3CFVA

Structural basis of the interaction of rbap46/rbap48 with histone h4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
411
structure length
390
Chain Sequence
MAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histone/chaperone
molecule keywords Histone-binding protein RBBP7
total genus 80
structure length 390
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3cfvA00
4FA1D 2B5LA 3I7LA 3DWLC 3V9FA 1QNIA 2HXCA 3PVUB 3OKTA 3I7NA 4E54B 4TZ4A 4A0AB 3UVMA 4E5ZA 2YNPA 4J82A 4CY5A 2AGXA 2H14A 5HE0B 3J80g 3I2NA 3PXSD 3EI2A 3VH0A 5CXCB 3SCYA 3DSMA 5FA5B 2PM6B 1GP2B 2Z2PA 2OK4A 4X63B 2P9IC 2I0TA 5I5MA 2PM7B 2IUPA 4L3HD 3EU7A 3CFSB 5EAMA 1FWXA 3MZKA 3C9CA 4JD2C 1SQJA 3OL2A 5EM2B 2AGYA 2IWKA 5EMKB 4XYIA 1JOFA 5CYKA 4O9DA 4FA9D 3UVLA 3GFCA 3IJCA 4A11A 4R7AB 3RN0D 2PM9B 3UKRC 2IUVA 5FKQA 3RLMD 4A0BB 4A09B 2IWFA 3OKWA 5TEFA 3EI3B 3MXXA 5B4WA 2B5MA 2PBIB 5TEEA 3IJ1A 3BG1A 4LG9A 2AQ5A 4OZUA 5K1CC 5SXMA 2H9NA 3V5WB 1A0RB 3SN6B 4D0KA 2I3TA 4IA9A 4PSWB 3SFZA 3ORVD 4J0WA 4CZYA 2OVPB 2IUQA 2I0SA 3EI3A 1N6FA 2G99A 2J57G 5IGQA 3DXKC 3N0DA 3EMHA 2PM9A 4FAND 2HJ4A 2YB8B 3SWSD 4U1EI 1L0QA 4XEIC 5AJAA 1JMXB 4N14A 3SHFA 2I0RA 2Z2NA 2CNXA 5FKRA 3SVWD 5EM2A 1TBGA 3RSEC 1Q47A 2H13A 3AFCA 3IJ0A 1NEXB 4O3TB 5AFU3 4QT8A 3AL9A 5HYNB 4J87A 1U4CA 4GMBA 4J86A 3PVWB 1OLZA 2CO0C 3L4MD 4GGAA 5H1MA 4O45A 2AH1A 4J79A 3SBQA 4AOWA 3I8EA 4CY2A 4H5JA 3CIKB 4L3GD 3I7OA 4MK0B 4ZOXA 1XIPA 2HJBA 5IGOA 4E5ZB 4J81A 3RMZD 3RRMC 1MG3A 2H9LA 4L9OA 4A08B 1GXRA 2CO0A 4X61B 3BG0A 3NVQA 3IIYA 1XKSA 2EBSA 4J0XA 5HE1B 5THAA 5GXIA 2H9PA 3I7PA 1OMWB 3I8CA 1XHMA 3PSLA 2P9SC 2GNQA 3FGBA 2B5NA 3A0FA 2H3XA 4A7JA 2XL2A 3OW8A 4FA5D 4CY1A 4GM9A 3C99A 4FAVD 1N6DA 1PGUA 1GG2B 2AGZA 4JXMA 4AEZA 5TDHB 4A08A 4IMMA 2MTAH 4YVDA 1MDAH 4BH6A 4GGCA 2CE8A 3F3GA 1PEVA 2CN3A 4A11B 2AGLA 3IKOA 4LGNA 2UZXB 3C75H 2BCJB 3E0CA 5EALA 2J55H 4GM3A 5FQDA 4GQ1A 3VGZA 3OKYB 3DM0A 1SHYB 5TF2A 2GC7A 2HESX 3MZLA 4ERQA 1NR0A 3ODTA 4I79A 4ERZA 4J8BA 4X60B 3DXMC 5IT9g 2P9KC 2H6QA 2YNNA 3OKYA 5IJ8E 3K27A 4HDJA 3SJLD 2AH0A 1JJUB 5HQGA 3JZHA 4JSNC 4NSXA 4CI1A 3VA6A 1TYQC 2UZYB 5FLXg 4JT6C 3SBPA 4ZOYA 3OL2B 3JZNA 5CYKB 4CY3A 3ZWLB 2XL3A 4CI8A 2H68A 3IIWA 4H5IA 4PSXB 2HKRA 4A2LA 3C5MA 3V7DB 4GQBB 3MMYA 4J84A 4PBYA 3UVNA 3I89A 3FM0A 2AGWA 5CXCA 2OJYA 2H47A 1VYHC 2OK6A 2P9LC 3KRXB 5I5JA 5K19A 3FRXA 2P9UC 3PXTD 4J78A 2OVRB 4GZ8A 3RN1D 4FWWA 4GGDA 5EAPA 4A0AA 3SXTD 2G9AA 4CZVA 5KDOB 4ESGA 1R5MA 1RI6A 2H9MA 1B9XA 1GOTB 4QRJA 4J73A 5EMLB 2H6KA 4UI9R 2H6NA 1SQ9A 3RFGA 3EI4B 4CZXA 3PXWD 4U7AA 4BUJC 3N0EA 3NVNA 5HE2B 5IJ7E 3EI4A 3L4OD 2O9KA 5A2Qg 4FHLA 4JT5C 3P4FA 2YNOA 3JAMg 5FKSA 4K3ID 3UR4A 1B9YA 4XYHA 4KFMB 3AH8B 4Y7RA 3SMRA 3B7FA 4GM8A 2QXVA 2Z2OA 2W18A 5C2VB 5C9ZB 4ERYA 4E54A 4LG8A 4A0BA 4Y5RD 4ZOZA 3PE7A 4CI3A 4L1QD 3EG6A 4FB1D 3CFVA 4JSPC 3JZGA 2XYIA 4O3UB 5FKTA 4D6VA 3AL8B 3HFQA 3EI1A 4OWRA 4QL1A 5GMKn 2P9PC 3RFHA 4G56B 3NVXA 3JROA 3KRWB 1MG2A 2HKMA 1K32A 2QC5A 2CN2A 2OIZA 3MKSB 5CXBB 3EI2B 2TRCB 5AMSA 2IAAA 4JSXC 2YBAA 2IURA 4A09A 4X3EA 1ERJA 5CXBA 2BBKH 3MKQA 4PNKB 4K3JB 5HE3B 4ZOVA 4JSVC 4Z8LA 2YMUA 5I5IA 1P22A 3SLED 5H14A 5JWZA 3JRPA 2P9NC 4A2MA 2GC4A 4GQ2P 2OVQB 1S4UX 3UVKA 5EMJB 3F3PA 4O1QD 3UVOA 4EWRA 3UKUC 3W15A 3I7HA 3I7KA 1YFQA 5IC7A 4CI2A 3SBRA 5C2WB 3K26A 1K8KC 5EMMB 5EARA 2J56H 4ES0A 2Q7QA 5FXYA 3JB9L 2CE9A 2HYEA 3PSCB 3BWSA 2B4EA 4PBZA 3OTTA 4FA4D 1N6EA 5GSAA 4PXWA 1U2VC 4J8GA 2I3SA 5H17A 3ULEC 3J81g 3U4YA 3EI1B 4ZN4A 4PC0A 3AL8A 3F3FA 4CC9A 4QQEA 1PBYB 1PI6A 3GREA 4BL0A 2XU7A 3JPXA 5GXHA 4J77A 3EWEA 1JMZB
