5HQGA

Wd40 domain of human e3 ubiquitin ligase cop1 (rfwd2)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
341
structure length
324
Chain Sequence
EFQECLSKFTRYNSVRPLATLSYALYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords E3 ubiquitin-protein ligase RFWD2
total genus 68
structure length 324
sequence length 341
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5hqgA00
3BG1A 4J8GA 4ES0A 3SXTD 3P4FA 3JB9L 2H47A 3V7DB 2H6KA 2OK4A 3C5MA 4FA5D 3IJ1A 4U7AA 4CY3A 3OKTA 5HE3B 4L3GD 4A11A 2I0RA 3L4MD 2IWKA 3K27A 4JD2C 2H68A 3JAMg 3CFVA 4AOWA 1JOFA 4EWRA 1U2VC 2J57G 1JMXB 4JSPC 2H9PA 4PC0A 2AGZA 1PI6A 3FM0A 5EM2A 5C2WB 3EI1B 1NEXB 4A0BA 2QC5A 3I7PA 2HESX 4BUJC 3UVNA 2PM6B 3KRWB 2IAAA 2HJBA 4O3UB 4ZOZA 4X60B 2B4EA 3DWLC 3MKQA 2G99A 4A2LA 3UKRC 4HDJA 2CN2A 1U4CA 3BG0A 4O1QD 1GG2B 3B7FA 4FWWA 3SHFA 4ZOYA 1NR0A 1TYQC 4CC9A 4Z8LA 3I7KA 3ULEC 4GZ8A 2H14A 5CYKB 5TF2A 4NSXA 4X63B 2UZYB 2GC4A 4J81A 4QL1A 4JSXC 2OIZA 4CY5A 5FKRA 5A2Qg 3MXXA 3AFCA 4O45A 4FB1D 3ORVD 2P9NC 2CE8A 4FAND 4AEZA 1PGUA 3I2NA 4J82A 4A2MA 3SN6B 4CZVA 4FHLA 3EG6A 2XU7A 4LG9A 5GXHA 3I7OA 4XEIC 3DM0A 3EI3B 4Y7RA 2IUVA 1MG2A 4ZOVA 3C9CA 2H13A 3F3FA 1MG3A 3F3PA 5C9ZB 3I7HA 3RFGA 3EMHA 4PBYA 2AH1A 4GQ1A 1JMZB 3UVOA 4A11B 4L1QD 5CXBA 4L9OA 3I8EA 2I3SA 3U4YA 4X3EA 4CZXA 4PSXB 1SQJA 2HKRA 1MDAH 3I7LA 4GGDA 3PSCB 4MK0B 3UVMA 4FAVD 3VGZA 3OKYA 3SMRA 4ERZA 4IA9A 1RI6A 2EBSA 4ZN4A 1XIPA 2PM7B 2OVRB 3AL8A 2GC7A 1Q47A 2H9LA 4GM3A 1A0RB 2CE9A 3UVKA 5KDOB 4QRJA 4UI9R 3SCYA 4J77A 2Q7QA 2AGWA 2O9KA 3VH0A 2YBAA 5FA5B 1OLZA 5CXBB 4CY2A 3SBPA 4GMBA 1TBGA 2W18A 4E5ZA 4OWRA 5EAMA 2HKMA 5FKTA 5I5MA 3K26A 2OK6A 3RFHA 2CO0C 3RN1D 1XKSA 5GXIA 3EI2A 5HYNB 3E0CA 2Z2OA 2IUPA 2XL2A 5EM2B 5THAA 5GMKn 4JSNC 4PNKB 2IURA 5CXCB 3UR4A 4PXWA 5FQDA 5EARA 1L0QA 4J0XA 3ZWLB 3JZGA 3IIWA 4X61B 5HE2B 4KFMB 3UKUC 5TDHB 4CI8A 1PBYB 3IJ0A 2Z2PA 5EMJB 5IT9g 4J84A 2HYEA 5C2VB 5B4WA 3RLMD 1GP2B 5HQGA 4K3JB 2H9NA 3PXTD 4A7JA 2J55H 2AGLA 3AH8B 2P9PC 1ERJA 2Z2NA 1N6EA 3PXWD 2CO0A 5K19A 2YNPA 2TRCB 3F3GA 3AL8B 2BCJB 4R7AB 2XYIA 5TEEA 3CFSB 3OL2B 3SFZA 2B5NA 2OJYA 3GREA 4GGAA 5EMLB 3JPXA 2HXCA 3SVWD 2B5LA 5K1CC 5HE0B 3SWSD 1YFQA 4JSVC 3EWEA 5EMKB 1P22A 2IUQA 3SBQA 3RSEC 2YB8B 4K3ID 3OTTA 2J56H 5IC7A 2P9LC 2P9UC 4YVDA 5IGOA 2GNQA 1QNIA 3EI2B 4CI3A 2AQ5A 3I8CA 3MKSB 3W15A 3BWSA 3GFCA 2AGYA 2H3XA 2P9KC 4G56B 3RMZD 3OL2A 4QQEA 3L4OD 3UVLA 4Y5RD 4XYHA 3IJCA 3EI3A 4LG8A 5AJAA 3IIYA 1FWXA 4JT5C 5EMMB 4CI1A 3DXKC 3AL9A 3N0EA 5FLXg 4A09A 4O3TB 3EI4A 1SQ9A 1JJUB 3C75H 2B5MA 4J79A 5IGQA 2IWFA 3EI1A 2G9AA 5EAPA 4A08A 1SHYB 3J81g 2YNOA 5H17A 4A0AA 3VA6A 5AFU3 5FKSA 4JT6C 3MZLA 4H5JA 2PBIB 3PVUB 4GM9A 4ERQA 3OW8A 2P9SC 3DXMC 2H6QA 3ODTA 4U1EI 4FA1D 2H9MA 3C99A 2I0SA 2I3TA 3NVNA 3RN0D 5AMSA 2YMUA 3V9FA 2P9IC 4PBZA 4GQBB 3EI4B 4J78A 3V5WB 5SXMA 3EU7A 4J0WA 1B9XA 4PSWB 4GGCA 3MZKA 4LGNA 3HFQA 5I5IA 5IJ7E 3OKYB 5FKQA 4J8BA 2YNNA 4FA9D 3OKWA 1GOTB 3KRXB 3I89A 5EALA 2BBKH 3FRXA 4J73A 5CXCA 3NVXA 4IMMA 4BL0A 4GM8A 1R5MA 4ERYA 1VYHC 3PSLA 3A0FA 2HJ4A 3JZNA 3IKOA 2UZXB 2H6NA 2XL3A 3J80g 1OMWB 4ZOXA 5CYKA 3JROA 5FXYA 5H1MA 1K32A 2AH0A 5IJ8E 5HE1B 4BH6A 1XHMA 3DSMA 2CNXA 3CIKB 4A08B 2QXVA 4CZYA 4E5ZB 5H14A 4QT8A 2MTAH 3NVQA 2I0TA 4XYIA 1N6FA 4E54B 3MMYA 1B9YA 4H5IA 4I79A 1S4UX 2AGXA 3PXSD 4A0BB 3I7NA 4ESGA 4J86A 4D0KA 2PM9B 1GXRA 5I5JA 1PEVA 4CI2A 3JZHA 3N0DA 2OVQB 4CY1A 3RRMC 4OZUA 3SLED 1K8KC 4J87A 4D6VA 5TEFA 4TZ4A 5GSAA 2CN3A 4O9DA 3FGBA 4N14A 3JRPA 4JXMA 3SJLD 4FA4D 4A09B 3PE7A 4GQ2P 3PVWB 4E54A 4L3HD 2PM9A 5JWZA 4A0AB 1N6DA 2OVPB 3SBRA
