5HQGA

Wd40 domain of human e3 ubiquitin ligase cop1 (rfwd2)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
341
structure length
324
Chain Sequence
EFQECLSKFTRYNSVRPLATLSYALYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords E3 ubiquitin-protein ligase RFWD2
publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 324
sequence length 341
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5hqgA00
3CFVA 4FA5D 4K3ID 4O1QD 3SXTD 5JWZA 3EWEA 2I3TA 2HJBA 2CE9A 1B9XA 4GQ1A 2HKMA 3BG0A 1Q47A 4JXMA 4LG8A 4XYHA 5HQGA 2YNOA 1U2VC 3EMHA 5FKQA 5I5MA 2YBAA 2B5LA 4BL0A 4GZ8A 4CI1A 3AL9A 1B9YA 4JD2C 4AEZA 3FGBA 2TRCB 5TEFA 3EU7A 3JROA 1PEVA 2CN3A 4H5JA 1OMWB 2OIZA 1SQ9A 3I7KA 3RFGA 1OLZA 3JB9L 3AFCA 4X63B 3N0EA 4GQBB 3AL8A 2J56H 4FAND 3SBQA 4BH6A 5C2VB 2H13A 3ODTA 3VA6A 1PI6A 1XHMA 1NEXB 2J57G 2Q7QA 4O9DA 3KRWB 2O9KA 3SBRA 4GQ2P 1SHYB 5H1MA 2H9PA 2UZXB 3U4YA 4HDJA 2HESX 3SVWD 1ERJA 1JOFA 3DXKC 3EI1B 1GXRA 5TDHB 4J73A 3RSEC 3FRXA 1FWXA 3I8CA 1GP2B 1JMXB 5I5JA 4L9OA 4J79A 5C9ZB 4ZOXA 2BCJB 5EMJB 4IA9A 4A11A 1GOTB 1XKSA 1NR0A 3UVLA 5H17A 3NVXA 2OJYA 3I7NA 2AH1A 3NVQA 2CO0C 5AJAA 4G56B 4PNKB 2QC5A 2PM6B 2OVRB 1R5MA 4J81A 2XYIA 3AH8B 2HJ4A 3MMYA 2OK4A 3RRMC 4J82A 3DXMC 5FLXg 2XU7A 4J8GA 4CY3A 3PSCB 1K8KC 2YMUA 4U1EI 5HE0B 3SFZA 3JZHA 4GM8A 3W15A 3SLED 1JJUB 5EARA 3I7HA 3K26A 2H9LA 3UR4A 3F3PA 4X3EA 4A2LA 4XYIA 4A0AA 2CO0A 5A2Qg 2AH0A 3F3FA 3EI3A 3ORVD 4OZUA 5FXYA 2OVQB 5EMLB 1U4CA 2I0SA 4J8BA 5FA5B 3OTTA 4YVDA 3OL2A 2EBSA 4EWRA 4OWRA 1GG2B 5EAMA 2UZYB 3I7OA 4QT8A 3PXWD 3I2NA 3ULEC 2GC4A 5AMSA 1L0QA 3OKYA 1TBGA 3RMZD 1N6EA 3V5WB 3OW8A 3C99A 2IURA 5K19A 3CIKB 4JSXC 3V7DB 3SN6B 3DM0A 3MZLA 4ZOZA 5CXBA 3HFQA 4IMMA 3OKWA 3F3GA 2H9NA 4E5ZA 4A0AB 2IUVA 3C5MA 5GXHA 4JSPC 2G9AA 3EI3B 3RLMD 2PM7B 1P22A 5HYNB 4ESGA 4Z8LA 3SJLD 3SCYA 2IWFA 5C2WB 4CC9A 4CI3A 2H47A 1RI6A 4X60B 3OL2B 3JZGA 4J86A 4A08A 3IJ1A 3GFCA 3CFSB 1S4UX 5H14A 4QQEA 2AGWA 2P9SC 3SWSD 4CZXA 3OKYB 2IWKA 4O3UB 4L1QD 3N0DA 5I5IA 4GGDA 2YB8B 3L4OD 4E54A 2Z2PA 3UVMA 3B7FA 3AL8B 5CXBB 4CI8A 3PSLA 1QNIA 4BUJC 4E5ZB 2H14A 4D0KA 5CXCA 3PVUB 5GXIA 2H3XA 3I8EA 4J78A 2PBIB 4CY1A 4UI9R 3JPXA 3DSMA 1N6DA 5IGQA 5CYKA 3EI2A 3EI4A 4PXWA 1MG3A 4AOWA 2QXVA 2H6QA 5TF2A 4LGNA 4A0BA 4JT5C 3PVWB 4PSXB 5GMKn 4JSVC 3J80g 5B4WA 3JAMg 1A0RB 3BG1A 3BWSA 3SHFA 4CY5A 2G99A 3PXTD 4NSXA 4GGAA 2YNNA 4A11B 1MDAH 2H6KA 3SBPA 2PM9A 5IJ8E 1JMZB 5HE2B 4LG9A 4O3TB 4L3GD 5EAPA 3MKQA 2P9KC 5TEEA 3ZWLB 5CXCB 5FQDA 4H5IA 2H68A 1K32A 1N6FA 3MXXA 2P9UC 1MG2A 5HE3B 4PBYA 2AGXA 3SMRA 4FWWA 2MTAH 3OKTA 5EMKB 5GSAA 4GM3A 1XIPA 3VGZA 2H9MA 5KDOB 2Z2NA 2CN2A 3E0CA 5CYKB 3EI2B 2IUPA 3EI4B 2GC7A 2I3SA 2AGZA 4X61B 2IAAA 2P9IC 4A0BB 4Y5RD 3UVOA 3GREA 5THAA 2B4EA 2HYEA 5K1CC 5EM2A 3EI1A 3PXSD 2I0RA 3IIYA 4FA9D 3L4MD 3I7PA 2IUQA 2PM9B 2J55H 4ZOYA 4JSNC 1TYQC 4J77A 1PGUA 5EMMB 2AQ5A 4CZVA 4D6VA 4ERZA 2YNPA 4R7AB 4PBZA 4QL1A 2AGLA 3JRPA 3UKRC 4XEIC 5AFU3 5FKTA 4A09A 4FB1D 2OK6A 4GM9A 5FKRA 5HE1B 1YFQA 3JZNA 4J0XA 3RFHA 2H6NA 2W18A 1PBYB 2XL2A 4FHLA 3EG6A 5EM2B 2P9PC 3C75H 4FAVD 3FM0A 5SXMA 3MZKA 3IIWA 2HKRA 2XL3A 2CNXA 3KRXB 4CI2A 4JT6C 3DWLC 3NVNA 3A0FA 3V9FA 3VH0A 4J0WA 2BBKH 3PE7A 4A7JA 3P4FA 4ES0A 3C9CA 4J87A 4O45A 5IT9g 2I0TA 4J84A 4ERQA 3IJCA 3UVKA 4CY2A 3K27A 4FA1D 3MKSB 3IKOA 4A08B 4KFMB 2B5NA 5FKSA 2Z2OA 5IJ7E 4MK0B 4QRJA 3I7LA 4A09B 1SQJA 5IC7A 2OVPB 3UVNA 5IGOA 4K3JB 4I79A 2P9LC 4ERYA 5EALA 4E54B 3I89A 2HXCA 4L3HD 2GNQA 1VYHC 4GMBA 4N14A 3J81g 3RN0D 4PSWB 3IJ0A 4Y7RA 4PC0A 4GGCA 2AGYA 3UKUC 4TZ4A 4U7AA 4A2MA 4ZN4A 4ZOVA 2P9NC 3RN1D 4FA4D 2B5MA 4CZYA 2CE8A