chains in the Genus database with same CATH superfamily
4FA1D 2B5LA 3I7LA 1UOPA 3DWLC 3V9FA 1QNIA 3ZDYA 3FCUA 2HXCA 3PVUB 3OKTA 3I7NA 4E54B 4TZ4A 4BP8A 4A0AB 3UVMA 3V4VA 4G1MA 4E5ZA 1I2MB 2YNPA 4J82A 4CY5A 4BCCA 2AGXA 2H14A 5HE0B 3J80g 3I2NA 3V4PA 3PXSD 3EI2A 3VH0A 5CXCB 3SCYA 5FFOA 3DSMA 1E8MA 5FA5B 2PM6B 1GP2B 2Z2PA 2OK4A 2P9IC 4X63B 2I0TA 5I5MA 2PM7B 1UTCA 2IUPA 2HU8A 4L3HD 4MMXA 3EU7A 3CFSB 5EAMA 1FWXA 3MZKA 3C9CA 4JD2C 1SQJA 3OL2A 5EM2B 2AGYA 2IWKA 5EMKB 4XYIA 3ZE1A 1JOFA 2VDQA 5CYKA 4O9DA 4FA9D 2VC2A 3UVLA 3GFCA 1H2YA 3IJCA 4A11A 4R7AB 3RN0D 2PM9B 3UKRC 2IUVA 5FKQA 3RLMD 4A0BB 4A09B 2IWFA 3OKWA 5TEFA 3EI3B 3MXXA 5B4WA 4DNVA 2B5MA 2PBIB 5TEEA 1VE7A 3IJ1A 3BG1A 3GC3B 2AQ5A 4LG9A 4OZUA 5K1CC 5SXMA 2H9NA 3T3MA 3V5WB 1A0RB 3SN6B 4D0KA 4Z7QA 3KCIA 2I3TA 4IA9A 4PSWB 3SFZA 1GOFA 3ORVD 4J0WA 4CZYA 4O2WA 2OVPB 2IUQA 2I0SA 3EI3A 1N6FA 2G99A 2J57G 3O4GA 4JHPC 4AN1A 5IGQA 3DXKC 3N0DA 4Z7OA 3EMHA 2PM9A 3FCSA 4FAND 2HJ4A 2YB8B 2VDPA 3SWSD 4U1EI 4D9SA 1L0QA 3QHYB 4XEIC 1JMXB 5AJAA 4N14A 3SHFA 2I0RA 2Z2NA 2CNXA 5FKRA 3SVWD 5EM2A 3IUJA 1TBGA 1Q47A 2H13A 4RE5A 3RSEC 3AFCA 4MMZA 3IJ0A 1NEXB 4O3TB 3K71A 5M5UA 1QFMA 5AFU3 3O4HA 4QT8A 3AL9A 5HYNB 3EQ9A 4J87A 1U4CA 3IURA 4GMBA 4J86A 3PVWB 1OLZA 3QI0A 2CO0C 3L4MD 4GGAA 2BKLA 5H1MA 4O45A 2AH1A 4J79A 3SBQA 4AOWA 3I8EA 4CY2A 4WJKA 4H5JA 4NC4A 3CIKB 3NIGA 4L3GD 3I7OA 4MK0B 4ZOXA 1XIPA 3T3PA 2VDLA 2HJBA 5IGOA 4E5ZB 4J81A 4JHNA 3RMZD 3RRMC 1MG3A 2H9LA 4L9OA 4A08B 4BCDA 1GXRA 2CO0A 1H2WA 4X61B 3BG0A 3NVQA 4RE6A 3IIYA 1XKSA 2EBSA 4J0XA 5HE1B 5THAA 5GXIA 2H9PA 3I7PA 1JTDB 1OMWB 3I8CA 1C9LA 1XHMA 3PSLA 2P9SC 2GNQA 3FGBA 5M61A 2B5NA 3MVDK 3A0FA 2H3XA 4NBMA 3ZE0A 4A7JA 2XL2A 3OW8A 1O6GA 4AX4A 4FA5D 1E5TA 4CY1A 4GM9A 3C99A 4FAVD 1N6DA 1PGUA 4WK0A 5E6UA 1GG2B 2AGZA 4JXMA 4AEZA 3EQ8A 5TDHB 4A08A 2XDWA 4IMMA 2MTAH 4YVDA 1MDAH 4BH6A 4GGCA 2CE8A 3F3GA 1PEVA 2CN3A 4L1MA 4A11B 2AGLA 4NENA 3IKOA 1QFSA 5C86A 4LGNA 4G55A 2UZXB 3C75H 5M5VA 2BCJB 3E0CA 3O4IA 5EALA 2J55H 5HDBA 4GM3A 5FQDA 4GQ1A 3VGZA 3OKYB 3DM0A 1H2ZA 1SHYB 5TF2A 2GC7A 3MUOA 2HESX 3MZLA 4ERQA 1NR0A 3ODTA 4I79A 4ERZA 4J8BA 4X60B 3DXMC 5IT9g 4QAMA 2P9KC 2H6QA 2YNNA 3OKYA 3K72A 4MMYA 5IJ8E 2VZ3A 4DNWA 2QZPA 3K27A 2QR5A 4HDJA 3SJLD 2AH0A 1JJUB 5HQGA 3JZHA 2EIEA 4JSNC 4NSXA 4CI1A 1GOGA 1YR2A 1TYQC 3VA6A 2UZYB 5FLXg 4JT6C 3SBPA 4ZOYA 1L5GA 3OL2B 3JZNA 5CYKB 4CY3A 3ZWLB 1BPOA 4DNUA 2XL3A 4CI8A 2H68A 3IIWA 4WK4A 4H5IA 4PSXB 1VZ3A 2HKRA 4A2LA 3C5MA 3V7DB 4GQBB 3GD1I 3MMYA 1VZ2A 3ZE2A 4J84A 3NIDA 4PBYA 3UVNA 1JV2A 3FM0A 3I89A 2AGWA 5CXCA 2OJYA 2H47A 1VYHC 2OK6A 2EICA 2JKXA 2P9LC 3IJEA 3IUMA 3KRXB 5I5JA 4NAAA 5K19A 3FRXA 2P9UC 3PXTD 4J78A 3VI3A 1VE6A 2OVRB 4GZ8A 3RN1D 4FWWA 4GGDA 3IUQA 5EAPA 4A0AA 3SXTD 2G9AA 5M5SA 4CZVA 5KDOB 4ESGA 1R5MA 2XE4A 1RI6A 2H9MA 1B9XA 1GOTB 4QRJA 4J73A 5EMLB 2H6KA 4UI9R 2H6NA 3EQ7A 1C9IA 1SQ9A 3RFGA 3EI4B 4CZXA 4AN0A 3PXWD 4U7AA 1E8NA 4UM9A 4BUJC 3N0EA 3NVNA 5HE2B 5IJ7E 3EI4A 3DDUA 3L4OD 4Z7NA 2O9KA 5A2Qg 4FHLA 4JT5C 3P4FA 2YNOA 3JAMg 5FKSA 4K3ID 1T2XA 3UR4A 1B9YA 4XYHA 4KFMB 3AH8B 3NIFA 4Y7RA 3MUNA 3OF7A 3SMRA 3IULA 5M5TA 3B7FA 4GM8A 2QXVA 2Z2OA 2W18A 5C2VB 5C9ZB 3ZDXA 2VDRA 4ERYA 4E54A 