2IUVA

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form b
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
359
structure length
359
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
total genus 95
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iuvA01
4JT6C 3OKWA 4J86A 5EAMA 5HE1B 4A11A 3OTTA 4J81A 2P9NC 4QL1A 5A2Qg 2P9IC 5EM2B 3JB9L 5C9ZB 3DSMA 2IURA 3JAMg 4BUJC 3SFZA 1PGUA 3V7DB 4ERQA 5FLXg 3I2NA 3K26A 3RN0D 4HDJA 2I0SA 4ZOXA 2PBIB 1S4UX 5TF2A 4FA1D 4E54A 4AOWA 1PBYB 4N14A 2YB8B 2O9KA 4J78A 5THAA 3UVNA 2PM9B 4CI1A 2P9PC 4PXWA 2Q7QA 4J8GA 2XL2A 5H14A 4GM8A 3A0FA 4XEIC 4Z8LA 4FB1D 3EMHA 4A09A 3E0CA 2IWFA 3EI3B 3PSCB 4QT8A 4O9DA 2OIZA 2IUPA 4NSXA 3AH8B 1P22A 2Z2PA 4EWRA 3OKTA 5CXCB 4PC0A 2CE9A 2H9LA 2H9NA 4JSVC 4IA9A 3JZNA 3ORVD 4ERZA 5I5JA 3DXKC 4A2MA 3EI4A 4J0XA 5IC7A 2YNOA 5HYNB 2TRCB 4A0BB 3B7FA 4GGCA 4ES0A 3AFCA 5GSAA 4J0WA 2B5LA 1OLZA 5B4WA 4L1QD 3DWLC 5HE3B 3EU7A 1SHYB 4J82A 4MK0B 4H5IA 3SBQA 2H9MA 3OKYB 3VGZA 3RN1D 4FWWA 5CYKA 5KDOB 2AGYA 4U7AA 3BG1A 2IWKA 3VH0A 3EI1A 5AFU3 4FHLA 4X61B 1XHMA 4CY3A 1XIPA 4TZ4A 3EWEA 4JSPC 4E5ZB 3NVXA 3FGBA 2QXVA 4ESGA 2PM6B 5TEEA 4IMMA 2H14A 4FA9D 1SQ9A 3AL8A 2XL3A 3N0DA 1GXRA 1PEVA 3DM0A 5SXMA 2OK6A 4X60B 5CXBA 1TBGA 2I3TA 5EMLB 2I3SA 4JD2C 1RI6A 2GC4A 5EMMB 5IGQA 4CY1A 2CNXA 1MG3A 4A11B 2OJYA 4FA5D 5EMKB 1TYQC 3I89A 1JMZB 3C75H 5GXHA 2H9PA 2YNNA 3PXTD 4XYHA 3PVUB 1A0RB 5EM2A 2CN3A 4CC9A 3PVWB 4L3GD 2G99A 5IT9g 1N6DA 2IUVA 3PXSD 2XYIA 2H6NA 3SBPA 3I7OA 4A0AA 2J55H 3C9CA 1FWXA 4QQEA 3JZGA 4E54B 4CI3A 2YBAA 4CZXA 5C2WB 2GC7A 3MZKA 3RMZD 3HFQA 3K27A 2OVPB 4O45A 2AGWA 4LG8A 2G9AA 1JJUB 4GGDA 1GOTB 5IJ8E 4UI9R 4CY2A 3ZWLB 3J81g 4A09B 2P9SC 5EALA 1GG2B 4FAVD 3V5WB 5I5MA 2H6QA 1L0QA 2HKMA 1U2VC 3PSLA 2H47A 3JRPA 4GQ1A 4ZN4A 2J56H 4X63B 3PE7A 4G56B 2XU7A 3NVNA 4GM3A 5I5IA 4GQBB 5AJAA 2YNPA 3JROA 1B9YA 2I0TA 4L3HD 2OVQB 3UVLA 5FKTA 3I8EA 2AQ5A 3EI4B 4R7AB 4LGNA 1ERJA 1Q47A 3JZHA 2BBKH 3BWSA 5GMKn 4I79A 3RFHA 5K1CC 4JT5C 2OVRB 4O1QD 3OL2A 3C99A 3MMYA 1B9XA 5FQDA 1R5MA 2J57G 4GQ2P 4J87A 3SN6B 4PNKB 3FM0A 2H3XA 2H6KA 3ODTA 4A2LA 5CYKB 3EI2A 3J80g 4FA4D 4J73A 4PBYA 2CO0A 5TDHB 3EI1B 3MKSB 2W18A 5FKRA 4JSXC 4AEZA 2P9LC 3GREA 4L9OA 5H1MA 4GZ8A 1OMWB 5IJ7E 4A08A 2BCJB 3ULEC 4ZOYA 1NR0A 4U1EI 2B5NA 4Y5RD 3MKQA 4K3ID 3AL8B 5HE2B 5CXBB 4K3JB 1GP2B 4J8BA 1N6FA 2HXCA 1JMXB 2AH1A 2QC5A 5HQGA 4GGAA 3SBRA 3DXMC 3V9FA 1K8KC 4ERYA 2P9UC 3RSEC 1JOFA 3I7HA 3BG0A 3I8CA 4Y7RA 2HKRA 5EAPA 3VA6A 4XYIA 3IIWA 3GFCA 2UZXB 3RFGA 3I7KA 3RLMD 4X3EA 3MZLA 2AGZA 4A0AB 2IAAA 4ZOVA 4LG9A 4ZOZA 3W15A 3AL9A 2HESX 5FKSA 4OWRA 2HYEA 1PI6A 3PXWD 4CI2A 4GMBA 3C5MA 2GNQA 2P9KC 2PM9A 1N6EA 3CFVA 4JSNC 2Z2NA 4O3TB 3SXTD 4CZVA 5TEFA 5EMJB 3UVOA 4J77A 2H68A 3CFSB 3RRMC 4PBZA 5K19A 2UZYB 3NVQA 3EI3A 5H17A 3SJLD 2CE8A 3KRXB 5IGOA 2CN2A 4CY5A 4PSWB 3I7LA 2AGXA 2H13A 5GXIA 4CI8A 5CXCA 3N0EA 3UVMA 3UR4A 3IKOA 1SQJA 4CZYA 1YFQA 4A7JA 3IJCA 3JPXA 3UKUC 4QRJA 2MTAH 2OK4A 3IIYA 1MDAH 4O3UB 3SWSD 3SLED 3IJ0A 3KRWB 3UVKA 3F3GA 2AGLA 3L4MD 1QNIA 2IUQA 3F3FA 3I7NA 3P4FA 5C2VB 3SHFA 4GM9A 1MG2A 4A0BA 4J79A 3EG6A 4BL0A 4H5JA 4OZUA 4D6VA 2Z2OA 1U4CA 3OL2B 4FAND 3SVWD 2PM7B 5HE0B 4YVDA 5AMSA 1NEXB 1K32A 3I7PA 5FA5B 3U4YA 3IJ1A 4JXMA 3SCYA 3CIKB 5EARA 5FXYA 3SMRA 3OKYA 3EI2B 3UKRC 5FKQA 3F3PA 2YMUA 4PSXB 2HJ4A 2CO0C 1XKSA 4E5ZA 3MXXA 4D0KA 2AH0A 4A08B 2I0RA 2HJBA 2B4EA 4KFMB 2B5MA 3OW8A 4BH6A 3FRXA 3L4OD 1VYHC 2EBSA 5JWZA 4J84A