chains in the Genus database with same CATH superfamily
3CFVA 4FA5D 4K3ID 4O1QD 4AN1A 5E6RA 3SXTD 5JWZA 3EWEA 2QZPA 2I3TA 3MUNA 2HJBA 4MMYA 2CE9A 5M5VA 4UM9A 4BCBA 1B9XA 4GQ1A 2HKMA 3BG0A 1Q47A 4JXMA 4LG8A 4XYHA 5HQGA 2YNOA 1U2VC 3EMHA 5HDBA 5FKQA 5I5MA 2YBAA 2B5LA 2VC2A 4BL0A 1M1XA 4GZ8A 4CI1A 3AL9A 1B9YA 4JD2C 4AEZA 3FGBA 4RE6A 1K3IA 2TRCB 4AMZA 5TEFA 4WJKA 3EU7A 3JROA 1PEVA 3IVMA 2CN3A 4H5JA 1OMWB 2OIZA 1SQ9A 3I7KA 3RFGA 1OLZA 3T3MA 4UM8A 3JB9L 3O4HA 3AFCA 4X63B 3N0EA 4GQBB 3AL8A 5M5RA 2J56H 4FAND 3SBQA 1VZ3A 4BH6A 5C2VB 2H13A 3ODTA 3QI0A 3VI4A 3VA6A 1PI6A 1XHMA 2VZ3A 1NEXB 2J57G 2Q7QA 1UOOA 4O9DA 3KRWB 2O9KA 3SBRA 4GQ2P 1SHYB 5H1MA 4Z7QA 2H9PA 2UZXB 3U4YA 4HDJA 2HESX 3SVWD 1ERJA 4MMZA 1JOFA 3DXKC 3EI1B 1GXRA 2VDMA 1GOGA 5TDHB 4J73A 3RSEC 3IURA 3FRXA 1FWXA 1YR2A 3I8CA 1GP2B 1JMXB 5I5JA 4L9OA 4J79A 5C9ZB 3OF7A 4O2WA 4ZOXA 2BCJB 5EMJB 2EIBA 4IA9A 4A11A 1GOTB 1XKSA 1NR0A 1A12A 2VDNA 2XE4A 3UVLA 3MUOA 4MMXA 1H2XA 5H17A 3ZDYA 3FCSA 1QFSA 3NVXA 4DNWA 2OJYA 1GOHA 3I7NA 1GOFA 2AH1A 3KCIA 3NVQA 2CO0C 5AJAA 4BP9A 4G56B 4PNKB 2QC5A 2PM6B 2OVRB 1R5MA 4J81A 2XYIA 2XZGA 3AH8B 2HJ4A 3MMYA 2OK4A 4WK4A 3RRMC 3K72A 4J82A 3DXMC 5FLXg 2XU7A 4J8GA 4CY3A 3PSCB 1K8KC 2YMUA 4U1EI 5HE0B 3SFZA 3JZHA 4GM8A 4JHNA 3W15A 1I2MB 3IUNA 3SLED 3VI3A 1JJUB 2WQ8A 5EARA 3I7HA 3K26A 2H9LA 3UR4A 3F3PA 2VDQA 3GC3B 4X3EA 4A2LA 2BKLA 4XYIA 4A0AA 2HU5A 2CO0A 5A2Qg 2AH0A 3F3FA 3EI3A 3IUJA 3ORVD 1UTCA 4OZUA 5FXYA 4O02A 2OVQB 5EMLB 1U4CA 1UOPA 2I0SA 4J8BA 5FA5B 4WK0A 3OTTA 4YVDA 3OL2A 2EBSA 4L1MA 5FFGA 4EWRA 4OWRA 1GG2B 5EAMA 1C9IA 2UZYB 3I7OA 4QT8A 5FFOA 3PXWD 3I2NA 3ULEC 2VZ1A 3V4PA 2GC4A 5AMSA 1L0QA 3OKYA 1TBGA 3RMZD 1N6EA 3V5WB 4IRZA 2EIEA 1H2WA 3OW8A 3C99A 2IURA 5K19A 4RE5A 4G1MA 3CIKB 4JSXC 3ZDZA 3V7DB 4DNUA 3SN6B 3DM0A 3O4GA 3MZLA 1H2YA 4ZOZA 5CXBA 3HFQA 4IMMA 3OKWA 3F3GA 2H9NA 4E5ZA 4A0AB 3O4IA 2IUVA 3C5MA 5GXHA 4JSPC 2G9AA 5M61A 3EI3B 3RLMD 2PM7B 1P22A 5HYNB 4ESGA 4Z8LA 3SJLD 3SCYA 2IWFA 5C2WB 4BCCA 3O4JA 4CC9A 4CI3A 2H47A 1RI6A 4X60B 3OL2B 3JZGA 4J86A 2HU8A 4A08A 3IJ1A 3GFCA 3CFSB 3IUMA 1S4UX 3EQ8A 5H14A 4QQEA 4NBMA 2AGWA 3ZE1A 2P9SC 3SWSD 4CZXA 3OKYB 2IWKA 4O3UB 3ZDXA 3IUQA 4L1QD 3N0DA 3V4VA 3IJEA 5I5IA 4GGDA 2YB8B 3L4OD 4E54A 2Z2PA 3T3PA 3UVMA 2VDRA 3B7FA 3AL8B 5CXBB 4CI8A 3PSLA 1QNIA 4JHPC 4BUJC 2VDKA 4E5ZB 3FCUA 2H14A 3IULA 5E6SA 4D0KA 5CXCA 3PVUB 5GXIA 2H3XA 3I8EA 4J78A 5C92A 2PBIB 2VDPA 4CY1A 4UI9R 3JPXA 3DSMA 1N6DA 5IGQA 5CYKA 3EI2A 3EI4A 4PXWA 1MG3A 4AOWA 1T2XA 2H6QA 2QXVA 5TF2A 4LGNA 4A0BA 4JT5C 3QHYB 3PVWB 1BPOA 4PSXB 5GMKn 4JSVC 3J80g 5B4WA 3JAMg 1A0RB 3BG1A 3BWSA 2EIDA 4NC4A 3SHFA 4CY5A 2JKXA 2G99A 3PXTD 4NSXA 4GGAA 5M5UA 1VE7A 2YNNA 4A11B 1MDAH 2H6KA 3SBPA 4QAMA 4NENA 2PM9A 3ZE0A 5IJ8E 1JMZB 1E8MA 5HE2B 4LG9A 1U8CA 4O3TB 4L3GD 5EAPA 3MKQA 2P9KC 5TEEA 1C9LA 3ZWLB 3K6SA 5CXCB 5FQDA 3DDUA 4H5IA 1JV2A 2H68A 1K32A 1N6FA 3MXXA 4NAAA 2P9UC 1JTDB 1MG2A 5HE3B 4PBYA 2AGXA 3SMRA 4FWWA 2HU7A 2MTAH 3OKTA 5EMKB 5GSAA 4GM3A 4BP8A 1XIPA 3VGZA 2H9MA 5KDOB 2Z2NA 2CN2A 3E0CA 4WK2A 5CYKB 4AN0A 2IUPA 3EI4B 3EI2B 2GC7A 2I3SA 2AGZA 4X61B 2IAAA 2P9IC 4D9SA 4A0BB 4Y5RD 3UVOA 3GREA 5THAA 2EICA 2B4EA 