3CFVA

Structural basis of the interaction of rbap46/rbap48 with histone h4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
411
structure length
390
Chain Sequence
MAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histone/chaperone
molecule keywords Histone-binding protein RBBP7
publication title Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 390
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3cfvA00
2GNQA 2H6NA 3I7PA 2CE8A 3RN1D 5GXHA 1L0QA 1QNIA 3VA6A 3UKUC 4J82A 3P4FA 3ODTA 3EI1A 5HE0B 4ERYA 2HESX 3SBQA 2IURA 2P9IC 3OKTA 3N0EA 2I3SA 5SXMA 3JRPA 1SHYB 3AH8B 4A08B 4BH6A 4ZOVA 2Q7QA 2YNOA 4QRJA 4JSVC 2H9MA 3EU7A 2Z2NA 3FGBA 3JPXA 4J0WA 3IJ1A 4E54B 4PBYA 4BL0A 1K8KC 2QXVA 2Z2PA 4QL1A 4O1QD 3W15A 4JSXC 4FA5D 4O9DA 4FB1D 3I89A 4GQBB 3I7NA 4FA9D 2P9PC 4J77A 1SQJA 3OW8A 4A11A 3SVWD 1MDAH 2CO0C 1JMXB 1U4CA 3C75H 3U4YA 2H47A 2BBKH 3BWSA 2I0TA 1PGUA 4H5IA 5EMLB 5H1MA 5GSAA 3ULEC 5C2VB 5EM2A 3B7FA 4O3TB 3V5WB 2H6QA 2XL3A 3JAMg 1N6FA 5HE2B 2AQ5A 3JROA 5IC7A 3KRXB 2H9NA 3JZHA 3ZWLB 4ZOYA 2IWKA 4D6VA 4Y7RA 2P9LC 4CY2A 3L4OD 4CY1A 3F3FA 3PSLA 5FXYA 3MMYA 1XKSA 2HKRA 3I7OA 4Z8LA 3VH0A 5IJ7E 5FA5B 2AH0A 3SBPA 5TEFA 2CN2A 4K3JB 5IGQA 5FQDA 4GM3A 4GMBA 2AGYA 2XYIA 1JJUB 1U2VC 2J55H 3DXMC 2UZXB 2P9NC 3JZGA 5AMSA 4X3EA 4NSXA 4OWRA 4A09A 3EWEA 4XEIC 4XYIA 1NR0A 4AEZA 1S4UX 3MKSB 5CYKB 5K1CC 2H14A 2PM9A 5AFU3 4J73A 4ZOXA 2OIZA 3OL2B 2AGWA 4A0BA 5CYKA 4ZOZA 4JT6C 3EI1B 1MG2A 3L4MD 3OL2A 5FKTA 5EAMA 2YMUA 3DWLC 3MZLA 4J0XA 3IJ0A 4X60B 3SJLD 2OVRB 3FRXA 3PSCB 5EMMB 2HYEA 4IA9A 5B4WA 3SHFA 3HFQA 4JSPC 1SQ9A 4A0AA 3ORVD 4XYHA 2PM7B 3RRMC 4YVDA 3JZNA 3SFZA 5K19A 2P9UC 3K27A 2EBSA 2I0SA 3MZKA 3UVOA 4FA4D 3AFCA 4J79A 2HJ4A 3PE7A 4E5ZA 3EI2B 2CO0A 3PVUB 2OVQB 3JB9L 4PSWB 4GGDA 3NVXA 1PEVA 3UVKA 4ESGA 5FLXg 4GQ1A 3EI2A 5AJAA 2IUVA 3I8EA 3I8CA 3N0DA 3EI4A 2HJBA 3UVNA 2CN3A 4A11B 2I0RA 5EMKB 4J86A 4FHLA 5EM2B 3SN6B 3I2NA 3RLMD 3V7DB 4CZVA 3DXKC 4J8GA 2QC5A 2BCJB 3CFSB 5HE1B 1PBYB 2OJYA 3K26A 4JD2C 3RFHA 3PVWB 1YFQA 2IUQA 4J8BA 4AOWA 1ERJA 2Z2OA 5FKSA 4J78A 3RN0D 3I7LA 5CXCA 1RI6A 4CZYA 5HYNB 3EMHA 3OTTA 2UZYB 3KRWB 5EAPA 1B9YA 2TRCB 2OK4A 3AL8A 2XL2A 2P9KC 4A09B 1TBGA 4CI3A 2AGXA 3DM0A 3I7HA 3DSMA 4LG8A 4J87A 3AL9A 2PM9B 2H9LA 4ES0A 2B5LA 3PXWD 2IUPA 2PBIB 3FM0A 4OZUA 4A0BB 4GGCA 3MKQA 5IJ8E 4PXWA 1GG2B 5H17A 4GGAA 5CXBB 2J57G 4TZ4A 2H68A 4A2LA 2AH1A 4ERQA 1K32A 2HXCA 1N6EA 5CXBA 5KDOB 1B9XA 3RFGA 1TYQC 4EWRA 2J56H 1R5MA 2B5NA 5A2Qg 3J81g 4A0AB 3V9FA 2CE9A 3VGZA 4L9OA 2IAAA 2P9SC 2H13A 4CY3A 3EI3A 2I3TA 4QT8A 4X63B 4LGNA 5HQGA 4FAND 4HDJA 4E5ZB 2G99A 4GZ8A 4FA1D 4I79A 4PNKB 1XHMA 2HKMA 3MXXA 1GOTB 3C5MA 4QQEA 1JOFA 4U1EI 3C99A 4FWWA 3EI4B 3NVQA 5GXIA 4JSNC 5C2WB 1OLZA 2O9KA 3IJCA 1NEXB 5H14A 2PM6B 3CFVA 4A08A 4BUJC 5THAA 4CY5A 3SMRA 2YB8B 5EARA 1Q47A 4PSXB 3RMZD 5HE3B 3SXTD 4JT5C 4H5JA 4A2MA 4CI8A 3UKRC 1MG3A 4GQ2P 2CNXA 2XU7A 4E54A 3J80g 2OVPB 2AGLA 5IGOA 4CI1A 3E0CA 2GC4A 5CXCB 2B4EA 3A0FA 2H6KA 3BG0A 5GMKn 2GC7A 4MK0B 4UI9R 2H9PA 4L3HD 4KFMB 4N14A 4O45A 3UVMA 3BG1A 3F3GA 3C9CA 4JXMA 4PC0A 4CC9A 4PBZA 1XIPA 5FKRA 3AL8B 5FKQA 1N6DA 3PXTD 1A0RB 1PI6A 4G56B 3CIKB 4O3UB 5TEEA 2H3XA 3IIWA 4J81A 2YNNA 3SCYA 4FAVD 2MTAH 3F3PA 3UR4A 5EMJB 4ZN4A 5C9ZB 4L3GD 3SLED 2G9AA 4K3ID 3SWSD 3I7KA 4D0KA 2W18A 1GXRA 2AGZA 3NVNA 5EALA 5I5IA 2IWFA 3GREA 2B5MA 3OKWA 5I5JA 5TDHB 4CZXA 3EG6A 3OKYB 3UVLA 4Y5RD 4J84A 4IMMA 4L1QD 4ERZA 5JWZA 4X61B 1FWXA 4U7AA 3PXSD 3OKYA 1P22A 5I5MA 4R7AB 5IT9g 4GM8A 3SBRA 2YBAA 4A7JA 4GM9A 2OK6A 4CI2A 3IIYA 3IKOA 1JMZB 1OMWB 4LG9A 2YNPA 3GFCA 5TF2A 1VYHC 3RSEC 3EI3B 1GP2B
chains in the Genus database with same CATH superfamily
2GNQA 2H6NA 3I7PA 3K72A 3QI0A 2CE8A 3RN1D 1E8MA 1UOQA 5GXHA 1L0QA 1QNIA 3VA6A 3UKUC 4J82A 3P4FA 3ODTA 3EI1A 4BP8A 3MUOA 5HE0B 4ERYA 4DNVA 2HESX 3SBQA 1QFSA 4G1EA 2IURA 2P9IC 3OKTA 3N0EA 2HU7A 2I3SA 5SXMA 3JRPA 4BCCA 1SHYB 3AH8B 4A08B 2EIEA 4BH6A 4ZOVA 2Q7QA 2YNOA 5C92A 2QR5A 4QRJA 4JSVC 4AN0A 2H9MA 4AN1A 3EU7A 2Z2NA 3FGBA 1H2WA 3JPXA 4J0WA 3IJ1A 4E54B 4PBYA 4BL0A 1K8KC 3IUMA 2QXVA 2Z2PA 4QL1A 4O1QD 5E6UA 3W15A 4JSXC 4FA5D 4O9DA 4FB1D 3I89A 4GQBB 3I7NA 3O4HA 4FA9D 2P9PC 4J77A 1SQJA 3OW8A 4A11A 3SVWD 4D9SA 1GOGA 1MDAH 2VDKA 2CO0C 4G55A 1JMXB 1U4CA 3C75H 3U4YA 2H47A 2BBKH 3BWSA 2I0TA 1PGUA 4H5IA 5EMLB 5H1MA 3T3MA 5GSAA 3ULEC 5C2VB 1U8CA 1E5TA 5EM2A 2QZPA 3B7FA 1JV2A 2VZ1A 4O3TB 3V5WB 2H6QA 2XL3A 3JAMg 1N6FA 5HE2B 2AQ5A 4DNUA 3ZE1A 4L1MA 3JROA 5IC7A 3EQ7A 1K3IA 2JKXA 3KRXB 2H9NA 3JZHA 3ZWLB 4ZOYA 2IWKA 1VZ2A 4D6VA 4Y7RA 2P9LC 3GD1I 4CY2A 3L4OD 4AX4A 4CY1A 4DNWA 3F3FA 3PSLA 5FXYA 3MMYA 1XKSA 5FFOA 2HKRA 3I7OA 2XE4A 5HDBA 4Z8LA 3VH0A 5IJ7E 5FA5B 2AH0A 4IRZA 3VI3A 3SBPA 2EICA 3ZDYA 5TEFA 2CN2A 4K3JB 4WK2A 5IGQA 5FQDA 4GM3A 4UM9A 4GMBA 2AGYA 2XYIA 3O4GA 1JJUB 4O02A 4BCBA 1U2VC 2J55H 3DXMC 2UZXB 2P9NC 1YR2A 3JZGA 5AMSA 2VZ3A 4X3EA 4NSXA 4OWRA 4A09A 3EWEA 4XEIC 4XYIA 1NR0A 4WK0A 4AEZA 1S4UX 3MKSB 3V4VA 4UM8A 5CYKB 5K1CC 2H14A 2VC2A 2PM9A 5AFU3 4J73A 4ZOXA 2OIZA 3OL2B 2AGWA 4A0BA 5CYKA 4ZOZA 4JT6C 3EI1B 1MG2A 3L4MD 3OL2A 1GOHA 5FKTA 5EAMA 2EIBA 2YMUA 3DWLC 3MZLA 4J0XA 3IJ0A 4X60B 3SJLD 2OVRB 3FRXA 3PSCB 5EMMB 2HYEA 3NIDA 3V4PA 4IA9A 3ZDXA 3IVMA 3IUNA 5E6SA 5B4WA 3SHFA 2XDWA 3HFQA 4JSPC 1SQ9A 4A0AA 3ORVD 3OF7A 4XYHA 2PM7B 3RRMC 4YVDA 3JZNA 3SFZA 3IUQA 5K19A 4AMZA 4Z7OA 2P9UC 3K27A 2EBSA 2I0SA 3MZKA 3UVOA 4FA4D 3AFCA 4J79A 2HJ4A 3PE7A 2HU8A 4E5ZA 3EI2B 2CO0A 5M5UA 3PVUB 2OVQB 3JB9L 4PSWB 4GGDA 3NVXA 3KCIA 1PEVA 4RE5A 3UVKA 4ESGA 5FLXg 4GQ1A 3EI2A 1UOOA 5AJAA 2IUVA 3I8EA 3I8CA 3N0DA 2VDNA 3EI4A 3MVDK 2HJBA 3UVNA 2CN3A 5M5TA 4A11B 1H2YA 2I0RA 4MMYA 1UTCA 5M5SA 1QFMA 5EMKB 4J86A 4FHLA 5EM2B 1GOFA 3SN6B 4NBMA 3I2NA 3RLMD 3V7DB 4CZVA 3DXKC 4J8GA 2QC5A 1T2XA 2BCJB 3CFSB 5HE1B 1PBYB 2OJYA 3K26A 4JD2C 3RFHA 3PVWB 1YFQA 4JHPC 2IUQA 4NAAA 4J8BA 4AOWA 1ERJA 2Z2OA 5FKSA 4J78A 3RN0D 3I7LA 5CXCA 1TYEA 1RI6A 3MUNA 4CZYA 4AMYA 4QAMA 5HYNB 3EMHA 3OTTA 2UZYB 3KRWB 5EAPA 2VDMA 1B9YA 4MMXA 3VI4A 2TRCB 1H2ZA 2EIDA 2OK4A 3AL8A 2VDRA 1C9LA 2BKLA 2XZGA 2XL2A 2P9KC 4A09B 1TBGA 4CI3A 2AGXA 5C86A 3DM0A 3I7HA 3DSMA 4LG8A 4J87A 3AL9A 2PM9B 2H9LA 4ES0A 2B5LA 3PXWD 5M5VA 3ZDZA 2IUPA 2PBIB 3FM0A 4OZUA 1C9IA 4NC4A 5M5RA 4A0BB 4GGCA 3MKQA 5IJ8E 4PXWA 1GG2B 5H17A 4GGAA 5CXBB 4WJKA 2J57G 4TZ4A 3ZE2A 2H68A 4G1MA 4A2LA 4WK4A 2AH1A 4ERQA 1K32A 3ZE0A 4O2WA 2HXCA 1N6EA 5CXBA 5KDOB 1B9XA 3RFGA 1TYQC 1H2XA 4EWRA 2J56H 1R5MA 2B5NA 5A2Qg 3J81g 4A0AB 3V9FA 2CE9A 4Z7NA 3EQ8A 3NIGA 3VGZA 4L9OA 3IUJA 2IAAA 2P9SC 2H13A 4CY3A 3EI3A 3O4JA 2I3TA 4QT8A 4X63B 4LGNA 5HQGA 1E8NA 1L5GA 4FAND 4HDJA 4E5ZB 2G99A 4GZ8A 4FA1D 1VE7A 3K6SA 4I79A 4PNKB 1XHMA 4BP9A 3MXXA 2HKMA 1GOTB 3C5MA 4QQEA 2VDLA 3FCUA 1JOFA 4U1EI 3C99A 3EI4B 3NVQA 4FWWA 5GXIA 2WQ8A 4JSNC 5C2WB 1OLZA 