chains in the Genus database with same CATH superfamily
4JT6C 3OKWA 4J86A 5EAMA 5HE1B 2XE4A 3IURA 4A11A 2VDPA 3OTTA 4J81A 2P9NC 4QL1A 5A2Qg 2P9IC 3T3PA 2VZ3A 3V4VA 5EM2B 3JB9L 5C9ZB 3DSMA 2IURA 3JAMg 4BUJC 3SFZA 1PGUA 3V7DB 4ERQA 5FLXg 3I2NA 1A12A 3K26A 3RN0D 4HDJA 5C92A 2I0SA 4BP9A 4ZOXA 2PBIB 1S4UX 5TF2A 1UOPA 4NBMA 4BCCA 4FA1D 5M5VA 1H2WA 4E54A 4AOWA 1PBYB 2BKLA 4N14A 2YB8B 2O9KA 4J78A 3ZE2A 5THAA 4AX4A 3UVNA 2PM9B 1UOOA 4CI1A 2P9PC 4PXWA 2Q7QA 4J8GA 2XL2A 5H14A 4NENA 1BPOA 4GM8A 3A0FA 4XEIC 4Z8LA 4FB1D 3EMHA 3IJEA 4DNUA 1C9IA 4A09A 3E0CA 4MMZA 2IWFA 1JTDB 3EI3B 3PSCB 4QT8A 4O9DA 3MUOA 3ZE1A 2VDMA 2OIZA 2IUPA 4NSXA 3AH8B 1P22A 2Z2PA 4MMYA 4EWRA 3OKTA 5CXCB 4PC0A 2CE9A 2H9LA 2H9NA 4JSVC 4IA9A 3JZNA 4IRZA 3ORVD 4ERZA 5E6UA 5E6SA 5I5JA 3DXKC 4UM9A 4A2MA 3EI4A 4J0XA 5IC7A 2YNOA 5HYNB 2TRCB 4AN1A 3K6SA 3B7FA 4GGCA 4ES0A 4A0BB 3AFCA 5GSAA 4J0WA 2B5LA 1OLZA 5B4WA 4L1QD 3DWLC 5HE3B 3EU7A 1SHYB 4J82A 4MK0B 4H5IA 2VDLA 3SBQA 3O4JA 3NIGA 3EQ7A 2H9MA 3OKYB 3VGZA 3RN1D 4FWWA 5CYKA 5KDOB 2AGYA 4U7AA 3BG1A 2IWKA 3VH0A 3EI1A 5AFU3 4FHLA 2WQ8A 4X61B 1XHMA 4CY3A 4BCDA 1XIPA 4TZ4A 4D9SA 3EWEA 4JSPC 4E5ZB 3NVXA 1E5TA 3FGBA 2QXVA 4ESGA 4Z7OA 2PM6B 3DDUA 4IMMA 5TEEA 4AMYA 2H14A 4FA9D 1SQ9A 3AL8A 2XL3A 3N0DA 1GXRA 1PEVA 3DM0A 5SXMA 2OK6A 4X60B 5CXBA 1TBGA 2I3TA 3K72A 5EMLB 1L5GA 2I3SA 4JD2C 4BCBA 1RI6A 2GC4A 5EMMB 3KCIA 5IGQA 4CY1A 2CNXA 4MMXA 5C86A 4JHNA 4DNWA 1MG3A 4A11B 2OJYA 4FA5D 5EMKB 2VDOA 1TYQC 3I89A 1JMZB 3C75H 5GXHA 1VZ2A 2H9PA 5M61A 2YNNA 3PXTD 4L1MA 4XYHA 2EICA 3PVUB 1A0RB 4NAAA 2CN3A 2XZGA 5EM2A 3PVWB 4CC9A 2EIEA 4L3GD 2G99A 1VE6A 5IT9g 1N6DA 2IUVA 1K3IA 3PXSD 3IVMA 2XYIA 2H6NA 3SBPA 3I7OA 4A0AA 1QFMA 2J55H 3C9CA 1FWXA 4QQEA 3JZGA 4E54B 4CI3A 2YBAA 4CZXA 5C2WB 1GOHA 2GC7A 3MZKA 3RMZD 3HFQA 3MUNA 3K27A 2OVPB 4O45A 2AGWA 2XDWA 3NIDA 4WJKA 4LG8A 2G9AA 3VI3A 4JHPC 3IUNA 1JJUB 4GGDA 4G1MA 1GOTB 5IJ8E 1GOFA 4AN0A 4UI9R 4CY2A 3ZWLB 3J81g 4A09B 2P9SC 1E8NA 5EALA 3IUQA 2QZPA 1GG2B 4FAVD 2EIBA 3V5WB 5I5MA 2H6QA 1L0QA 2HKMA 1U2VC 3PSLA 4G1EA 3FCUA 3O4HA 2H47A 3JRPA 2QR5A 4GQ1A 4ZN4A 2J56H 1U8CA 4X63B 2EIDA 3PE7A 4G56B 5FFGA 5M5RA 2XU7A 3NVNA 4GM3A 5I5IA 4GQBB 5AJAA 4Z7NA 2YNPA 3JROA 1H2YA 1H2ZA 3NIFA 4AMZA 1B9YA 2I0TA 4L3HD 2OVQB 4WK4A 3UVLA 5FKTA 2VZ1A 2AQ5A 3EQ8A 3EI4B 3I8EA 4R7AB 2VDQA 4LGNA 1ERJA 1Q47A 3JZHA 2BBKH 3BWSA 5GMKn 4I79A 3RFHA 5K1CC 4JT5C 2OVRB 4O1QD 4O2WA 3OL2A 3C99A 1TYEA 3MMYA 1B9XA 5FQDA 1R5MA 2J57G 4GQ2P 4J87A 3SN6B 4PNKB 3FM0A 2H3XA 1M1XA 2H6KA 3K71A 3ODTA 4A2LA 5CYKB 3EI2A 3J80g 4FA4D 3ZDZA 3QI0A 4J73A 2CO0A 2VDNA 4PBYA 5TDHB 3EI1B 3MKSB 2W18A 5FKRA 4JSXC 4AEZA 2P9LC 3GREA 4L9OA 4RE5A 2VC2A 5H1MA 4GZ8A 1OMWB 1C9LA 2HU7A 3IULA 5IJ7E 1QFSA 3ZDYA 4A08A 3O4GA 2BCJB 3ULEC 4ZOYA 1NR0A 4U1EI 3VI4A 1I2MB 2B5NA 4Y5RD 3MKQA 3AL8B 4K3ID 5HE2B 5CXBB 4DNVA 4K3JB 1GP2B 4J8BA 1N6FA 2HXCA 3T3MA 1JMXB 2AH1A 2QC5A 5HQGA 4GGAA 1JV2A 3SBRA 3DXMC 3V9FA 1O6GA 1K8KC 4ERYA 2P9UC 3RSEC 1JOFA 3I7HA 3BG0A 3EQ9A 3I8CA 4RE6A 3ZDXA 4Y7RA 5HDBA 2HKRA 5EAPA 4G55A 3VA6A 4Z7QA 4XYIA 2VDKA 3IIWA 3GFCA 2UZXB 3RFGA 3I7KA 3RLMD 4X3EA 3MZLA 2AGZA 4A0AB 3IUJA 2IAAA 4ZOVA 4LG9A 4ZOZA 3W15A 3AL9A 2HESX 5FKSA 4OWRA 2HYEA 4WK2A 1YR2A 4WK0A 1PI6A 3PXWD 4CI2A 3IUMA 3C5MA 4GMBA 2GNQA 2HU8A 2P9KC 4UM8A 