chains in the Genus database with same CATH superfamily
5M5UA 3BG1A 4J8GA 4ES0A 3SXTD 3P4FA 3JB9L 2H47A 3V7DB 2H6KA 2OK4A 3O4GA 2VDLA 3C5MA 4JHPC 4FA5D 3IJ1A 4U7AA 4RE6A 4CY3A 3OKTA 1A12A 5HE3B 2EIDA 4L3GD 4A11A 2I0RA 1GOFA 3L4MD 3ZDXA 1UOPA 2IWKA 3K27A 4JD2C 2H68A 3JAMg 1T2XA 3CFVA 1JOFA 1QFMA 4AOWA 4AX4A 4EWRA 1U2VC 2J57G 1JMXB 4JSPC 2H9PA 3EQ8A 4PC0A 2AGZA 4BCDA 1PI6A 4QAMA 3FM0A 3MUNA 5EM2A 5C2WB 3EI1B 1NEXB 4A0BA 2QC5A 3I7PA 4AMYA 2HESX 4BUJC 3UVNA 2PM6B 3KRWB 3O4JA 2IAAA 1QFSA 2HJBA 5E6RA 4O3UB 4ZOZA 1U8CA 4X60B 2B4EA 3DWLC 3MKQA 2G99A 4A2LA 3UKRC 4DNWA 4HDJA 4DNUA 2CN2A 1U4CA 3BG0A 4O1QD 1GG2B 3B7FA 4BP9A 2WQ8A 4FWWA 5M5TA 3SHFA 4ZOYA 1NR0A 4AMZA 1TYQC 3ZE0A 2QR5A 4CC9A 4Z8LA 3I7KA 3ULEC 4GZ8A 2H14A 5CYKB 5TF2A 4NSXA 4X63B 2UZYB 4G1MA 2GC4A 4J81A 4QL1A 4JSXC 2OIZA 4CY5A 5FKRA 5HDBA 5A2Qg 4BP8A 3MXXA 3AFCA 4O45A 3NIFA 4FB1D 4Z7QA 3NIDA 3ORVD 2P9NC 2CE8A 4FAND 4AEZA 1PGUA 3I2NA 4J82A 4A2MA 3SN6B 4CZVA 4FHLA 3EG6A 2XU7A 4LG9A 1C9IA 5GXHA 3I7OA 4XEIC 3DM0A 3EI3B 4Y7RA 2IUVA 1MG2A 4ZOVA 3C9CA 2H13A 3F3FA 1O6GA 1MG3A 3F3PA 5C9ZB 3I7HA 3RFGA 4UM8A 3EMHA 3FCUA 4PBYA 2AH1A 4GQ1A 1JMZB 3UVOA 5E6SA 4A11B 4L1QD 5CXBA 4L9OA 3I8EA 4O2WA 2I3SA 3U4YA 4X3EA 4CZXA 4PSXB 1SQJA 2HKRA 1MDAH 3I7LA 4GGDA 4AN1A 3PSCB 4MK0B 3UVMA 4FAVD 3VGZA 3OKYA 4O02A 3SMRA 4JHNA 4ERZA 4IA9A 1RI6A 2EBSA 4ZN4A 3EQ7A 2VC2A 1XIPA 2PM7B 2OVRB 3AL8A 3IVMA 2GC7A 1Q47A 2H9LA 4GM3A 1A0RB 3SBRA 2CE9A 3UVKA 5KDOB 4QRJA 4UI9R 3SCYA 4J77A 2Q7QA 2AGWA 2O9KA 3T3PA 3VH0A 3IUJA 2EICA 3GC3B 2YBAA 5FA5B 1OLZA 5CXBB 5M5RA 4L1MA 3SBPA 4CY2A 4GMBA 5C92A 4MMYA 1TBGA 1JTDB 2QZPA 2W18A 4E5ZA 4OWRA 5EAMA 2HKMA 5FKTA 5I5MA 3K26A 4IRZA 2OK6A 3RFHA 2CO0C 3RN1D 1XKSA 5GXIA 3EI2A 5HYNB 3E0CA 2Z2OA 4MMXA 2IUPA 2XL2A 5EM2B 5THAA 5GMKn 4JSNC 4PNKB 1UOQA 2HU8A 2IURA 1GOHA 5CXCB 3UR4A 4PXWA 4G1EA 5FQDA 2XE4A 2VDMA 1I2MB 5EARA 1L0QA 4J0XA 3ZWLB 3JZGA 3IIWA 3IUMA 4X61B 5HE2B 1VE6A 1C9LA 1H2XA 4KFMB 3UKUC 5TDHB 2VDQA 5FFOA 3K6SA 4CI8A 1PBYB 3IJ0A 2Z2PA 5EMJB 5IT9g 3MVDK 4J84A 3VI4A 2HYEA 5C2VB 5B4WA 3RLMD 4WK2A 1GP2B 4AN0A 5HQGA 4K3JB 2H9NA 3PXTD 4A7JA 2J55H 2AGLA 4DNVA 1UOOA 3AH8B 4NBMA 2P9PC 1ERJA 2Z2NA 1N6EA 3PXWD 2CO0A 5K19A 2YNPA 2TRCB 3F3GA 4D9SA 4WK0A 3AL8B 2BCJB 4R7AB 1E8NA 2XYIA 3CFSB 5TEEA 3OL2B 3SFZA 2B5NA 2OJYA 3GREA 4GGAA 1VE7A 5EMLB 4RE5A 3JPXA 2HXCA 3SVWD 1E5TA 2B5LA 5K1CC 5HE0B 3SWSD 1YFQA 4JSVC 4Z7OA 3EWEA 5EMKB 1P22A 2IUQA 3SBQA 3RSEC 2VDNA 2YB8B 1E8MA 1H2ZA 4K3ID 3OTTA 2J56H 3IURA 5IC7A 5FFGA 2P9LC 1UTCA 2XDWA 2P9UC 4YVDA 3MUOA 5IGOA 2GNQA 1QNIA 3EI2B 4CI3A 2AQ5A 3I8CA 3MKSB 3W15A 1GOGA 3BWSA 2XZGA 2AGYA 3GFCA 3IUNA 2H3XA 2P9KC 4WK4A 4G56B 3RMZD 1L5GA 3OL2A 3L4OD 2JKXA 4MMZA 1H2WA 4QQEA 3UVLA 1YR2A 4XYHA 4Y5RD 3DDUA 3EI3A 3IJCA 4LG8A 5AJAA 3IIYA 1FWXA 4JT5C 5EMMB 4CI1A 3DXKC 3AL9A 3N0EA 5FLXg 4A09A 4O3TB 3EI4A 1SQ9A 1JJUB 3C75H 1H2YA 2B5MA 4J79A 3K71A 5IGQA 3V4VA 2IWFA 3EI1A 2G9AA 1K3IA 5EAPA 4A08A 2EIBA 1SHYB 3IJEA 2EIEA 1VZ3A 2YNOA 3J81g 3ZE1A 5M5VA 5H17A 4A0AA 3VA6A 5AFU3 3QI0A 5FKSA 4JT6C 3O4IA 3MZLA 4H5JA 3OF7A 2PBIB 3PVUB 4GM9A 4ERQA 3OW8A 2P9SC 3DXMC 2H6QA 3ODTA 4U1EI 4FA1D 1O6FA 2H9MA 3C99A 3ZDYA 2I0SA 2I3TA 3NVNA 