2HYEA 1O6GA 5K1CC 5EM2A 3EI1A 1H2ZA 3PXSD 2I0RA 1O6FA 3IIYA 4FA9D 3L4MD 1UOQA 3I7PA 2IUQA 2PM9B 2J55H 4ZOYA 4JSNC 1TYQC 4J77A 1PGUA 5EMMB 2AQ5A 4CZVA 5M5TA 2XDWA 3NIGA 1TYEA 4D6VA 4ERZA 3NIFA 2YNPA 1QFMA 4R7AB 4PBZA 4QL1A 2AGLA 3JRPA 3UKRC 4XEIC 5AFU3 5FKTA 4A09A 4FB1D 3MVDK 1L5GA 4AMYA 1VE6A 2OK6A 4GM9A 5FKRA 5HE1B 1VZ2A 1YFQA 3JZNA 4J0XA 3RFHA 2H6NA 5E6UA 2W18A 1PBYB 2XL2A 4FHLA 3EG6A 5EM2B 1E8NA 2P9PC 3C75H 4FAVD 3FM0A 5SXMA 3MZKA 3IIWA 2HKRA 2XL3A 2CNXA 3KRXB 4CI2A 4JT6C 3DWLC 3NVNA 3NIDA 3A0FA 3V9FA 3VH0A 4J0WA 2BBKH 2QR5A 3PE7A 4A7JA 3P4FA 4ES0A 3C9CA 4J87A 4O45A 5IT9g 2I0TA 4J84A 5M5SA 4ERQA 2VDLA 3GD1I 4BCDA 3IJCA 3UVKA 4CY2A 3K27A 4FA1D 3MKSB 3IKOA 4A08B 4KFMB 2B5NA 5FKSA 2VDOA 2Z2OA 4MK0B 5IJ7E 3K71A 4QRJA 4Z7NA 3I7LA 4A09B 4AX4A 1SQJA 5IC7A 2OVPB 3UVNA 5IGOA 4Z7OA 4K3JB 4I79A 2P9LC 4ERYA 5C86A 5EALA 4E54B 3I89A 4DNVA 2HXCA 4L3HD 2GNQA 1VYHC 4GMBA 4N14A 3J81g 3RN0D 1E5TA 4PSWB 3IJ0A 4Y7RA 4PC0A 4GGCA 2AGYA 3UKUC 4TZ4A 4U7AA 3ZE2A 3EQ9A 4G55A 4A2MA 4ZN4A 4ZOVA 2P9NC 3RN1D 3EQ7A 4FA4D 2B5MA 4G1EA 4CZYA 2CE8A
chains in the Genus database with same CATH topology
3CFVA 4FA5D 4K3ID 4O1QD 3SXTD 5JWZA 3EWEA 2I3TA 2HJBA 2CE9A 1B9XA 4GQ1A 2HKMA 3BG0A 1Q47A 4JXMA 4LG8A 4XYHA 5HQGA 2YNOA 1U2VC 3EMHA 5FKQA 5I5MA 2YBAA 2B5LA 4BL0A 4GZ8A 4CI1A 3AL9A 1B9YA 4JD2C 4AEZA 3FGBA 2TRCB 5TEFA 3EU7A 3JROA 1PEVA 2CN3A 4H5JA 1OMWB 2OIZA 1SQ9A 3I7KA 3RFGA 1OLZA 3JB9L 3AFCA 4X63B 3N0EA 4GQBB 3AL8A 2J56H 4FAND 3SBQA 4BH6A 5C2VB 2H13A 3ODTA 3VA6A 1PI6A 1XHMA 1NEXB 2J57G 2Q7QA 4O9DA 3KRWB 2O9KA 3SBRA 4GQ2P 1SHYB 5H1MA 2H9PA 2UZXB 3U4YA 4HDJA 2HESX 3SVWD 1ERJA 1JOFA 3DXKC 3EI1B 1GXRA 5TDHB 4J73A 3RSEC 3FRXA 1FWXA 3I8CA 1GP2B 1JMXB 5I5JA 4L9OA 4J79A 5C9ZB 4ZOXA 2BCJB 5EMJB 4IA9A 4A11A 1GOTB 1XKSA 1NR0A 3UVLA 5H17A 3NVXA 2OJYA 3I7NA 2AH1A 3NVQA 2CO0C 5AJAA 4G56B 4PNKB 2QC5A 2PM6B 2OVRB 1R5MA 4J81A 2XYIA 3AH8B 2HJ4A 3MMYA 2OK4A 3RRMC 4J82A 3DXMC 5FLXg 2XU7A 4J8GA 4CY3A 3PSCB 1K8KC 2YMUA 4U1EI 5HE0B 3SFZA 3JZHA 4GM8A 3W15A 3SLED 1JJUB 5EARA 3I7HA 3K26A 2H9LA 3UR4A 3F3PA 4X3EA 4A2LA 4XYIA 4A0AA 2CO0A 5A2Qg 2AH0A 3F3FA 3EI3A 3ORVD 4OZUA 5FXYA 2OVQB 5EMLB 1U4CA 2I0SA 4J8BA 5FA5B 3OTTA 4YVDA 3OL2A 2EBSA 4EWRA 4OWRA 1GG2B 5EAMA 2UZYB 3I7OA 4QT8A 3PXWD 3I2NA 3ULEC 2GC4A 5AMSA 1L0QA 3OKYA 1TBGA 3RMZD 1N6EA 3V5WB 3OW8A 3C99A 2IURA 5K19A 3CIKB 4JSXC 3V7DB 3SN6B 3DM0A 3MZLA 4ZOZA 5CXBA 3HFQA 4IMMA 3OKWA 3F3GA 2H9NA 4E5ZA 4A0AB 2IUVA 3C5MA 5GXHA 4JSPC 2G9AA 3EI3B 3RLMD 2PM7B 1P22A 5HYNB 4ESGA 4Z8LA 3SJLD 3SCYA 2IWFA 5C2WB 4CC9A 4CI3A 2H47A 1RI6A 4X60B 3OL2B 3JZGA 4J86A 4A08A 3IJ1A 3GFCA 3CFSB 1S4UX 5H14A 4QQEA 2AGWA 2P9SC 3SWSD 4CZXA 3OKYB 2IWKA 4O3UB 4L1QD 3N0DA 5I5IA 4GGDA 2YB8B 3L4OD 4E54A 2Z2PA 3UVMA 3B7FA 3AL8B 5CXBB 4CI8A 3PSLA 1QNIA 4BUJC 4E5ZB 2H14A 4D0KA 5CXCA 3PVUB 5GXIA 2H3XA 3I8EA 4J78A 2PBIB 4CY1A 4UI9R 3JPXA 3DSMA 1N6DA 5IGQA 5CYKA 3EI2A 3EI4A 4PXWA 1MG3A 4AOWA 2QXVA 2H6QA 5TF2A 4LGNA 4A0BA 4JT5C 3PVWB 4PSXB 5GMKn 4JSVC 3J80g 5B4WA 3JAMg 1A0RB 3BG1A 3BWSA 3SHFA 4CY5A 2G99A 3PXTD 4NSXA 4GGAA 2YNNA 4A11B 1MDAH 2H6KA 3SBPA 2PM9A 5IJ8E 1JMZB 5HE2B 4LG9A 4O3TB 4L3GD 5EAPA 3MKQA 2P9KC 5TEEA 3ZWLB 5CXCB 5FQDA 4H5IA 2H68A 1K32A 1N6FA 3MXXA 2P9UC 1MG2A 5HE3B 4PBYA 2AGXA 3SMRA 4FWWA 2MTAH 3OKTA 5EMKB 5GSAA 4GM3A 1XIPA 3VGZA 2H9MA 5KDOB 2Z2NA 2CN2A 3E0CA 5CYKB 3EI2B 2IUPA 3EI4B 2GC7A 2I3SA 