2PM9A 5FFOA 1N6EA 3CFVA 4JSNC 2Z2NA 4O3TB 3SXTD 4BP8A 5M5SA 3V4PA 4CZVA 5M5TA 5TEFA 5EMJB 3UVOA 4J77A 2H68A 3CFSB 1UOQA 3RRMC 5M5UA 4O02A 4PBZA 5K19A 2UZYB 3NVQA 3EI3A 5H17A 3SJLD 2CE8A 3KRXB 5IGOA 2CN2A 4CY5A 4PSWB 3I7LA 2AGXA 2H13A 5GXIA 4CI8A 5CXCA 3N0EA 3UVMA 3UR4A 3IKOA 1SQJA 3QHYB 1YFQA 2VDRA 3IJCA 4A7JA 4CZYA 3JPXA 3UKUC 4QRJA 2MTAH 2OK4A 3IIYA 3MVDK 1MDAH 4O3UB 3SWSD 3SLED 3IJ0A 3KRWB 3UVKA 3F3GA 2AGLA 3ZE0A 3L4MD 1QNIA 3OF7A 2IUQA 3F3FA 3I7NA 3P4FA 5E6RA 5C2VB 3SHFA 1GOGA 4GM9A 1MG2A 4A0BA 4J79A 3EG6A 4BL0A 4H5JA 4OZUA 4D6VA 1T2XA 3FCSA 2Z2OA 3GC3B 1U4CA 3OL2B 4FAND 3SVWD 2PM7B 5HE0B 4YVDA 1O6FA 5AMSA 3GD1I 1NEXB 1K32A 3I7PA 5FA5B 3U4YA 3IJ1A 4JXMA 3SCYA 3CIKB 5EARA 5FXYA 3SMRA 3OKYA 1VE7A 3EI2B 4QAMA 3UKRC 5FKQA 3F3PA 4NC4A 2YMUA 4PSXB 2HJ4A 2CO0C 1XKSA 3O4IA 1UTCA 4E5ZA 1E8MA 3MXXA 4D0KA 2AH0A 2HU5A 4A08B 1H2XA 2I0RA 2HJBA 2B4EA 4KFMB 2B5MA 3OW8A 4BH6A 3FRXA 2JKXA 3L4OD 1VYHC 2EBSA 5JWZA 4J84A 1VZ3A
chains in the Genus database with same CATH topology
4JT6C 3OKWA 4J86A 5EAMA 5HE1B 4A11A 3OTTA 4J81A 2P9NC 4QL1A 5A2Qg 2P9IC 5EM2B 3JB9L 5C9ZB 3DSMA 2IURA 3JAMg 4BUJC 3SFZA 1PGUA 3V7DB 4ERQA 5FLXg 3I2NA 3K26A 3RN0D 4HDJA 2I0SA 4ZOXA 2PBIB 1S4UX 5TF2A 4FA1D 4E54A 4AOWA 1PBYB 4N14A 2YB8B 2O9KA 4J78A 5THAA 3UVNA 2PM9B 4CI1A 2P9PC 4PXWA 2Q7QA 4J8GA 2XL2A 5H14A 4GM8A 3A0FA 4XEIC 4Z8LA 4FB1D 3EMHA 4A09A 3E0CA 2IWFA 3EI3B 3PSCB 4QT8A 4O9DA 2OIZA 2IUPA 4NSXA 3AH8B 1P22A 2Z2PA 4EWRA 3OKTA 5CXCB 4PC0A 2CE9A 2H9LA 2H9NA 4JSVC 4IA9A 3JZNA 3ORVD 4ERZA 5I5JA 3DXKC 4A2MA 3EI4A 4J0XA 5IC7A 2YNOA 5HYNB 2TRCB 4A0BB 3B7FA 4GGCA 4ES0A 3AFCA 5GSAA 4J0WA 2B5LA 1OLZA 5B4WA 4L1QD 3DWLC 5HE3B 3EU7A 1SHYB 4J82A 4MK0B 4H5IA 3SBQA 2H9MA 3OKYB 3VGZA 3RN1D 4FWWA 5CYKA 5KDOB 2AGYA 4U7AA 3BG1A 2IWKA 3VH0A 3EI1A 5AFU3 4FHLA 4X61B 1XHMA 4CY3A 1XIPA 4TZ4A 3EWEA 4JSPC 4E5ZB 3NVXA 3FGBA 2QXVA 4ESGA 2PM6B 5TEEA 4IMMA 2H14A 4FA9D 1SQ9A 3AL8A 2XL3A 3N0DA 1GXRA 1PEVA 3DM0A 5SXMA 2OK6A 4X60B 5CXBA 1TBGA 2I3TA 5EMLB 2I3SA 4JD2C 1RI6A 2GC4A 5EMMB 5IGQA 4CY1A 2CNXA 1MG3A 4A11B 2OJYA 4FA5D 5EMKB 1TYQC 3I89A 1JMZB 3C75H 5GXHA 2H9PA 2YNNA 3PXTD 4XYHA 3PVUB 1A0RB 5EM2A 2CN3A 4CC9A 3PVWB 4L3GD 2G99A 5IT9g 1N6DA 2IUVA 3PXSD 2XYIA 2H6NA 3SBPA 3I7OA 4A0AA 2J55H 3C9CA 1FWXA 4QQEA 3JZGA 4E54B 4CI3A 2YBAA 4CZXA 5C2WB 2GC7A 3MZKA 3RMZD 3HFQA 3K27A 2OVPB 4O45A 2AGWA 4LG8A 2G9AA 1JJUB 4GGDA 1GOTB 5IJ8E 4UI9R 4CY2A 3ZWLB 3J81g 4A09B 2P9SC 5EALA 1GG2B 4FAVD 3V5WB 5I5MA 2H6QA 1L0QA 2HKMA 1U2VC 3PSLA 2H47A 3JRPA 4GQ1A 4ZN4A 2J56H 4X63B 3PE7A 4G56B 2XU7A 3NVNA 4GM3A 5I5IA 4GQBB 5AJAA 2YNPA 3JROA 1B9YA 2I0TA 4L3HD 2OVQB 3UVLA 5FKTA 3I8EA 2AQ5A 3EI4B 4R7AB 4LGNA 1ERJA 1Q47A 3JZHA 2BBKH 3BWSA 5GMKn 4I79A 3RFHA 5K1CC 4JT5C 2OVRB 4O1QD 3OL2A 3C99A 3MMYA 1B9XA 5FQDA 1R5MA 2J57G 4GQ2P 4J87A 3SN6B 4PNKB 3FM0A 2H3XA 2H6KA 3ODTA 4A2LA 5CYKB 3EI2A 3J80g 4FA4D 4J73A 4PBYA 2CO0A 5TDHB 3EI1B 3MKSB 2W18A 5FKRA 4JSXC 4AEZA 2P9LC 3GREA 4L9OA 5H1MA 4GZ8A 1OMWB 5IJ7E 4A08A 2BCJB 3ULEC 4ZOYA 1NR0A 4U1EI 2B5NA 4Y5RD 3MKQA 4K3ID 3AL8B 5HE2B 5CXBB 4K3JB 1GP2B 4J8BA 1N6FA 2HXCA 1JMXB 2AH1A 2QC5A 5HQGA 4GGAA 3SBRA 3DXMC 3V9FA 1K8KC 4ERYA 2P9UC 3RSEC 1JOFA 3I7HA 3BG0A 3I8CA 4Y7RA 2HKRA 5EAPA 3VA6A 4XYIA 3IIWA 3GFCA 2UZXB 3RFGA 3I7KA 3RLMD 4X3EA 3MZLA 2AGZA 4A0AB 2IAAA 4ZOVA 4LG9A 4ZOZA 3W15A 3AL9A 2HESX 5FKSA 4OWRA 2HYEA 