3RN0D 5AMSA 2YMUA 4WJKA 2P9IC 4PBZA 3V9FA 4GQBB 4BCBA 3EI4B 4J78A 3V5WB 5SXMA 1BPOA 4UM9A 3O4HA 3EU7A 4J0WA 1B9XA 2VZ1A 4PSWB 4GGCA 3MZKA 4LGNA 3HFQA 5I5IA 5IJ7E 3OKYB 2VDRA 5FKQA 4J8BA 2YNNA 4FA9D 3OKWA 1GOTB 3KRXB 3I89A 5EALA 1JV2A 2BBKH 3FRXA 3ZDZA 4J73A 5CXCA 3IULA 1M1XA 2VDKA 3NVXA 4IMMA 4BL0A 4GM8A 5M61A 1R5MA 4ERYA 1VYHC 3PSLA 3A0FA 4NAAA 2HJ4A 3T3MA 3JZNA 3IKOA 2UZXB 3FCSA 2H6NA 2XL3A 3J80g 1OMWB 2HU5A 5CYKA 3JROA 4ZOXA 5FXYA 3V4PA 5H1MA 1K32A 2AH0A 5IJ8E 5HE1B 4BH6A 5M5SA 1XHMA 3DSMA 2CNXA 3CIKB 4A08B 2QXVA 4CZYA 3NIGA 1TYEA 4E5ZB 5H14A 4QT8A 3IUQA 2MTAH 3NVQA 4G55A 2I0TA 4XYIA 1N6FA 4BCCA 4E54B 3MMYA 1B9YA 4H5IA 4I79A 1VZ2A 2VDOA 1S4UX 2AGXA 3PXSD 4A0BB 3I7NA 4ESGA 4J86A 4D0KA 2PM9B 1GXRA 5I5JA 1PEVA 3ZE2A 4CI2A 4Z7NA 3JZHA 3N0DA 2OVQB 4CY1A 3RRMC 4OZUA 3SLED 1K8KC 4J87A 3KCIA 4D6VA 5TEFA 4TZ4A 5GSAA 2CN3A 4O9DA 3FGBA 4N14A 3JRPA 3QHYB 4JXMA 4NENA 3SJLD 3VI3A 4FA4D 4A09B 3PE7A 5E6UA 4GQ2P 3PVWB 4E54A 3K72A 5C86A 2BKLA 4L3HD 2PM9A 2VZ3A 5JWZA 4A0AB 1N6DA 2HU7A 2OVPB 4NC4A 2VDPA 3GD1I 3EQ9A
chains in the Genus database with same CATH topology
3BG1A 4J8GA 4ES0A 3SXTD 3P4FA 3JB9L 2H47A 3V7DB 2H6KA 2OK4A 3C5MA 4FA5D 3IJ1A 4U7AA 4CY3A 3OKTA 5HE3B 4L3GD 4A11A 2I0RA 3L4MD 2IWKA 3K27A 4JD2C 2H68A 3JAMg 3CFVA 4AOWA 1JOFA 4EWRA 1U2VC 2J57G 1JMXB 4JSPC 2H9PA 4PC0A 2AGZA 1PI6A 3FM0A 5EM2A 5C2WB 3EI1B 1NEXB 4A0BA 2QC5A 3I7PA 2HESX 4BUJC 3UVNA 2PM6B 3KRWB 2IAAA 2HJBA 4O3UB 4ZOZA 4X60B 2B4EA 3DWLC 3MKQA 2G99A 4A2LA 3UKRC 4HDJA 2CN2A 1U4CA 3BG0A 4O1QD 1GG2B 3B7FA 4FWWA 3SHFA 4ZOYA 1NR0A 1TYQC 4CC9A 4Z8LA 3I7KA 3ULEC 4GZ8A 2H14A 5CYKB 5TF2A 4NSXA 4X63B 2UZYB 2GC4A 4J81A 4QL1A 4JSXC 2OIZA 4CY5A 5FKRA 5A2Qg 3MXXA 3AFCA 4O45A 4FB1D 3ORVD 2P9NC 2CE8A 4FAND 4AEZA 1PGUA 3I2NA 4J82A 4A2MA 3SN6B 4CZVA 4FHLA 3EG6A 2XU7A 4LG9A 5GXHA 3I7OA 4XEIC 3DM0A 3EI3B 4Y7RA 2IUVA 1MG2A 4ZOVA 3C9CA 2H13A 3F3FA 1MG3A 3F3PA 5C9ZB 3I7HA 3RFGA 3EMHA 4PBYA 2AH1A 4GQ1A 1JMZB 3UVOA 4A11B 4L1QD 5CXBA 4L9OA 3I8EA 2I3SA 3U4YA 4X3EA 4CZXA 4PSXB 1SQJA 2HKRA 1MDAH 3I7LA 4GGDA 3PSCB 4MK0B 3UVMA 4FAVD 3VGZA 3OKYA 3SMRA 4ERZA 4IA9A 1RI6A 2EBSA 4ZN4A 1XIPA 2PM7B 2OVRB 3AL8A 2GC7A 1Q47A 2H9LA 4GM3A 1A0RB 2CE9A 3UVKA 5KDOB 4QRJA 4UI9R 3SCYA 4J77A 2Q7QA 2AGWA 2O9KA 3VH0A 2YBAA 5FA5B 1OLZA 5CXBB 4CY2A 3SBPA 4GMBA 1TBGA 2W18A 4E5ZA 4OWRA 5EAMA 2HKMA 5FKTA 5I5MA 3K26A 2OK6A 3RFHA 2CO0C 3RN1D 1XKSA 5GXIA 3EI2A 5HYNB 3E0CA 2Z2OA 2IUPA 2XL2A 5EM2B 5THAA 5GMKn 4JSNC 4PNKB 2IURA 5CXCB 3UR4A 4PXWA 5FQDA 5EARA 1L0QA 4J0XA 3ZWLB 3JZGA 3IIWA 4X61B 5HE2B 4KFMB 3UKUC 5TDHB 4CI8A 1PBYB 3IJ0A 2Z2PA 5EMJB 5IT9g 4J84A 2HYEA 5C2VB 5B4WA 3RLMD 1GP2B 5HQGA 4K3JB 2H9NA 3PXTD 4A7JA 2J55H 2AGLA 3AH8B 2P9PC 1ERJA 2Z2NA 1N6EA 3PXWD 2CO0A 5K19A 2YNPA 2TRCB 3F3GA 3AL8B 2BCJB 4R7AB 2XYIA 5TEEA 3CFSB 3OL2B 3SFZA 2B5NA 2OJYA 3GREA 4GGAA 5EMLB 3JPXA 2HXCA 3SVWD 2B5LA 5K1CC 5HE0B 3SWSD 1YFQA 4JSVC 3EWEA 5EMKB 1P22A 2IUQA 3SBQA 3RSEC 2YB8B 4K3ID 3OTTA 2J56H 5IC7A 2P9LC 2P9UC 4YVDA 5IGOA 2GNQA 1QNIA 3EI2B 4CI3A 2AQ5A 3I8CA 3MKSB 3W15A 3BWSA 3GFCA 2AGYA 2H3XA 2P9KC 4G56B 3RMZD 3OL2A 4QQEA 3L4OD 3UVLA 4Y5RD 4XYHA 3IJCA 3EI3A 4LG8A 5AJAA 3IIYA 1FWXA 4JT5C 5EMMB 4CI1A 3DXKC 3AL9A 3N0EA 5FLXg 4A09A 4O3TB 3EI4A 1SQ9A 1JJUB 3C75H 2B5MA 4J79A 5IGQA 2IWFA 3EI1A 2G9AA 5EAPA 4A08A 1SHYB 3J81g 2YNOA 5H17A 4A0AA 3VA6A 5AFU3 5FKSA 4JT6C 3MZLA 4H5JA 2PBIB 