4LG8A 4A0BA 4Y5RD 4ZOZA 1O6FA 2VDMA 2HU5A 3PE7A 4CI3A 4L1QD 3EG6A 4FB1D 3CFVA 4JSPC 5C92A 3JZGA 2WQ8A 2XYIA 4O3UB 5FKTA 4D6VA 2VDNA 3AL8B 2EIBA 3HFQA 3ZDZA 3EI1A 4OWRA 4QL1A 5GMKn 2P9PC 3RFHA 4UM8A 4G56B 5FFGA 3NVXA 3JROA 3KRWB 2XZGA 1MG2A 2HKMA 4BP9A 1K32A 1A12A 2QC5A 4O02A 1GOHA 2CN2A 2OIZA 3MKSB 5CXBB 3EI2B 2TRCB 5AMSA 2IAAA 4JSXC 2YBAA 1TYEA 1H2XA 2IURA 4X3EA 4A09A 2VDKA 1ERJA 5CXBA 2BBKH 3MKQA 4PNKB 4G1EA 4K3JB 4AMYA 5HE3B 4ZOVA 5E6SA 4JSVC 4Z8LA 2YMUA 5I5IA 1P22A 3SLED 5H14A 5JWZA 3JRPA 2P9NC 2HU7A 4A2MA 2VZ1A 2GC4A 4GQ2P 2OVQB 1S4UX 3UVKA 3K6SA 1UOOA 5EMJB 3F3PA 3O4JA 5M5RA 4O1QD 3UVOA 4EWRA 3UKUC 3W15A 3I7HA 3I7KA 1YFQA 4IRZA 1M1XA 2EIDA 5IC7A 1U8CA 3SBRA 4CI2A 5C2WB 3K26A 3IUNA 1K8KC 5EMMB 3IVMA 5EARA 2J56H 4ES0A 2Q7QA 5FXYA 3JB9L 2CE9A 2HYEA 3PSCB 3BWSA 2B4EA 4PBZA 3OTTA 4FA4D 3VI4A 2VDOA 1N6EA 5GSAA 4PXWA 1U2VC 4J8GA 2I3SA 5H17A 3ULEC 3J81g 3U4YA 4WK2A 1UOQA 3EI1B 4ZN4A 4BCBA 4PC0A 5E6RA 3AL8A 3F3FA 4CC9A 4AMZA 4QQEA 1PBYB 1PI6A 3GREA 4BL0A 1K3IA 2XU7A 3JPXA 5GXHA 4J77A 3EWEA 1JMZB
chains in the Genus database with same CATH topology
4FA1D 2B5LA 3I7LA 3DWLC 3V9FA 1QNIA 2HXCA 3PVUB 3OKTA 3I7NA 4E54B 4TZ4A 4A0AB 3UVMA 4E5ZA 2YNPA 4J82A 4CY5A 2AGXA 2H14A 5HE0B 3J80g 3I2NA 3PXSD 3EI2A 3VH0A 5CXCB 3SCYA 3DSMA 5FA5B 2PM6B 1GP2B 2Z2PA 2OK4A 4X63B 2P9IC 2I0TA 5I5MA 2PM7B 2IUPA 4L3HD 3EU7A 3CFSB 5EAMA 1FWXA 3MZKA 3C9CA 4JD2C 1SQJA 3OL2A 5EM2B 2AGYA 2IWKA 5EMKB 4XYIA 1JOFA 5CYKA 4O9DA 4FA9D 3UVLA 3GFCA 3IJCA 4A11A 4R7AB 3RN0D 2PM9B 3UKRC 2IUVA 5FKQA 3RLMD 4A0BB 4A09B 2IWFA 3OKWA 5TEFA 3EI3B 3MXXA 5B4WA 2B5MA 2PBIB 5TEEA 3IJ1A 3BG1A 4LG9A 2AQ5A 4OZUA 5K1CC 5SXMA 2H9NA 3V5WB 1A0RB 3SN6B 4D0KA 2I3TA 4IA9A 4PSWB 3SFZA 3ORVD 4J0WA 4CZYA 2OVPB 2IUQA 2I0SA 3EI3A 1N6FA 2G99A 2J57G 5IGQA 3DXKC 3N0DA 3EMHA 2PM9A 4FAND 2HJ4A 2YB8B 3SWSD 4U1EI 1L0QA 4XEIC 5AJAA 1JMXB 4N14A 3SHFA 2I0RA 2Z2NA 2CNXA 5FKRA 3SVWD 5EM2A 1TBGA 3RSEC 1Q47A 2H13A 3AFCA 3IJ0A 1NEXB 4O3TB 5AFU3 4QT8A 3AL9A 5HYNB 4J87A 1U4CA 4GMBA 4J86A 3PVWB 1OLZA 2CO0C 3L4MD 4GGAA 5H1MA 4O45A 2AH1A 4J79A 3SBQA 4AOWA 3I8EA 4CY2A 4H5JA 3CIKB 4L3GD 3I7OA 4MK0B 4ZOXA 1XIPA 2HJBA 5IGOA 4E5ZB 4J81A 3RMZD 3RRMC 1MG3A 2H9LA 4L9OA 4A08B 1GXRA 2CO0A 4X61B 3BG0A 3NVQA 3IIYA 1XKSA 2EBSA 4J0XA 5HE1B 5THAA 5GXIA 2H9PA 3I7PA 1OMWB 3I8CA 1XHMA 3PSLA 2P9SC 2GNQA 3FGBA 2B5NA 3A0FA 2H3XA 4A7JA 2XL2A 3OW8A 4FA5D 4CY1A 4GM9A 3C99A 4FAVD 1N6DA 1PGUA 1GG2B 2AGZA 4JXMA 4AEZA 5TDHB 4A08A 4IMMA 2MTAH 4YVDA 1MDAH 4BH6A 4GGCA 2CE8A 3F3GA 1PEVA 2CN3A 4A11B 2AGLA 3IKOA 4LGNA 2UZXB 3C75H 2BCJB 3E0CA 5EALA 2J55H 4GM3A 5FQDA 4GQ1A 3VGZA 3OKYB 3DM0A 1SHYB 5TF2A 2GC7A 2HESX 3MZLA 4ERQA 1NR0A 3ODTA 4I79A 4ERZA 4J8BA 4X60B 3DXMC 5IT9g 2P9KC 2H6QA 2YNNA 3OKYA 5IJ8E 3K27A 4HDJA 3SJLD 2AH0A 1JJUB 5HQGA 3JZHA 4JSNC 4NSXA 4CI1A 3VA6A 1TYQC 2UZYB 5FLXg 4JT6C 3SBPA 4ZOYA 3OL2B 3JZNA 5CYKB 4CY3A 3ZWLB 2XL3A 4CI8A 2H68A 3IIWA 4H5IA 4PSXB 2HKRA 4A2LA 3C5MA 3V7DB 4GQBB 3MMYA 4J84A 4PBYA 3UVNA 3I89A 3FM0A 2AGWA 5CXCA 2OJYA 2H47A 1VYHC 2OK6A 2P9LC 3KRXB 5I5JA 5K19A 3FRXA 2P9UC 3PXTD 4J78A 2OVRB 4GZ8A 3RN1D 4FWWA 4GGDA 5EAPA 4A0AA 3SXTD 2G9AA 4CZVA 5KDOB 4ESGA 1R5MA 1RI6A 2H9MA 1B9XA 1GOTB 4QRJA 4J73A 5EMLB 2H6KA 4UI9R 2H6NA 1SQ9A 3RFGA 3EI4B 4CZXA 3PXWD 4U7AA 4BUJC 3N0EA 3NVNA 5HE2B 5IJ7E 3EI4A 3L4OD 2O9KA 5A2Qg 4FHLA 4JT5C 3P4FA 2YNOA 3JAMg 5FKSA 4K3ID 