1PI6A 3PXWD 4CI2A 4GMBA 3C5MA 2GNQA 2P9KC 2PM9A 1N6EA 3CFVA 4JSNC 2Z2NA 4O3TB 3SXTD 4CZVA 5TEFA 5EMJB 3UVOA 4J77A 2H68A 3CFSB 3RRMC 4PBZA 5K19A 2UZYB 3NVQA 3EI3A 5H17A 3SJLD 2CE8A 3KRXB 5IGOA 2CN2A 4CY5A 4PSWB 3I7LA 2AGXA 2H13A 5GXIA 4CI8A 5CXCA 3N0EA 3UVMA 3UR4A 3IKOA 1SQJA 4CZYA 1YFQA 4A7JA 3IJCA 3JPXA 3UKUC 4QRJA 2MTAH 2OK4A 3IIYA 1MDAH 4O3UB 3SWSD 3SLED 3IJ0A 3KRWB 3UVKA 3F3GA 2AGLA 3L4MD 1QNIA 2IUQA 3F3FA 3I7NA 3P4FA 5C2VB 3SHFA 4GM9A 1MG2A 4A0BA 4J79A 3EG6A 4BL0A 4H5JA 4OZUA 4D6VA 2Z2OA 1U4CA 3OL2B 4FAND 3SVWD 2PM7B 5HE0B 4YVDA 5AMSA 1NEXB 1K32A 3I7PA 5FA5B 3U4YA 3IJ1A 4JXMA 3SCYA 3CIKB 5EARA 5FXYA 3SMRA 3OKYA 3EI2B 3UKRC 5FKQA 3F3PA 2YMUA 4PSXB 2HJ4A 2CO0C 1XKSA 4E5ZA 3MXXA 4D0KA 2AH0A 4A08B 2I0RA 2HJBA 2B4EA 4KFMB 2B5MA 3OW8A 4BH6A 3FRXA 3L4OD 1VYHC 2EBSA 5JWZA 4J84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JT6 C;  3OKW A;  4J86 A;  5EAM A;  5HE1 B;  4A11 A;  3OTT A;  4J81 A;  2P9N C;  4QL1 A;  5A2Q g;  2P9I C;  5EM2 B;  3JB9 L;  5C9Z B;  3DSM A;  2IUR A;  3JAM g;  4BUJ C;  3SFZ A;  1PGU A;  3V7D B;  4ERQ A;  5FLX g;  3I2N A;  3K26 A;  3RN0 D;  4HDJ A;  2I0S A;  4ZOX A;  2PBI B;  1S4U X;  5TF2 A;  4FA1 D;  4E54 A;  4AOW A;  1PBY B;  4N14 A;  2YB8 B;  2O9K A;  4J78 A;  5THA A;  3UVN A;  2PM9 B;  4CI1 A;  2P9P C;  4PXW A;  2Q7Q A;  4J8G A;  2XL2 A;  5H14 A;  4GM8 A;  3A0F A;  4XEI C;  4Z8L A;  4FB1 D;  3EMH A;  4A09 A;  3E0C A;  2IWF A;  3EI3 B;  3PSC B;  4QT8 A;  4O9D A;  2OIZ A;  2IUP A;  4NSX A;  3AH8 B;  1P22 A;  2Z2P A;  4EWR A;  3OKT A;  5CXC B;  4PC0 A;  2CE9 A;  2H9L A;  2H9N A;  4JSV C;  4IA9 A;  3JZN A;  3ORV D;  4ERZ A;  5I5J A;  3DXK C;  4A2M A;  3EI4 A;  4J0X A;  5IC7 A;  2YNO A;  5HYN B;  2TRC B;  4A0B B;  3B7F A;  4GGC A;  4ES0 A;  3AFC A;  5GSA A;  4J0W A;  2B5L A;  1OLZ A;  5B4W A;  4L1Q D;  3DWL C;  5HE3 B;  3EU7 A;  1SHY B;  4J82 A;  4MK0 B;  4H5I A;  3SBQ A;  2H9M A;  3OKY B;  3VGZ A;  3RN1 D;  4FWW A;  5CYK A;  5KDO B;  2AGY A;  4U7A A;  3BG1 A;  2IWK A;  3VH0 A;  3EI1 A;  5AFU 3;  4FHL A;  4X61 B;  1XHM A;  4CY3 A;  1XIP A;  4TZ4 A;  3EWE A;  4JSP C;  4E5Z B;  3NVX A;  3FGB A;  2QXV A;  4ESG A;  2PM6 B;  5TEE A;  4IMM A;  2H14 A;  4FA9 D;  1SQ9 A;  3AL8 A;  2XL3 A;  3N0D A;  1GXR A;  1PEV A;  3DM0 A;  5SXM A;  2OK6 A;  4X60 B;  5CXB A;  1TBG A;  2I3T A;  5EML B;  2I3S A;  4JD2 C;  1RI6 A;  2GC4 A;  5EMM B;  5IGQ A;  4CY1 A;  2CNX A;  1MG3 A;  4A11 B;  2OJY A;  4FA5 D;  5EMK B;  1TYQ C;  3I89 A;  1JMZ B;  3C75 H;  5GXH A;  2H9P A;  2YNN A;  3PXT D;  4XYH A;  3PVU B;  1A0R B;  5EM2 A;  2CN3 A;  4CC9 A;  3PVW B;  4L3G D;  2G99 A;  5IT9 g;  1N6D A;  2IUV A;  3PXS D;  2XYI A;  2H6N A;  3SBP A;  3I7O A;  4A0A A;  2J55 H;  3C9C A;  1FWX A;  4QQE A;  3JZG A;  4E54 B;  4CI3 A;  2YBA A;  4CZX A;  5C2W B;  2GC7 A;  3MZK A;  3RMZ D;  3HFQ A;  3K27 A;  2OVP B;  4O45 A;  2AGW A;  4LG8 A;  2G9A A;  1JJU B;  4GGD A;  1GOT B;  5IJ8 E;  4UI9 R;  4CY2 A;  3ZWL B;  3J81 g;  4A09 B;  2P9S C;  5EAL A;  1GG2 B;  4FAV D;  3V5W B;  5I5M A;  2H6Q A;  1L0Q A;  2HKM A;  1U2V C;  3PSL A;  2H47 A;  3JRP A;  4GQ1 A;  4ZN4 A;  2J56 H;  4X63 B;  3PE7 A;  4G56 B;  2XU7 A;  3NVN A;  4GM3 A;  5I5I A;  4GQB B;  5AJA A;  2YNP A;  3JRO A;  1B9Y A;  2I0T A;  4L3H D;  2OVQ B;  3UVL A;  5FKT A;  3I8E A;  2AQ5 A;  3EI4 B;  4R7A B;  4LGN A;  1ERJ A;  1Q47 A;  3JZH A;  2BBK H;  3BWS A;  5GMK n;  4I79 A;  3RFH A;  5K1C C;  4JT5 C;  2OVR B;  4O1Q D;  3OL2 A;  3C99 A;  3MMY A;  1B9X A;  5FQD A;  1R5M A;  2J57 G;  4GQ2 P;  4J87 A;  3SN6 B;  4PNK B;  3FM0 A;  2H3X A;  2H6K A;  3ODT A;  4A2L A;  5CYK B;  3EI2 A;  3J80 g;  4FA4 D;  4J73 A;  4PBY A;  2CO0 A;  5TDH B;  3EI1 B;  3MKS B;  2W18 A;  5FKR A;  4JSX C;  4AEZ A;  2P9L C;  3GRE A;  4L9O A;  5H1M A;  4GZ8 A;  1OMW B;  5IJ7 E;  4A08 A;  2BCJ B;  3ULE C;  4ZOY A;  1NR0 A;  4U1E I;  2B5N A;  4Y5R D;  3MKQ A;  4K3I D;  3AL8 B;  5HE2 B;  5CXB B;  4K3J B;  1GP2 B;  4J8B A;  1N6F A;  2HXC A;  1JMX B;  2AH1 A;  2QC5 A;  5HQG A;  4GGA A;  3SBR A;  3DXM C;  3V9F A;  1K8K C;  4ERY A;  2P9U C;  3RSE C;  1JOF A;  3I7H A;  3BG0 A;  3I8C A;  4Y7R A;  2HKR A;  5EAP A;  3VA6 A;  4XYI A;  3IIW A;  3GFC A;  2UZX B;  3RFG A;  3I7K A;  3RLM D;  4X3E A;  3MZL A;  2AGZ A;  4A0A B;  2IAA A;  4ZOV A;  4LG9 A;  4ZOZ A;  3W15 A;  3AL9 A;  2HES X;  5FKS A;  4OWR A;  2HYE A;  1PI6 A;  3PXW D;  4CI2 A;  4GMB A;  3C5M A;  2GNQ A;  2P9K C;  2PM9 A;  1N6E A;  3CFV A;  4JSN C;  2Z2N A;  4O3T B;  3SXT D;  4CZV A;  5TEF A;  5EMJ B;  3UVO A;  4J77 A;  2H68 A;  3CFS B;  3RRM C;  4PBZ A;  5K19 A;  2UZY B;  3NVQ A;  3EI3 A;  5H17 A;  3SJL D;  2CE8 A;  3KRX B;  5IGO A;  2CN2 A;  4CY5 A;  4PSW B;  3I7L A;  2AGX A;  2H13 A;  5GXI A;  4CI8 A;  5CXC A;  3N0E A;  3UVM A;  3UR4 A;  3IKO A;  1SQJ A;  4CZY A;  1YFQ A;  4A7J A;  3IJC A;  3JPX A;  3UKU C;  4QRJ A;  2MTA H;  2OK4 A;  3IIY A;  1MDA H;  4O3U B;  3SWS D;  3SLE D;  3IJ0 A;  3KRW B;  3UVK A;  3F3G A;  2AGL A;  3L4M D;  1QNI A;  2IUQ A;  3F3F A;  3I7N A;  3P4F A;  5C2V B;  3SHF A;  4GM9 A;  1MG2 A;  4A0B A;  4J79 A;  3EG6 A;  4BL0 A;  4H5J A;  4OZU A;  4D6V A;  2Z2O A;  1U4C A;  3OL2 B;  4FAN D;  3SVW D;  2PM7 B;  5HE0 B;  4YVD A;  5AMS A;  1NEX B;  1K32 A;  3I7P A;  5FA5 B;  3U4Y A;  3IJ1 A;  4JXM A;  3SCY A;  3CIK B;  5EAR A;  5FXY A;  3SMR A;  3OKY A;  3EI2 B;  3UKR C;  5FKQ A;  3F3P A;  2YMU A;  4PSX B;  2HJ4 A;  2CO0 C;  1XKS A;  4E5Z A;  3MXX A;  4D0K A;  2AH0 A;  4A08 B;  2I0R A;  2HJB A;  2B4E A;  4KFM B;  2B5M A;  3OW8 A;  4BH6 A;  3FRX A;  3L4O D;  1VYH C;  2EBS A;  5JWZ A;  4J84 A; 
#chains in the Genus database with same CATH topology
 4JT6 C;  3OKW A;  4J86 A;  5EAM A;  5HE1 B;  2XE4 A;  3IUR A;  4A11 A;  2VDP A;  3OTT A;  4J81 A;  2P9N C;  4QL1 A;  5A2Q g;  2P9I C;  3T3P A;  2VZ3 A;  3V4V A;  5EM2 B;  3JB9 L;  5C9Z B;  3DSM A;  2IUR A;  3JAM g;  4BUJ C;  3SFZ A;  1PGU A;  3V7D B;  4ERQ A;  5FLX g;  3I2N A;  1A12 A;  3K26 A;  3RN0 D;  4HDJ A;  5C92 A;  2I0S A;  4BP9 A;  4ZOX A;  2PBI B;  1S4U X;  5TF2 A;  1UOP A;  4NBM A;  4BCC A;  4FA1 D;  5M5V A;  1H2W A;  4E54 A;  4AOW A;  1PBY B;  2BKL A;  4N14 A;  2YB8 B;  2O9K A;  4J78 A;  3ZE2 A;  5THA A;  4AX4 A;  3UVN A;  2PM9 B;  1UOO A;  4CI1 A;  2P9P C;  4PXW A;  2Q7Q A;  4J8G A;  2XL2 A;  5H14 A;  4NEN A;  1BPO A;  4GM8 A;  3A0F A;  4XEI C;  4Z8L A;  4FB1 D;  3EMH A;  3IJE A;  4DNU A;  1C9I A;  4A09 A;  3E0C A;  4MMZ A;  2IWF A;  1JTD B;  3EI3 B;  3PSC B;  4QT8 A;  4O9D A;  3MUO A;  3ZE1 A;  2VDM A;  2OIZ A;  2IUP A;  4NSX A;  3AH8 B;  1P22 A;  2Z2P A;  4MMY A;  4EWR A;  3OKT A;  5CXC B;  4PC0 A;  2CE9 A;  2H9L A;  2H9N A;  4JSV C;  4IA9 A;  3JZN A;  4IRZ A;  3ORV