3PVUB 4GM9A 4ERQA 3OW8A 2P9SC 3DXMC 2H6QA 3ODTA 4U1EI 4FA1D 2H9MA 3C99A 2I0SA 2I3TA 3NVNA 3RN0D 5AMSA 2YMUA 3V9FA 2P9IC 4PBZA 4GQBB 3EI4B 4J78A 3V5WB 5SXMA 3EU7A 4J0WA 1B9XA 4PSWB 4GGCA 3MZKA 4LGNA 3HFQA 5I5IA 5IJ7E 3OKYB 5FKQA 4J8BA 2YNNA 4FA9D 3OKWA 1GOTB 3KRXB 3I89A 5EALA 2BBKH 3FRXA 4J73A 5CXCA 3NVXA 4IMMA 4BL0A 4GM8A 1R5MA 4ERYA 1VYHC 3PSLA 3A0FA 2HJ4A 3JZNA 3IKOA 2UZXB 2H6NA 2XL3A 3J80g 1OMWB 4ZOXA 5CYKA 3JROA 5FXYA 5H1MA 1K32A 2AH0A 5IJ8E 5HE1B 4BH6A 1XHMA 3DSMA 2CNXA 3CIKB 4A08B 2QXVA 4CZYA 4E5ZB 5H14A 4QT8A 2MTAH 3NVQA 2I0TA 4XYIA 1N6FA 4E54B 3MMYA 1B9YA 4H5IA 4I79A 1S4UX 2AGXA 3PXSD 4A0BB 3I7NA 4ESGA 4J86A 4D0KA 2PM9B 1GXRA 5I5JA 1PEVA 4CI2A 3JZHA 3N0DA 2OVQB 4CY1A 3RRMC 4OZUA 3SLED 1K8KC 4J87A 4D6VA 5TEFA 4TZ4A 5GSAA 2CN3A 4O9DA 3FGBA 4N14A 3JRPA 4JXMA 3SJLD 4FA4D 4A09B 3PE7A 4GQ2P 3PVWB 4E54A 4L3HD 2PM9A 5JWZA 4A0AB 1N6DA 2OVPB 3SBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG1 A;  4J8G A;  4ES0 A;  3SXT D;  3P4F A;  3JB9 L;  2H47 A;  3V7D B;  2H6K A;  2OK4 A;  3C5M A;  4FA5 D;  3IJ1 A;  4U7A A;  4CY3 A;  3OKT A;  5HE3 B;  4L3G D;  4A11 A;  2I0R A;  3L4M D;  2IWK A;  3K27 A;  4JD2 C;  2H68 A;  3JAM g;  3CFV A;  4AOW A;  1JOF A;  4EWR A;  1U2V C;  2J57 G;  1JMX B;  4JSP C;  2H9P A;  4PC0 A;  2AGZ A;  1PI6 A;  3FM0 A;  5EM2 A;  5C2W B;  3EI1 B;  1NEX B;  4A0B A;  2QC5 A;  3I7P A;  2HES X;  4BUJ C;  3UVN A;  2PM6 B;  3KRW B;  2IAA A;  2HJB A;  4O3U B;  4ZOZ A;  4X60 B;  2B4E A;  3DWL C;  3MKQ A;  2G99 A;  4A2L A;  3UKR C;  4HDJ A;  2CN2 A;  1U4C A;  3BG0 A;  4O1Q D;  1GG2 B;  3B7F A;  4FWW A;  3SHF A;  4ZOY A;  1NR0 A;  1TYQ C;  4CC9 A;  4Z8L A;  3I7K A;  3ULE C;  4GZ8 A;  2H14 A;  5CYK B;  5TF2 A;  4NSX A;  4X63 B;  2UZY B;  2GC4 A;  4J81 A;  4QL1 A;  4JSX C;  2OIZ A;  4CY5 A;  5FKR A;  5A2Q g;  3MXX A;  3AFC A;  4O45 A;  4FB1 D;  3ORV D;  2P9N C;  2CE8 A;  4FAN D;  4AEZ A;  1PGU A;  3I2N A;  4J82 A;  4A2M A;  3SN6 B;  4CZV A;  4FHL A;  3EG6 A;  2XU7 A;  4LG9 A;  5GXH A;  3I7O A;  4XEI C;  3DM0 A;  3EI3 B;  4Y7R A;  2IUV A;  1MG2 A;  4ZOV A;  3C9C A;  2H13 A;  3F3F A;  1MG3 A;  3F3P A;  5C9Z B;  3I7H A;  3RFG A;  3EMH A;  4PBY A;  2AH1 A;  4GQ1 A;  1JMZ B;  3UVO A;  4A11 B;  4L1Q D;  5CXB A;  4L9O A;  3I8E A;  2I3S A;  3U4Y A;  4X3E A;  4CZX A;  4PSX B;  1SQJ A;  2HKR A;  1MDA H;  3I7L A;  4GGD A;  3PSC B;  4MK0 B;  3UVM A;  4FAV D;  3VGZ A;  3OKY A;  3SMR A;  4ERZ A;  4IA9 A;  1RI6 A;  2EBS A;  4ZN4 A;  1XIP A;  2PM7 B;  2OVR B;  3AL8 A;  2GC7 A;  1Q47 A;  2H9L A;  4GM3 A;  1A0R B;  2CE9 A;  3UVK A;  5KDO B;  4QRJ A;  4UI9 R;  3SCY A;  4J77 A;  2Q7Q A;  2AGW A;  2O9K A;  3VH0 A;  2YBA A;  5FA5 B;  1OLZ A;  5CXB B;  4CY2 A;  3SBP A;  4GMB A;  1TBG A;  2W18 A;  4E5Z A;  4OWR A;  5EAM A;  2HKM A;  5FKT A;  5I5M A;  3K26 A;  2OK6 A;  3RFH A;  2CO0 C;  3RN1 D;  1XKS A;  5GXI A;  3EI2 A;  5HYN B;  3E0C A;  2Z2O A;  2IUP A;  2XL2 A;  5EM2 B;  5THA A;  5GMK n;  4JSN C;  4PNK B;  2IUR A;  5CXC B;  3UR4 A;  4PXW A;  5FQD A;  5EAR A;  1L0Q A;  4J0X A;  3ZWL B;  3JZG A;  3IIW A;  4X61 B;  5HE2 B;  4KFM B;  3UKU C;  5TDH B;  4CI8 A;  1PBY B;  3IJ0 A;  2Z2P A;  5EMJ B;  5IT9 g;  4J84 A;  2HYE A;  5C2V B;  5B4W A;  3RLM D;  1GP2 B;  5HQG A;  4K3J B;  2H9N A;  3PXT D;  4A7J A;  2J55 H;  2AGL A;  3AH8 B;  2P9P C;  1ERJ A;  2Z2N A;  1N6E A;  3PXW D;  