3CFVA

Structural basis of the interaction of rbap46/rbap48 with histone h4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
411
structure length
390
Chain Sequence
MAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-binding protein RBBP7
publication title Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histone/chaperone
total genus 80
structure length 390
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3cfvA00
1GG2B 3DXKC 4XEIC 5FQDA 1PGUA 2IWFA 4Y7RA 3KRXB 3UVKA 5AJAA 4CY2A 1L0QA 2H6NA 3SXTD 3SFZA 3ULEC 3K26A 3J80g 4CI8A 4JSNC 2MTAH 3C75H 3MZKA 4ZN4A 5EM2A 2QC5A 4QL1A 4FWWA 5IGOA 5C9ZB 4A2LA 4GQ2P 3I2NA 5CXBA 3I7LA 4JSPC 5GSAA 4N14A 1XKSA 4CZVA 3IIWA 3RN0D 3I7NA 2J55H 3AL8B 4GM9A 4PBZA 3VA6A 2HESX 2AGXA 4H5JA 3AL9A 4K3ID 2B4EA 4R7AB 4EWRA 4QT8A 3OTTA 3PE7A 2PM9B 3VH0A 2IUQA 5FA5B 3GREA 3JROA 1MG3A 5SXMA 3IJ1A 3SN6B 3PVUB 4FA4D 1ERJA 3MKSB 1JJUB 3SVWD 4E54A 4U7AA 3VGZA 4J77A 2HXCA 3RLMD 3SBPA 2H6QA 4FA5D 5FKSA 4J79A 4OWRA 4LGNA 3JRPA 3W15A 4E5ZA 3F3PA 4GQBB 2EBSA 4IMMA 2HKRA 4O1QD 3SBRA 4FA9D 2PM7B 3SMRA 3EI2A 3HFQA 4GZ8A 5HE1B 3V7DB 3I89A 1RI6A 4GQ1A 4A08B 2OVRB 5GMKn 2I0TA 4J84A 2P9LC 4FB1D 5IJ7E 3JZNA 2H47A 3OL2B 2H68A 4J78A 4A0AA 1B9XA 2OVPB 4A09A 3GFCA 1JMZB 4AEZA 5CXCA 3EI2B 4PBYA 2UZYB 3B7FA 1R5MA 4J81A 5THAA 2H6KA 4CI1A 5EMJB 4CY3A 4LG8A 1S4UX 4MK0B 4X61B 4TZ4A 3OKTA 5HE2B 1OLZA 4GMBA 3V5WB 5C2WB 2P9UC 2OIZA 5TDHB 4A0AB 3BG0A 4X3EA 2UZXB 5EMKB 2I3SA 1B9YA 3K27A 4J86A 4PSWB 5FKQA 2P9IC 3MKQA 3I7KA 2P9SC 4FHLA 1SQJA 3P4FA 4JD2C 3NVQA 2CE8A 2AQ5A 3F3GA 4CC9A 3ODTA 4J87A 3AL8A 2J56H 2YNPA 4J73A 5EALA 2IUVA 3OW8A 2H14A 4ZOVA 4U1EI 4I79A 3OKWA 2BBKH 5IJ8E 3JZHA 2PM9A 2CNXA 2CN3A 4ERYA 1QNIA 5CYKB 4ZOZA 1MG2A 1SHYB 4O9DA 2IAAA 4KFMB 2CO0C 2Q7QA 3FGBA 1SQ9A 4PC0A 3UR4A 2H9MA 3RSEC 2IURA 2GC7A 4GGCA 2XL2A 3I8EA 2HYEA 2Z2PA 4PSXB 4H5IA 4A08A 4FAND 3BG1A 2BCJB 1FWXA 1K8KC 4J8GA 2I3TA 4O3TB 4XYHA 5FLXg 2OK6A 5K1CC 5EAMA 1NR0A 5HE3B 4X63B 1TBGA 3OL2A 5HYNB 3UKRC 3U4YA 2QXVA 1PEVA 3DM0A 2B5NA 3I7PA 3JZGA 5I5MA 3OKYB 3ORVD 2OJYA 4J8BA 3SLED 4CZYA 1GP2B 4CI2A 4GGDA 3L4MD 3SHFA 3RFHA 1MDAH 2O9KA 3SCYA 4D0KA 2YBAA 4O3UB 4CY5A 4K3JB 3ZWLB 5GXHA 5IT9g 4ESGA 4O45A 3IJ0A 4OZUA 4QQEA 1N6DA 2B5LA 3RN1D 2AGLA 2I0RA 4ZOXA 4A0BB 4JXMA 3FRXA 3MMYA 4BH6A 2AH1A 2P9NC 4NSXA 3RRMC 2HKMA 4X60B 5HQGA 3SBQA 2H9LA 4A11B 4FAVD 3PVWB 4A2MA 5JWZA 1K32A 1TYQC 5KDOB 3EG6A 4ERZA 4JT6C 1Q47A 5IGQA 4L9OA 1VYHC 2YNOA 5CYKA 3EI1B 3EU7A 3A0FA 3BWSA 5I5JA 2H9NA 1A0RB 2GC4A 3CIKB 5AMSA 3AFCA 1XHMA 2PM6B 3J81g 3KRWB 1N6FA 1YFQA 5I5IA 2G99A 4IA9A 4UI9R 3PXTD 4AOWA 2B5MA 4CI3A 3N0EA 2G9AA 3EI3A 1OMWB 5TEEA 4ES0A 3EI4B 5K19A 1PBYB 3CFSB 3DSMA 3EWEA 3JPXA 2AGYA 5AFU3 4QRJA 4JSVC 2YB8B 3RFGA 4GM3A 3EI3B 4XYIA 3OKYA 3IKOA 1U2VC 2IWKA 1XIPA 2OK4A 5TEFA 5EMMB 5GXIA 2TRCB 3UVMA 1GOTB 4YVDA 2XL3A 3RMZD 5H17A 3PXWD 2J57G 3EMHA 5EM2B 5EARA 5CXBB 2XYIA 4A0BA 2H9PA 3I7OA 4BL0A 3MZLA 3NVNA 1JMXB 2Z2OA 2H3XA 5H14A 3E0CA 4ERQA 5A2Qg 4CY1A 2OVQB 5B4WA 4A11A 2H13A 3I7HA 3C5MA 4BUJC 2P9KC 3N0DA 2YMUA 3PSLA 4CZXA 2AGWA 1P22A 4A7JA 4JT5C 4ZOYA 4D6VA 5TF2A 4FA1D 1U4CA 3AH8B 3PSCB 3UKUC 4E54B 4JSXC 2W18A 3EI1A 3PXSD 3DWLC 4J0XA 4J0WA 3F3FA 5EMLB 3SWSD 1JOFA 3IIYA 2PBIB 4Y5RD 5IC7A 3NVXA 4L3HD 4E5ZB 2I0SA 5FKRA 3JAMg 2CO0A 3IJCA 3L4OD 2IUPA 4L3GD 2YNNA 5FXYA 2AGZA 4GM8A 3UVOA 4GGAA 3UVNA 3C99A 5C2VB 2HJ4A 1NEXB 4LG9A 3EI4A 2P9PC 2HJBA 3UVLA 5EAPA 5H1MA 3I8CA 4PXWA 3MXXA 3CFVA 2CE9A 2Z2NA 5FKTA 4A09B 2GNQA 1PI6A 5HE0B 4HDJA 2XU7A 3FM0A 3SJLD 4J82A 3V9FA 5CXCB 1GXRA 2AH0A 4PNKB 3C9CA 3DXMC 2CN2A 4L1QD 4Z8LA 4G56B 3JB9L 1N6EA