D;  4ERZ A;  5E6U A;  5E6S A;  5I5J A;  3DXK C;  4UM9 A;  4A2M A;  3EI4 A;  4J0X A;  5IC7 A;  2YNO A;  5HYN B;  2TRC B;  4AN1 A;  3K6S A;  3B7F A;  4GGC A;  4ES0 A;  4A0B B;  3AFC A;  5GSA A;  4J0W A;  2B5L A;  1OLZ A;  5B4W A;  4L1Q D;  3DWL C;  5HE3 B;  3EU7 A;  1SHY B;  4J82 A;  4MK0 B;  4H5I A;  2VDL A;  3SBQ A;  3O4J A;  3NIG A;  3EQ7 A;  2H9M A;  3OKY B;  3VGZ A;  3RN1 D;  4FWW A;  5CYK A;  5KDO B;  2AGY A;  4U7A A;  3BG1 A;  2IWK A;  3VH0 A;  3EI1 A;  5AFU 3;  4FHL A;  2WQ8 A;  4X61 B;  1XHM A;  4CY3 A;  4BCD A;  1XIP A;  4TZ4 A;  4D9S A;  3EWE A;  4JSP C;  4E5Z B;  3NVX A;  1E5T A;  3FGB A;  2QXV A;  4ESG A;  4Z7O A;  2PM6 B;  3DDU A;  4IMM A;  5TEE A;  4AMY A;  2H14 A;  4FA9 D;  1SQ9 A;  3AL8 A;  2XL3 A;  3N0D A;  1GXR A;  1PEV A;  3DM0 A;  5SXM A;  2OK6 A;  4X60 B;  5CXB A;  1TBG A;  2I3T A;  3K72 A;  5EML B;  1L5G A;  2I3S A;  4JD2 C;  4BCB A;  1RI6 A;  2GC4 A;  5EMM B;  3KCI A;  5IGQ A;  4CY1 A;  2CNX A;  4MMX A;  5C86 A;  4JHN A;  4DNW A;  1MG3 A;  4A11 B;  2OJY A;  4FA5 D;  5EMK B;  2VDO A;  1TYQ C;  3I89 A;  1JMZ B;  3C75 H;  5GXH A;  1VZ2 A;  2H9P A;  5M61 A;  2YNN A;  3PXT D;  4L1M A;  4XYH A;  2EIC A;  3PVU B;  1A0R B;  4NAA A;  2CN3 A;  2XZG A;  5EM2 A;  3PVW B;  4CC9 A;  2EIE A;  4L3G D;  2G99 A;  1VE6 A;  5IT9 g;  1N6D A;  2IUV A;  1K3I A;  3PXS D;  3IVM A;  2XYI A;  2H6N A;  3SBP A;  3I7O A;  4A0A A;  1QFM A;  2J55 H;  3C9C A;  1FWX A;  4QQE A;  3JZG A;  4E54 B;  4CI3 A;  2YBA A;  4CZX A;  5C2W B;  1GOH A;  2GC7 A;  3MZK A;  3RMZ D;  3HFQ A;  3MUN A;  3K27 A;  2OVP B;  4O45 A;  2AGW A;  2XDW A;  3NID A;  4WJK A;  4LG8 A;  2G9A A;  3VI3 A;  4JHP C;  3IUN A;  1JJU B;  4GGD A;  4G1M A;  1GOT B;  5IJ8 E;  1GOF A;  4AN0 A;  4UI9 R;  4CY2 A;  3ZWL B;  3J81 g;  4A09 B;  2P9S C;  1E8N A;  5EAL A;  3IUQ A;  2QZP A;  1GG2 B;  4FAV D;  2EIB A;  3V5W B;  5I5M A;  2H6Q A;  1L0Q A;  2HKM A;  1U2V C;  3PSL A;  4G1E A;  3FCU A;  3O4H A;  2H47 A;  3JRP A;  2QR5 A;  4GQ1 A;  4ZN4 A;  2J56 H;  1U8C A;  4X63 B;  2EID A;  3PE7 A;  4G56 B;  5FFG A;  5M5R A;  2XU7 A;  3NVN A;  4GM3 A;  5I5I A;  4GQB B;  5AJA A;  4Z7N A;  2YNP A;  3JRO A;  1H2Y A;  1H2Z A;  3NIF A;  4AMZ A;  1B9Y A;  2I0T A;  4L3H D;  2OVQ B;  4WK4 A;  3UVL A;  5FKT A;  2VZ1 A;  2AQ5 A;  3EQ8 A;  3EI4 B;  3I8E A;  4R7A B;  2VDQ A;  4LGN A;  1ERJ A;  1Q47 A;  3JZH A;  2BBK H;  3BWS A;  5GMK n;  4I79 A;  3RFH A;  5K1C C;  4JT5 C;  2OVR B;  4O1Q D;  4O2W A;  3OL2 A;  3C99 A;  1TYE A;  3MMY A;  1B9X A;  5FQD A;  1R5M A;  2J57 G;  4GQ2 P;  4J87 A;  3SN6 B;  4PNK B;  3FM0 A;  2H3X A;  1M1X A;  2H6K A;  3K71 A;  3ODT A;  4A2L A;  5CYK B;  3EI2 A;  3J80 g;  4FA4 D;  3ZDZ A;  3QI0 A;  4J73 A;  2CO0 A;  2VDN A;  4PBY A;  5TDH B;  3EI1 B;  3MKS B;  2W18 A;  5FKR A;  4JSX C;  4AEZ A;  2P9L C;  3GRE A;  4L9O A;  4RE5 A;  2VC2 A;  5H1M A;  4GZ8 A;  1OMW B;  1C9L A;  2HU7 A;  3IUL A;  5IJ7 E;  1QFS A;  3ZDY A;  4A08 A;  3O4G A;  2BCJ B;  3ULE C;  4ZOY A;  1NR0 A;  4U1E I;  3VI4 A;  1I2M B;  2B5N A;  4Y5R D;  3MKQ A;  3AL8 B;  4K3I D;  5HE2 B;  5CXB B;  4DNV A;  4K3J B;  1GP2 B;  4J8B A;  1N6F A;  2HXC A;  3T3M A;  1JMX B;  2AH1 A;  2QC5 A;  5HQG A;  4GGA A;  1JV2 A;  3SBR A;  3DXM C;  3V9F A;  1O6G A;  1K8K C;  4ERY A;  2P9U C;  3RSE C;  1JOF A;  3I7H A;  3BG0 A;  3EQ9 A;  3I8C A;  4RE6 A;  