3UR4A 1B9YA 4XYHA 4KFMB 3AH8B 4Y7RA 3SMRA 3B7FA 4GM8A 2QXVA 2Z2OA 2W18A 5C2VB 5C9ZB 4ERYA 4E54A 4LG8A 4A0BA 4Y5RD 4ZOZA 3PE7A 4CI3A 4L1QD 3EG6A 4FB1D 3CFVA 4JSPC 3JZGA 2XYIA 4O3UB 5FKTA 4D6VA 3AL8B 3HFQA 3EI1A 4OWRA 4QL1A 5GMKn 2P9PC 3RFHA 4G56B 3NVXA 3JROA 3KRWB 1MG2A 2HKMA 1K32A 2QC5A 2CN2A 2OIZA 3MKSB 5CXBB 3EI2B 2TRCB 5AMSA 2IAAA 4JSXC 2YBAA 2IURA 4A09A 4X3EA 1ERJA 5CXBA 2BBKH 3MKQA 4PNKB 4K3JB 5HE3B 4ZOVA 4JSVC 4Z8LA 2YMUA 5I5IA 1P22A 3SLED 5H14A 5JWZA 3JRPA 2P9NC 4A2MA 2GC4A 4GQ2P 2OVQB 1S4UX 3UVKA 5EMJB 3F3PA 4O1QD 3UVOA 4EWRA 3UKUC 3W15A 3I7HA 3I7KA 1YFQA 5IC7A 4CI2A 3SBRA 5C2WB 3K26A 1K8KC 5EMMB 5EARA 2J56H 4ES0A 2Q7QA 5FXYA 3JB9L 2CE9A 2HYEA 3PSCB 3BWSA 2B4EA 4PBZA 3OTTA 4FA4D 1N6EA 5GSAA 4PXWA 1U2VC 4J8GA 2I3SA 5H17A 3ULEC 3J81g 3U4YA 3EI1B 4ZN4A 4PC0A 3AL8A 3F3FA 4CC9A 4QQEA 1PBYB 1PI6A 3GREA 4BL0A 2XU7A 3JPXA 5GXHA 4J77A 3EWEA 1JMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA1 D;  2B5L A;  3I7L A;  3DWL C;  3V9F A;  1QNI A;  2HXC A;  3PVU B;  3OKT A;  3I7N A;  4E54 B;  4TZ4 A;  4A0A B;  3UVM A;  4E5Z A;  2YNP A;  4J82 A;  4CY5 A;  2AGX A;  2H14 A;  5HE0 B;  3J80 g;  3I2N A;  3PXS D;  3EI2 A;  3VH0 A;  5CXC B;  3SCY A;  3DSM A;  5FA5 B;  2PM6 B;  1GP2 B;  2Z2P A;  2OK4 A;  4X63 B;  2P9I C;  2I0T A;  5I5M A;  2PM7 B;  2IUP A;  4L3H D;  3EU7 A;  3CFS B;  5EAM A;  1FWX A;  3MZK A;  3C9C A;  4JD2 C;  1SQJ A;  3OL2 A;  5EM2 B;  2AGY A;  2IWK A;  5EMK B;  4XYI A;  1JOF A;  5CYK A;  4O9D A;  4FA9 D;  3UVL A;  3GFC A;  3IJC A;  4A11 A;  4R7A B;  3RN0 D;  2PM9 B;  3UKR C;  2IUV A;  5FKQ A;  3RLM D;  4A0B B;  4A09 B;  2IWF A;  3OKW A;  5TEF A;  3EI3 B;  3MXX A;  5B4W A;  2B5M A;  2PBI B;  5TEE A;  3IJ1 A;  3BG1 A;  4LG9 A;  2AQ5 A;  4OZU A;  5K1C C;  5SXM A;  2H9N A;  3V5W B;  1A0R B;  3SN6 B;  4D0K A;  2I3T A;  4IA9 A;  4PSW B;  3SFZ A;  3ORV D;  4J0W A;  4CZY A;  2OVP B;  2IUQ A;  2I0S A;  3EI3 A;  1N6F A;  2G99 A;  2J57 G;  5IGQ A;  3DXK C;  3N0D A;  3EMH A;  2PM9 A;  4FAN D;  2HJ4 A;  2YB8 B;  3SWS D;  4U1E I;  1L0Q A;  4XEI C;  5AJA A;  1JMX B;  4N14 A;  3SHF A;  2I0R A;  2Z2N A;  2CNX A;  5FKR A;  3SVW D;  5EM2 A;  1TBG A;  3RSE C;  1Q47 A;  2H13 A;  3AFC A;  3IJ0 A;  1NEX B;  4O3T B;  5AFU 3;  4QT8 A;  3AL9 A;  5HYN B;  4J87 A;  1U4C A;  4GMB A;  4J86 A;  3PVW B;  1OLZ A;  2CO0 C;  3L4M D;  4GGA A;  5H1M A;  4O45 A;  2AH1 A;  4J79 A;  3SBQ A;  4AOW A;  3I8E A;  4CY2 A;  4H5J A;  3CIK B;  4L3G D;  3I7O A;  4MK0 B;  4ZOX A;  1XIP A;  2HJB A;  5IGO A;  4E5Z B;  4J81 A;  3RMZ D;  3RRM C;  1MG3 A;  2H9L A;  4L9O A;  4A08 B;  1GXR A;  2CO0 A;  4X61 B;  3BG0 A;  3NVQ A;  3IIY A;  1XKS A;  2EBS A;  4J0X A;  5HE1 B;  5THA A;  5GXI A;  2H9P A;  3I7P A;  1OMW B;  3I8C A;  1XHM A;  3PSL A;  2P9S C;  2GNQ A;  3FGB A;  2B5N A;  3A0F A;  2H3X A;  4A7J A;  2XL2 A;  3OW8 A;  4FA5 D;  4CY1 A;  4GM9 A;  3C99 A;  4FAV D;  1N6D A;  1PGU A;  1GG2 B;  2AGZ A;  4JXM A;  4AEZ A;  5TDH B;  4A08 A;  4IMM A;  2MTA H;  4YVD A;  1MDA H;  4BH6 A;  4GGC A;  2CE8 A;  3F3G A;  1PEV A;  2CN3 A;  4A11 B;  2AGL A;  3IKO A;  4LGN A;  2UZX B;  3C75 H;  2BCJ B;  3E0C A;  5EAL A;  2J55 H;  4GM3 A;  5FQD A;  4GQ1 A;  3VGZ A;  3OKY B;  3DM0 A;  1SHY B;  5TF2 A;  2GC7 A;  2HES X;  3MZL A;  4ERQ A;  1NR0 A;  3ODT A;  4I79 A;  4ERZ A;  4J8B A;  4X60 B;  3DXM C;  5IT9 g;  2P9K C;  2H6Q