2O9KA 3IJCA 2VDQA 1NEXB 2HU5A 4JHNA 5H14A 2PM6B 3CFVA 3QHYB 5FFGA 4A08A 4BUJC 3FCSA 5THAA 4CY5A 3SMRA 1VZ3A 2YB8B 5EARA 1Q47A 4PSXB 3RMZD 5HE3B 3SXTD 4JT5C 3DDUA 4H5JA 4A2MA 4CI8A 3T3PA 3UKRC 1MG3A 4GQ2P 1JTDB 2CNXA 1O6FA 2XU7A 4RE6A 4E54A 3IULA 3J80g 2OVPB 2AGLA 5IGOA 4CI1A 3NIFA 5M61A 3E0CA 2GC4A 5CXCB 2B4EA 4BCDA 3A0FA 3K71A 2H6KA 3BG0A 5GMKn 2GC7A 4MK0B 4UI9R 2H9PA 4L3HD 4KFMB 4N14A 4O45A 3UVMA 3BG1A 1I2MB 3F3GA 3C9CA 4JXMA 1A12A 4PC0A 4CC9A 4PBZA 1XIPA 5FKRA 3AL8B 5FKQA 1N6DA 3IURA 3PXTD 1A0RB 1PI6A 3GC3B 1BPOA 1VE6A 4G56B 3CIKB 4O3UB 5TEEA 2H3XA 3IIWA 4J81A 2YNNA 3SCYA 4FAVD 2MTAH 3F3PA 3IJEA 1O6GA 3UR4A 5EMJB 4ZN4A 5C9ZB 4L3GD 3SLED 2G9AA 2VDOA 4K3ID 3SWSD 3EQ9A 3I7KA 4D0KA 1M1XA 2W18A 1GXRA 2AGZA 3NVNA 5EALA 5I5IA 2IWFA 1UOPA 3GREA 2B5MA 3OKWA 4Z7QA 5I5JA 4MMZA 5TDHB 4CZXA 3EG6A 3OKYB 3UVLA 4Y5RD 4J84A 4IMMA 4L1QD 4ERZA 5JWZA 4X61B 5E6RA 1FWXA 4U7AA 3PXSD 3OKYA 1P22A 5I5MA 4R7AB 5IT9g 3O4IA 4GM8A 3SBRA 2YBAA 4A7JA 4GM9A 2OK6A 4CI2A 3IIYA 3IKOA 1JMZB 1OMWB 2VDPA 2YNPA 3GFCA 4LG9A 5TF2A 1VYHC 3RSEC 3EI3B 1GP2B 4NENA
chains in the Genus database with same CATH topology
2GNQA 2H6NA 3I7PA 2CE8A 3RN1D 5GXHA 1L0QA 1QNIA 3VA6A 3UKUC 4J82A 3P4FA 3ODTA 3EI1A 5HE0B 4ERYA 2HESX 3SBQA 2IURA 2P9IC 3OKTA 3N0EA 2I3SA 5SXMA 3JRPA 1SHYB 3AH8B 4A08B 4BH6A 4ZOVA 2Q7QA 2YNOA 4QRJA 4JSVC 2H9MA 3EU7A 2Z2NA 3FGBA 3JPXA 4J0WA 3IJ1A 4E54B 4PBYA 4BL0A 1K8KC 2QXVA 2Z2PA 4QL1A 4O1QD 3W15A 4JSXC 4FA5D 4O9DA 4FB1D 3I89A 4GQBB 3I7NA 4FA9D 2P9PC 4J77A 1SQJA 3OW8A 4A11A 3SVWD 1MDAH 2CO0C 1JMXB 1U4CA 3C75H 3U4YA 2H47A 2BBKH 3BWSA 2I0TA 1PGUA 4H5IA 5EMLB 5H1MA 5GSAA 3ULEC 5C2VB 5EM2A 3B7FA 4O3TB 3V5WB 2H6QA 2XL3A 3JAMg 1N6FA 5HE2B 2AQ5A 3JROA 5IC7A 3KRXB 2H9NA 3JZHA 3ZWLB 4ZOYA 2IWKA 4D6VA 4Y7RA 2P9LC 4CY2A 3L4OD 4CY1A 3F3FA 3PSLA 5FXYA 3MMYA 1XKSA 2HKRA 3I7OA 4Z8LA 3VH0A 5IJ7E 5FA5B 2AH0A 3SBPA 5TEFA 2CN2A 4K3JB 5IGQA 5FQDA 4GM3A 4GMBA 2AGYA 2XYIA 1JJUB 1U2VC 2J55H 3DXMC 2UZXB 2P9NC 3JZGA 5AMSA 4X3EA 4NSXA 4OWRA 4A09A 3EWEA 4XEIC 4XYIA 1NR0A 4AEZA 1S4UX 3MKSB 5CYKB 5K1CC 2H14A 2PM9A 5AFU3 4J73A 4ZOXA 2OIZA 3OL2B 2AGWA 4A0BA 5CYKA 4ZOZA 4JT6C 3EI1B 1MG2A 3L4MD 3OL2A 5FKTA 5EAMA 2YMUA 3DWLC 3MZLA 4J0XA 3IJ0A 4X60B 3SJLD 2OVRB 3FRXA 3PSCB 5EMMB 2HYEA 4IA9A 5B4WA 3SHFA 3HFQA 4JSPC 1SQ9A 4A0AA 3ORVD 4XYHA 2PM7B 3RRMC 4YVDA 3JZNA 3SFZA 5K19A 2P9UC 3K27A 2EBSA 2I0SA 3MZKA 3UVOA 4FA4D 3AFCA 4J79A 2HJ4A 3PE7A 4E5ZA 3EI2B 2CO0A 3PVUB 2OVQB 3JB9L 4PSWB 4GGDA 3NVXA 1PEVA 3UVKA 4ESGA 5FLXg 4GQ1A 3EI2A 5AJAA 2IUVA 3I8EA 3I8CA 3N0DA 3EI4A 2HJBA 3UVNA 2CN3A 4A11B 2I0RA 5EMKB 4J86A 4FHLA 5EM2B 3SN6B 3I2NA 3RLMD 3V7DB 4CZVA 3DXKC 4J8GA 2QC5A 2BCJB 3CFSB 5HE1B 1PBYB 2OJYA 3K26A 4JD2C 3RFHA 3PVWB 1YFQA 2IUQA 4J8BA 4AOWA 1ERJA 2Z2OA 5FKSA 4J78A 3RN0D 3I7LA 5CXCA 1RI6A 4CZYA 5HYNB 3EMHA 3OTTA 2UZYB 3KRWB 5EAPA 1B9YA 2TRCB 2OK4A 3AL8A 2XL2A 2P9KC 4A09B 1TBGA 4CI3A 2AGXA 3DM0A 3I7HA 3DSMA 4LG8A 4J87A 3AL9A 2PM9B 2H9LA 4ES0A 2B5LA 3PXWD 2IUPA 2PBIB 3FM0A 4OZUA 4A0BB 4GGCA 3MKQA 5IJ8E 4PXWA 1GG2B 5H17A 4GGAA 5CXBB 2J57G 4TZ4A 2H68A 4A2LA 2AH1A 4ERQA 1K32A 2HXCA 1N6EA 5CXBA 5KDOB 1B9XA 3RFGA 1TYQC 4EWRA 2J56H 1R5MA 2B5NA 5A2Qg 3J81g 4A0AB 3V9FA 2CE9A 3VGZA 4L9OA 2IAAA 2P9SC 2H13A 4CY3A 3EI3A 2I3TA 4QT8A 4X63B 4LGNA 5HQGA 4FAND 4HDJA 4E5ZB 2G99A 4GZ8A 4FA1D 4I79A 4PNKB 1XHMA 2HKMA 3MXXA 1GOTB 3C5MA 4QQEA 1JOFA 