chains in the Genus database with same CATH superfamily
1GG2B 1O6FA 3DXKC 4XEIC 5FQDA 1PGUA 2IWFA 4Y7RA 3KRXB 3UVKA 5AJAA 4CY2A 1L0QA 2H6NA 4WK0A 3ZDXA 3SXTD 3SFZA 3ULEC 3K26A 4AN0A 3J80g 4CI8A 4JSNC 2MTAH 3C75H 3MZKA 4ZN4A 3VI4A 5EM2A 1JV2A 2QC5A 4QL1A 4FWWA 5IGOA 5FFOA 5C9ZB 4A2LA 4GQ2P 3I2NA 5CXBA 3I7LA 4JSPC 5GSAA 4N14A 1XKSA 4CZVA 2VC2A 3IIWA 3O4HA 3RN0D 3I7NA 1A12A 2J55H 3AL8B 4GM9A 4PBZA 3VA6A 2HESX 1QFSA 2AGXA 4H5JA 3AL9A 4K3ID 4G1MA 3KCIA 2B4EA 2VZ1A 4R7AB 4EWRA 4QT8A 1GOGA 5M5VA 3OTTA 3PE7A 4MMZA 2PM9B 3VH0A 2IUQA 5FA5B 3GREA 3JROA 1MG3A 5SXMA 3IJ1A 3SN6B 3PVUB 4FA4D 1ERJA 3MKSB 1JJUB 3SVWD 4E54A 1UOPA 2VDOA 4U7AA 4WJKA 4J77A 2HXCA 3VGZA 3RLMD 3SBPA 2H6QA 4FA5D 5FKSA 4J79A 4OWRA 3O4JA 1H2XA 4LGNA 3JRPA 3W15A 4DNVA 4E5ZA 3F3PA 4GQBB 3IURA 2EBSA 4IMMA 2HKRA 4O1QD 3SBRA 3ZDYA 4FA9D 2PM7B 3SMRA 3EI2A 3HFQA 4GZ8A 5HE1B 3V7DB 3I89A 1RI6A 4GQ1A 4A08B 2OVRB 1GOHA 5GMKn 2I0TA 4BCDA 4J84A 2P9LC 5M5RA 4FB1D 4RE6A 5IJ7E 3JZNA 5E6UA 2H47A 3DDUA 3OL2B 2H68A 4J78A 3EQ7A 3NIGA 4A0AA 1B9XA 2OVPB 4A09A 1O6GA 3GFCA 1JMZB 4AEZA 3EQ9A 3NIDA 4O02A 5CXCA 3EI2B 4PBYA 2UZYB 3B7FA 1R5MA 4J81A 5THAA 2H6KA 4CI1A 5EMJB 4CY3A 4LG8A 1S4UX 4MK0B 4X61B 4TZ4A 3OKTA 5HE2B 3GC3B 1OLZA 4GMBA 3V5WB 5C2WB 2P9UC 2OIZA 5TDHB 1H2WA 4A0AB 3BG0A 4X3EA 2XE4A 2UZXB 4WK2A 5EMKB 3GD1I 3T3MA 2I3SA 1B9YA 3K27A 4J86A 4PSWB 5FKQA 2P9IC 3MKQA 3I7KA 2P9SC 4FHLA 1SQJA 3P4FA 4JD2C 3NVQA 2CE8A 4AMYA 1K3IA 2AQ5A 3F3GA 4CC9A 3IULA 3ODTA 2EICA 3AL8A 2J56H 4J87A 2VDMA 2YNPA 4J73A 5EALA 2IUVA 3OW8A 2H14A 4ZOVA 4U1EI 3QHYB 2EIEA 4I79A 3OKWA 2BBKH 5IJ8E 3JZHA 2PM9A 4BP9A 2CNXA 2CN3A 4ERYA 1E5TA 1QNIA 5CYKB 4ZOZA 1MG2A 4MMYA 3VI3A 1SHYB 4O9DA 2IAAA 5C92A 3MVDK 4KFMB 2CO0C 1E8MA 2QZPA 2Q7QA 2VDNA 3FGBA 3IUMA 1C9IA 1SQ9A 4PC0A 4UM9A 3UR4A 3ZDZA 2H9MA 1BPOA 3FCSA 5M5SA 3O4GA 4D9SA 3RSEC 2IURA 3V4VA 2GC7A 1M1XA 4GGCA 2WQ8A 3K6SA 2XL2A 3EQ8A 3I8EA 2HYEA 2VDQA 2Z2PA 4PSXB 3OF7A 4H5IA 4A08A 3IVMA 4DNUA 4FAND 1VE6A 3BG1A 1K8KC 1FWXA 2BCJB 4J8GA 2I3TA 4O3TB 4XYHA 4AMZA 5FLXg 2OK6A 5K1CC 4QAMA 1H2ZA 5EAMA 1NR0A 5HE3B 4X63B 4Z7OA 1TBGA 3OL2A 5HYNB 3UKRC 5M5TA 3U4YA 2QXVA 1PEVA 3DM0A 2B5NA 3I7PA 3JZGA 1VZ2A 5I5MA 4NENA 3OKYB 3ORVD 2OJYA 4J8BA 3SLED 4CZYA 1GP2B 4CI2A 4GGDA 3L4MD 3SHFA 3IUQA 3RFHA 3MUNA 2EIDA 1MDAH 2O9KA 3SCYA 4IRZA 4D0KA 5FFGA 1QFMA 2YBAA 4O3UB 4CY5A 4K3JB 3ZWLB 5GXHA 5IT9g 4NBMA 4ESGA 4AN1A 4O45A 3IJ0A 4OZUA 4QQEA 3T3PA 4MMXA 1N6DA 2B5LA 1C9LA 2AGLA 2I0RA 3RN1D 3ZE0A 4ZOXA 4A0BB 4JXMA 3FRXA 3MMYA 4BH6A 2AH1A 2P9NC 4NSXA 3RRMC 2HKMA 4BP8A 3O4IA 4X60B 5HQGA 3SBQA 2H9LA 4A11B 1JTDB 4FAVD 4L1MA 4JHPC 1U8CA 3PVWB 4A2MA 5JWZA 1K32A 1TYQC 5KDOB 3EG6A 4ERZA 4JT6C 1Q47A 1TYEA 4L9OA 4Z7QA 5IGQA 1VYHC 2YNOA 5CYKA 3EI1B 3IJEA 3EU7A 3A0FA 3BWSA 5I5JA 2H9NA 1A0RB 2GC4A 2XDWA 3CIKB 5AMSA 3AFCA 2VDRA 1XHMA 2PM6B 3J81g 2VDLA 3KRWB 1N6FA 3K71A 1YFQA 3FCUA 5I5IA 5M61A 2G99A 2XZGA 4IA9A 4UI9R 4O2WA 4DNWA 3PXTD 4AOWA 2B5MA 4G1EA 4CI3A 2HU5A 3N0EA 2G9AA 3EI3A 1OMWB 5TEEA 4ES0A 3EI4B 5K19A 1PBYB 3CFSB 1E8NA 3DSMA 3EWEA 1H2YA 1VZ3A 3JPXA 2AGYA 5AFU3 4QRJA 4JSVC 2BKLA 3V4PA 5C86A 2YB8B 3RFGA 4GM3A 3EI3B 4XYIA 3OKYA 