A;  2YNN A;  3OKY A;  5IJ8 E;  3K27 A;  4HDJ A;  3SJL D;  2AH0 A;  1JJU B;  5HQG A;  3JZH A;  4JSN C;  4NSX A;  4CI1 A;  3VA6 A;  1TYQ C;  2UZY B;  5FLX g;  4JT6 C;  3SBP A;  4ZOY A;  3OL2 B;  3JZN A;  5CYK B;  4CY3 A;  3ZWL B;  2XL3 A;  4CI8 A;  2H68 A;  3IIW A;  4H5I A;  4PSX B;  2HKR A;  4A2L A;  3C5M A;  3V7D B;  4GQB B;  3MMY A;  4J84 A;  4PBY A;  3UVN A;  3I89 A;  3FM0 A;  2AGW A;  5CXC A;  2OJY A;  2H47 A;  1VYH C;  2OK6 A;  2P9L C;  3KRX B;  5I5J A;  5K19 A;  3FRX A;  2P9U C;  3PXT D;  4J78 A;  2OVR B;  4GZ8 A;  3RN1 D;  4FWW A;  4GGD A;  5EAP A;  4A0A A;  3SXT D;  2G9A A;  4CZV A;  5KDO B;  4ESG A;  1R5M A;  1RI6 A;  2H9M A;  1B9X A;  1GOT B;  4QRJ A;  4J73 A;  5EML B;  2H6K A;  4UI9 R;  2H6N A;  1SQ9 A;  3RFG A;  3EI4 B;  4CZX A;  3PXW D;  4U7A A;  4BUJ C;  3N0E A;  3NVN A;  5HE2 B;  5IJ7 E;  3EI4 A;  3L4O D;  2O9K A;  5A2Q g;  4FHL A;  4JT5 C;  3P4F A;  2YNO A;  3JAM g;  5FKS A;  4K3I D;  3UR4 A;  1B9Y A;  4XYH A;  4KFM B;  3AH8 B;  4Y7R A;  3SMR A;  3B7F A;  4GM8 A;  2QXV A;  2Z2O A;  2W18 A;  5C2V B;  5C9Z B;  4ERY A;  4E54 A;  4LG8 A;  4A0B A;  4Y5R D;  4ZOZ A;  3PE7 A;  4CI3 A;  4L1Q D;  3EG6 A;  4FB1 D;  3CFV A;  4JSP C;  3JZG A;  2XYI A;  4O3U B;  5FKT A;  4D6V A;  3AL8 B;  3HFQ A;  3EI1 A;  4OWR A;  4QL1 A;  5GMK n;  2P9P C;  3RFH A;  4G56 B;  3NVX A;  3JRO A;  3KRW B;  1MG2 A;  2HKM A;  1K32 A;  2QC5 A;  2CN2 A;  2OIZ A;  3MKS B;  5CXB B;  3EI2 B;  2TRC B;  5AMS A;  2IAA A;  4JSX C;  2YBA A;  2IUR A;  4A09 A;  4X3E A;  1ERJ A;  5CXB A;  2BBK H;  3MKQ A;  4PNK B;  4K3J B;  5HE3 B;  4ZOV A;  4JSV C;  4Z8L A;  2YMU A;  5I5I A;  1P22 A;  3SLE D;  5H14 A;  5JWZ A;  3JRP A;  2P9N C;  4A2M A;  2GC4 A;  4GQ2 P;  2OVQ B;  1S4U X;  3UVK A;  5EMJ B;  3F3P A;  4O1Q D;  3UVO A;  4EWR A;  3UKU C;  3W15 A;  3I7H A;  3I7K A;  1YFQ A;  5IC7 A;  4CI2 A;  3SBR A;  5C2W B;  3K26 A;  1K8K C;  5EMM B;  5EAR A;  2J56 H;  4ES0 A;  2Q7Q A;  5FXY A;  3JB9 L;  2CE9 A;  2HYE A;  3PSC B;  3BWS A;  2B4E A;  4PBZ A;  3OTT A;  4FA4 D;  1N6E A;  5GSA A;  4PXW A;  1U2V C;  4J8G A;  2I3S A;  5H17 A;  3ULE C;  3J81 g;  3U4Y A;  3EI1 B;  4ZN4 A;  4PC0 A;  3AL8 A;  3F3F A;  4CC9 A;  4QQE A;  1PBY B;  1PI6 A;  3GRE A;  4BL0 A;  2XU7 A;  3JPX A;  5GXH A;  4J77 A;  3EWE A;  1JMZ B; 
#chains in the Genus database with same CATH topology
 4FA1 D;  2B5L A;  3I7L A;  1UOP A;  3DWL C;  3V9F A;  1QNI A;  3ZDY A;  3FCU A;  2HXC A;  3PVU B;  3OKT A;  3I7N A;  4E54 B;  4TZ4 A;  4BP8 A;  4A0A B;  3UVM A;  3V4V A;  4G1M A;  4E5Z A;  1I2M B;  2YNP A;  4J82 A;  4CY5 A;  4BCC A;  2AGX A;  2H14 A;  5HE0 B;  3J80 g;  3I2N A;  3V4P A;  3PXS D;  3EI2 A;  3VH0 A;  5CXC B;  3SCY A;  5FFO A;  3DSM A;  1E8M A;  5FA5 B;  2PM6 B;  1GP2 B;  2Z2P A;  2OK4 A;  2P9I C;  4X63 B;  2I0T A;  5I5M A;  2PM7 B;  1UTC A;  2IUP A;  2HU8 A;  4L3H D;  4MMX A;  3EU7 A;  3CFS B;  5EAM A;  1FWX A;  3MZK A;  3C9C A;  4JD2 C;  1SQJ A;  3OL2 A;  5EM2 B;  2AGY A;  2IWK A;  5EMK B;  4XYI A;  3ZE1 A;  1JOF A;  2VDQ A;  5CYK A;  4O9D A;  4FA9 D;  2VC2 A;  3UVL A;  3GFC A;  1H2Y A;  3IJC A;  4A11 A;  4R7A B;  3RN0 D;  2PM9 B;  3UKR C;  2IUV A;  5FKQ A;  3RLM D;  4A0B B;  4A09 B;  2IWF A;  3OKW A;  5TEF A;  3EI3 B;  3MXX A;  5B4W A;  4DNV A;  2B5M A;  2PBI B;  5TEE A;  1VE7 A;  3IJ1 A;  3BG1 A;  3GC3 B;  2AQ5 A;  4LG9 A;  