4U1EI 3C99A 4FWWA 3EI4B 3NVQA 5GXIA 4JSNC 5C2WB 1OLZA 2O9KA 3IJCA 1NEXB 5H14A 2PM6B 3CFVA 4A08A 4BUJC 5THAA 4CY5A 3SMRA 2YB8B 5EARA 1Q47A 4PSXB 3RMZD 5HE3B 3SXTD 4JT5C 4H5JA 4A2MA 4CI8A 3UKRC 1MG3A 4GQ2P 2CNXA 2XU7A 4E54A 3J80g 2OVPB 2AGLA 5IGOA 4CI1A 3E0CA 2GC4A 5CXCB 2B4EA 3A0FA 2H6KA 3BG0A 5GMKn 2GC7A 4MK0B 4UI9R 2H9PA 4L3HD 4KFMB 4N14A 4O45A 3UVMA 3BG1A 3F3GA 3C9CA 4JXMA 4PC0A 4CC9A 4PBZA 1XIPA 5FKRA 3AL8B 5FKQA 1N6DA 3PXTD 1A0RB 1PI6A 4G56B 3CIKB 4O3UB 5TEEA 2H3XA 3IIWA 4J81A 2YNNA 3SCYA 4FAVD 2MTAH 3F3PA 3UR4A 5EMJB 4ZN4A 5C9ZB 4L3GD 3SLED 2G9AA 4K3ID 3SWSD 3I7KA 4D0KA 2W18A 1GXRA 2AGZA 3NVNA 5EALA 5I5IA 2IWFA 3GREA 2B5MA 3OKWA 5I5JA 5TDHB 4CZXA 3EG6A 3OKYB 3UVLA 4Y5RD 4J84A 4IMMA 4L1QD 4ERZA 5JWZA 4X61B 1FWXA 4U7AA 3PXSD 3OKYA 1P22A 5I5MA 4R7AB 5IT9g 4GM8A 3SBRA 2YBAA 4A7JA 4GM9A 2OK6A 4CI2A 3IIYA 3IKOA 1JMZB 1OMWB 4LG9A 2YNPA 3GFCA 5TF2A 1VYHC 3RSEC 3EI3B 1GP2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GNQ A;  2H6N A;  3I7P A;  2CE8 A;  3RN1 D;  5GXH A;  1L0Q A;  1QNI A;  3VA6 A;  3UKU C;  4J82 A;  3P4F A;  3ODT A;  3EI1 A;  5HE0 B;  4ERY A;  2HES X;  3SBQ A;  2IUR A;  2P9I C;  3OKT A;  3N0E A;  2I3S A;  5SXM A;  3JRP A;  1SHY B;  3AH8 B;  4A08 B;  4BH6 A;  4ZOV A;  2Q7Q A;  2YNO A;  4QRJ A;  4JSV C;  2H9M A;  3EU7 A;  2Z2N A;  3FGB A;  3JPX A;  4J0W A;  3IJ1 A;  4E54 B;  4PBY A;  4BL0 A;  1K8K C;  2QXV A;  2Z2P A;  4QL1 A;  4O1Q D;  3W15 A;  4JSX C;  4FA5 D;  4O9D A;  4FB1 D;  3I89 A;  4GQB B;  3I7N A;  4FA9 D;  2P9P C;  4J77 A;  1SQJ A;  3OW8 A;  4A11 A;  3SVW D;  1MDA H;  2CO0 C;  1JMX B;  1U4C A;  3C75 H;  3U4Y A;  2H47 A;  2BBK H;  3BWS A;  2I0T A;  1PGU A;  4H5I A;  5EML B;  5H1M A;  5GSA A;  3ULE C;  5C2V B;  5EM2 A;  3B7F A;  4O3T B;  3V5W B;  2H6Q A;  2XL3 A;  3JAM g;  1N6F A;  5HE2 B;  2AQ5 A;  3JRO A;  5IC7 A;  3KRX B;  2H9N A;  3JZH A;  3ZWL B;  4ZOY A;  2IWK A;  4D6V A;  4Y7R A;  2P9L C;  4CY2 A;  3L4O D;  4CY1 A;  3F3F A;  3PSL A;  5FXY A;  3MMY A;  1XKS A;  2HKR A;  3I7O A;  4Z8L A;  3VH0 A;  5IJ7 E;  5FA5 B;  2AH0 A;  3SBP A;  5TEF A;  2CN2 A;  4K3J B;  5IGQ A;  5FQD A;  4GM3 A;  4GMB A;  2AGY A;  2XYI A;  1JJU B;  1U2V C;  2J55 H;  3DXM C;  2UZX B;  2P9N C;  3JZG A;  5AMS A;  4X3E A;  4NSX A;  4OWR A;  4A09 A;  3EWE A;  4XEI C;  4XYI A;  1NR0 A;  4AEZ A;  1S4U X;  3MKS B;  5CYK B;  5K1C C;  2H14 A;  2PM9 A;  5AFU 3;  4J73 A;  4ZOX A;  2OIZ A;  3OL2 B;  2AGW A;  4A0B A;  5CYK A;  4ZOZ A;  4JT6 C;  3EI1 B;  1MG2 A;  3L4M D;  3OL2 A;  5FKT A;  5EAM A;  2YMU A;  3DWL C;  3MZL A;  4J0X A;  3IJ0 A;  4X60 B;  3SJL D;  2OVR B;  3FRX A;  3PSC B;  5EMM B;  2HYE A;  4IA9 A;  5B4W A;  3SHF A;  3HFQ A;  4JSP C;  1SQ9 A;  4A0A A;  3ORV D;  4XYH A;  2PM7 B;  3RRM C;  4YVD A;  3JZN A;  3SFZ A;  5K19 A;  2P9U C;  3K27 A;  2EBS A;  2I0S A;  3MZK A;  3UVO A;  4FA4 D;  3AFC A;  4J79 A;  2HJ4 A;  3PE7 A;  4E5Z A;  3EI2 B;  2CO0 A;  3PVU B;  2OVQ B;  3JB9 L;  4PSW B;  4GGD A;  3NVX A;  1PEV A;  3UVK A;  4ESG A;  5FLX g;  4GQ1 A;  3EI2 A;  5AJA A;  2IUV A;  3I8E A;  3I8C A;  3N0D A;  3EI4 A;  2HJB A;  3UVN A;  2CN3 A;  4A11 B;  2I0R A;  5EMK B;  4J86 A;  4FHL A;  5EM2 B;  3SN6 B;  3I2N A;  3RLM D;  3V7D B;  4CZV A;  3DXK C;  4J8G A;  2QC5 A;  2BCJ B;  3CFS B;  5HE1 B;  1PBY B;  2OJY A;  3K26 A;  4JD2 C;  3RFH A;  3PVW B;  1YFQ A;  2IUQ A;  4J8B A;  