3IKOA 4BCBA 4UM8A 1U2VC 2IWKA 1XIPA 2OK4A 4NAAA 5TEFA 4G55A 5EMMB 5M5UA 5GXIA 2TRCB 3UVMA 4WK4A 1GOTB 4YVDA 1UOQA 1UTCA 3ZE2A 2XL3A 3RMZD 1T2XA 3K72A 5H17A 3PXWD 2J57G 3EMHA 4BCCA 1YR2A 4RE5A 5EM2B 5EARA 3IUNA 5CXBB 2XYIA 4A0BA 3NIFA 2H9PA 2VZ3A 3I7OA 4BL0A 3MZLA 3NVNA 1JMXB 2Z2OA 2H3XA 5H14A 3E0CA 4ERQA 5A2Qg 4CY1A 2OVQB 5B4WA 4A11A 2H13A 2EIBA 3C5MA 3I7HA 4BUJC 2P9KC 3ZE1A 3N0DA 2YMUA 3PSLA 4CZXA 2AGWA 1P22A 4A7JA 4JT5C 4ZOYA 1GOFA 4D6VA 5TF2A 1L5GA 1I2MB 4FA1D 1U4CA 3AH8B 3PSCB 2JKXA 3UKUC 4E54B 4JSXC 2W18A 1VE7A 4JHNA 3EI1A 3PXSD 3DWLC 4J0XA 4J0WA 3F3FA 5EMLB 3SWSD 1JOFA 3IIYA 2PBIB 4Y5RD 5IC7A 1UOOA 3NVXA 4L3HD 4AX4A 4E5ZB 2VDKA 4NC4A 2I0SA 5FKRA 3JAMg 2CO0A 3IJCA 3L4OD 2IUPA 4L3GD 2YNNA 5FXYA 5HDBA 3MUOA 2AGZA 4GM8A 3UVOA 4GGAA 3UVNA 3C99A 5C2VB 5E6SA 2HJ4A 3QI0A 1NEXB 4LG9A 3EI4A 2P9PC 2HJBA 3UVLA 2HU7A 5EAPA 5H1MA 3I8CA 4PXWA 3MXXA 5E6RA 3IUJA 3CFVA 2CE9A 2Z2NA 5FKTA 4A09B 2GNQA 1PI6A 5HE0B 4HDJA 2XU7A 3FM0A 3SJLD 4J82A 3V9FA 5CXCB 4Z7NA 1GXRA 2AH0A 4PNKB 3C9CA 2VDPA 3DXMC 2CN2A 4L1QD 2HU8A 4G56B 4Z8LA 3JB9L 1N6EA 2QR5A
chains in the Genus database with same CATH topology
1GG2B 3DXKC 4XEIC 5FQDA 1PGUA 2IWFA 4Y7RA 3KRXB 3UVKA 5AJAA 4CY2A 1L0QA 2H6NA 3SXTD 3SFZA 3ULEC 3K26A 3J80g 4CI8A 4JSNC 2MTAH 3C75H 3MZKA 4ZN4A 5EM2A 2QC5A 4QL1A 4FWWA 5IGOA 5C9ZB 4A2LA 4GQ2P 3I2NA 5CXBA 3I7LA 4JSPC 5GSAA 4N14A 1XKSA 4CZVA 3IIWA 3RN0D 3I7NA 2J55H 3AL8B 4GM9A 4PBZA 3VA6A 2HESX 2AGXA 4H5JA 3AL9A 4K3ID 2B4EA 4R7AB 4EWRA 4QT8A 3OTTA 3PE7A 2PM9B 3VH0A 2IUQA 5FA5B 3GREA 3JROA 1MG3A 5SXMA 3IJ1A 3SN6B 3PVUB 4FA4D 1ERJA 3MKSB 1JJUB 3SVWD 4E54A 4U7AA 3VGZA 4J77A 2HXCA 3RLMD 3SBPA 2H6QA 4FA5D 5FKSA 4J79A 4OWRA 4LGNA 3JRPA 3W15A 4E5ZA 3F3PA 4GQBB 2EBSA 4IMMA 2HKRA 4O1QD 3SBRA 4FA9D 2PM7B 3SMRA 3EI2A 3HFQA 4GZ8A 5HE1B 3V7DB 3I89A 1RI6A 4GQ1A 4A08B 2OVRB 5GMKn 2I0TA 4J84A 2P9LC 4FB1D 5IJ7E 3JZNA 2H47A 3OL2B 2H68A 4J78A 4A0AA 1B9XA 2OVPB 4A09A 3GFCA 1JMZB 4AEZA 5CXCA 3EI2B 4PBYA 2UZYB 3B7FA 1R5MA 4J81A 5THAA 2H6KA 4CI1A 5EMJB 4CY3A 4LG8A 1S4UX 4MK0B 4X61B 4TZ4A 3OKTA 5HE2B 1OLZA 4GMBA 3V5WB 5C2WB 2P9UC 2OIZA 5TDHB 4A0AB 3BG0A 4X3EA 2UZXB 5EMKB 2I3SA 1B9YA 3K27A 4J86A 4PSWB 5FKQA 2P9IC 3MKQA 3I7KA 2P9SC 4FHLA 1SQJA 3P4FA 4JD2C 3NVQA 2CE8A 2AQ5A 3F3GA 4CC9A 3ODTA 4J87A 3AL8A 2J56H 2YNPA 4J73A 5EALA 2IUVA 3OW8A 2H14A 4ZOVA 4U1EI 4I79A 3OKWA 2BBKH 5IJ8E 3JZHA 2PM9A 2CNXA 2CN3A 4ERYA 1QNIA 5CYKB 4ZOZA 1MG2A 1SHYB 4O9DA 2IAAA 4KFMB 2CO0C 2Q7QA 3FGBA 1SQ9A 4PC0A 3UR4A 2H9MA 3RSEC 2IURA 2GC7A 4GGCA 2XL2A 3I8EA 2HYEA 2Z2PA 4PSXB 4H5IA 4A08A 4FAND 3BG1A 2BCJB 1FWXA 1K8KC 4J8GA 2I3TA 4O3TB 4XYHA 5FLXg 2OK6A 5K1CC 5EAMA 1NR0A 5HE3B 4X63B 1TBGA 3OL2A 5HYNB 3UKRC 3U4YA 2QXVA 1PEVA 3DM0A 2B5NA 3I7PA 3JZGA 5I5MA 3OKYB 3ORVD 2OJYA 4J8BA 3SLED 4CZYA 1GP2B 4CI2A 4GGDA 3L4MD 3SHFA 3RFHA 1MDAH 2O9KA 3SCYA 4D0KA 2YBAA 4O3UB 4CY5A 4K3JB 3ZWLB 5GXHA 5IT9g 4ESGA 4O45A 3IJ0A 4OZUA 4QQEA 1N6DA 2B5LA 3RN1D 2AGLA 2I0RA 4ZOXA 4A0BB 4JXMA 3FRXA 3MMYA 4BH6A 2AH1A 2P9NC 4NSXA 3RRMC 2HKMA 4X60B 5HQGA 3SBQA 2H9LA 4A11B 4FAVD 3PVWB 4A2MA 5JWZA 1K32A 1TYQC 5KDOB 3EG6A 4ERZA 4JT6C 1Q47A 5IGQA 4L9OA 1VYHC 2YNOA 5CYKA 3EI1B 3EU7A 3A0FA 3BWSA 5I5JA 2H9NA 1A0RB 2GC4A 3CIKB 5AMSA 3AFCA 1XHMA 2PM6B 3J81g 3KRWB 1N6FA 1YFQA 5I5IA 2G99A 4IA9A 4UI9R 3PXTD 4AOWA 2B5MA 4CI3A 3N0EA 2G9AA 3EI3A 1OMWB 5TEEA 4ES0A 3EI4B 5K19A 1PBYB 3CFSB 