3CFVA

Structural basis of the interaction of rbap46/rbap48 with histone h4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
411
structure length
390
Chain Sequence
MAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-binding protein RBBP7
publication title Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histone/chaperone
total genus 80
structure length 390
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3cfvA00
4LG9A 4XEIC 1GG2B 3EI3B 2AH1A 4FA4D 4H5IA 4L1QD 3SXTD 3RLMD 1GP2B 1S4UX 4A11A 4BH6A 5K19A 1TBGA 4GQ1A 3IJ1A 4GM8A 3C9CA 3L4MD 5CXCB 3W15A 3MKSB 4K3JB 5EM2A 2H13A 3GREA 5H1MA 2PM7B 2HJBA 4GM9A 3E0CA 5H17A 2OVQB 3L4OD 4Y7RA 3CIKB 3JROA 2AGXA 4CY2A 2TRCB 2H47A 1K8KC 5TDHB 2P9SC 2AGWA 4MK0B 2CN2A 1SHYB 2YB8B 2IURA 4X61B 5EMLB 3N0EA 4J86A 3I7NA 3HFQA 4E54A 3ORVD 4J8GA 2P9IC 3SBPA 4PBZA 3C5MA 4CZYA 1N6DA 5SXMA 5EARA 1GXRA 3A0FA 5TEEA 1GOTB 5FLXg 4E5ZB 1YFQA 4FB1D 1OLZA 3DM0A 2W18A 2P9UC 2AQ5A 3KRXB 3JB9L 4A0BB 2IUQA 2H6QA 4CZXA 2CO0C 2UZXB 2AGZA 1N6EA 2Z2NA 4CI2A 2AGLA 3CFSB 5CXBB 3RRMC 3UR4A 4CZVA 1MG3A 4PBYA 4E5ZA 3JZHA 5AFU3 3IKOA 3ZWLB 5EALA 4R7AB 2H14A 1U2VC 3UVMA 3SFZA 2H9NA 4J79A 3J81g 2YMUA 2YNNA 4PSWB 2PM6B 3FM0A 2H9LA 3F3PA 3OKYA 3VA6A 1NR0A 5HE3B 5IJ8E 2XYIA 4LGNA 2I0TA 3PSCB 1PEVA 3K26A 3DWLC 5I5JA 5HE1B 2B5MA 2GNQA 2O9KA 3SMRA 4OZUA 4BUJC 3EI4B 4QRJA 5I5MA 4JT6C 3MKQA 2P9PC 2B5NA 3UVNA 4HDJA 4A08B 2HXCA 5IGQA 4FAVD 3EMHA 4GQ2P 2XL2A 5FKTA 3VGZA 4AOWA 4GQBB 2J56H 3OW8A 4Y5RD 4J87A 2H3XA 2HYEA 3DXKC 3JPXA 3AFCA 4ERZA 4A2MA 1PGUA 2IWKA 4A7JA 2H9MA 4X3EA 3EI4A 4CY1A 3JAMg 2YBAA 3IJCA 1FWXA 3F3FA 4GZ8A 4A0AB 3MZKA 4O45A 3K27A 3GFCA 3PSLA 5TF2A 2IUPA 1A0RB 3EI3A 4J0XA 4QL1A 4GGCA 5FA5B 5FXYA 3V7DB 3OL2B 2J55H 