2CO0 A;  5K19 A;  2YNP A;  2TRC B;  3F3G A;  3AL8 B;  2BCJ B;  4R7A B;  2XYI A;  5TEE A;  3CFS B;  3OL2 B;  3SFZ A;  2B5N A;  2OJY A;  3GRE A;  4GGA A;  5EML B;  3JPX A;  2HXC A;  3SVW D;  2B5L A;  5K1C C;  5HE0 B;  3SWS D;  1YFQ A;  4JSV C;  3EWE A;  5EMK B;  1P22 A;  2IUQ A;  3SBQ A;  3RSE C;  2YB8 B;  4K3I D;  3OTT A;  2J56 H;  5IC7 A;  2P9L C;  2P9U C;  4YVD A;  5IGO A;  2GNQ A;  1QNI A;  3EI2 B;  4CI3 A;  2AQ5 A;  3I8C A;  3MKS B;  3W15 A;  3BWS A;  3GFC A;  2AGY A;  2H3X A;  2P9K C;  4G56 B;  3RMZ D;  3OL2 A;  4QQE A;  3L4O D;  3UVL A;  4Y5R D;  4XYH A;  3IJC A;  3EI3 A;  4LG8 A;  5AJA A;  3IIY A;  1FWX A;  4JT5 C;  5EMM B;  4CI1 A;  3DXK C;  3AL9 A;  3N0E A;  5FLX g;  4A09 A;  4O3T B;  3EI4 A;  1SQ9 A;  1JJU B;  3C75 H;  2B5M A;  4J79 A;  5IGQ A;  2IWF A;  3EI1 A;  2G9A A;  5EAP A;  4A08 A;  1SHY B;  3J81 g;  2YNO A;  5H17 A;  4A0A A;  3VA6 A;  5AFU 3;  5FKS A;  4JT6 C;  3MZL A;  4H5J A;  2PBI B;  3PVU B;  4GM9 A;  4ERQ A;  3OW8 A;  2P9S C;  3DXM C;  2H6Q A;  3ODT A;  4U1E I;  4FA1 D;  2H9M A;  3C99 A;  2I0S A;  2I3T A;  3NVN A;  3RN0 D;  5AMS A;  2YMU A;  3V9F A;  2P9I C;  4PBZ A;  4GQB B;  3EI4 B;  4J78 A;  3V5W B;  5SXM A;  3EU7 A;  4J0W A;  1B9X A;  4PSW B;  4GGC A;  3MZK A;  4LGN A;  3HFQ A;  5I5I A;  5IJ7 E;  3OKY B;  5FKQ A;  4J8B A;  2YNN A;  4FA9 D;  3OKW A;  1GOT B;  3KRX B;  3I89 A;  5EAL A;  2BBK H;  3FRX A;  4J73 A;  5CXC A;  3NVX A;  4IMM A;  4BL0 A;  4GM8 A;  1R5M A;  4ERY A;  1VYH C;  3PSL A;  3A0F A;  2HJ4 A;  3JZN A;  3IKO A;  2UZX B;  2H6N A;  2XL3 A;  3J80 g;  1OMW B;  4ZOX A;  5CYK A;  3JRO A;  5FXY A;  5H1M A;  1K32 A;  2AH0 A;  5IJ8 E;  5HE1 B;  4BH6 A;  1XHM A;  3DSM A;  2CNX A;  3CIK B;  4A08 B;  2QXV A;  4CZY A;  4E5Z B;  5H14 A;  4QT8 A;  2MTA H;  3NVQ A;  2I0T A;  4XYI A;  1N6F A;  4E54 B;  3MMY A;  1B9Y A;  4H5I A;  4I79 A;  1S4U X;  2AGX A;  3PXS D;  4A0B B;  3I7N A;  4ESG A;  4J86 A;  4D0K A;  2PM9 B;  1GXR A;  5I5J A;  1PEV A;  4CI2 A;  3JZH A;  3N0D A;  2OVQ B;  4CY1 A;  3RRM C;  4OZU A;  3SLE D;  1K8K C;  4J87 A;  4D6V A;  5TEF A;  4TZ4 A;  5GSA A;  2CN3 A;  4O9D A;  3FGB A;  4N14 A;  3JRP A;  4JXM A;  3SJL D;  4FA4 D;  4A09 B;  3PE7 A;  4GQ2 P;  3PVW B;  4E54 A;  4L3H D;  2PM9 A;  5JWZ A;  4A0A B;  1N6D A;  2OVP B;  3SBR A; 
#chains in the Genus database with same CATH topology
 5M5U A;  3BG1 A;  4J8G A;  4ES0 A;  3SXT D;  3P4F A;  3JB9 L;  2H47 A;  3V7D B;  2H6K A;  2OK4 A;  3O4G A;  2VDL A;  3C5M A;  4JHP C;  4FA5 D;  3IJ1 A;  4U7A A;  4RE6 A;  4CY3 A;  3OKT A;  1A12 A;  5HE3 B;  2EID A;  4L3G D;  4A11 A;  2I0R A;  1GOF A;  3L4M D;  3ZDX A;  1UOP A;  2IWK A;  3K27 A;  4JD2 C;  2H68 A;  3JAM g;  1T2X A;  3CFV A;  1JOF A;  1QFM A;  4AOW A;  4AX4 A;  4EWR A;  1U2V C;  2J57 G;  1JMX B;  4JSP C;  2H9P A;  3EQ8 A;  4PC0 A;  2AGZ A;  4BCD A;  1PI6 A;  4QAM A;  3FM0 A;  3MUN A;  5EM2 A;  5C2W B;  3EI1 B;  1NEX B;  4A0B A;  2QC5 A;  3I7P A;  4AMY A;  2HES X;  4BUJ C;  3UVN A;  2PM6 B;  3KRW B;  3O4J A;  2IAA A;  1QFS A;  2HJB A;  5E6R A;  4O3U B;  4ZOZ A;  1U8C A;  4X60 B;  2B4E A;  3DWL C;  3MKQ A;  2G99 A;  4A2L A;  3UKR C;  4DNW A;  4HDJ A;  4DNU A;  2CN2 A;  1U4C A;  3BG0 A;  4O1Q D;  1GG2 B;  3B7F A;  4BP9 A;  2WQ8 A;  4FWW A;  5M5T A;  3SHF A;  4ZOY A;  1NR0 A;  4AMZ A;  1TYQ C;  3ZE0 A;  2QR5 A;  4CC9 A;  4Z8L A;  