2AGZA 4X61B 2IAAA 2P9IC 4A0BB 4Y5RD 3UVOA 3GREA 5THAA 2B4EA 2HYEA 5K1CC 5EM2A 3EI1A 3PXSD 2I0RA 3IIYA 4FA9D 3L4MD 3I7PA 2IUQA 2PM9B 2J55H 4ZOYA 4JSNC 1TYQC 4J77A 1PGUA 5EMMB 2AQ5A 4CZVA 4D6VA 4ERZA 2YNPA 4R7AB 4PBZA 4QL1A 2AGLA 3JRPA 3UKRC 4XEIC 5AFU3 5FKTA 4A09A 4FB1D 2OK6A 4GM9A 5FKRA 5HE1B 1YFQA 3JZNA 4J0XA 3RFHA 2H6NA 2W18A 1PBYB 2XL2A 4FHLA 3EG6A 5EM2B 2P9PC 3C75H 4FAVD 3FM0A 5SXMA 3MZKA 3IIWA 2HKRA 2XL3A 2CNXA 3KRXB 4CI2A 4JT6C 3DWLC 3NVNA 3A0FA 3V9FA 3VH0A 4J0WA 2BBKH 3PE7A 4A7JA 3P4FA 4ES0A 3C9CA 4J87A 4O45A 5IT9g 2I0TA 4J84A 4ERQA 3IJCA 3UVKA 4CY2A 3K27A 4FA1D 3MKSB 3IKOA 4A08B 4KFMB 2B5NA 5FKSA 2Z2OA 5IJ7E 4MK0B 4QRJA 3I7LA 4A09B 1SQJA 5IC7A 2OVPB 3UVNA 5IGOA 4K3JB 4I79A 2P9LC 4ERYA 5EALA 4E54B 3I89A 2HXCA 4L3HD 2GNQA 1VYHC 4GMBA 4N14A 3J81g 3RN0D 4PSWB 3IJ0A 4Y7RA 4PC0A 4GGCA 2AGYA 3UKUC 4TZ4A 4U7AA 4A2MA 4ZN4A 4ZOVA 2P9NC 3RN1D 4FA4D 2B5MA 4CZYA 2CE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFV A;  4FA5 D;  4K3I D;  4O1Q D;  3SXT D;  5JWZ A;  3EWE A;  2I3T A;  2HJB A;  2CE9 A;  1B9X A;  4GQ1 A;  2HKM A;  3BG0 A;  1Q47 A;  4JXM A;  4LG8 A;  4XYH A;  5HQG A;  2YNO A;  1U2V C;  3EMH A;  5FKQ A;  5I5M A;  2YBA A;  2B5L A;  4BL0 A;  4GZ8 A;  4CI1 A;  3AL9 A;  1B9Y A;  4JD2 C;  4AEZ A;  3FGB A;  2TRC B;  5TEF A;  3EU7 A;  3JRO A;  1PEV A;  2CN3 A;  4H5J A;  1OMW B;  2OIZ A;  1SQ9 A;  3I7K A;  3RFG A;  1OLZ A;  3JB9 L;  3AFC A;  4X63 B;  3N0E A;  4GQB B;  3AL8 A;  2J56 H;  4FAN D;  3SBQ A;  4BH6 A;  5C2V B;  2H13 A;  3ODT A;  3VA6 A;  1PI6 A;  1XHM A;  1NEX B;  2J57 G;  2Q7Q A;  4O9D A;  3KRW B;  2O9K A;  3SBR A;  4GQ2 P;  1SHY B;  5H1M A;  2H9P A;  2UZX B;  3U4Y A;  4HDJ A;  2HES X;  3SVW D;  1ERJ A;  1JOF A;  3DXK C;  3EI1 B;  1GXR A;  5TDH B;  4J73 A;  3RSE C;  3FRX A;  1FWX A;  3I8C A;  1GP2 B;  1JMX B;  5I5J A;  4L9O A;  4J79 A;  5C9Z B;  4ZOX A;  2BCJ B;  5EMJ B;  4IA9 A;  4A11 A;  1GOT B;  1XKS A;  1NR0 A;  3UVL A;  5H17 A;  3NVX A;  2OJY A;  3I7N A;  2AH1 A;  3NVQ A;  2CO0 C;  5AJA A;  4G56 B;  4PNK B;  2QC5 A;  2PM6 B;  2OVR B;  1R5M A;  4J81 A;  2XYI A;  3AH8 B;  2HJ4 A;  3MMY A;  2OK4 A;  3RRM C;  4J82 A;  3DXM C;  5FLX g;  2XU7 A;  4J8G A;  4CY3 A;  3PSC B;  1K8K C;  2YMU A;  4U1E I;  5HE0 B;  3SFZ A;  3JZH A;  4GM8 A;  3W15 A;  3SLE D;  1JJU B;  5EAR A;  3I7H A;  3K26 A;  2H9L A;  3UR4 A;  3F3P A;  4X3E A;  4A2L A;  4XYI A;  4A0A A;  2CO0 A;  5A2Q g;  2AH0 A;  3F3F A;  3EI3 A;  3ORV D;  4OZU A;  5FXY A;  2OVQ B;  5EML B;  1U4C A;  2I0S A;  4J8B A;  5FA5 B;  3OTT A;  4YVD A;  3OL2 A;  2EBS A;  4EWR A;  4OWR A;  1GG2 B;  5EAM A;  2UZY B;  3I7O A;  4QT8 A;  3PXW D;  3I2N A;  3ULE C;  2GC4 A;  5AMS A;  1L0Q A;  3OKY A;  1TBG A;  3RMZ D;  1N6E A;  3V5W B;  3OW8 A;  3C99 A;  2IUR A;  5K19 A;  3CIK B;  4JSX C;  3V7D B;  3SN6 B;  3DM0 A;  3MZL A;  4ZOZ A;  5CXB A;  3HFQ A;  4IMM A;  3OKW A;  3F3G A;  2H9N A;  4E5Z A;  4A0A B;  2IUV A;  3C5M A;  5GXH A;  4JSP C;  2G9A A;  3EI3 B;  3RLM D;  2PM7 B;  1P22 A;  5HYN B;  4ESG A;  4Z8L A;  3SJL D;  3SCY A;  2IWF A;  5C2W B;  4CC9 A;  4CI3 A;  2H47 A;  1RI6 A;  4X60 B;  3OL2 B;  3JZG A;  4J86 A;  4A08 A;  3IJ1 A;  3GFC A;  3CFS B;  1S4U X;  5H14 A;  4QQE A;  2AGW A;  2P9S C;  3SWS D;  4CZX A;  3OKY B;  2IWK A;  4O3U B;  4L1Q D;  3N0D A;  5I5I A;  4GGD A;  2YB8 B;  3L4O D;  4E54 A;  2Z2P A;  3UVM