3DSMA 3EWEA 3JPXA 2AGYA 5AFU3 4QRJA 4JSVC 2YB8B 3RFGA 4GM3A 3EI3B 4XYIA 3OKYA 3IKOA 1U2VC 2IWKA 1XIPA 2OK4A 5TEFA 5EMMB 5GXIA 2TRCB 3UVMA 1GOTB 4YVDA 2XL3A 3RMZD 5H17A 3PXWD 2J57G 3EMHA 5EM2B 5EARA 5CXBB 2XYIA 4A0BA 2H9PA 3I7OA 4BL0A 3MZLA 3NVNA 1JMXB 2Z2OA 2H3XA 5H14A 3E0CA 4ERQA 5A2Qg 4CY1A 2OVQB 5B4WA 4A11A 2H13A 3I7HA 3C5MA 4BUJC 2P9KC 3N0DA 2YMUA 3PSLA 4CZXA 2AGWA 1P22A 4A7JA 4JT5C 4ZOYA 4D6VA 5TF2A 4FA1D 1U4CA 3AH8B 3PSCB 3UKUC 4E54B 4JSXC 2W18A 3EI1A 3PXSD 3DWLC 4J0XA 4J0WA 3F3FA 5EMLB 3SWSD 1JOFA 3IIYA 2PBIB 4Y5RD 5IC7A 3NVXA 4L3HD 4E5ZB 2I0SA 5FKRA 3JAMg 2CO0A 3IJCA 3L4OD 2IUPA 4L3GD 2YNNA 5FXYA 2AGZA 4GM8A 3UVOA 4GGAA 3UVNA 3C99A 5C2VB 2HJ4A 1NEXB 4LG9A 3EI4A 2P9PC 2HJBA 3UVLA 5EAPA 5H1MA 3I8CA 4PXWA 3MXXA 3CFVA 2CE9A 2Z2NA 5FKTA 4A09B 2GNQA 1PI6A 5HE0B 4HDJA 2XU7A 3FM0A 3SJLD 4J82A 3V9FA 5CXCB 1GXRA 2AH0A 4PNKB 3C9CA 3DXMC 2CN2A 4L1QD 4Z8LA 4G56B 3JB9L 1N6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GG2 B;  3DXK C;  4XEI C;  5FQD A;  1PGU A;  2IWF A;  4Y7R A;  3KRX B;  3UVK A;  5AJA A;  4CY2 A;  1L0Q A;  2H6N A;  3SXT D;  3SFZ A;  3ULE C;  3K26 A;  3J80 g;  4CI8 A;  4JSN C;  2MTA H;  3C75 H;  3MZK A;  4ZN4 A;  5EM2 A;  2QC5 A;  4QL1 A;  4FWW A;  5IGO A;  5C9Z B;  4A2L A;  4GQ2 P;  3I2N A;  5CXB A;  3I7L A;  4JSP C;  5GSA A;  4N14 A;  1XKS A;  4CZV A;  3IIW A;  3RN0 D;  3I7N A;  2J55 H;  3AL8 B;  4GM9 A;  4PBZ A;  3VA6 A;  2HES X;  2AGX A;  4H5J A;  3AL9 A;  4K3I D;  2B4E A;  4R7A B;  4EWR A;  4QT8 A;  3OTT A;  3PE7 A;  2PM9 B;  3VH0 A;  2IUQ A;  5FA5 B;  3GRE A;  3JRO A;  1MG3 A;  5SXM A;  3IJ1 A;  3SN6 B;  3PVU B;  4FA4 D;  1ERJ A;  3MKS B;  1JJU B;  3SVW D;  4E54 A;  4U7A A;  3VGZ A;  4J77 A;  2HXC A;  3RLM D;  3SBP A;  2H6Q A;  4FA5 D;  5FKS A;  4J79 A;  4OWR A;  4LGN A;  3JRP A;  3W15 A;  4E5Z A;  3F3P A;  4GQB B;  2EBS A;  4IMM A;  2HKR A;  4O1Q D;  3SBR A;  4FA9 D;  2PM7 B;  3SMR A;  3EI2 A;  3HFQ A;  4GZ8 A;  5HE1 B;  3V7D B;  3I89 A;  1RI6 A;  4GQ1 A;  4A08 B;  2OVR B;  5GMK n;  2I0T A;  4J84 A;  2P9L C;  4FB1 D;  5IJ7 E;  3JZN A;  2H47 A;  3OL2 B;  2H68 A;  4J78 A;  4A0A A;  1B9X A;  2OVP B;  4A09 A;  3GFC A;  1JMZ B;  4AEZ A;  5CXC A;  3EI2 B;  4PBY A;  2UZY B;  3B7F A;  1R5M A;  4J81 A;  5THA A;  2H6K A;  4CI1 A;  5EMJ B;  4CY3 A;  4LG8 A;  1S4U X;  4MK0 B;  4X61 B;  4TZ4 A;  3OKT A;  5HE2 B;  1OLZ A;  4GMB A;  3V5W B;  5C2W B;  2P9U C;  2OIZ A;  5TDH B;  4A0A B;  3BG0 A;  4X3E A;  2UZX B;  5EMK B;  2I3S A;  1B9Y A;  3K27 A;  4J86 A;  4PSW B;  5FKQ A;  2P9I C;  3MKQ A;  3I7K A;  2P9S C;  4FHL A;  1SQJ A;  3P4F A;  4JD2 C;  3NVQ A;  2CE8 A;  2AQ5 A;  3F3G A;  4CC9 A;  3ODT A;  4J87 A;  3AL8 A;  2J56 H;  2YNP A;  4J73 A;  5EAL A;  2IUV A;  3OW8 A;  2H14 A;  4ZOV A;  4U1E I;  4I79 A;  3OKW A;  2BBK H;  5IJ8 E;  3JZH A;  2PM9 A;  2CNX A;  2CN3 A;  4ERY A;  1QNI A;  5CYK B;  4ZOZ A;  1MG2 A;  1SHY B;  4O9D A;  2IAA A;  4KFM B;  2CO0 C;  2Q7Q A;  3FGB A;  1SQ9 A;  4PC0 A;  3UR4 A;  2H9M A;  3RSE C;  2IUR A;  2GC7 A;  4GGC A;  2XL2 A;  3I8E A;  2HYE A;  2Z2P A;  4PSX B;  4H5I A;  4A08 A;  4FAN D;  3BG1 A;  2BCJ B;  1FWX A;  1K8K C;  4J8G A;  2I3T A;  4O3T B;  4XYH A;  5FLX g;  2OK6 A;  5K1C C;  5EAM A;  1NR0 A;  5HE3 B;  4X63 B;  1TBG A;  3OL2 A;  5HYN B;  3UKR C;  3U4Y A;  2QXV A;  1PEV A;  3DM0 A;  2B5N A;  3I7P A;  3JZG A;  5I5M