3I7K A;  3ULE C;  4GZ8 A;  2H14 A;  5CYK B;  5TF2 A;  4NSX A;  4X63 B;  2UZY B;  4G1M A;  2GC4 A;  4J81 A;  4QL1 A;  4JSX C;  2OIZ A;  4CY5 A;  5FKR A;  5HDB A;  5A2Q g;  4BP8 A;  3MXX A;  3AFC A;  4O45 A;  3NIF A;  4FB1 D;  4Z7Q A;  3NID A;  3ORV D;  2P9N C;  2CE8 A;  4FAN D;  4AEZ A;  1PGU A;  3I2N A;  4J82 A;  4A2M A;  3SN6 B;  4CZV A;  4FHL A;  3EG6 A;  2XU7 A;  4LG9 A;  1C9I A;  5GXH A;  3I7O A;  4XEI C;  3DM0 A;  3EI3 B;  4Y7R A;  2IUV A;  1MG2 A;  4ZOV A;  3C9C A;  2H13 A;  3F3F A;  1O6G A;  1MG3 A;  3F3P A;  5C9Z B;  3I7H A;  3RFG A;  4UM8 A;  3EMH A;  3FCU A;  4PBY A;  2AH1 A;  4GQ1 A;  1JMZ B;  3UVO A;  5E6S A;  4A11 B;  4L1Q D;  5CXB A;  4L9O A;  3I8E A;  4O2W A;  2I3S A;  3U4Y A;  4X3E A;  4CZX A;  4PSX B;  1SQJ A;  2HKR A;  1MDA H;  3I7L A;  4GGD A;  4AN1 A;  3PSC B;  4MK0 B;  3UVM A;  4FAV D;  3VGZ A;  3OKY A;  4O02 A;  3SMR A;  4JHN A;  4ERZ A;  4IA9 A;  1RI6 A;  2EBS A;  4ZN4 A;  3EQ7 A;  2VC2 A;  1XIP A;  2PM7 B;  2OVR B;  3AL8 A;  3IVM A;  2GC7 A;  1Q47 A;  2H9L A;  4GM3 A;  1A0R B;  3SBR A;  2CE9 A;  3UVK A;  5KDO B;  4QRJ A;  4UI9 R;  3SCY A;  4J77 A;  2Q7Q A;  2AGW A;  2O9K A;  3T3P A;  3VH0 A;  3IUJ A;  2EIC A;  3GC3 B;  2YBA A;  5FA5 B;  1OLZ A;  5CXB B;  5M5R A;  4L1M A;  3SBP A;  4CY2 A;  4GMB A;  5C92 A;  4MMY A;  1TBG A;  1JTD B;  2QZP A;  2W18 A;  4E5Z A;  4OWR A;  5EAM A;  2HKM A;  5FKT A;  5I5M A;  3K26 A;  4IRZ A;  2OK6 A;  3RFH A;  2CO0 C;  3RN1 D;  1XKS A;  5GXI A;  3EI2 A;  5HYN B;  3E0C A;  2Z2O A;  4MMX A;  2IUP A;  2XL2 A;  5EM2 B;  5THA A;  5GMK n;  4JSN C;  4PNK B;  1UOQ A;  2HU8 A;  2IUR A;  1GOH A;  5CXC B;  3UR4 A;  4PXW A;  4G1E A;  5FQD A;  2XE4 A;  2VDM A;  1I2M B;  5EAR A;  1L0Q A;  4J0X A;  3ZWL B;  3JZG A;  3IIW A;  3IUM A;  4X61 B;  5HE2 B;  1VE6 A;  1C9L A;  1H2X A;  4KFM B;  3UKU C;  5TDH B;  2VDQ A;  5FFO A;  3K6S A;  4CI8 A;  1PBY B;  3IJ0 A;  2Z2P A;  5EMJ B;  5IT9 g;  3MVD K;  4J84 A;  3VI4 A;  2HYE A;  5C2V B;  5B4W A;  3RLM D;  4WK2 A;  1GP2 B;  4AN0 A;  5HQG A;  4K3J B;  2H9N A;  3PXT D;  4A7J A;  2J55 H;  2AGL A;  4DNV A;  1UOO A;  3AH8 B;  4NBM A;  2P9P C;  1ERJ A;  2Z2N A;  1N6E A;  3PXW D;  2CO0 A;  5K19 A;  2YNP A;  2TRC B;  3F3G A;  4D9S A;  4WK0 A;  3AL8 B;  2BCJ B;  4R7A B;  1E8N A;  2XYI A;  3CFS B;  5TEE A;  3OL2 B;  3SFZ A;  2B5N A;  2OJY A;  3GRE A;  4GGA A;  1VE7 A;  5EML B;  4RE5 A;  3JPX A;  2HXC A;  3SVW D;  1E5T A;  2B5L A;  5K1C C;  5HE0 B;  3SWS D;  1YFQ A;  4JSV C;  4Z7O A;  3EWE A;  5EMK B;  1P22 A;  2IUQ A;  3SBQ A;  3RSE C;  2VDN A;  2YB8 B;  1E8M A;  1H2Z A;  4K3I D;  3OTT A;  2J56 H;  3IUR A;  5IC7 A;  5FFG A;  2P9L C;  1UTC A;  2XDW A;  2P9U C;  4YVD A;  3MUO A;  5IGO A;  2GNQ A;  1QNI A;  3EI2 B;  4CI3 A;  2AQ5 A;  3I8C A;  3MKS B;  3W15 A;  1GOG A;  3BWS A;  2XZG A;  2AGY A;  3GFC A;  3IUN A;  2H3X A;  2P9K C;  4WK4 A;  4G56 B;  3RMZ D;  1L5G A;  3OL2 A;  3L4O D;  2JKX A;  4MMZ A;  1H2W A;  4QQE A;  3UVL A;  1YR2 A;  4XYH A;  4Y5R D;  3DDU A;  3EI3 A;  3IJC A;  4LG8 A;  5AJA A;  3IIY A;  1FWX A;  4JT5 C;  5EMM B;  4CI1 A;  3DXK C;  3AL9 A;  3N0E A;  5FLX g;  4A09 A;  4O3T B;  3EI4 A;  1SQ9 A;  1JJU B;  3C75 H;  1H2Y A;  2B5M A;  4J79 A;  3K71 A;  5IGQ A;  3V4V A;  2IWF A;  3EI1 A;  2G9A A;  1K3I A;  5EAP A;  4A08 A;  2EIB A;  1SHY B;  3IJE A;  2EIE A;  1VZ3 A;  2YNO A;  