4K3ID 3F3GA 3KRWB 1MG2A 1SQJA 3PXSD 1U4CA 3SN6B 4ERQA 5CXCA 5C2VB 3OTTA 2YNPA 2B4EA 1N6FA 5GSAA 3V9FA 1RI6A 4TZ4A 4A0AA 2H9PA 3B7FA 5FKRA 2G9AA 4ZN4A 3JRPA 3VH0A 2B5LA 3EI2B 3PXTD 2OVRB 5K1CC 1JMXB 1JOFA 3NVXA 2J57G 2QXVA 4L3HD 1B9XA 3UVLA 5C2WB 4CI1A 1VYHC 4GM3A 3UVKA 3I89A 3PVWB 4D0KA 4FA1D 3EI1B 5HQGA 2BCJB 3EG6A 4L9OA 5IGOA 4JSXC 3SWSD 3AL8B 4ZOXA 3MMYA 3SJLD 5FKQA 2IUVA 2Z2OA 2HESX 3NVQA 3EI2A 3I7OA 1Q47A 3EU7A 1XKSA 4JSPC 4A0BA 4J0WA 4J81A 2I3SA 3UVOA 3BWSA 5EMKB 2IWFA 4EWRA 3I7KA 4AEZA 2QC5A 2GC4A 4JSNC 1B9YA 2CE8A 5C9ZB 5EAPA 2HKMA 5CXBA 3BG0A 4FAND 4CY5A 4A09B 3ODTA 3RN0D 5B4WA 4LG8A 3SHFA 2AH0A 4J82A 5A2Qg 4XYIA 3SBQA 3FGBA 4PSXB 4Z8LA 5KDOB 1R5MA 3BG1A 4I79A 4JD2C 4CI3A 1MDAH 5EAMA 3RMZD 4PXWA 5EMJB 2UZYB 4D6VA 4J77A 4FHLA 3AL9A 4NSXA 4H5JA 4UI9R 4ERYA 4A11B 2MTAH 4ES0A 3RFHA 4L3GD 1K32A 4IA9A 4FA9D 4J78A 4X63B 3JZNA 3I8EA 4A08A 3MZLA 2CO0A 3PVUB 4JT5C 3SLED 5IJ7E 2OK6A 2HKRA 3I8CA 2OIZA 3N0DA 2H6KA 4CY3A 4O3TB 1XIPA 2Z2PA 3JZGA 4J84A 2H68A 3CFVA 3DSMA 4JXMA 2I0SA 2G99A 4BL0A 4X60B 4CC9A 4ESGA 4E54B 4GGAA 4JSVC 5AJAA 2IAAA 3C75H 2XL3A 4U1EI 3U4YA 3RN1D 3OKWA 4GGDA 1QNIA 3C99A 1P22A 5CYKB 4A2LA 2OJYA 4ZOVA 3J80g 1JJUB 3OL2A 5HE0B 2OVPB 3NVNA 4PC0A 4QQEA 2OK4A 3AH8B 4ZOYA 4KFMB 2PBIB 4QT8A 3FRXA 4YVDA 2I3TA 5GXIA 3I7HA 4N14A 5CYKA 3SVWD 3PE7A 2AGYA 2CE9A 2GC7A 1ERJA 1JMZB 1OMWB 5EMMB 4O3UB 5I5IA 3RSEC 4J8BA 3IIWA 4XYHA 2P9LC 4FA5D 1SQ9A 5JWZA 4ZOZA 3OKYB 3EI1A 2EBSA 5HYNB 3RFGA 5FKSA 3AL8A 2P9NC 2PM9B 5H14A 5GXHA 4O9DA 2P9KC 2YNOA 2CNXA 2H6NA 4IMMA 4O1QD 5IT9g 2CN3A 1TYQC 3I2NA 3SCYA 3I7PA 2HJ4A 3UKRC 5AMSA 3ULEC 3IJ0A 3IIYA 2XU7A 4PNKB 5THAA 3I7LA 4J73A 4OWRA 4G56B 2Q7QA 3SBRA 1NEXB 3P4FA 4GMBA 5GMKn 3DXMC 2PM9A 5HE2B 4FWWA 1L0QA 4A09A 5FQDA 3UKUC 2BBKH 1XHMA 4CI8A 5IC7A 3V5WB 3OKTA 5TEFA 3PXWD 3EWEA 1PI6A 5EM2B 4U7AA 2I0RA 3MXXA 1PBYB