A;  3OKY B;  3ORV D;  2OJY A;  4J8B A;  3SLE D;  4CZY A;  1GP2 B;  4CI2 A;  4GGD A;  3L4M D;  3SHF A;  3RFH A;  1MDA H;  2O9K A;  3SCY A;  4D0K A;  2YBA A;  4O3U B;  4CY5 A;  4K3J B;  3ZWL B;  5GXH A;  5IT9 g;  4ESG A;  4O45 A;  3IJ0 A;  4OZU A;  4QQE A;  1N6D A;  2B5L A;  3RN1 D;  2AGL A;  2I0R A;  4ZOX A;  4A0B B;  4JXM A;  3FRX A;  3MMY A;  4BH6 A;  2AH1 A;  2P9N C;  4NSX A;  3RRM C;  2HKM A;  4X60 B;  5HQG A;  3SBQ A;  2H9L A;  4A11 B;  4FAV D;  3PVW B;  4A2M A;  5JWZ A;  1K32 A;  1TYQ C;  5KDO B;  3EG6 A;  4ERZ A;  4JT6 C;  1Q47 A;  5IGQ A;  4L9O A;  1VYH C;  2YNO A;  5CYK A;  3EI1 B;  3EU7 A;  3A0F A;  3BWS A;  5I5J A;  2H9N A;  1A0R B;  2GC4 A;  3CIK B;  5AMS A;  3AFC A;  1XHM A;  2PM6 B;  3J81 g;  3KRW B;  1N6F A;  1YFQ A;  5I5I A;  2G99 A;  4IA9 A;  4UI9 R;  3PXT D;  4AOW A;  2B5M A;  4CI3 A;  3N0E A;  2G9A A;  3EI3 A;  1OMW B;  5TEE A;  4ES0 A;  3EI4 B;  5K19 A;  1PBY B;  3CFS B;  3DSM A;  3EWE A;  3JPX A;  2AGY A;  5AFU 3;  4QRJ A;  4JSV C;  2YB8 B;  3RFG A;  4GM3 A;  3EI3 B;  4XYI A;  3OKY A;  3IKO A;  1U2V C;  2IWK A;  1XIP A;  2OK4 A;  5TEF A;  5EMM B;  5GXI A;  2TRC B;  3UVM A;  1GOT B;  4YVD A;  2XL3 A;  3RMZ D;  5H17 A;  3PXW D;  2J57 G;  3EMH A;  5EM2 B;  5EAR A;  5CXB B;  2XYI A;  4A0B A;  2H9P A;  3I7O A;  4BL0 A;  3MZL A;  3NVN A;  1JMX B;  2Z2O A;  2H3X A;  5H14 A;  3E0C A;  4ERQ A;  5A2Q g;  4CY1 A;  2OVQ B;  5B4W A;  4A11 A;  2H13 A;  3I7H A;  3C5M A;  4BUJ C;  2P9K C;  3N0D A;  2YMU A;  3PSL A;  4CZX A;  2AGW A;  1P22 A;  4A7J A;  4JT5 C;  4ZOY A;  4D6V A;  5TF2 A;  4FA1 D;  1U4C A;  3AH8 B;  3PSC B;  3UKU C;  4E54 B;  4JSX C;  2W18 A;  3EI1 A;  3PXS D;  3DWL C;  4J0X A;  4J0W A;  3F3F A;  5EML B;  3SWS D;  1JOF A;  3IIY A;  2PBI B;  4Y5R D;  5IC7 A;  3NVX A;  4L3H D;  4E5Z B;  2I0S A;  5FKR A;  3JAM g;  2CO0 A;  3IJC A;  3L4O D;  2IUP A;  4L3G D;  2YNN A;  5FXY A;  2AGZ A;  4GM8 A;  3UVO A;  4GGA A;  3UVN A;  3C99 A;  5C2V B;  2HJ4 A;  1NEX B;  4LG9 A;  3EI4 A;  2P9P C;  2HJB A;  3UVL A;  5EAP A;  5H1M A;  3I8C A;  4PXW A;  3MXX A;  3CFV A;  2CE9 A;  2Z2N A;  5FKT A;  4A09 B;  2GNQ A;  1PI6 A;  5HE0 B;  4HDJ A;  2XU7 A;  3FM0 A;  3SJL D;  4J82 A;  3V9F A;  5CXC B;  1GXR A;  2AH0 A;  4PNK B;  3C9C A;  3DXM C;  2CN2 A;  4L1Q D;  4Z8L A;  4G56 B;  3JB9 L;  1N6E A; 
#chains in the Genus database with same CATH topology
 1GG2 B;  1O6F A;  3DXK C;  4XEI C;  5FQD A;  1PGU A;  2IWF A;  4Y7R A;  3KRX B;  3UVK A;  5AJA A;  4CY2 A;  1L0Q A;  2H6N A;  4WK0 A;  3ZDX A;  3SXT D;  3SFZ A;  3ULE C;  3K26 A;  4AN0 A;  3J80 g;  4CI8 A;  4JSN C;  2MTA H;  3C75 H;  3MZK A;  4ZN4 A;  3VI4 A;  5EM2 A;  1JV2 A;  2QC5 A;  4QL1 A;  4FWW A;  5IGO A;  5FFO A;  5C9Z B;  4A2L A;  4GQ2 P;  3I2N A;  5CXB A;  3I7L A;  4JSP C;  5GSA A;  4N14 A;  1XKS A;  4CZV A;  2VC2 A;  3IIW A;  3O4H A;  3RN0 D;  3I7N A;  1A12 A;  2J55 H;  3AL8 B;  4GM9 A;  4PBZ A;  3VA6 A;  2HES X;  1QFS A;  2AGX A;  4H5J A;  3AL9 A;  4K3I D;  4G1M A;  3KCI A;  2B4E A;  2VZ1 A;  4R7A B;  4EWR A;  4QT8 A;  1GOG A;  5M5V A;  3OTT A;  3PE7 A;  4MMZ A;  2PM9 B;  3VH0 A;  2IUQ A;  5FA5 B;  3GRE A;  3JRO A;  1MG3 A;  5SXM A;  3IJ1 A;  3SN6 B;  3PVU B;  4FA4 D;  1ERJ A;  3MKS B;  1JJU B;  3SVW D;  4E54 A;  1UOP A;  2VDO A;  4U7A A;  4WJK A;  4J77 A;  2HXC A;  3VGZ A;  3RLM D;  3SBP A;  2H6Q A;  4FA5 D;  