3J81 g;  3ZE1 A;  5M5V A;  5H17 A;  4A0A A;  3VA6 A;  5AFU 3;  3QI0 A;  5FKS A;  4JT6 C;  3O4I A;  3MZL A;  4H5J A;  3OF7 A;  2PBI B;  3PVU B;  4GM9 A;  4ERQ A;  3OW8 A;  2P9S C;  3DXM C;  2H6Q A;  3ODT A;  4U1E I;  4FA1 D;  1O6F A;  2H9M A;  3C99 A;  3ZDY A;  2I0S A;  2I3T A;  3NVN A;  3RN0 D;  5AMS A;  2YMU A;  4WJK A;  2P9I C;  4PBZ A;  3V9F A;  4GQB B;  4BCB A;  3EI4 B;  4J78 A;  3V5W B;  5SXM A;  1BPO A;  4UM9 A;  3O4H A;  3EU7 A;  4J0W A;  1B9X A;  2VZ1 A;  4PSW B;  4GGC A;  3MZK A;  4LGN A;  3HFQ A;  5I5I A;  5IJ7 E;  3OKY B;  2VDR A;  5FKQ A;  4J8B A;  2YNN A;  4FA9 D;  3OKW A;  1GOT B;  3KRX B;  3I89 A;  5EAL A;  1JV2 A;  2BBK H;  3FRX A;  3ZDZ A;  4J73 A;  5CXC A;  3IUL A;  1M1X A;  2VDK A;  3NVX A;  4IMM A;  4BL0 A;  4GM8 A;  5M61 A;  1R5M A;  4ERY A;  1VYH C;  3PSL A;  3A0F A;  4NAA A;  2HJ4 A;  3T3M A;  3JZN A;  3IKO A;  2UZX B;  3FCS A;  2H6N A;  2XL3 A;  3J80 g;  1OMW B;  2HU5 A;  5CYK A;  3JRO A;  4ZOX A;  5FXY A;  3V4P A;  5H1M A;  1K32 A;  2AH0 A;  5IJ8 E;  5HE1 B;  4BH6 A;  5M5S A;  1XHM A;  3DSM A;  2CNX A;  3CIK B;  4A08 B;  2QXV A;  4CZY A;  3NIG A;  1TYE A;  4E5Z B;  5H14 A;  4QT8 A;  3IUQ A;  2MTA H;  3NVQ A;  4G55 A;  2I0T A;  4XYI A;  1N6F A;  4BCC A;  4E54 B;  3MMY A;  1B9Y A;  4H5I A;  4I79 A;  1VZ2 A;  2VDO A;  1S4U X;  2AGX A;  3PXS D;  4A0B B;  3I7N A;  4ESG A;  4J86 A;  4D0K A;  2PM9 B;  1GXR A;  5I5J A;  1PEV A;  3ZE2 A;  4CI2 A;  4Z7N A;  3JZH A;  3N0D A;  2OVQ B;  4CY1 A;  3RRM C;  4OZU A;  3SLE D;  1K8K C;  4J87 A;  3KCI A;  4D6V A;  5TEF A;  4TZ4 A;  5GSA A;  2CN3 A;  4O9D A;  3FGB A;  4N14 A;  3JRP A;  3QHY B;  4JXM A;  4NEN A;  3SJL D;  3VI3 A;  4FA4 D;  4A09 B;  3PE7 A;  5E6U A;  4GQ2 P;  3PVW B;  4E54 A;  3K72 A;  5C86 A;  2BKL A;  4L3H D;  2PM9 A;  2VZ3 A;  5JWZ A;  4A0A B;  1N6D A;  2HU7 A;  2OVP B;  4NC4 A;  2VDP A;  3GD1 I;  3EQ9 A; 
#chains in the Genus database with same CATH homology
 3BG1 A;  4J8G A;  4ES0 A;  3SXT D;  3P4F A;  3JB9 L;  2H47 A;  3V7D B;  2H6K A;  2OK4 A;  3C5M A;  4FA5 D;  3IJ1 A;  4U7A A;  4CY3 A;  3OKT A;  5HE3 B;  4L3G D;  4A11 A;  2I0R A;  3L4M D;  2IWK A;  3K27 A;  4JD2 C;  2H68 A;  3JAM g;  3CFV A;  4AOW A;  1JOF A;  4EWR A;  1U2V C;  2J57 G;  1JMX B;  4JSP C;  2H9P A;  4PC0 A;  2AGZ A;  1PI6 A;  3FM0 A;  5EM2 A;  5C2W B;  3EI1 B;  1NEX B;  4A0B A;  2QC5 A;  3I7P A;  2HES X;  4BUJ C;  3UVN A;  2PM6 B;  3KRW B;  2IAA A;  2HJB A;  4O3U B;  4ZOZ A;  4X60 B;  2B4E A;  3DWL C;  3MKQ A;  2G99 A;  4A2L A;  3UKR C;  4HDJ A;  2CN2 A;  1U4C A;  3BG0 A;  4O1Q D;  1GG2 B;  3B7F A;  4FWW A;  3SHF A;  4ZOY A;  1NR0 A;  1TYQ C;  4CC9 A;  4Z8L A;  3I7K A;  3ULE C;  4GZ8 A;  2H14 A;  5CYK B;  5TF2 A;  4NSX A;  4X63 B;  2UZY B;  2GC4 A;  4J81 A;  4QL1 A;  4JSX C;  2OIZ A;  4CY5 A;  5FKR A;  5A2Q g;  3MXX A;  3AFC A;  4O45 A;  4FB1 D;  3ORV D;  2P9N C;  2CE8 A;  4FAN D;  4AEZ A;  1PGU A;  3I2N A;  4J82 A;  4A2M A;  3SN6 B;  4CZV A;  4FHL A;  3EG6 A;  2XU7 A;  4LG9 A;  5GXH A;  3I7O A;  4XEI C;  3DM0 A;  3EI3 B;  4Y7R A;  2IUV A;  1MG2 A;  4ZOV A;  3C9C A;  2H13 A;  3F3F A;  1MG3 A;  3F3P A;  5C9Z B;  3I7H A;  3RFG A;  3EMH A;  4PBY A;  2AH1 A;  4GQ1 A;  1JMZ B;  3UVO A;  4A11 B;  4L1Q D;  5CXB A;  4L9O A;  3I8E A;  2I3S A;  3U4Y A;  4X3E A;  4CZX A;  4PSX B;  1SQJ A;  2HKR A;  1MDA H;  3I7L A;  4GGD