chains in the Genus database with same CATH superfamily
4LG9A 4XEIC 2VDOA 1GG2B 3EI3B 2AH1A 4FA4D 1JTDB 4H5IA 4L1QD 3SXTD 3RLMD 5E6UA 1H2YA 5FFGA 5C92A 1GP2B 2VDKA 1S4UX 4A11A 3MUOA 3EQ9A 4BH6A 5K19A 1TBGA 1VE6A 4GQ1A 3IJ1A 4GM8A 3C9CA 3L4MD 5CXCB 3W15A 3MKSB 3NIFA 4K3JB 2HU5A 5EM2A 3O4HA 2H13A 1C9LA 3GREA 5H1MA 2PM7B 2HJBA 4GM9A 4MMXA 3E0CA 5H17A 4AMYA 2OVQB 3L4OD 4Y7RA 2JKXA 3GC3B 3CIKB 3JROA 2AGXA 4CY2A 4DNUA 1VZ3A 2TRCB 2H47A 1K8KC 5TDHB 2P9SC 2AGWA 4MK0B 2CN2A 1SHYB 2YB8B 2IURA 4X61B 4BCBA 5EMLB 3N0EA 4J86A 3I7NA 3HFQA 4E54A 3GD1I 3ORVD 4J8GA 1BPOA 2P9IC 4PBZA 3SBPA 3C5MA 4CZYA 1N6DA 4Z7NA 5SXMA 5EARA 1GXRA 3A0FA 5TEEA 1GOTB 5FLXg 4E5ZB 1YFQA 4FB1D 4G55A 1OLZA 3DM0A 2W18A 2P9UC 3IJEA 2AQ5A 3KRXB 3JB9L 2XDWA 1U8CA 4RE6A 4A0BB 2IUQA 2H6QA 4CZXA 2CO0C 2UZXB 2AGZA 1N6EA 3QHYB 1TYEA 2Z2NA 4CI2A 4JHPC 2AGLA 3CFSB 1E8MA 5CXBB 3RRMC 3UR4A 4CZVA 1MG3A 4RE5A 4PBYA 4E5ZA 3JZHA 1UOOA 1I2MB 5AFU3 3IKOA 3ZWLB 5EALA 3MVDK 4R7AB 2VDQA 2H14A 4UM8A 1U2VC 3UVMA 2VDRA 3SFZA 2H9NA 4J79A 3J81g 1GOFA 2YMUA 2HU8A 2YNNA 4PSWB 2PM6B 3FM0A 1QFMA 2H9LA 3F3PA 3OKYA 2EIBA 3EQ7A 3VA6A 1NR0A 5HE3B 5IJ8E 2XYIA 3PSCB 2I0TA 4LGNA 1PEVA 3K26A 3DDUA 3DWLC 1UOQA 5I5JA 5HE1B 4Z7QA 4WJKA 2B5MA 3IULA 2GNQA 2O9KA 3SMRA 4OZUA 3MUNA 4BUJC 3EI4B 4QRJA 5I5MA 4G1MA 3ZE0A 4JT6C 4BCDA 5M5UA 3MKQA 2P9PC 2EIDA 3IURA 2B5NA 3UVNA 1C9IA 4HDJA 3IVMA 1JV2A 4DNVA 4A08B 2HXCA 5IGQA 4FAVD 3EMHA 4GQ2P 2XL2A 5FKTA 3VGZA 4AOWA 4GQBB 2J56H 5FFOA 3ZDXA 3OW8A 4Y5RD 4DNWA 4J87A 2H3XA 2HYEA 3DXKC 3JPXA 3AFCA 4ERZA 4A2MA 1PGUA 2IWKA 4A7JA 2H9MA 4X3EA 3O4IA 5M61A 3EI4A 4CY1A 4MMZA 