A;  3B7F A;  3AL8 B;  5CXB B;  4CI8 A;  3PSL A;  1QNI A;  4BUJ C;  4E5Z B;  2H14 A;  4D0K A;  5CXC A;  3PVU B;  5GXI A;  2H3X A;  3I8E A;  4J78 A;  2PBI B;  4CY1 A;  4UI9 R;  3JPX A;  3DSM A;  1N6D A;  5IGQ A;  5CYK A;  3EI2 A;  3EI4 A;  4PXW A;  1MG3 A;  4AOW A;  2QXV A;  2H6Q A;  5TF2 A;  4LGN A;  4A0B A;  4JT5 C;  3PVW B;  4PSX B;  5GMK n;  4JSV C;  3J80 g;  5B4W A;  3JAM g;  1A0R B;  3BG1 A;  3BWS A;  3SHF A;  4CY5 A;  2G99 A;  3PXT D;  4NSX A;  4GGA A;  2YNN A;  4A11 B;  1MDA H;  2H6K A;  3SBP A;  2PM9 A;  5IJ8 E;  1JMZ B;  5HE2 B;  4LG9 A;  4O3T B;  4L3G D;  5EAP A;  3MKQ A;  2P9K C;  5TEE A;  3ZWL B;  5CXC B;  5FQD A;  4H5I A;  2H68 A;  1K32 A;  1N6F A;  3MXX A;  2P9U C;  1MG2 A;  5HE3 B;  4PBY A;  2AGX A;  3SMR A;  4FWW A;  2MTA H;  3OKT A;  5EMK B;  5GSA A;  4GM3 A;  1XIP A;  3VGZ A;  2H9M A;  5KDO B;  2Z2N A;  2CN2 A;  3E0C A;  5CYK B;  3EI2 B;  2IUP A;  3EI4 B;  2GC7 A;  2I3S A;  2AGZ A;  4X61 B;  2IAA A;  2P9I C;  4A0B B;  4Y5R D;  3UVO A;  3GRE A;  5THA A;  2B4E A;  2HYE A;  5K1C C;  5EM2 A;  3EI1 A;  3PXS D;  2I0R A;  3IIY A;  4FA9 D;  3L4M D;  3I7P A;  2IUQ A;  2PM9 B;  2J55 H;  4ZOY A;  4JSN C;  1TYQ C;  4J77 A;  1PGU A;  5EMM B;  2AQ5 A;  4CZV A;  4D6V A;  4ERZ A;  2YNP A;  4R7A B;  4PBZ A;  4QL1 A;  2AGL A;  3JRP A;  3UKR C;  4XEI C;  5AFU 3;  5FKT A;  4A09 A;  4FB1 D;  2OK6 A;  4GM9 A;  5FKR A;  5HE1 B;  1YFQ A;  3JZN A;  4J0X A;  3RFH A;  2H6N A;  2W18 A;  1PBY B;  2XL2 A;  4FHL A;  3EG6 A;  5EM2 B;  2P9P C;  3C75 H;  4FAV D;  3FM0 A;  5SXM A;  3MZK A;  3IIW A;  2HKR A;  2XL3 A;  2CNX A;  3KRX B;  4CI2 A;  4JT6 C;  3DWL C;  3NVN A;  3A0F A;  3V9F A;  3VH0 A;  4J0W A;  2BBK H;  3PE7 A;  4A7J A;  3P4F A;  4ES0 A;  3C9C A;  4J87 A;  4O45 A;  5IT9 g;  2I0T A;  4J84 A;  4ERQ A;  3IJC A;  3UVK A;  4CY2 A;  3K27 A;  4FA1 D;  3MKS B;  3IKO A;  4A08 B;  4KFM B;  2B5N A;  5FKS A;  2Z2O A;  5IJ7 E;  4MK0 B;  4QRJ A;  3I7L A;  4A09 B;  1SQJ A;  5IC7 A;  2OVP B;  3UVN A;  5IGO A;  4K3J B;  4I79 A;  2P9L C;  4ERY A;  5EAL A;  4E54 B;  3I89 A;  2HXC A;  4L3H D;  2GNQ A;  1VYH C;  4GMB A;  4N14 A;  3J81 g;  3RN0 D;  4PSW B;  3IJ0 A;  4Y7R A;  4PC0 A;  4GGC A;  2AGY A;  3UKU C;  4TZ4 A;  4U7A A;  4A2M A;  4ZN4 A;  4ZOV A;  2P9N C;  3RN1 D;  4FA4 D;  2B5M A;  4CZY A;  2CE8 A; 
#chains in the Genus database with same CATH topology
 3CFV A;  4FA5 D;  4K3I D;  4O1Q D;  4AN1 A;  5E6R A;  3SXT D;  5JWZ A;  3EWE A;  2QZP A;  2I3T A;  3MUN A;  2HJB A;  4MMY A;  2CE9 A;  5M5V A;  4UM9 A;  4BCB A;  1B9X A;  4GQ1 A;  2HKM A;  3BG0 A;  1Q47 A;  4JXM A;  4LG8 A;  4XYH A;  5HQG A;  2YNO A;  1U2V C;  3EMH A;  5HDB A;  5FKQ A;  5I5M A;  2YBA A;  2B5L A;  2VC2 A;  4BL0 A;  1M1X A;  4GZ8 A;  4CI1 A;  3AL9 A;  1B9Y A;  4JD2 C;  4AEZ A;  3FGB A;  4RE6 A;  1K3I A;  2TRC B;  4AMZ A;  5TEF A;  4WJK A;  3EU7 A;  3JRO A;  1PEV A;  3IVM A;  2CN3 A;  4H5J A;  1OMW B;  2OIZ A;  1SQ9 A;  3I7K A;  3RFG A;  1OLZ A;  3T3M A;  4UM8 A;  3JB9 L;  3O4H A;  3AFC A;  4X63 B;  3N0E A;  4GQB B;  3AL8 A;  5M5R A;  2J56 H;  4FAN D;  3SBQ A;  1VZ3 A;  4BH6 A;  5C2V B;  2H13 A;  3ODT A;  3QI0 A;  3VI4 A;  3VA6 A;  1PI6 A;  1XHM A;  2VZ3 A;  1NEX B;  2J57 G;  2Q7Q A;  1UOO A;  4O9D A;  3KRW B;  2O9K A;  3SBR A;  4GQ2 P;  1SHY B;  5H1M A;  4Z7Q A;  2H9P A;  2UZX B;  3U4Y A;  4HDJ A;  2HES X;  3SVW D;  