5FKS A;  4J79 A;  4OWR A;  3O4J A;  1H2X A;  4LGN A;  3JRP A;  3W15 A;  4DNV A;  4E5Z A;  3F3P A;  4GQB B;  3IUR A;  2EBS A;  4IMM A;  2HKR A;  4O1Q D;  3SBR A;  3ZDY A;  4FA9 D;  2PM7 B;  3SMR A;  3EI2 A;  3HFQ A;  4GZ8 A;  5HE1 B;  3V7D B;  3I89 A;  1RI6 A;  4GQ1 A;  4A08 B;  2OVR B;  1GOH A;  5GMK n;  2I0T A;  4BCD A;  4J84 A;  2P9L C;  5M5R A;  4FB1 D;  4RE6 A;  5IJ7 E;  3JZN A;  5E6U A;  2H47 A;  3DDU A;  3OL2 B;  2H68 A;  4J78 A;  3EQ7 A;  3NIG A;  4A0A A;  1B9X A;  2OVP B;  4A09 A;  1O6G A;  3GFC A;  1JMZ B;  4AEZ A;  3EQ9 A;  3NID A;  4O02 A;  5CXC A;  3EI2 B;  4PBY A;  2UZY B;  3B7F A;  1R5M A;  4J81 A;  5THA A;  2H6K A;  4CI1 A;  5EMJ B;  4CY3 A;  4LG8 A;  1S4U X;  4MK0 B;  4X61 B;  4TZ4 A;  3OKT A;  5HE2 B;  3GC3 B;  1OLZ A;  4GMB A;  3V5W B;  5C2W B;  2P9U C;  2OIZ A;  5TDH B;  1H2W A;  4A0A B;  3BG0 A;  4X3E A;  2XE4 A;  2UZX B;  4WK2 A;  5EMK B;  3GD1 I;  3T3M A;  2I3S A;  1B9Y A;  3K27 A;  4J86 A;  4PSW B;  5FKQ A;  2P9I C;  3MKQ A;  3I7K A;  2P9S C;  4FHL A;  1SQJ A;  3P4F A;  4JD2 C;  3NVQ A;  2CE8 A;  4AMY A;  1K3I A;  2AQ5 A;  3F3G A;  4CC9 A;  3IUL A;  3ODT A;  2EIC A;  3AL8 A;  2J56 H;  4J87 A;  2VDM A;  2YNP A;  4J73 A;  5EAL A;  2IUV A;  3OW8 A;  2H14 A;  4ZOV A;  4U1E I;  3QHY B;  2EIE A;  4I79 A;  3OKW A;  2BBK H;  5IJ8 E;  3JZH A;  2PM9 A;  4BP9 A;  2CNX A;  2CN3 A;  4ERY A;  1E5T A;  1QNI A;  5CYK B;  4ZOZ A;  1MG2 A;  4MMY A;  3VI3 A;  1SHY B;  4O9D A;  2IAA A;  5C92 A;  3MVD K;  4KFM B;  2CO0 C;  1E8M A;  2QZP A;  2Q7Q A;  2VDN A;  3FGB A;  3IUM A;  1C9I A;  1SQ9 A;  4PC0 A;  4UM9 A;  3UR4 A;  3ZDZ A;  2H9M A;  1BPO A;  3FCS A;  5M5S A;  3O4G A;  4D9S A;  3RSE C;  2IUR A;  3V4V A;  2GC7 A;  1M1X A;  4GGC A;  2WQ8 A;  3K6S A;  2XL2 A;  3EQ8 A;  3I8E A;  2HYE A;  2VDQ A;  2Z2P A;  4PSX B;  3OF7 A;  4H5I A;  4A08 A;  3IVM A;  4DNU A;  4FAN D;  1VE6 A;  3BG1 A;  1K8K C;  1FWX A;  2BCJ B;  4J8G A;  2I3T A;  4O3T B;  4XYH A;  4AMZ A;  5FLX g;  2OK6 A;  5K1C C;  4QAM A;  1H2Z A;  5EAM A;  1NR0 A;  5HE3 B;  4X63 B;  4Z7O A;  1TBG A;  3OL2 A;  5HYN B;  3UKR C;  5M5T A;  3U4Y A;  2QXV A;  1PEV A;  3DM0 A;  2B5N A;  3I7P A;  3JZG A;  1VZ2 A;  5I5M A;  4NEN A;  3OKY B;  3ORV D;  2OJY A;  4J8B A;  3SLE D;  4CZY A;  1GP2 B;  4CI2 A;  4GGD A;  3L4M D;  3SHF A;  3IUQ A;  3RFH A;  3MUN A;  2EID A;  1MDA H;  2O9K A;  3SCY A;  4IRZ A;  4D0K A;  5FFG A;  1QFM A;  2YBA A;  4O3U B;  4CY5 A;  4K3J B;  3ZWL B;  5GXH A;  5IT9 g;  4NBM A;  4ESG A;  4AN1 A;  4O45 A;  3IJ0 A;  4OZU A;  4QQE A;  3T3P A;  4MMX A;  1N6D A;  2B5L A;  1C9L A;  2AGL A;  2I0R A;  3RN1 D;  3ZE0 A;  4ZOX A;  4A0B B;  4JXM A;  3FRX A;  3MMY A;  4BH6 A;  2AH1 A;  2P9N C;  4NSX A;  3RRM C;  2HKM A;  4BP8 A;  3O4I A;  4X60 B;  5HQG A;  3SBQ A;  2H9L A;  4A11 B;  1JTD B;  4FAV D;  4L1M A;  4JHP C;  1U8C A;  3PVW B;  4A2M A;  5JWZ A;  1K32 A;  1TYQ C;  5KDO B;  3EG6 A;  4ERZ A;  4JT6 C;  1Q47 A;  1TYE A;  4L9O A;  4Z7Q A;  5IGQ A;  1VYH C;  2YNO A;  5CYK A;  3EI1 B;  3IJE A;  3EU7 A;  3A0F A;  3BWS A;  5I5J A;  2H9N A;  1A0R B;  2GC4 A;  2XDW A;  3CIK B;  5AMS A;  3AFC A;  2VDR A;  1XHM A;  2PM6 B;  3J81 g;  2VDL A;  3KRW B;  1N6F A;  3K71 A;  1YFQ A;  3FCU A;  5I5I A;  5M61 A;  2G99 A;  2XZG A;  4IA9 A;  4UI9 R;  4O2W A;  4DNW A;  3PXT D;  4AOW A;  2B5M A;  4G1E A;  4CI3 A;  2HU5 A;  3N0E