3ZDX A;  4Y7R A;  5HDB A;  2HKR A;  5EAP A;  4G55 A;  3VA6 A;  4Z7Q A;  4XYI A;  2VDK A;  3IIW A;  3GFC A;  2UZX B;  3RFG A;  3I7K A;  3RLM D;  4X3E A;  3MZL A;  2AGZ A;  4A0A B;  3IUJ A;  2IAA A;  4ZOV A;  4LG9 A;  4ZOZ A;  3W15 A;  3AL9 A;  2HES X;  5FKS A;  4OWR A;  2HYE A;  4WK2 A;  1YR2 A;  4WK0 A;  1PI6 A;  3PXW D;  4CI2 A;  3IUM A;  3C5M A;  4GMB A;  2GNQ A;  2HU8 A;  2P9K C;  4UM8 A;  2PM9 A;  5FFO A;  1N6E A;  3CFV A;  4JSN C;  2Z2N A;  4O3T B;  3SXT D;  4BP8 A;  5M5S A;  3V4P A;  4CZV A;  5M5T A;  5TEF A;  5EMJ B;  3UVO A;  4J77 A;  2H68 A;  3CFS B;  1UOQ A;  3RRM C;  5M5U A;  4O02 A;  4PBZ A;  5K19 A;  2UZY B;  3NVQ A;  3EI3 A;  5H17 A;  3SJL D;  2CE8 A;  3KRX B;  5IGO A;  2CN2 A;  4CY5 A;  4PSW B;  3I7L A;  2AGX A;  2H13 A;  5GXI A;  4CI8 A;  5CXC A;  3N0E A;  3UVM A;  3UR4 A;  3IKO A;  1SQJ A;  3QHY B;  1YFQ A;  2VDR A;  3IJC A;  4A7J A;  4CZY A;  3JPX A;  3UKU C;  4QRJ A;  2MTA H;  2OK4 A;  3IIY A;  3MVD K;  1MDA H;  4O3U B;  3SWS D;  3SLE D;  3IJ0 A;  3KRW B;  3UVK A;  3F3G A;  2AGL A;  3ZE0 A;  3L4M D;  1QNI A;  3OF7 A;  2IUQ A;  3F3F A;  3I7N A;  3P4F A;  5E6R A;  5C2V B;  3SHF A;  1GOG A;  4GM9 A;  1MG2 A;  4A0B A;  4J79 A;  3EG6 A;  4BL0 A;  4H5J A;  4OZU A;  4D6V A;  1T2X A;  3FCS A;  2Z2O A;  3GC3 B;  1U4C A;  3OL2 B;  4FAN D;  3SVW D;  2PM7 B;  5HE0 B;  4YVD A;  1O6F A;  5AMS A;  3GD1 I;  1NEX B;  1K32 A;  3I7P A;  5FA5 B;  3U4Y A;  3IJ1 A;  4JXM A;  3SCY A;  3CIK B;  5EAR A;  5FXY A;  3SMR A;  3OKY A;  1VE7 A;  3EI2 B;  4QAM A;  3UKR C;  5FKQ A;  3F3P A;  4NC4 A;  2YMU A;  4PSX B;  2HJ4 A;  2CO0 C;  1XKS A;  3O4I A;  1UTC A;  4E5Z A;  1E8M A;  3MXX A;  4D0K A;  2AH0 A;  2HU5 A;  4A08 B;  1H2X A;  2I0R A;  2HJB A;  2B4E A;  4KFM B;  2B5M A;  3OW8 A;  4BH6 A;  3FRX A;  2JKX A;  3L4O D;  1VYH C;  2EBS A;  5JWZ A;  4J84 A;  1VZ3 A; 
#chains in the Genus database with same CATH homology
 4JT6 C;  3OKW A;  4J86 A;  5EAM A;  5HE1 B;  4A11 A;  3OTT A;  4J81 A;  2P9N C;  4QL1 A;  5A2Q g;  2P9I C;  5EM2 B;  3JB9 L;  5C9Z B;  3DSM A;  2IUR A;  3JAM g;  4BUJ C;  3SFZ A;  1PGU A;  3V7D B;  4ERQ A;  5FLX g;  3I2N A;  3K26 A;  3RN0 D;  4HDJ A;  2I0S A;  4ZOX A;  2PBI B;  1S4U X;  5TF2 A;  4FA1 D;  4E54 A;  4AOW A;  1PBY B;  4N14 A;  2YB8 B;  2O9K A;  4J78 A;  5THA A;  3UVN A;  2PM9 B;  4CI1 A;  2P9P C;  4PXW A;  2Q7Q A;  4J8G A;  2XL2 A;  5H14 A;  4GM8 A;  3A0F A;  4XEI C;  4Z8L A;  4FB1 D;  3EMH A;  4A09 A;  3E0C A;  2IWF A;  3EI3 B;  3PSC B;  4QT8 A;  4O9D A;  2OIZ A;  2IUP A;  4NSX A;  3AH8 B;  1P22 A;  2Z2P A;  4EWR A;  3OKT A;  5CXC B;  4PC0 A;  2CE9 A;  2H9L A;  2H9N A;  4JSV C;  4IA9 A;  3JZN A;  3ORV D;  4ERZ A;  5I5J A;  3DXK C;  4A2M A;  3EI4 A;  4J0X A;  5IC7 A;  2YNO A;  5HYN B;  2TRC B;  4A0B B;  3B7F A;  4GGC A;  4ES0 A;  3AFC A;  5GSA A;  4J0W A;  2B5L A;  1OLZ A;  5B4W A;  4L1Q D;  3DWL C;  5HE3 B;  3EU7 A;  1SHY B;  4J82 A;  4MK0 B;  4H5I A;  3SBQ A;  2H9M A;  3OKY B;  3VGZ A;  3RN1 D;  4FWW A;  5CYK A;  5KDO B;  2AGY A;  4U7A A;  3BG1 A;  2IWK A;  3VH0 A;  3EI1 A;  5AFU 3;  4FHL A;  4X61 B;  1XHM A;  4CY3 A;  1XIP A;  4TZ4 A;  3EWE A;  4JSP C;  4E5Z B;  3NVX A;  3FGB A;  2QXV A;  4ESG A;  2PM6 B;  5TEE A;  4IMM A;  2H14 A;  4FA9 D;  1SQ9 A;  3AL8 A;  2XL3 A;  3N0D A;  1GXR A;  1PEV A;  3DM0 A;  5SXM A;  2OK6 A;  4X60 