1ERJ A;  4MMZ A;  1JOF A;  3DXK C;  3EI1 B;  1GXR A;  2VDM A;  1GOG A;  5TDH B;  4J73 A;  3RSE C;  3IUR A;  3FRX A;  1FWX A;  1YR2 A;  3I8C A;  1GP2 B;  1JMX B;  5I5J A;  4L9O A;  4J79 A;  5C9Z B;  3OF7 A;  4O2W A;  4ZOX A;  2BCJ B;  5EMJ B;  2EIB A;  4IA9 A;  4A11 A;  1GOT B;  1XKS A;  1NR0 A;  1A12 A;  2VDN A;  2XE4 A;  3UVL A;  3MUO A;  4MMX A;  1H2X A;  5H17 A;  3ZDY A;  3FCS A;  1QFS A;  3NVX A;  4DNW A;  2OJY A;  1GOH A;  3I7N A;  1GOF A;  2AH1 A;  3KCI A;  3NVQ A;  2CO0 C;  5AJA A;  4BP9 A;  4G56 B;  4PNK B;  2QC5 A;  2PM6 B;  2OVR B;  1R5M A;  4J81 A;  2XYI A;  2XZG A;  3AH8 B;  2HJ4 A;  3MMY A;  2OK4 A;  4WK4 A;  3RRM C;  3K72 A;  4J82 A;  3DXM C;  5FLX g;  2XU7 A;  4J8G A;  4CY3 A;  3PSC B;  1K8K C;  2YMU A;  4U1E I;  5HE0 B;  3SFZ A;  3JZH A;  4GM8 A;  4JHN A;  3W15 A;  1I2M B;  3IUN A;  3SLE D;  3VI3 A;  1JJU B;  2WQ8 A;  5EAR A;  3I7H A;  3K26 A;  2H9L A;  3UR4 A;  3F3P A;  2VDQ A;  3GC3 B;  4X3E A;  4A2L A;  2BKL A;  4XYI A;  4A0A A;  2HU5 A;  2CO0 A;  5A2Q g;  2AH0 A;  3F3F A;  3EI3 A;  3IUJ A;  3ORV D;  1UTC A;  4OZU A;  5FXY A;  4O02 A;  2OVQ B;  5EML B;  1U4C A;  1UOP A;  2I0S A;  4J8B A;  5FA5 B;  4WK0 A;  3OTT A;  4YVD A;  3OL2 A;  2EBS A;  4L1M A;  5FFG A;  4EWR A;  4OWR A;  1GG2 B;  5EAM A;  1C9I A;  2UZY B;  3I7O A;  4QT8 A;  5FFO A;  3PXW D;  3I2N A;  3ULE C;  2VZ1 A;  3V4P A;  2GC4 A;  5AMS A;  1L0Q A;  3OKY A;  1TBG A;  3RMZ D;  1N6E A;  3V5W B;  4IRZ A;  2EIE A;  1H2W A;  3OW8 A;  3C99 A;  2IUR A;  5K19 A;  4RE5 A;  4G1M A;  3CIK B;  4JSX C;  3ZDZ A;  3V7D B;  4DNU A;  3SN6 B;  3DM0 A;  3O4G A;  3MZL A;  1H2Y A;  4ZOZ A;  5CXB A;  3HFQ A;  4IMM A;  3OKW A;  3F3G A;  2H9N A;  4E5Z A;  4A0A B;  3O4I A;  2IUV A;  3C5M A;  5GXH A;  4JSP C;  2G9A A;  5M61 A;  3EI3 B;  3RLM D;  2PM7 B;  1P22 A;  5HYN B;  4ESG A;  4Z8L A;  3SJL D;  3SCY A;  2IWF A;  5C2W B;  4BCC A;  3O4J A;  4CC9 A;  4CI3 A;  2H47 A;  1RI6 A;  4X60 B;  3OL2 B;  3JZG A;  4J86 A;  2HU8 A;  4A08 A;  3IJ1 A;  3GFC A;  3CFS B;  3IUM A;  1S4U X;  3EQ8 A;  5H14 A;  4QQE A;  4NBM A;  2AGW A;  3ZE1 A;  2P9S C;  3SWS D;  4CZX A;  3OKY B;  2IWK A;  4O3U B;  3ZDX A;  3IUQ A;  4L1Q D;  3N0D A;  3V4V A;  3IJE A;  5I5I A;  4GGD A;  2YB8 B;  3L4O D;  4E54 A;  2Z2P A;  3T3P A;  3UVM A;  2VDR A;  3B7F A;  3AL8 B;  5CXB B;  4CI8 A;  3PSL A;  1QNI A;  4JHP C;  4BUJ C;  2VDK A;  4E5Z B;  3FCU A;  2H14 A;  3IUL A;  5E6S A;  4D0K A;  5CXC A;  3PVU B;  5GXI A;  2H3X A;  3I8E A;  4J78 A;  5C92 A;  2PBI B;  2VDP A;  4CY1 A;  4UI9 R;  3JPX A;  3DSM A;  1N6D A;  5IGQ A;  5CYK A;  3EI2 A;  3EI4 A;  4PXW A;  1MG3 A;  4AOW A;  1T2X A;  2H6Q A;  2QXV A;  5TF2 A;  4LGN A;  4A0B A;  4JT5 C;  3QHY B;  3PVW B;  1BPO A;  4PSX B;  5GMK n;  4JSV C;  3J80 g;  5B4W A;  3JAM g;  1A0R B;  3BG1 A;  3BWS A;  2EID A;  4NC4 A;  3SHF A;  4CY5 A;  2JKX A;  2G99 A;  3PXT D;  4NSX A;  4GGA A;  5M5U A;  1VE7 A;  2YNN A;  4A11 B;  1MDA H;  2H6K A;  3SBP A;  4QAM A;  4NEN A;  2PM9 A;  3ZE0 A;  5IJ8 E;  1JMZ B;  1E8M A;  5HE2 B;  4LG9 A;  1U8C A;  4O3T B;  4L3G D;  5EAP A;  3MKQ A;  2P9K C;  5TEE A;  1C9L A;  3ZWL B;  3K6S A;  5CXC B;  5FQD A;  3DDU A;  4H5I A;  1JV2 A;  2H68 A;  1K32 A;  1N6F A;  3MXX A;  4NAA A;  2P9U C;  1JTD B;  1MG2 A;  5HE3 B;  4PBY A;  2AGX A;  3SMR A;  4FWW A;  2HU7 A;  2MTA H;  3OKT A;  5EMK B;  