3JAMg 2YBAA 3IJCA 1FWXA 3F3FA 4GZ8A 4A0AB 3MZKA 4O45A 3K27A 3GFCA 3PSLA 1O6GA 4BP8A 5TF2A 1UTCA 1A0RB 2IUPA 3EI3A 4J0XA 4GGCA 4QL1A 5FA5B 5FXYA 3V7DB 3V4PA 3OL2B 2J55H 4K3ID 5M5SA 3F3GA 3KRWB 4WK2A 1MG2A 3FCUA 5E6RA 5C86A 1SQJA 3PXSD 1U4CA 3SN6B 3T3PA 4ERQA 5CXCA 5C2VB 3OTTA 2YNPA 2B4EA 1N6FA 5GSAA 2VDNA 3V9FA 1RI6A 4TZ4A 4A0AA 2H9PA 3K6SA 3B7FA 5FKRA 2G9AA 4ZN4A 3JRPA 3VH0A 2B5LA 3EI2B 4NENA 3PXTD 5HDBA 2OVRB 5K1CC 3O4JA 1JMXB 1JOFA 1UOPA 3NVXA 2J57G 2QXVA 4AX4A 4L3HD 1B9XA 3UVLA 4MMYA 4O2WA 5C2WB 4CI1A 1VYHC 4GM3A 1YR2A 3UVKA 3I89A 1QFSA 3PVWB 4D0KA 4FA1D 3EI1B 5HQGA 2BCJB 3EG6A 4L9OA 5IGOA 4JSXC 3SWSD 1K3IA 3AL8B 4ZOXA 3MMYA 3SJLD 5FKQA 4NC4A 4NAAA 3OF7A 2IUVA 2Z2OA 2QR5A 2HESX 3NVQA 3VI4A 3EI2A 3I7OA 1Q47A 3EU7A 1XKSA 4JSPC 4A0BA 4J0WA 2EICA 4J81A 2I3SA 3UVOA 3BWSA 2VZ3A 5EMKB 2IWFA 4EWRA 3I7KA 4AEZA 2QC5A 2GC4A 4JSNC 1B9YA 2CE8A 5C9ZB 5EAPA 1VZ2A 3KCIA 2HKMA 5CXBA 1A12A 3BG0A 4FAND 4G1EA 5M5TA 3ZE1A 4CY5A 4A09B 3ODTA 3RN0D 3K71A 5B4WA 4IRZA 4LG8A 3SHFA 2AH0A 3VI3A 4J82A 5E6SA 5A2Qg 4XYIA 3SBQA 3FGBA 4PSXB 2VDPA 4WK4A 4Z8LA 5KDOB 1R5MA 3BG1A 4I79A 3T3MA 4JD2C 4CI3A 1MDAH 3FCSA 4UM9A 5EAMA 3RMZD 4PXWA 5EMJB 4AN0A 2UZYB 4O02A 4D6VA 4J77A 4FHLA 3AL9A 4NSXA 4H5JA 4UI9R 4ERYA 4A11B 2MTAH 1O6FA 1VE7A 4ES0A 3RFHA 4L3GD 1K32A 3IUNA 4IA9A 1H2WA 4FA9D 4JHNA 4J78A 4X63B 3EQ8A 3JZNA 1H2ZA 2XZGA 3I8EA 4A08A 3MZLA 2CO0A 3PVUB 4JT5C 3SLED 5IJ7E 2OK6A 2HKRA 3I8CA 2OIZA 3N0DA 2H6KA 2VZ1A 4CY3A 4O3TB 1XIPA 2Z2PA 4BP9A 3JZGA 4D9SA 4J84A 2H68A 3CFVA 3DSMA 4JXMA 3NIGA 2I0SA 5M5RA 2G99A 4BL0A 4X60B 4CC9A 4ESGA 4E54B 4GGAA 4JSVC 5AJAA 4BCCA 2IAAA 3C75H 2XL3A 1E8NA 4U1EI 3ZDZA 3U4YA 1L5GA 3RN1D 3OKWA 4GGDA 5M5VA 1QNIA 3C99A 1P22A 5CYKB 4A2LA 2OJYA 4ZOVA 