4AOW A;  1ERJ A;  2Z2O A;  5FKS A;  4J78 A;  3RN0 D;  3I7L A;  5CXC A;  1RI6 A;  4CZY A;  5HYN B;  3EMH A;  3OTT A;  2UZY B;  3KRW B;  5EAP A;  1B9Y A;  2TRC B;  2OK4 A;  3AL8 A;  2XL2 A;  2P9K C;  4A09 B;  1TBG A;  4CI3 A;  2AGX A;  3DM0 A;  3I7H A;  3DSM A;  4LG8 A;  4J87 A;  3AL9 A;  2PM9 B;  2H9L A;  4ES0 A;  2B5L A;  3PXW D;  2IUP A;  2PBI B;  3FM0 A;  4OZU A;  4A0B B;  4GGC A;  3MKQ A;  5IJ8 E;  4PXW A;  1GG2 B;  5H17 A;  4GGA A;  5CXB B;  2J57 G;  4TZ4 A;  2H68 A;  4A2L A;  2AH1 A;  4ERQ A;  1K32 A;  2HXC A;  1N6E A;  5CXB A;  5KDO B;  1B9X A;  3RFG A;  1TYQ C;  4EWR A;  2J56 H;  1R5M A;  2B5N A;  5A2Q g;  3J81 g;  4A0A B;  3V9F A;  2CE9 A;  3VGZ A;  4L9O A;  2IAA A;  2P9S C;  2H13 A;  4CY3 A;  3EI3 A;  2I3T A;  4QT8 A;  4X63 B;  4LGN A;  5HQG A;  4FAN D;  4HDJ A;  4E5Z B;  2G99 A;  4GZ8 A;  4FA1 D;  4I79 A;  4PNK B;  1XHM A;  2HKM A;  3MXX A;  1GOT B;  3C5M A;  4QQE A;  1JOF A;  4U1E I;  3C99 A;  4FWW A;  3EI4 B;  3NVQ A;  5GXI A;  4JSN C;  5C2W B;  1OLZ A;  2O9K A;  3IJC A;  1NEX B;  5H14 A;  2PM6 B;  3CFV A;  4A08 A;  4BUJ C;  5THA A;  4CY5 A;  3SMR A;  2YB8 B;  5EAR A;  1Q47 A;  4PSX B;  3RMZ D;  5HE3 B;  3SXT D;  4JT5 C;  4H5J A;  4A2M A;  4CI8 A;  3UKR C;  1MG3 A;  4GQ2 P;  2CNX A;  2XU7 A;  4E54 A;  3J80 g;  2OVP B;  2AGL A;  5IGO A;  4CI1 A;  3E0C A;  2GC4 A;  5CXC B;  2B4E A;  3A0F A;  2H6K A;  3BG0 A;  5GMK n;  2GC7 A;  4MK0 B;  4UI9 R;  2H9P A;  4L3H D;  4KFM B;  4N14 A;  4O45 A;  3UVM A;  3BG1 A;  3F3G A;  3C9C A;  4JXM A;  4PC0 A;  4CC9 A;  4PBZ A;  1XIP A;  5FKR A;  3AL8 B;  5FKQ A;  1N6D A;  3PXT D;  1A0R B;  1PI6 A;  4G56 B;  3CIK B;  4O3U B;  5TEE A;  2H3X A;  3IIW A;  4J81 A;  2YNN A;  3SCY A;  4FAV D;  2MTA H;  3F3P A;  3UR4 A;  5EMJ B;  4ZN4 A;  5C9Z B;  4L3G D;  3SLE D;  2G9A A;  4K3I D;  3SWS D;  3I7K A;  4D0K A;  2W18 A;  1GXR A;  2AGZ A;  3NVN A;  5EAL A;  5I5I A;  2IWF A;  3GRE A;  2B5M A;  3OKW A;  5I5J A;  5TDH B;  4CZX A;  3EG6 A;  3OKY B;  3UVL A;  4Y5R D;  4J84 A;  4IMM A;  4L1Q D;  4ERZ A;  5JWZ A;  4X61 B;  1FWX A;  4U7A A;  3PXS D;  3OKY A;  1P22 A;  5I5M A;  4R7A B;  5IT9 g;  4GM8 A;  3SBR A;  2YBA A;  4A7J A;  4GM9 A;  2OK6 A;  4CI2 A;  3IIY A;  3IKO A;  1JMZ B;  1OMW B;  4LG9 A;  2YNP A;  3GFC A;  5TF2 A;  1VYH C;  3RSE C;  3EI3 B;  1GP2 B; 
#chains in the Genus database with same CATH topology
 2GNQ A;  2H6N A;  3I7P A;  3K72 A;  3QI0 A;  2CE8 A;  3RN1 D;  1E8M A;  1UOQ A;  5GXH A;  1L0Q A;  1QNI A;  3VA6 A;  3UKU C;  4J82 A;  3P4F A;  3ODT A;  3EI1 A;  4BP8 A;  3MUO A;  5HE0 B;  4ERY A;  4DNV A;  2HES X;  3SBQ A;  1QFS A;  4G1E A;  2IUR A;  2P9I C;  3OKT A;  3N0E A;  2HU7 A;  2I3S A;  5SXM A;  3JRP A;  4BCC A;  1SHY B;  3AH8 B;  4A08 B;  2EIE A;  4BH6 A;  4ZOV A;  2Q7Q A;  2YNO A;  5C92 A;  2QR5 A;  4QRJ A;  4JSV C;  4AN0 A;  2H9M A;  4AN1 A;  3EU7 A;  2Z2N A;  3FGB A;  1H2W A;  3JPX A;  4J0W A;  3IJ1 A;  4E54 B;  4PBY A;  4BL0 A;  1K8K C;  3IUM A;  2QXV A;  2Z2P A;  4QL1 A;  4O1Q D;  5E6U A;  3W15 A;  4JSX C;  4FA5 D;  4O9D A;  4FB1 D;  3I89 A;  4GQB B;  3I7N A;  3O4H A;  4FA9 D;  2P9P C;  4J77 A;  1SQJ A;  3OW8 A;  4A11 A;  3SVW D;  4D9S A;  1GOG A;  1MDA H;  2VDK A;  2CO0 C;  4G55 A;  1JMX B;  1U4C A;  3C75 H;  3U4Y A;  2H47 A;  2BBK H;  3BWS A;  2I0T A;  1PGU A;  4H5I A;  5EML B;  5H1M A;  3T3M A;  5GSA A;  3ULE