4OZU A;  5K1C C;  5SXM A;  2H9N A;  3T3M A;  3V5W B;  1A0R B;  3SN6 B;  4D0K A;  4Z7Q A;  3KCI A;  2I3T A;  4IA9 A;  4PSW B;  3SFZ A;  1GOF A;  3ORV D;  4J0W A;  4CZY A;  4O2W A;  2OVP B;  2IUQ A;  2I0S A;  3EI3 A;  1N6F A;  2G99 A;  2J57 G;  3O4G A;  4JHP C;  4AN1 A;  5IGQ A;  3DXK C;  3N0D A;  4Z7O A;  3EMH A;  2PM9 A;  3FCS A;  4FAN D;  2HJ4 A;  2YB8 B;  2VDP A;  3SWS D;  4U1E I;  4D9S A;  1L0Q A;  3QHY B;  4XEI C;  1JMX B;  5AJA A;  4N14 A;  3SHF A;  2I0R A;  2Z2N A;  2CNX A;  5FKR A;  3SVW D;  5EM2 A;  3IUJ A;  1TBG A;  1Q47 A;  2H13 A;  4RE5 A;  3RSE C;  3AFC A;  4MMZ A;  3IJ0 A;  1NEX B;  4O3T B;  3K71 A;  5M5U A;  1QFM A;  5AFU 3;  3O4H A;  4QT8 A;  3AL9 A;  5HYN B;  3EQ9 A;  4J87 A;  1U4C A;  3IUR A;  4GMB A;  4J86 A;  3PVW B;  1OLZ A;  3QI0 A;  2CO0 C;  3L4M D;  4GGA A;  2BKL A;  5H1M A;  4O45 A;  2AH1 A;  4J79 A;  3SBQ A;  4AOW A;  3I8E A;  4CY2 A;  4WJK A;  4H5J A;  4NC4 A;  3CIK B;  3NIG A;  4L3G D;  3I7O A;  4MK0 B;  4ZOX A;  1XIP A;  3T3P A;  2VDL A;  2HJB A;  5IGO A;  4E5Z B;  4J81 A;  4JHN A;  3RMZ D;  3RRM C;  1MG3 A;  2H9L A;  4L9O A;  4A08 B;  4BCD A;  1GXR A;  2CO0 A;  1H2W A;  4X61 B;  3BG0 A;  3NVQ A;  4RE6 A;  3IIY A;  1XKS A;  2EBS A;  4J0X A;  5HE1 B;  5THA A;  5GXI A;  2H9P A;  3I7P A;  1JTD B;  1OMW B;  3I8C A;  1C9L A;  1XHM A;  3PSL A;  2P9S C;  2GNQ A;  3FGB A;  5M61 A;  2B5N A;  3MVD K;  3A0F A;  2H3X A;  4NBM A;  3ZE0 A;  4A7J A;  2XL2 A;  3OW8 A;  1O6G A;  4AX4 A;  4FA5 D;  1E5T A;  4CY1 A;  4GM9 A;  3C99 A;  4FAV D;  1N6D A;  1PGU A;  4WK0 A;  5E6U A;  1GG2 B;  2AGZ A;  4JXM A;  4AEZ A;  3EQ8 A;  5TDH B;  4A08 A;  2XDW A;  4IMM A;  2MTA H;  4YVD A;  1MDA H;  4BH6 A;  4GGC A;  2CE8 A;  3F3G A;  1PEV A;  2CN3 A;  4L1M A;  4A11 B;  2AGL A;  4NEN A;  3IKO A;  1QFS A;  5C86 A;  4LGN A;  4G55 A;  2UZX B;  3C75 H;  5M5V A;  2BCJ B;  3E0C A;  3O4I A;  5EAL A;  2J55 H;  5HDB A;  4GM3 A;  5FQD A;  4GQ1 A;  3VGZ A;  3OKY B;  3DM0 A;  1H2Z A;  1SHY B;  5TF2 A;  2GC7 A;  3MUO A;  2HES X;  3MZL A;  4ERQ A;  1NR0 A;  3ODT A;  4I79 A;  4ERZ A;  4J8B A;  4X60 B;  3DXM C;  5IT9 g;  4QAM A;  2P9K C;  2H6Q A;  2YNN A;  3OKY A;  3K72 A;  4MMY A;  5IJ8 E;  2VZ3 A;  4DNW A;  2QZP A;  3K27 A;  2QR5 A;  4HDJ A;  3SJL D;  2AH0 A;  1JJU B;  5HQG A;  3JZH A;  2EIE A;  4JSN C;  4NSX A;  4CI1 A;  1GOG A;  1YR2 A;  1TYQ C;  3VA6 A;  2UZY B;  5FLX g;  4JT6 C;  3SBP A;  4ZOY A;  1L5G A;  3OL2 B;  3JZN A;  5CYK B;  4CY3 A;  3ZWL B;  1BPO A;  4DNU A;  2XL3 A;  4CI8 A;  2H68 A;  3IIW A;  4WK4 A;  4H5I A;  4PSX B;  1VZ3 A;  2HKR A;  4A2L A;  3C5M A;  3V7D B;  4GQB B;  3GD1 I;  3MMY A;  1VZ2 A;  3ZE2 A;  4J84 A;  3NID A;  4PBY A;  3UVN A;  1JV2 A;  3FM0 A;  3I89 A;  2AGW A;  5CXC A;  2OJY A;  2H47 A;  1VYH C;  2OK6 A;  2EIC A;  2JKX A;  2P9L C;  3IJE A;  3IUM A;  3KRX B;  5I5J A;  4NAA A;  5K19 A;  3FRX A;  2P9U C;  3PXT D;  4J78 A;  3VI3 A;  1VE6 A;  2OVR B;  4GZ8 A;  3RN1 D;  4FWW A;  4GGD A;  3IUQ A;  5EAP A;  4A0A A;  3SXT D;  2G9A A;  5M5S A;  4CZV A;  5KDO B;  4ESG A;  1R5M A;  2XE4 A;  1RI6 A;  2H9M A;  1B9X A;  1GOT B;  4QRJ A;  4J73 A;  5EML B;  2H6K A;  4UI9 R;  2H6N A;  3EQ7 A;  1C9I A;  1SQ9 A;  3RFG A;  3EI4 B;  4CZX A;  4AN0 A;  3PXW D;  4U7A A;  1E8N A;  4UM9 A;  4BUJ C;  3N0E A;  3NVN A;  5HE2 B;  5IJ7 E;  3EI4 A;  3DDU A;  3L4O D;  4Z7N A;  