A;  2G9A A;  3EI3 A;  1OMW B;  5TEE A;  4ES0 A;  3EI4 B;  5K19 A;  1PBY B;  3CFS B;  1E8N A;  3DSM A;  3EWE A;  1H2Y A;  1VZ3 A;  3JPX A;  2AGY A;  5AFU 3;  4QRJ A;  4JSV C;  2BKL A;  3V4P A;  5C86 A;  2YB8 B;  3RFG A;  4GM3 A;  3EI3 B;  4XYI A;  3OKY A;  3IKO A;  4BCB A;  4UM8 A;  1U2V C;  2IWK A;  1XIP A;  2OK4 A;  4NAA A;  5TEF A;  4G55 A;  5EMM B;  5M5U A;  5GXI A;  2TRC B;  3UVM A;  4WK4 A;  1GOT B;  4YVD A;  1UOQ A;  1UTC A;  3ZE2 A;  2XL3 A;  3RMZ D;  1T2X A;  3K72 A;  5H17 A;  3PXW D;  2J57 G;  3EMH A;  4BCC A;  1YR2 A;  4RE5 A;  5EM2 B;  5EAR A;  3IUN A;  5CXB B;  2XYI A;  4A0B A;  3NIF A;  2H9P A;  2VZ3 A;  3I7O A;  4BL0 A;  3MZL A;  3NVN A;  1JMX B;  2Z2O A;  2H3X A;  5H14 A;  3E0C A;  4ERQ A;  5A2Q g;  4CY1 A;  2OVQ B;  5B4W A;  4A11 A;  2H13 A;  2EIB A;  3C5M A;  3I7H A;  4BUJ C;  2P9K C;  3ZE1 A;  3N0D A;  2YMU A;  3PSL A;  4CZX A;  2AGW A;  1P22 A;  4A7J A;  4JT5 C;  4ZOY A;  1GOF A;  4D6V A;  5TF2 A;  1L5G A;  1I2M B;  4FA1 D;  1U4C A;  3AH8 B;  3PSC B;  2JKX A;  3UKU C;  4E54 B;  4JSX C;  2W18 A;  1VE7 A;  4JHN A;  3EI1 A;  3PXS D;  3DWL C;  4J0X A;  4J0W A;  3F3F A;  5EML B;  3SWS D;  1JOF A;  3IIY A;  2PBI B;  4Y5R D;  5IC7 A;  1UOO A;  3NVX A;  4L3H D;  4AX4 A;  4E5Z B;  2VDK A;  4NC4 A;  2I0S A;  5FKR A;  3JAM g;  2CO0 A;  3IJC A;  3L4O D;  2IUP A;  4L3G D;  2YNN A;  5FXY A;  5HDB A;  3MUO A;  2AGZ A;  4GM8 A;  3UVO A;  4GGA A;  3UVN A;  3C99 A;  5C2V B;  5E6S A;  2HJ4 A;  3QI0 A;  1NEX B;  4LG9 A;  3EI4 A;  2P9P C;  2HJB A;  3UVL A;  2HU7 A;  5EAP A;  5H1M A;  3I8C A;  4PXW A;  3MXX A;  5E6R A;  3IUJ A;  3CFV A;  2CE9 A;  2Z2N A;  5FKT A;  4A09 B;  2GNQ A;  1PI6 A;  5HE0 B;  4HDJ A;  2XU7 A;  3FM0 A;  3SJL D;  4J82 A;  3V9F A;  5CXC B;  4Z7N A;  1GXR A;  2AH0 A;  4PNK B;  3C9C A;  2VDP A;  3DXM C;  2CN2 A;  4L1Q D;  2HU8 A;  4G56 B;  4Z8L A;  3JB9 L;  1N6E A;  2QR5 A; 
#chains in the Genus database with same CATH homology
 1GG2 B;  3DXK C;  4XEI C;  5FQD A;  1PGU A;  2IWF A;  4Y7R A;  3KRX B;  3UVK A;  5AJA A;  4CY2 A;  1L0Q A;  2H6N A;  3SXT D;  3SFZ A;  3ULE C;  3K26 A;  3J80 g;  4CI8 A;  4JSN C;  2MTA H;  3C75 H;  3MZK A;  4ZN4 A;  5EM2 A;  2QC5 A;  4QL1 A;  4FWW A;  5IGO A;  5C9Z B;  4A2L A;  4GQ2 P;  3I2N A;  5CXB A;  3I7L A;  4JSP C;  5GSA A;  4N14 A;  1XKS A;  4CZV A;  3IIW A;  3RN0 D;  3I7N A;  2J55 H;  3AL8 B;  4GM9 A;  4PBZ A;  3VA6 A;  2HES X;  2AGX A;  4H5J A;  3AL9 A;  4K3I D;  2B4E A;  4R7A B;  4EWR A;  4QT8 A;  3OTT A;  3PE7 A;  2PM9 B;  3VH0 A;  2IUQ A;  5FA5 B;  3GRE A;  3JRO A;  1MG3 A;  5SXM A;  3IJ1 A;  3SN6 B;  3PVU B;  4FA4 D;  1ERJ A;  3MKS B;  1JJU B;  3SVW D;  4E54 A;  4U7A A;  3VGZ A;  4J77 A;  2HXC A;  3RLM D;  3SBP A;  2H6Q A;  4FA5 D;  5FKS A;  4J79 A;  4OWR A;  4LGN A;  3JRP A;  3W15 A;  4E5Z A;  3F3P A;  4GQB B;  2EBS A;  4IMM A;  2HKR A;  4O1Q D;  3SBR A;  4FA9 D;  2PM7 B;  3SMR A;  3EI2 A;  3HFQ A;  4GZ8 A;  5HE1 B;  3V7D B;  3I89 A;  1RI6 A;  4GQ1 A;  4A08 B;  2OVR B;  5GMK n;  2I0T A;  4J84 A;  2P9L C;  4FB1 D;  5IJ7 E;  3JZN A;  2H47 A;  3OL2 B;  2H68 A;  4J78 A;  4A0A A;  1B9X A;  2OVP B;  4A09 A;  3GFC A;  1JMZ B;  4AEZ A;  5CXC A;  3EI2 B;  4PBY A;  2UZY B;  3B7F A;  1R5M A;  4J81 A;  5THA A;  2H6K A;  4CI1 A;  5EMJ B;  4CY3 A;  4LG8 A;  1S4U X;  4MK0 B;  4X61 B;  4TZ4 A;  3OKT A;  5HE2 B;  1OLZ A;  