A;  3PSC B;  4MK0 B;  3UVM A;  4FAV D;  3VGZ A;  3OKY A;  3SMR A;  4ERZ A;  4IA9 A;  1RI6 A;  2EBS A;  4ZN4 A;  1XIP A;  2PM7 B;  2OVR B;  3AL8 A;  2GC7 A;  1Q47 A;  2H9L A;  4GM3 A;  1A0R B;  2CE9 A;  3UVK A;  5KDO B;  4QRJ A;  4UI9 R;  3SCY A;  4J77 A;  2Q7Q A;  2AGW A;  2O9K A;  3VH0 A;  2YBA A;  5FA5 B;  1OLZ A;  5CXB B;  4CY2 A;  3SBP A;  4GMB A;  1TBG A;  2W18 A;  4E5Z A;  4OWR A;  5EAM A;  2HKM A;  5FKT A;  5I5M A;  3K26 A;  2OK6 A;  3RFH A;  2CO0 C;  3RN1 D;  1XKS A;  5GXI A;  3EI2 A;  5HYN B;  3E0C A;  2Z2O A;  2IUP A;  2XL2 A;  5EM2 B;  5THA A;  5GMK n;  4JSN C;  4PNK B;  2IUR A;  5CXC B;  3UR4 A;  4PXW A;  5FQD A;  5EAR A;  1L0Q A;  4J0X A;  3ZWL B;  3JZG A;  3IIW A;  4X61 B;  5HE2 B;  4KFM B;  3UKU C;  5TDH B;  4CI8 A;  1PBY B;  3IJ0 A;  2Z2P A;  5EMJ B;  5IT9 g;  4J84 A;  2HYE A;  5C2V B;  5B4W A;  3RLM D;  1GP2 B;  5HQG A;  4K3J B;  2H9N A;  3PXT D;  4A7J A;  2J55 H;  2AGL A;  3AH8 B;  2P9P C;  1ERJ A;  2Z2N A;  1N6E A;  3PXW D;  2CO0 A;  5K19 A;  2YNP A;  2TRC B;  3F3G A;  3AL8 B;  2BCJ B;  4R7A B;  2XYI A;  5TEE A;  3CFS B;  3OL2 B;  3SFZ A;  2B5N A;  2OJY A;  3GRE A;  4GGA A;  5EML B;  3JPX A;  2HXC A;  3SVW D;  2B5L A;  5K1C C;  5HE0 B;  3SWS D;  1YFQ A;  4JSV C;  3EWE A;  5EMK B;  1P22 A;  2IUQ A;  3SBQ A;  3RSE C;  2YB8 B;  4K3I D;  3OTT A;  2J56 H;  5IC7 A;  2P9L C;  2P9U C;  4YVD A;  5IGO A;  2GNQ A;  1QNI A;  3EI2 B;  4CI3 A;  2AQ5 A;  3I8C A;  3MKS B;  3W15 A;  3BWS A;  3GFC A;  2AGY A;  2H3X A;  2P9K C;  4G56 B;  3RMZ D;  3OL2 A;  4QQE A;  3L4O D;  3UVL A;  4Y5R D;  4XYH A;  3IJC A;  3EI3 A;  4LG8 A;  5AJA A;  3IIY A;  1FWX A;  4JT5 C;  5EMM B;  4CI1 A;  3DXK C;  3AL9 A;  3N0E A;  5FLX g;  4A09 A;  4O3T B;  3EI4 A;  1SQ9 A;  1JJU B;  3C75 H;  2B5M A;  4J79 A;  5IGQ A;  2IWF A;  3EI1 A;  2G9A A;  5EAP A;  4A08 A;  1SHY B;  3J81 g;  2YNO A;  5H17 A;  4A0A A;  3VA6 A;  5AFU 3;  5FKS A;  4JT6 C;  3MZL A;  4H5J A;  2PBI B;  3PVU B;  4GM9 A;  4ERQ A;  3OW8 A;  2P9S C;  3DXM C;  2H6Q A;  3ODT A;  4U1E I;  4FA1 D;  2H9M A;  3C99 A;  2I0S A;  2I3T A;  3NVN A;  3RN0 D;  5AMS A;  2YMU A;  3V9F A;  2P9I C;  4PBZ A;  4GQB B;  3EI4 B;  4J78 A;  3V5W B;  5SXM A;  3EU7 A;  4J0W A;  1B9X A;  4PSW B;  4GGC A;  3MZK A;  4LGN A;  3HFQ A;  5I5I A;  5IJ7 E;  3OKY B;  5FKQ A;  4J8B A;  2YNN A;  4FA9 D;  3OKW A;  1GOT B;  3KRX B;  3I89 A;  5EAL A;  2BBK H;  3FRX A;  4J73 A;  5CXC A;  3NVX A;  4IMM A;  4BL0 A;  4GM8 A;  1R5M A;  4ERY A;  1VYH C;  3PSL A;  3A0F A;  2HJ4 A;  3JZN A;  3IKO A;  2UZX B;  2H6N A;  2XL3 A;  3J80 g;  1OMW B;  4ZOX A;  5CYK A;  3JRO A;  5FXY A;  5H1M A;  1K32 A;  2AH0 A;  5IJ8 E;  5HE1 B;  4BH6 A;  1XHM A;  3DSM A;  2CNX A;  3CIK B;  4A08 B;  2QXV A;  4CZY A;  4E5Z B;  5H14 A;  4QT8 A;  2MTA H;  3NVQ A;  2I0T A;  4XYI A;  1N6F A;  4E54 B;  3MMY A;  1B9Y A;  4H5I A;  4I79 A;  1S4U X;  2AGX A;  3PXS D;  4A0B B;  3I7N A;  4ESG A;  4J86 A;  4D0K A;  2PM9 B;  1GXR A;  5I5J A;  1PEV A;  4CI2 A;  3JZH A;  3N0D A;  2OVQ B;  4CY1 A;  3RRM C;  4OZU A;  3SLE D;  1K8K C;  4J87 A;  4D6V A;  5TEF A;  4TZ4 A;  5GSA A;  2CN3 A;  4O9D A;  3FGB A;  4N14 A;  3JRP A;  4JXM A;  3SJL D;  4FA4 D;  4A09 B;  3PE7 A;  4GQ2 P;  3PVW B;  4E54 A;  4L3H D;  2PM9 A;  5JWZ A;  4A0A B;  1N6D A;  2OVP B;  3SBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...