C;  5C2V B;  1U8C A;  1E5T A;  5EM2 A;  2QZP A;  3B7F A;  1JV2 A;  2VZ1 A;  4O3T B;  3V5W B;  2H6Q A;  2XL3 A;  3JAM g;  1N6F A;  5HE2 B;  2AQ5 A;  4DNU A;  3ZE1 A;  4L1M A;  3JRO A;  5IC7 A;  3EQ7 A;  1K3I A;  2JKX A;  3KRX B;  2H9N A;  3JZH A;  3ZWL B;  4ZOY A;  2IWK A;  1VZ2 A;  4D6V A;  4Y7R A;  2P9L C;  3GD1 I;  4CY2 A;  3L4O D;  4AX4 A;  4CY1 A;  4DNW A;  3F3F A;  3PSL A;  5FXY A;  3MMY A;  1XKS A;  5FFO A;  2HKR A;  3I7O A;  2XE4 A;  5HDB A;  4Z8L A;  3VH0 A;  5IJ7 E;  5FA5 B;  2AH0 A;  4IRZ A;  3VI3 A;  3SBP A;  2EIC A;  3ZDY A;  5TEF A;  2CN2 A;  4K3J B;  4WK2 A;  5IGQ A;  5FQD A;  4GM3 A;  4UM9 A;  4GMB A;  2AGY A;  2XYI A;  3O4G A;  1JJU B;  4O02 A;  4BCB A;  1U2V C;  2J55 H;  3DXM C;  2UZX B;  2P9N C;  1YR2 A;  3JZG A;  5AMS A;  2VZ3 A;  4X3E A;  4NSX A;  4OWR A;  4A09 A;  3EWE A;  4XEI C;  4XYI A;  1NR0 A;  4WK0 A;  4AEZ A;  1S4U X;  3MKS B;  3V4V A;  4UM8 A;  5CYK B;  5K1C C;  2H14 A;  2VC2 A;  2PM9 A;  5AFU 3;  4J73 A;  4ZOX A;  2OIZ A;  3OL2 B;  2AGW A;  4A0B A;  5CYK A;  4ZOZ A;  4JT6 C;  3EI1 B;  1MG2 A;  3L4M D;  3OL2 A;  1GOH A;  5FKT A;  5EAM A;  2EIB A;  2YMU A;  3DWL C;  3MZL A;  4J0X A;  3IJ0 A;  4X60 B;  3SJL D;  2OVR B;  3FRX A;  3PSC B;  5EMM B;  2HYE A;  3NID A;  3V4P A;  4IA9 A;  3ZDX A;  3IVM A;  3IUN A;  5E6S A;  5B4W A;  3SHF A;  2XDW A;  3HFQ A;  4JSP C;  1SQ9 A;  4A0A A;  3ORV D;  3OF7 A;  4XYH A;  2PM7 B;  3RRM C;  4YVD A;  3JZN A;  3SFZ A;  3IUQ A;  5K19 A;  4AMZ A;  4Z7O A;  2P9U C;  3K27 A;  2EBS A;  2I0S A;  3MZK A;  3UVO A;  4FA4 D;  3AFC A;  4J79 A;  2HJ4 A;  3PE7 A;  2HU8 A;  4E5Z A;  3EI2 B;  2CO0 A;  5M5U A;  3PVU B;  2OVQ B;  3JB9 L;  4PSW B;  4GGD A;  3NVX A;  3KCI A;  1PEV A;  4RE5 A;  3UVK A;  4ESG A;  5FLX g;  4GQ1 A;  3EI2 A;  1UOO A;  5AJA A;  2IUV A;  3I8E A;  3I8C A;  3N0D A;  2VDN A;  3EI4 A;  3MVD K;  2HJB A;  3UVN A;  2CN3 A;  5M5T A;  4A11 B;  1H2Y A;  2I0R A;  4MMY A;  1UTC A;  5M5S A;  1QFM A;  5EMK B;  4J86 A;  4FHL A;  5EM2 B;  1GOF A;  3SN6 B;  4NBM A;  3I2N A;  3RLM D;  3V7D B;  4CZV A;  3DXK C;  4J8G A;  2QC5 A;  1T2X A;  2BCJ B;  3CFS B;  5HE1 B;  1PBY B;  2OJY A;  3K26 A;  4JD2 C;  3RFH A;  3PVW B;  1YFQ A;  4JHP C;  2IUQ A;  4NAA A;  4J8B A;  4AOW A;  1ERJ A;  2Z2O A;  5FKS A;  4J78 A;  3RN0 D;  3I7L A;  5CXC A;  1TYE A;  1RI6 A;  3MUN A;  4CZY A;  4AMY A;  4QAM A;  5HYN B;  3EMH A;  3OTT A;  2UZY B;  3KRW B;  5EAP A;  2VDM A;  1B9Y A;  4MMX A;  3VI4 A;  2TRC B;  1H2Z A;  2EID A;  2OK4 A;  3AL8 A;  2VDR A;  1C9L A;  2BKL A;  2XZG A;  2XL2 A;  2P9K C;  4A09 B;  1TBG A;  4CI3 A;  2AGX A;  5C86 A;  3DM0 A;  3I7H A;  3DSM A;  4LG8 A;  4J87 A;  3AL9 A;  2PM9 B;  2H9L A;  4ES0 A;  2B5L A;  3PXW D;  5M5V A;  3ZDZ A;  2IUP A;  2PBI B;  3FM0 A;  4OZU A;  1C9I A;  4NC4 A;  5M5R A;  4A0B B;  4GGC A;  3MKQ A;  5IJ8 E;  4PXW A;  1GG2 B;  5H17 A;  4GGA A;  5CXB B;  4WJK A;  2J57 G;  4TZ4 A;  3ZE2 A;  2H68 A;  4G1M A;  4A2L A;  4WK4 A;  2AH1 A;  4ERQ A;  1K32 A;  3ZE0 A;  4O2W A;  2HXC A;  1N6E A;  5CXB A;  5KDO B;  1B9X A;  3RFG A;  1TYQ C;  1H2X A;  4EWR A;  2J56 H;  1R5M A;  2B5N A;  5A2Q g;  3J81 g;  4A0A B;  3V9F A;  2CE9 A;  4Z7N A;  3EQ8 A;  3NIG A;  3VGZ A;  4L9O A;  3IUJ A;  2IAA A;  2P9S C;  2H13 A;  4CY3 A;  3EI3 A;  3O4J A;  2I3T A;  4QT8 A;  4X63 B;  4LGN A;  5HQG A;  1E8N A;  1L5G A;  4FAN D;  