4GMB A;  3V5W B;  5C2W B;  2P9U C;  2OIZ A;  5TDH B;  4A0A B;  3BG0 A;  4X3E A;  2UZX B;  5EMK B;  2I3S A;  1B9Y A;  3K27 A;  4J86 A;  4PSW B;  5FKQ A;  2P9I C;  3MKQ A;  3I7K A;  2P9S C;  4FHL A;  1SQJ A;  3P4F A;  4JD2 C;  3NVQ A;  2CE8 A;  2AQ5 A;  3F3G A;  4CC9 A;  3ODT A;  4J87 A;  3AL8 A;  2J56 H;  2YNP A;  4J73 A;  5EAL A;  2IUV A;  3OW8 A;  2H14 A;  4ZOV A;  4U1E I;  4I79 A;  3OKW A;  2BBK H;  5IJ8 E;  3JZH A;  2PM9 A;  2CNX A;  2CN3 A;  4ERY A;  1QNI A;  5CYK B;  4ZOZ A;  1MG2 A;  1SHY B;  4O9D A;  2IAA A;  4KFM B;  2CO0 C;  2Q7Q A;  3FGB A;  1SQ9 A;  4PC0 A;  3UR4 A;  2H9M A;  3RSE C;  2IUR A;  2GC7 A;  4GGC A;  2XL2 A;  3I8E A;  2HYE A;  2Z2P A;  4PSX B;  4H5I A;  4A08 A;  4FAN D;  3BG1 A;  2BCJ B;  1FWX A;  1K8K C;  4J8G A;  2I3T A;  4O3T B;  4XYH A;  5FLX g;  2OK6 A;  5K1C C;  5EAM A;  1NR0 A;  5HE3 B;  4X63 B;  1TBG A;  3OL2 A;  5HYN B;  3UKR C;  3U4Y A;  2QXV A;  1PEV A;  3DM0 A;  2B5N A;  3I7P A;  3JZG A;  5I5M A;  3OKY B;  3ORV D;  2OJY A;  4J8B A;  3SLE D;  4CZY A;  1GP2 B;  4CI2 A;  4GGD A;  3L4M D;  3SHF A;  3RFH A;  1MDA H;  2O9K A;  3SCY A;  4D0K A;  2YBA A;  4O3U B;  4CY5 A;  4K3J B;  3ZWL B;  5GXH A;  5IT9 g;  4ESG A;  4O45 A;  3IJ0 A;  4OZU A;  4QQE A;  1N6D A;  2B5L A;  3RN1 D;  2AGL A;  2I0R A;  4ZOX A;  4A0B B;  4JXM A;  3FRX A;  3MMY A;  4BH6 A;  2AH1 A;  2P9N C;  4NSX A;  3RRM C;  2HKM A;  4X60 B;  5HQG A;  3SBQ A;  2H9L A;  4A11 B;  4FAV D;  3PVW B;  4A2M A;  5JWZ A;  1K32 A;  1TYQ C;  5KDO B;  3EG6 A;  4ERZ A;  4JT6 C;  1Q47 A;  5IGQ A;  4L9O A;  1VYH C;  2YNO A;  5CYK A;  3EI1 B;  3EU7 A;  3A0F A;  3BWS A;  5I5J A;  2H9N A;  1A0R B;  2GC4 A;  3CIK B;  5AMS A;  3AFC A;  1XHM A;  2PM6 B;  3J81 g;  3KRW B;  1N6F A;  1YFQ A;  5I5I A;  2G99 A;  4IA9 A;  4UI9 R;  3PXT D;  4AOW A;  2B5M A;  4CI3 A;  3N0E A;  2G9A A;  3EI3 A;  1OMW B;  5TEE A;  4ES0 A;  3EI4 B;  5K19 A;  1PBY B;  3CFS B;  3DSM A;  3EWE A;  3JPX A;  2AGY A;  5AFU 3;  4QRJ A;  4JSV C;  2YB8 B;  3RFG A;  4GM3 A;  3EI3 B;  4XYI A;  3OKY A;  3IKO A;  1U2V C;  2IWK A;  1XIP A;  2OK4 A;  5TEF A;  5EMM B;  5GXI A;  2TRC B;  3UVM A;  1GOT B;  4YVD A;  2XL3 A;  3RMZ D;  5H17 A;  3PXW D;  2J57 G;  3EMH A;  5EM2 B;  5EAR A;  5CXB B;  2XYI A;  4A0B A;  2H9P A;  3I7O A;  4BL0 A;  3MZL A;  3NVN A;  1JMX B;  2Z2O A;  2H3X A;  5H14 A;  3E0C A;  4ERQ A;  5A2Q g;  4CY1 A;  2OVQ B;  5B4W A;  4A11 A;  2H13 A;  3I7H A;  3C5M A;  4BUJ C;  2P9K C;  3N0D A;  2YMU A;  3PSL A;  4CZX A;  2AGW A;  1P22 A;  4A7J A;  4JT5 C;  4ZOY A;  4D6V A;  5TF2 A;  4FA1 D;  1U4C A;  3AH8 B;  3PSC B;  3UKU C;  4E54 B;  4JSX C;  2W18 A;  3EI1 A;  3PXS D;  3DWL C;  4J0X A;  4J0W A;  3F3F A;  5EML B;  3SWS D;  1JOF A;  3IIY A;  2PBI B;  4Y5R D;  5IC7 A;  3NVX A;  4L3H D;  4E5Z B;  2I0S A;  5FKR A;  3JAM g;  2CO0 A;  3IJC A;  3L4O D;  2IUP A;  4L3G D;  2YNN A;  5FXY A;  2AGZ A;  4GM8 A;  3UVO A;  4GGA A;  3UVN A;  3C99 A;  5C2V B;  2HJ4 A;  1NEX B;  4LG9 A;  3EI4 A;  2P9P C;  2HJB A;  3UVL A;  5EAP A;  5H1M A;  3I8C A;  4PXW A;  3MXX A;  3CFV A;  2CE9 A;  2Z2N A;  5FKT A;  4A09 B;  2GNQ A;  1PI6 A;  5HE0 B;  4HDJ A;  2XU7 A;  3FM0 A;  3SJL D;  4J82 A;  3V9F A;  5CXC B;  1GXR A;  2AH0 A;  4PNK B;  3C9C A;  3DXM C;  2CN2 A;  4L1Q D;  4Z8L A;  4G56 B;  3JB9 L;  1N6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...