5GSA A;  4GM3 A;  4BP8 A;  1XIP A;  3VGZ A;  2H9M A;  5KDO B;  2Z2N A;  2CN2 A;  3E0C A;  4WK2 A;  5CYK B;  4AN0 A;  2IUP A;  3EI4 B;  3EI2 B;  2GC7 A;  2I3S A;  2AGZ A;  4X61 B;  2IAA A;  2P9I C;  4D9S A;  4A0B B;  4Y5R D;  3UVO A;  3GRE A;  5THA A;  2EIC A;  2B4E A;  2HYE A;  1O6G A;  5K1C C;  5EM2 A;  3EI1 A;  1H2Z A;  3PXS D;  2I0R A;  1O6F A;  3IIY A;  4FA9 D;  3L4M D;  1UOQ A;  3I7P A;  2IUQ A;  2PM9 B;  2J55 H;  4ZOY A;  4JSN C;  1TYQ C;  4J77 A;  1PGU A;  5EMM B;  2AQ5 A;  4CZV A;  5M5T A;  2XDW A;  3NIG A;  1TYE A;  4D6V A;  4ERZ A;  3NIF A;  2YNP A;  1QFM A;  4R7A B;  4PBZ A;  4QL1 A;  2AGL A;  3JRP A;  3UKR C;  4XEI C;  5AFU 3;  5FKT A;  4A09 A;  4FB1 D;  3MVD K;  1L5G A;  4AMY A;  1VE6 A;  2OK6 A;  4GM9 A;  5FKR A;  5HE1 B;  1VZ2 A;  1YFQ A;  3JZN A;  4J0X A;  3RFH A;  2H6N A;  5E6U A;  2W18 A;  1PBY B;  2XL2 A;  4FHL A;  3EG6 A;  5EM2 B;  1E8N A;  2P9P C;  3C75 H;  4FAV D;  3FM0 A;  5SXM A;  3MZK A;  3IIW A;  2HKR A;  2XL3 A;  2CNX A;  3KRX B;  4CI2 A;  4JT6 C;  3DWL C;  3NVN A;  3NID A;  3A0F A;  3V9F A;  3VH0 A;  4J0W A;  2BBK H;  2QR5 A;  3PE7 A;  4A7J A;  3P4F A;  4ES0 A;  3C9C A;  4J87 A;  4O45 A;  5IT9 g;  2I0T A;  4J84 A;  5M5S A;  4ERQ A;  2VDL A;  3GD1 I;  4BCD A;  3IJC A;  3UVK A;  4CY2 A;  3K27 A;  4FA1 D;  3MKS B;  3IKO A;  4A08 B;  4KFM B;  2B5N A;  5FKS A;  2VDO A;  2Z2O A;  4MK0 B;  5IJ7 E;  3K71 A;  4QRJ A;  4Z7N A;  3I7L A;  4A09 B;  4AX4 A;  1SQJ A;  5IC7 A;  2OVP B;  3UVN A;  5IGO A;  4Z7O A;  4K3J B;  4I79 A;  2P9L C;  4ERY A;  5C86 A;  5EAL A;  4E54 B;  3I89 A;  4DNV A;  2HXC A;  4L3H D;  2GNQ A;  1VYH C;  4GMB A;  4N14 A;  3J81 g;  3RN0 D;  1E5T A;  4PSW B;  3IJ0 A;  4Y7R A;  4PC0 A;  4GGC A;  2AGY A;  3UKU C;  4TZ4 A;  4U7A A;  3ZE2 A;  3EQ9 A;  4G55 A;  4A2M A;  4ZN4 A;  4ZOV A;  2P9N C;  3RN1 D;  3EQ7 A;  4FA4 D;  2B5M A;  4G1E A;  4CZY A;  2CE8 A; 
#chains in the Genus database with same CATH homology
 3CFV A;  4FA5 D;  4K3I D;  4O1Q D;  3SXT D;  5JWZ A;  3EWE A;  2I3T A;  2HJB A;  2CE9 A;  1B9X A;  4GQ1 A;  2HKM A;  3BG0 A;  1Q47 A;  4JXM A;  4LG8 A;  4XYH A;  5HQG A;  2YNO A;  1U2V C;  3EMH A;  5FKQ A;  5I5M A;  2YBA A;  2B5L A;  4BL0 A;  4GZ8 A;  4CI1 A;  3AL9 A;  1B9Y A;  4JD2 C;  4AEZ A;  3FGB A;  2TRC B;  5TEF A;  3EU7 A;  3JRO A;  1PEV A;  2CN3 A;  4H5J A;  1OMW B;  2OIZ A;  1SQ9 A;  3I7K A;  3RFG A;  1OLZ A;  3JB9 L;  3AFC A;  4X63 B;  3N0E A;  4GQB B;  3AL8 A;  2J56 H;  4FAN D;  3SBQ A;  4BH6 A;  5C2V B;  2H13 A;  3ODT A;  3VA6 A;  1PI6 A;  1XHM A;  1NEX B;  2J57 G;  2Q7Q A;  4O9D A;  3KRW B;  2O9K A;  3SBR A;  4GQ2 P;  1SHY B;  5H1M A;  2H9P A;  2UZX B;  3U4Y A;  4HDJ A;  2HES X;  3SVW D;  1ERJ A;  1JOF A;  3DXK C;  3EI1 B;  1GXR A;  5TDH B;  4J73 A;  3RSE C;  3FRX A;  1FWX A;  3I8C A;  1GP2 B;  1JMX B;  5I5J A;  4L9O A;  4J79 A;  5C9Z B;  4ZOX A;  2BCJ B;  5EMJ B;  4IA9 A;  4A11 A;  1GOT B;  1XKS A;  1NR0 A;  3UVL A;  5H17 A;  3NVX A;  2OJY A;  3I7N A;  2AH1 A;  3NVQ A;  2CO0 C;  5AJA A;  4G56 B;  4PNK B;  2QC5 A;  2PM6 B;  2OVR B;  1R5M A;  4J81 A;  2XYI A;  3AH8 B;  2HJ4 A;  3MMY A;  2OK4 A;  3RRM C;  4J82 A;  3DXM C;  5FLX g;  2XU7 A;  4J8G A;  4CY3 A;  3PSC B;  1K8K C;  2YMU A;  4U1E I;  5HE0 B;  3SFZ A;  3JZH A;  4GM8 A;  3W15 A;  3SLE D;  1JJU B;  5EAR A;  3I7H A;  3K26 A;  2H9L A;  3UR4 A;  3F3P A;  4X3E