2O9K A;  5A2Q g;  4FHL A;  4JT5 C;  3P4F A;  2YNO A;  3JAM g;  5FKS A;  4K3I D;  1T2X A;  3UR4 A;  1B9Y A;  4XYH A;  4KFM B;  3AH8 B;  3NIF A;  4Y7R A;  3MUN A;  3OF7 A;  3SMR A;  3IUL A;  5M5T A;  3B7F A;  4GM8 A;  2QXV A;  2Z2O A;  2W18 A;  5C2V B;  5C9Z B;  3ZDX A;  2VDR A;  4ERY A;  4E54 A;  4LG8 A;  4A0B A;  4Y5R D;  4ZOZ A;  1O6F A;  2VDM A;  2HU5 A;  3PE7 A;  4CI3 A;  4L1Q D;  3EG6 A;  4FB1 D;  3CFV A;  4JSP C;  5C92 A;  3JZG A;  2WQ8 A;  2XYI A;  4O3U B;  5FKT A;  4D6V A;  2VDN A;  3AL8 B;  2EIB A;  3HFQ A;  3ZDZ A;  3EI1 A;  4OWR A;  4QL1 A;  5GMK n;  2P9P C;  3RFH A;  4UM8 A;  4G56 B;  5FFG A;  3NVX A;  3JRO A;  3KRW B;  2XZG A;  1MG2 A;  2HKM A;  4BP9 A;  1K32 A;  1A12 A;  2QC5 A;  4O02 A;  1GOH A;  2CN2 A;  2OIZ A;  3MKS B;  5CXB B;  3EI2 B;  2TRC B;  5AMS A;  2IAA A;  4JSX C;  2YBA A;  1TYE A;  1H2X A;  2IUR A;  4X3E A;  4A09 A;  2VDK A;  1ERJ A;  5CXB A;  2BBK H;  3MKQ A;  4PNK B;  4G1E A;  4K3J B;  4AMY A;  5HE3 B;  4ZOV A;  5E6S A;  4JSV C;  4Z8L A;  2YMU A;  5I5I A;  1P22 A;  3SLE D;  5H14 A;  5JWZ A;  3JRP A;  2P9N C;  2HU7 A;  4A2M A;  2VZ1 A;  2GC4 A;  4GQ2 P;  2OVQ B;  1S4U X;  3UVK A;  3K6S A;  1UOO A;  5EMJ B;  3F3P A;  3O4J A;  5M5R A;  4O1Q D;  3UVO A;  4EWR A;  3UKU C;  3W15 A;  3I7H A;  3I7K A;  1YFQ A;  4IRZ A;  1M1X A;  2EID A;  5IC7 A;  1U8C A;  3SBR A;  4CI2 A;  5C2W B;  3K26 A;  3IUN A;  1K8K C;  5EMM B;  3IVM A;  5EAR A;  2J56 H;  4ES0 A;  2Q7Q A;  5FXY A;  3JB9 L;  2CE9 A;  2HYE A;  3PSC B;  3BWS A;  2B4E A;  4PBZ A;  3OTT A;  4FA4 D;  3VI4 A;  2VDO A;  1N6E A;  5GSA A;  4PXW A;  1U2V C;  4J8G A;  2I3S A;  5H17 A;  3ULE C;  3J81 g;  3U4Y A;  4WK2 A;  1UOQ A;  3EI1 B;  4ZN4 A;  4BCB A;  4PC0 A;  5E6R A;  3AL8 A;  3F3F A;  4CC9 A;  4AMZ A;  4QQE A;  1PBY B;  1PI6 A;  3GRE A;  4BL0 A;  1K3I A;  2XU7 A;  3JPX A;  5GXH A;  4J77 A;  3EWE A;  1JMZ B; 
#chains in the Genus database with same CATH homology
 4FA1 D;  2B5L A;  3I7L A;  3DWL C;  3V9F A;  1QNI A;  2HXC A;  3PVU B;  3OKT A;  3I7N A;  4E54 B;  4TZ4 A;  4A0A B;  3UVM A;  4E5Z A;  2YNP A;  4J82 A;  4CY5 A;  2AGX A;  2H14 A;  5HE0 B;  3J80 g;  3I2N A;  3PXS D;  3EI2 A;  3VH0 A;  5CXC B;  3SCY A;  3DSM A;  5FA5 B;  2PM6 B;  1GP2 B;  2Z2P A;  2OK4 A;  4X63 B;  2P9I C;  2I0T A;  5I5M A;  2PM7 B;  2IUP A;  4L3H D;  3EU7 A;  3CFS B;  5EAM A;  1FWX A;  3MZK A;  3C9C A;  4JD2 C;  1SQJ A;  3OL2 A;  5EM2 B;  2AGY A;  2IWK A;  5EMK B;  4XYI A;  1JOF A;  5CYK A;  4O9D A;  4FA9 D;  3UVL A;  3GFC A;  3IJC A;  4A11 A;  4R7A B;  3RN0 D;  2PM9 B;  3UKR C;  2IUV A;  5FKQ A;  3RLM D;  4A0B B;  4A09 B;  2IWF A;  3OKW A;  5TEF A;  3EI3 B;  3MXX A;  5B4W A;  2B5M A;  2PBI B;  5TEE A;  3IJ1 A;  3BG1 A;  4LG9 A;  2AQ5 A;  4OZU A;  5K1C C;  5SXM A;  2H9N A;  3V5W B;  1A0R B;  3SN6 B;  4D0K A;  2I3T A;  4IA9 A;  4PSW B;  3SFZ A;  3ORV D;  4J0W A;  4CZY A;  2OVP B;  2IUQ A;  2I0S A;  3EI3 A;  1N6F A;  2G99 A;  2J57 G;  5IGQ A;  3DXK C;  3N0D A;  3EMH A;  2PM9 A;  4FAN D;  2HJ4 A;  2YB8 B;  3SWS D;  4U1E I;  1L0Q A;  4XEI C;  5AJA A;  1JMX B;  4N14 A;  3SHF A;  2I0R A;  2Z2N A;  2CNX A;  5FKR A;  3SVW D;  5EM2 A;  1TBG A;  3RSE C;  1Q47 A;  2H13 A;  3AFC A;  3IJ0 A;  1NEX B;  4O3T B;  5AFU 3;  4QT8 A;  3AL9 A;  5HYN B;  4J87 A;  1U4C A;  4GMB A;  4J86 A;  3PVW B;  1OLZ A;  2CO0 C;  3L4M D;  4GGA