B;  5CXB A;  1TBG A;  2I3T A;  5EML B;  2I3S A;  4JD2 C;  1RI6 A;  2GC4 A;  5EMM B;  5IGQ A;  4CY1 A;  2CNX A;  1MG3 A;  4A11 B;  2OJY A;  4FA5 D;  5EMK B;  1TYQ C;  3I89 A;  1JMZ B;  3C75 H;  5GXH A;  2H9P A;  2YNN A;  3PXT D;  4XYH A;  3PVU B;  1A0R B;  5EM2 A;  2CN3 A;  4CC9 A;  3PVW B;  4L3G D;  2G99 A;  5IT9 g;  1N6D A;  2IUV A;  3PXS D;  2XYI A;  2H6N A;  3SBP A;  3I7O A;  4A0A A;  2J55 H;  3C9C A;  1FWX A;  4QQE A;  3JZG A;  4E54 B;  4CI3 A;  2YBA A;  4CZX A;  5C2W B;  2GC7 A;  3MZK A;  3RMZ D;  3HFQ A;  3K27 A;  2OVP B;  4O45 A;  2AGW A;  4LG8 A;  2G9A A;  1JJU B;  4GGD A;  1GOT B;  5IJ8 E;  4UI9 R;  4CY2 A;  3ZWL B;  3J81 g;  4A09 B;  2P9S C;  5EAL A;  1GG2 B;  4FAV D;  3V5W B;  5I5M A;  2H6Q A;  1L0Q A;  2HKM A;  1U2V C;  3PSL A;  2H47 A;  3JRP A;  4GQ1 A;  4ZN4 A;  2J56 H;  4X63 B;  3PE7 A;  4G56 B;  2XU7 A;  3NVN A;  4GM3 A;  5I5I A;  4GQB B;  5AJA A;  2YNP A;  3JRO A;  1B9Y A;  2I0T A;  4L3H D;  2OVQ B;  3UVL A;  5FKT A;  3I8E A;  2AQ5 A;  3EI4 B;  4R7A B;  4LGN A;  1ERJ A;  1Q47 A;  3JZH A;  2BBK H;  3BWS A;  5GMK n;  4I79 A;  3RFH A;  5K1C C;  4JT5 C;  2OVR B;  4O1Q D;  3OL2 A;  3C99 A;  3MMY A;  1B9X A;  5FQD A;  1R5M A;  2J57 G;  4GQ2 P;  4J87 A;  3SN6 B;  4PNK B;  3FM0 A;  2H3X A;  2H6K A;  3ODT A;  4A2L A;  5CYK B;  3EI2 A;  3J80 g;  4FA4 D;  4J73 A;  4PBY A;  2CO0 A;  5TDH B;  3EI1 B;  3MKS B;  2W18 A;  5FKR A;  4JSX C;  4AEZ A;  2P9L C;  3GRE A;  4L9O A;  5H1M A;  4GZ8 A;  1OMW B;  5IJ7 E;  4A08 A;  2BCJ B;  3ULE C;  4ZOY A;  1NR0 A;  4U1E I;  2B5N A;  4Y5R D;  3MKQ A;  4K3I D;  3AL8 B;  5HE2 B;  5CXB B;  4K3J B;  1GP2 B;  4J8B A;  1N6F A;  2HXC A;  1JMX B;  2AH1 A;  2QC5 A;  5HQG A;  4GGA A;  3SBR A;  3DXM C;  3V9F A;  1K8K C;  4ERY A;  2P9U C;  3RSE C;  1JOF A;  3I7H A;  3BG0 A;  3I8C A;  4Y7R A;  2HKR A;  5EAP A;  3VA6 A;  4XYI A;  3IIW A;  3GFC A;  2UZX B;  3RFG A;  3I7K A;  3RLM D;  4X3E A;  3MZL A;  2AGZ A;  4A0A B;  2IAA A;  4ZOV A;  4LG9 A;  4ZOZ A;  3W15 A;  3AL9 A;  2HES X;  5FKS A;  4OWR A;  2HYE A;  1PI6 A;  3PXW D;  4CI2 A;  4GMB A;  3C5M A;  2GNQ A;  2P9K C;  2PM9 A;  1N6E A;  3CFV A;  4JSN C;  2Z2N A;  4O3T B;  3SXT D;  4CZV A;  5TEF A;  5EMJ B;  3UVO A;  4J77 A;  2H68 A;  3CFS B;  3RRM C;  4PBZ A;  5K19 A;  2UZY B;  3NVQ A;  3EI3 A;  5H17 A;  3SJL D;  2CE8 A;  3KRX B;  5IGO A;  2CN2 A;  4CY5 A;  4PSW B;  3I7L A;  2AGX A;  2H13 A;  5GXI A;  4CI8 A;  5CXC A;  3N0E A;  3UVM A;  3UR4 A;  3IKO A;  1SQJ A;  4CZY A;  1YFQ A;  4A7J A;  3IJC A;  3JPX A;  3UKU C;  4QRJ A;  2MTA H;  2OK4 A;  3IIY A;  1MDA H;  4O3U B;  3SWS D;  3SLE D;  3IJ0 A;  3KRW B;  3UVK A;  3F3G A;  2AGL A;  3L4M D;  1QNI A;  2IUQ A;  3F3F A;  3I7N A;  3P4F A;  5C2V B;  3SHF A;  4GM9 A;  1MG2 A;  4A0B A;  4J79 A;  3EG6 A;  4BL0 A;  4H5J A;  4OZU A;  4D6V A;  2Z2O A;  1U4C A;  3OL2 B;  4FAN D;  3SVW D;  2PM7 B;  5HE0 B;  4YVD A;  5AMS A;  1NEX B;  1K32 A;  3I7P A;  5FA5 B;  3U4Y A;  3IJ1 A;  4JXM A;  3SCY A;  3CIK B;  5EAR A;  5FXY A;  3SMR A;  3OKY A;  3EI2 B;  3UKR C;  5FKQ A;  3F3P A;  2YMU A;  4PSX B;  2HJ4 A;  2CO0 C;  1XKS A;  4E5Z A;  3MXX A;  4D0K A;  2AH0 A;  4A08 B;  2I0R A;  2HJB A;  2B4E A;  4KFM B;  2B5M A;  3OW8 A;  4BH6 A;  3FRX A;  3L4O D;  1VYH C;  2EBS A;  5JWZ A;  4J84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...