A;  4A2L A;  4XYI A;  4A0A A;  2CO0 A;  5A2Q g;  2AH0 A;  3F3F A;  3EI3 A;  3ORV D;  4OZU A;  5FXY A;  2OVQ B;  5EML B;  1U4C A;  2I0S A;  4J8B A;  5FA5 B;  3OTT A;  4YVD A;  3OL2 A;  2EBS A;  4EWR A;  4OWR A;  1GG2 B;  5EAM A;  2UZY B;  3I7O A;  4QT8 A;  3PXW D;  3I2N A;  3ULE C;  2GC4 A;  5AMS A;  1L0Q A;  3OKY A;  1TBG A;  3RMZ D;  1N6E A;  3V5W B;  3OW8 A;  3C99 A;  2IUR A;  5K19 A;  3CIK B;  4JSX C;  3V7D B;  3SN6 B;  3DM0 A;  3MZL A;  4ZOZ A;  5CXB A;  3HFQ A;  4IMM A;  3OKW A;  3F3G A;  2H9N A;  4E5Z A;  4A0A B;  2IUV A;  3C5M A;  5GXH A;  4JSP C;  2G9A A;  3EI3 B;  3RLM D;  2PM7 B;  1P22 A;  5HYN B;  4ESG A;  4Z8L A;  3SJL D;  3SCY A;  2IWF A;  5C2W B;  4CC9 A;  4CI3 A;  2H47 A;  1RI6 A;  4X60 B;  3OL2 B;  3JZG A;  4J86 A;  4A08 A;  3IJ1 A;  3GFC A;  3CFS B;  1S4U X;  5H14 A;  4QQE A;  2AGW A;  2P9S C;  3SWS D;  4CZX A;  3OKY B;  2IWK A;  4O3U B;  4L1Q D;  3N0D A;  5I5I A;  4GGD A;  2YB8 B;  3L4O D;  4E54 A;  2Z2P A;  3UVM A;  3B7F A;  3AL8 B;  5CXB B;  4CI8 A;  3PSL A;  1QNI A;  4BUJ C;  4E5Z B;  2H14 A;  4D0K A;  5CXC A;  3PVU B;  5GXI A;  2H3X A;  3I8E A;  4J78 A;  2PBI B;  4CY1 A;  4UI9 R;  3JPX A;  3DSM A;  1N6D A;  5IGQ A;  5CYK A;  3EI2 A;  3EI4 A;  4PXW A;  1MG3 A;  4AOW A;  2QXV A;  2H6Q A;  5TF2 A;  4LGN A;  4A0B A;  4JT5 C;  3PVW B;  4PSX B;  5GMK n;  4JSV C;  3J80 g;  5B4W A;  3JAM g;  1A0R B;  3BG1 A;  3BWS A;  3SHF A;  4CY5 A;  2G99 A;  3PXT D;  4NSX A;  4GGA A;  2YNN A;  4A11 B;  1MDA H;  2H6K A;  3SBP A;  2PM9 A;  5IJ8 E;  1JMZ B;  5HE2 B;  4LG9 A;  4O3T B;  4L3G D;  5EAP A;  3MKQ A;  2P9K C;  5TEE A;  3ZWL B;  5CXC B;  5FQD A;  4H5I A;  2H68 A;  1K32 A;  1N6F A;  3MXX A;  2P9U C;  1MG2 A;  5HE3 B;  4PBY A;  2AGX A;  3SMR A;  4FWW A;  2MTA H;  3OKT A;  5EMK B;  5GSA A;  4GM3 A;  1XIP A;  3VGZ A;  2H9M A;  5KDO B;  2Z2N A;  2CN2 A;  3E0C A;  5CYK B;  3EI2 B;  2IUP A;  3EI4 B;  2GC7 A;  2I3S A;  2AGZ A;  4X61 B;  2IAA A;  2P9I C;  4A0B B;  4Y5R D;  3UVO A;  3GRE A;  5THA A;  2B4E A;  2HYE A;  5K1C C;  5EM2 A;  3EI1 A;  3PXS D;  2I0R A;  3IIY A;  4FA9 D;  3L4M D;  3I7P A;  2IUQ A;  2PM9 B;  2J55 H;  4ZOY A;  4JSN C;  1TYQ C;  4J77 A;  1PGU A;  5EMM B;  2AQ5 A;  4CZV A;  4D6V A;  4ERZ A;  2YNP A;  4R7A B;  4PBZ A;  4QL1 A;  2AGL A;  3JRP A;  3UKR C;  4XEI C;  5AFU 3;  5FKT A;  4A09 A;  4FB1 D;  2OK6 A;  4GM9 A;  5FKR A;  5HE1 B;  1YFQ A;  3JZN A;  4J0X A;  3RFH A;  2H6N A;  2W18 A;  1PBY B;  2XL2 A;  4FHL A;  3EG6 A;  5EM2 B;  2P9P C;  3C75 H;  4FAV D;  3FM0 A;  5SXM A;  3MZK A;  3IIW A;  2HKR A;  2XL3 A;  2CNX A;  3KRX B;  4CI2 A;  4JT6 C;  3DWL C;  3NVN A;  3A0F A;  3V9F A;  3VH0 A;  4J0W A;  2BBK H;  3PE7 A;  4A7J A;  3P4F A;  4ES0 A;  3C9C A;  4J87 A;  4O45 A;  5IT9 g;  2I0T A;  4J84 A;  4ERQ A;  3IJC A;  3UVK A;  4CY2 A;  3K27 A;  4FA1 D;  3MKS B;  3IKO A;  4A08 B;  4KFM B;  2B5N A;  5FKS A;  2Z2O A;  5IJ7 E;  4MK0 B;  4QRJ A;  3I7L A;  4A09 B;  1SQJ A;  5IC7 A;  2OVP B;  3UVN A;  5IGO A;  4K3J B;  4I79 A;  2P9L C;  4ERY A;  5EAL A;  4E54 B;  3I89 A;  2HXC A;  4L3H D;  2GNQ A;  1VYH C;  4GMB A;  4N14 A;  3J81 g;  3RN0 D;  4PSW B;  3IJ0 A;  4Y7R A;  4PC0 A;  4GGC A;  2AGY A;  3UKU C;  4TZ4 A;  4U7A A;  4A2M A;  4ZN4 A;  4ZOV A;  2P9N C;  3RN1 D;  4FA4 D;  2B5M A;  4CZY A;  2CE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...