4HDJ A;  4E5Z B;  2G99 A;  4GZ8 A;  4FA1 D;  1VE7 A;  3K6S A;  4I79 A;  4PNK B;  1XHM A;  4BP9 A;  3MXX A;  2HKM A;  1GOT B;  3C5M A;  4QQE A;  2VDL A;  3FCU A;  1JOF A;  4U1E I;  3C99 A;  3EI4 B;  3NVQ A;  4FWW A;  5GXI A;  2WQ8 A;  4JSN C;  5C2W B;  1OLZ A;  2O9K A;  3IJC A;  2VDQ A;  1NEX B;  2HU5 A;  4JHN A;  5H14 A;  2PM6 B;  3CFV A;  3QHY B;  5FFG A;  4A08 A;  4BUJ C;  3FCS A;  5THA A;  4CY5 A;  3SMR A;  1VZ3 A;  2YB8 B;  5EAR A;  1Q47 A;  4PSX B;  3RMZ D;  5HE3 B;  3SXT D;  4JT5 C;  3DDU A;  4H5J A;  4A2M A;  4CI8 A;  3T3P A;  3UKR C;  1MG3 A;  4GQ2 P;  1JTD B;  2CNX A;  1O6F A;  2XU7 A;  4RE6 A;  4E54 A;  3IUL A;  3J80 g;  2OVP B;  2AGL A;  5IGO A;  4CI1 A;  3NIF A;  5M61 A;  3E0C A;  2GC4 A;  5CXC B;  2B4E A;  4BCD A;  3A0F A;  3K71 A;  2H6K A;  3BG0 A;  5GMK n;  2GC7 A;  4MK0 B;  4UI9 R;  2H9P A;  4L3H D;  4KFM B;  4N14 A;  4O45 A;  3UVM A;  3BG1 A;  1I2M B;  3F3G A;  3C9C A;  4JXM A;  1A12 A;  4PC0 A;  4CC9 A;  4PBZ A;  1XIP A;  5FKR A;  3AL8 B;  5FKQ A;  1N6D A;  3IUR A;  3PXT D;  1A0R B;  1PI6 A;  3GC3 B;  1BPO A;  1VE6 A;  4G56 B;  3CIK B;  4O3U B;  5TEE A;  2H3X A;  3IIW A;  4J81 A;  2YNN A;  3SCY A;  4FAV D;  2MTA H;  3F3P A;  3IJE A;  1O6G A;  3UR4 A;  5EMJ B;  4ZN4 A;  5C9Z B;  4L3G D;  3SLE D;  2G9A A;  2VDO A;  4K3I D;  3SWS D;  3EQ9 A;  3I7K A;  4D0K A;  1M1X A;  2W18 A;  1GXR A;  2AGZ A;  3NVN A;  5EAL A;  5I5I A;  2IWF A;  1UOP A;  3GRE A;  2B5M A;  3OKW A;  4Z7Q A;  5I5J A;  4MMZ A;  5TDH B;  4CZX A;  3EG6 A;  3OKY B;  3UVL A;  4Y5R D;  4J84 A;  4IMM A;  4L1Q D;  4ERZ A;  5JWZ A;  4X61 B;  5E6R A;  1FWX A;  4U7A A;  3PXS D;  3OKY A;  1P22 A;  5I5M A;  4R7A B;  5IT9 g;  3O4I A;  4GM8 A;  3SBR A;  2YBA A;  4A7J A;  4GM9 A;  2OK6 A;  4CI2 A;  3IIY A;  3IKO A;  1JMZ B;  1OMW B;  2VDP A;  2YNP A;  3GFC A;  4LG9 A;  5TF2 A;  1VYH C;  3RSE C;  3EI3 B;  1GP2 B;  4NEN A; 
#chains in the Genus database with same CATH homology
 2GNQ A;  2H6N A;  3I7P A;  2CE8 A;  3RN1 D;  5GXH A;  1L0Q A;  1QNI A;  3VA6 A;  3UKU C;  4J82 A;  3P4F A;  3ODT A;  3EI1 A;  5HE0 B;  4ERY A;  2HES X;  3SBQ A;  2IUR A;  2P9I C;  3OKT A;  3N0E A;  2I3S A;  5SXM A;  3JRP A;  1SHY B;  3AH8 B;  4A08 B;  4BH6 A;  4ZOV A;  2Q7Q A;  2YNO A;  4QRJ A;  4JSV C;  2H9M A;  3EU7 A;  2Z2N A;  3FGB A;  3JPX A;  4J0W A;  3IJ1 A;  4E54 B;  4PBY A;  4BL0 A;  1K8K C;  2QXV A;  2Z2P A;  4QL1 A;  4O1Q D;  3W15 A;  4JSX C;  4FA5 D;  4O9D A;  4FB1 D;  3I89 A;  4GQB B;  3I7N A;  4FA9 D;  2P9P C;  4J77 A;  1SQJ A;  3OW8 A;  4A11 A;  3SVW D;  1MDA H;  2CO0 C;  1JMX B;  1U4C A;  3C75 H;  3U4Y A;  2H47 A;  2BBK H;  3BWS A;  2I0T A;  1PGU A;  4H5I A;  5EML B;  5H1M A;  5GSA A;  3ULE C;  5C2V B;  5EM2 A;  3B7F A;  4O3T B;  3V5W B;  2H6Q A;  2XL3 A;  3JAM g;  1N6F A;  5HE2 B;  2AQ5 A;  3JRO A;  5IC7 A;  3KRX B;  2H9N A;  3JZH A;  3ZWL B;  4ZOY A;  2IWK A;  4D6V A;  4Y7R A;  2P9L C;  4CY2 A;  3L4O D;  4CY1 A;  3F3F A;  3PSL A;  5FXY A;  3MMY A;  1XKS A;  2HKR A;  3I7O A;  4Z8L A;  3VH0 A;  5IJ7 E;  5FA5 B;  2AH0 A;  3SBP A;  5TEF A;  2CN2 A;  4K3J B;  5IGQ A;  5FQD A;  4GM3 A;  4GMB A;  2AGY A;  2XYI A;  1JJU B;  1U2V C;  2J55 H;  3DXM C;  2UZX B;  2P9N C;  3JZG A;  5AMS A;  4X3E A;  4NSX A;  4OWR A;  4A09 A;  3EWE A;  4XEI C;  4XYI A;  1NR0 A;  4AEZ A;  1S4U X;  3MKS B;  5CYK B;  5K1C C;  2H14 A;  