A;  5H1M A;  4O45 A;  2AH1 A;  4J79 A;  3SBQ A;  4AOW A;  3I8E A;  4CY2 A;  4H5J A;  3CIK B;  4L3G D;  3I7O A;  4MK0 B;  4ZOX A;  1XIP A;  2HJB A;  5IGO A;  4E5Z B;  4J81 A;  3RMZ D;  3RRM C;  1MG3 A;  2H9L A;  4L9O A;  4A08 B;  1GXR A;  2CO0 A;  4X61 B;  3BG0 A;  3NVQ A;  3IIY A;  1XKS A;  2EBS A;  4J0X A;  5HE1 B;  5THA A;  5GXI A;  2H9P A;  3I7P A;  1OMW B;  3I8C A;  1XHM A;  3PSL A;  2P9S C;  2GNQ A;  3FGB A;  2B5N A;  3A0F A;  2H3X A;  4A7J A;  2XL2 A;  3OW8 A;  4FA5 D;  4CY1 A;  4GM9 A;  3C99 A;  4FAV D;  1N6D A;  1PGU A;  1GG2 B;  2AGZ A;  4JXM A;  4AEZ A;  5TDH B;  4A08 A;  4IMM A;  2MTA H;  4YVD A;  1MDA H;  4BH6 A;  4GGC A;  2CE8 A;  3F3G A;  1PEV A;  2CN3 A;  4A11 B;  2AGL A;  3IKO A;  4LGN A;  2UZX B;  3C75 H;  2BCJ B;  3E0C A;  5EAL A;  2J55 H;  4GM3 A;  5FQD A;  4GQ1 A;  3VGZ A;  3OKY B;  3DM0 A;  1SHY B;  5TF2 A;  2GC7 A;  2HES X;  3MZL A;  4ERQ A;  1NR0 A;  3ODT A;  4I79 A;  4ERZ A;  4J8B A;  4X60 B;  3DXM C;  5IT9 g;  2P9K C;  2H6Q A;  2YNN A;  3OKY A;  5IJ8 E;  3K27 A;  4HDJ A;  3SJL D;  2AH0 A;  1JJU B;  5HQG A;  3JZH A;  4JSN C;  4NSX A;  4CI1 A;  3VA6 A;  1TYQ C;  2UZY B;  5FLX g;  4JT6 C;  3SBP A;  4ZOY A;  3OL2 B;  3JZN A;  5CYK B;  4CY3 A;  3ZWL B;  2XL3 A;  4CI8 A;  2H68 A;  3IIW A;  4H5I A;  4PSX B;  2HKR A;  4A2L A;  3C5M A;  3V7D B;  4GQB B;  3MMY A;  4J84 A;  4PBY A;  3UVN A;  3I89 A;  3FM0 A;  2AGW A;  5CXC A;  2OJY A;  2H47 A;  1VYH C;  2OK6 A;  2P9L C;  3KRX B;  5I5J A;  5K19 A;  3FRX A;  2P9U C;  3PXT D;  4J78 A;  2OVR B;  4GZ8 A;  3RN1 D;  4FWW A;  4GGD A;  5EAP A;  4A0A A;  3SXT D;  2G9A A;  4CZV A;  5KDO B;  4ESG A;  1R5M A;  1RI6 A;  2H9M A;  1B9X A;  1GOT B;  4QRJ A;  4J73 A;  5EML B;  2H6K A;  4UI9 R;  2H6N A;  1SQ9 A;  3RFG A;  3EI4 B;  4CZX A;  3PXW D;  4U7A A;  4BUJ C;  3N0E A;  3NVN A;  5HE2 B;  5IJ7 E;  3EI4 A;  3L4O D;  2O9K A;  5A2Q g;  4FHL A;  4JT5 C;  3P4F A;  2YNO A;  3JAM g;  5FKS A;  4K3I D;  3UR4 A;  1B9Y A;  4XYH A;  4KFM B;  3AH8 B;  4Y7R A;  3SMR A;  3B7F A;  4GM8 A;  2QXV A;  2Z2O A;  2W18 A;  5C2V B;  5C9Z B;  4ERY A;  4E54 A;  4LG8 A;  4A0B A;  4Y5R D;  4ZOZ A;  3PE7 A;  4CI3 A;  4L1Q D;  3EG6 A;  4FB1 D;  3CFV A;  4JSP C;  3JZG A;  2XYI A;  4O3U B;  5FKT A;  4D6V A;  3AL8 B;  3HFQ A;  3EI1 A;  4OWR A;  4QL1 A;  5GMK n;  2P9P C;  3RFH A;  4G56 B;  3NVX A;  3JRO A;  3KRW B;  1MG2 A;  2HKM A;  1K32 A;  2QC5 A;  2CN2 A;  2OIZ A;  3MKS B;  5CXB B;  3EI2 B;  2TRC B;  5AMS A;  2IAA A;  4JSX C;  2YBA A;  2IUR A;  4A09 A;  4X3E A;  1ERJ A;  5CXB A;  2BBK H;  3MKQ A;  4PNK B;  4K3J B;  5HE3 B;  4ZOV A;  4JSV C;  4Z8L A;  2YMU A;  5I5I A;  1P22 A;  3SLE D;  5H14 A;  5JWZ A;  3JRP A;  2P9N C;  4A2M A;  2GC4 A;  4GQ2 P;  2OVQ B;  1S4U X;  3UVK A;  5EMJ B;  3F3P A;  4O1Q D;  3UVO A;  4EWR A;  3UKU C;  3W15 A;  3I7H A;  3I7K A;  1YFQ A;  5IC7 A;  4CI2 A;  3SBR A;  5C2W B;  3K26 A;  1K8K C;  5EMM B;  5EAR A;  2J56 H;  4ES0 A;  2Q7Q A;  5FXY A;  3JB9 L;  2CE9 A;  2HYE A;  3PSC B;  3BWS A;  2B4E A;  4PBZ A;  3OTT A;  4FA4 D;  1N6E A;  5GSA A;  4PXW A;  1U2V C;  4J8G A;  2I3S A;  5H17 A;  3ULE C;  3J81 g;  3U4Y A;  3EI1 B;  4ZN4 A;  4PC0 A;  3AL8 A;  3F3F A;  4CC9 A;  4QQE A;  1PBY B;  1PI6 A;  3GRE A;  4BL0 A;  2XU7 A;  3JPX A;  5GXH A;  4J77 A;  3EWE A;  1JMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...