N A;  2H6K A;  3F3G A;  4A0A A;  4XEI C;  2PBI B;  2EBS A;  4PBZ A;  3N0D A;  5TEE A;  5I5I A;  1JMZ B;  2OIZ A;  2Z2N A;  4L9O A;  5TDH B;  4N14 A;  5FQD A;  2I0R A;  4A0B A;  3MZL A;  1GP2 B;  2PM7 B;  3CFV A;  4ZOZ A;  5EMJ B;  1L0Q A;  4PC0 A;  4GZ8 A;  4OZU A;  4QT8 A;  3SBQ A;  2Z2P A;  5EM2 B;  4JD2 C;  4BH6 A;  3OW8 A;  3FRX A;  3EI3 A;  5C9Z B;  3AL8 B;  3I7H A;  1QNI A;  3V9F A;  5H1M A;  2AGL A;  3UKR C;  4L3G D;  4L1Q D;  1XIP A;  3I7K A;  3SBP A;  4CZV A;  4D6V A;  2IWK A;  3RSE C;  4IA9 A;  4BUJ C;  3F3P A;  1JMX B;  1PBY B;  3UVN A;  4L3H D;  4A08 A;  5FKS A;  4GM3 A;  4D0K A;  3DM0 A;  1K8K C;  4LG9 A;  5GSA A;  4J0X A;  3UVK A;  5C2W B;  3DXK C;  3IJ0 A;  2CO0 C;  4PSX B;  3SBR A;  4BL0 A;  3I8E A;  4UI9 R;  3I2N A;  3PSL A;  2HES X;  3OKY B;  4O9D A;  4EWR A;  4J77 A;  4LGN A;  3PVW B;  2BBK H;  2AGX A;  3NVN A;  2CN2 A;  3P4F A;  5HQG A;  4U1E I;  3SWS D;  4JT5 C;  4AOW A;  2YNO A;  5K1C C;  3HFQ A;  1N6F A;  2GC7 A;  3NVQ A;  2J57 G;  1N6D A;  2XL3 A;  2O9K A;  4KFM B;  2H3X A;  5IJ7 E;  4ZOX A;  3I7L A;  4LG8 A;  3OKW A;  1OMW B;  4U7A A;  3I8C A;  4JSV C;  3BG1 A;  2H13 A;  2AGZ A;  2H14 A;  4CI8 A;  4J87 A;  3EG6 A;  4FAV D;  1GXR A;  5GMK n;  3PVU B;  5I5J A;  2XYI A;  3K26 A;  5FA5 B;  3IJC A;  2TRC B;  3ORV D;  2AGW A;  4AEZ A;  5IC7 A;  2I3S A;  4X63 B;  3C5M A;  3K27 A;  2OJY A;  5HE1 B;  3F3F A;  3W15 A;  2CNX A;  4J84 A;  4J8B A;  5HE2 B;  4FA1 D;  4E5Z A;  3RRM C;  3PSC B;  1SHY B;  1K32 A;  3PXT D;  5IGO A;  1U2V C;  2H9M A;  2P9I C;  3IIW A;  3VA6 A;  5A2Q g;  4A09 A;  5EAP A;  4O3U B;  2HKM A;  5FXY A;  4MK0 B;  4GQ1 A;  4CY3 A;  2CO0 A;  3CFS B;  4J0W A;  2HYE A;  5IJ8 E;  4OWR A;  4X3E A;  4CI3 A;  3VH0 A;  2QC5 A;  2P9L C;  5CXB B;  5EMK B;  2HXC A;  2CE8 A;  3BWS A;  4J81 A;  1ERJ A;  4GQ2 P;  1SQ9 A;  3JPX A;  1U4C A;  2OK4 A;  2UZY B;  3MMY A;  3MXX A;  4O1Q D;  5FKQ A;  3EI4 B;  3SLE D;  4NSX A;  4J78 A;  5GXH A;  4E54 B;  5KDO B;  3SN6 B;  2Q7Q A;  5TEF A;  1FWX A;  2H9P A;  5EAL A;  3U4Y A;  3RN0 D;  5GXI A;  4A11 B;  2P9K C;  3MKQ A;  2HJ4 A;  3OL2 A;  4O45 A;  5CYK A;  4ES0 A;  5TF2 A;  2W18 A;  2PM6 B;  1GG2 B;  3JAM g;  1R5M A;  4GGC A;  4GQB B;  3GFC A;  1MDA H;  3I7O A;  3E0C A;  4TZ4 A;  3EI1 B;  3EI2 A;  2B5M A;  2UZX B;  4ERY A;  3EMH A;  3N0E A;  4QL1 A;  5H14 A;  1NEX B;  1RI6 A;  3RMZ D;  4ERQ A;  4PXW A;  2AGY A;  3PXS D;  3SFZ A;  2PM9 A;  4A0A B;  5CXC A;  3AFC A;  5EAM A;  5HE0 B;  3JB9 L;  4JT6 C;  4PNK B;  2XL2 A;  3V5W B;  4FWW A;  4JXM A;  5EAR A;  3SCY A;  2IUQ A;  2HKR A;  3SXT D;  2YMU A;  3DWL C;  4J82 A;  5IGQ A;  1N6E A;  4CI2 A;  1S4U X;  4GGA A;  2B4E A;  3PE7 A;  4H5I A;  4JSP C;  3RFG A;  4FA5 D;  2IWF A;  3KRW B;  1SQJ A;  4QQE A;  3ZWL B;  2CE9 A;  3C75 H;  3EI3 B;  5EM2 A;  4J86 A;  2OVQ B;  4GM8 A;  4J8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...