2PM9 A;  5AFU 3;  4J73 A;  4ZOX A;  2OIZ A;  3OL2 B;  2AGW A;  4A0B A;  5CYK A;  4ZOZ A;  4JT6 C;  3EI1 B;  1MG2 A;  3L4M D;  3OL2 A;  5FKT A;  5EAM A;  2YMU A;  3DWL C;  3MZL A;  4J0X A;  3IJ0 A;  4X60 B;  3SJL D;  2OVR B;  3FRX A;  3PSC B;  5EMM B;  2HYE A;  4IA9 A;  5B4W A;  3SHF A;  3HFQ A;  4JSP C;  1SQ9 A;  4A0A A;  3ORV D;  4XYH A;  2PM7 B;  3RRM C;  4YVD A;  3JZN A;  3SFZ A;  5K19 A;  2P9U C;  3K27 A;  2EBS A;  2I0S A;  3MZK A;  3UVO A;  4FA4 D;  3AFC A;  4J79 A;  2HJ4 A;  3PE7 A;  4E5Z A;  3EI2 B;  2CO0 A;  3PVU B;  2OVQ B;  3JB9 L;  4PSW B;  4GGD A;  3NVX A;  1PEV A;  3UVK A;  4ESG A;  5FLX g;  4GQ1 A;  3EI2 A;  5AJA A;  2IUV A;  3I8E A;  3I8C A;  3N0D A;  3EI4 A;  2HJB A;  3UVN A;  2CN3 A;  4A11 B;  2I0R A;  5EMK B;  4J86 A;  4FHL A;  5EM2 B;  3SN6 B;  3I2N A;  3RLM D;  3V7D B;  4CZV A;  3DXK C;  4J8G A;  2QC5 A;  2BCJ B;  3CFS B;  5HE1 B;  1PBY B;  2OJY A;  3K26 A;  4JD2 C;  3RFH A;  3PVW B;  1YFQ A;  2IUQ A;  4J8B A;  4AOW A;  1ERJ A;  2Z2O A;  5FKS A;  4J78 A;  3RN0 D;  3I7L A;  5CXC A;  1RI6 A;  4CZY A;  5HYN B;  3EMH A;  3OTT A;  2UZY B;  3KRW B;  5EAP A;  1B9Y A;  2TRC B;  2OK4 A;  3AL8 A;  2XL2 A;  2P9K C;  4A09 B;  1TBG A;  4CI3 A;  2AGX A;  3DM0 A;  3I7H A;  3DSM A;  4LG8 A;  4J87 A;  3AL9 A;  2PM9 B;  2H9L A;  4ES0 A;  2B5L A;  3PXW D;  2IUP A;  2PBI B;  3FM0 A;  4OZU A;  4A0B B;  4GGC A;  3MKQ A;  5IJ8 E;  4PXW A;  1GG2 B;  5H17 A;  4GGA A;  5CXB B;  2J57 G;  4TZ4 A;  2H68 A;  4A2L A;  2AH1 A;  4ERQ A;  1K32 A;  2HXC A;  1N6E A;  5CXB A;  5KDO B;  1B9X A;  3RFG A;  1TYQ C;  4EWR A;  2J56 H;  1R5M A;  2B5N A;  5A2Q g;  3J81 g;  4A0A B;  3V9F A;  2CE9 A;  3VGZ A;  4L9O A;  2IAA A;  2P9S C;  2H13 A;  4CY3 A;  3EI3 A;  2I3T A;  4QT8 A;  4X63 B;  4LGN A;  5HQG A;  4FAN D;  4HDJ A;  4E5Z B;  2G99 A;  4GZ8 A;  4FA1 D;  4I79 A;  4PNK B;  1XHM A;  2HKM A;  3MXX A;  1GOT B;  3C5M A;  4QQE A;  1JOF A;  4U1E I;  3C99 A;  4FWW A;  3EI4 B;  3NVQ A;  5GXI A;  4JSN C;  5C2W B;  1OLZ A;  2O9K A;  3IJC A;  1NEX B;  5H14 A;  2PM6 B;  3CFV A;  4A08 A;  4BUJ C;  5THA A;  4CY5 A;  3SMR A;  2YB8 B;  5EAR A;  1Q47 A;  4PSX B;  3RMZ D;  5HE3 B;  3SXT D;  4JT5 C;  4H5J A;  4A2M A;  4CI8 A;  3UKR C;  1MG3 A;  4GQ2 P;  2CNX A;  2XU7 A;  4E54 A;  3J80 g;  2OVP B;  2AGL A;  5IGO A;  4CI1 A;  3E0C A;  2GC4 A;  5CXC B;  2B4E A;  3A0F A;  2H6K A;  3BG0 A;  5GMK n;  2GC7 A;  4MK0 B;  4UI9 R;  2H9P A;  4L3H D;  4KFM B;  4N14 A;  4O45 A;  3UVM A;  3BG1 A;  3F3G A;  3C9C A;  4JXM A;  4PC0 A;  4CC9 A;  4PBZ A;  1XIP A;  5FKR A;  3AL8 B;  5FKQ A;  1N6D A;  3PXT D;  1A0R B;  1PI6 A;  4G56 B;  3CIK B;  4O3U B;  5TEE A;  2H3X A;  3IIW A;  4J81 A;  2YNN A;  3SCY A;  4FAV D;  2MTA H;  3F3P A;  3UR4 A;  5EMJ B;  4ZN4 A;  5C9Z B;  4L3G D;  3SLE D;  2G9A A;  4K3I D;  3SWS D;  3I7K A;  4D0K A;  2W18 A;  1GXR A;  2AGZ A;  3NVN A;  5EAL A;  5I5I A;  2IWF A;  3GRE A;  2B5M A;  3OKW A;  5I5J A;  5TDH B;  4CZX A;  3EG6 A;  3OKY B;  3UVL A;  4Y5R D;  4J84 A;  4IMM A;  4L1Q D;  4ERZ A;  5JWZ A;  4X61 B;  1FWX A;  4U7A A;  3PXS D;  3OKY A;  1P22 A;  5I5M A;  4R7A B;  5IT9 g;  4GM8 A;  3SBR A;  2YBA A;  4A7J A;  4GM9 A;  2OK6 A;  4CI2 A;  3IIY A;  3IKO A;  1JMZ B;  1OMW B;  4LG9 A;  2YNP A;  3GFC A;  5TF2 A;  1VYH C;  3RSE C;  3EI3 B;  1GP2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...