3J80g 1JJUB 2QZPA 3OL2A 5HE0B 1GOGA 2OVPB 3NVNA 2HU7A 4PC0A 4QQEA 2OK4A 3AH8B 4NBMA 1GOHA 4ZOYA 2WQ8A 4AMZA 4KFMB 2PBIB 4QT8A 3FRXA 3NIDA 4YVDA 2I3TA 5GXIA 3I7HA 4N14A 1M1XA 3ZDYA 3K72A 5CYKA 3SVWD 4WK0A 3PE7A 2AGYA 2CE9A 2GC7A 1ERJA 1JMZB 1OMWB 5EMMB 4O3UB 1H2XA 5I5IA 3RSEC 4J8BA 3IIWA 4XYHA 2P9LC 3O4GA 4FA5D 1SQ9A 5JWZA 4ZOZA 2BKLA 3OKYB 4AN1A 3EI1A 2EBSA 3ZE2A 5HYNB 2VDLA 3RFGA 5FKSA 4L1MA 3AL8A 2P9NC 2PM9B 5H14A 5GXHA 4O9DA 2P9KC 3V4VA 4Z7OA 2YNOA 2CNXA 2H6NA 4IMMA 4O1QD 2VC2A 5IT9g 2CN3A 1TYQC 3I2NA 3SCYA 3I7PA 2HJ4A 2VDMA 3IUMA 3UKRC 5AMSA 1E5TA 3ULEC 3IJ0A 3IIYA 2XU7A 1T2XA 4PNKB 5THAA 3I7LA 4J73A 4OWRA 4G56B 2Q7QA 3IUJA 3SBRA 1NEXB 3P4FA 4GMBA 5GMKn 3DXMC 2PM9A 3QI0A 4QAMA 5HE2B 4FWWA 1L0QA 2XE4A 4A09A 5FQDA 3UKUC 2BBKH 1XHMA 3IUQA 4CI8A 5IC7A 3V5WB 3OKTA 5TEFA 3PXWD 3EWEA 2EIEA 1PI6A 5EM2B 4U7AA 2I0RA 3MXXA 1PBYB
chains in the Genus database with same CATH topology
4LG9A 4XEIC 1GG2B 3EI3B 2AH1A 4FA4D 4H5IA 4L1QD 3SXTD 3RLMD 1GP2B 1S4UX 4A11A 4BH6A 5K19A 1TBGA 4GQ1A 3IJ1A 4GM8A 3C9CA 3L4MD 5CXCB 3W15A 3MKSB 4K3JB 5EM2A 2H13A 3GREA 5H1MA 2PM7B 2HJBA 4GM9A 3E0CA 5H17A 2OVQB 3L4OD 4Y7RA 3CIKB 3JROA 2AGXA 4CY2A 2TRCB 2H47A 1K8KC 5TDHB 2P9SC 2AGWA 4MK0B 2CN2A 1SHYB 2YB8B 2IURA 4X61B 5EMLB 3N0EA 4J86A 3I7NA 3HFQA 4E54A 3ORVD 4J8GA 2P9IC 3SBPA 4PBZA 3C5MA 4CZYA 1N6DA 5SXMA 5EARA 1GXRA 3A0FA 5TEEA 1GOTB 5FLXg 4E5ZB 1YFQA 4FB1D 1OLZA 3DM0A 2W18A 2P9UC 2AQ5A 3KRXB 3JB9L 4A0BB 2IUQA 2H6QA 4CZXA 2CO0C 2UZXB 2AGZA 1N6EA 2Z2NA 4CI2A 2AGLA 3CFSB 5CXBB 3RRMC 3UR4A 4CZVA 1MG3A 4PBYA 4E5ZA 3JZHA 5AFU3 3IKOA 3ZWLB 5EALA 4R7AB 2H14A 1U2VC 3UVMA 3SFZA 2H9NA 4J79A 3J81g 2YMUA 2YNNA 4PSWB 2PM6B 3FM0A 2H9LA 3F3PA 3OKYA 3VA6A 1NR0A 5HE3B 5IJ8E 2XYIA 4LGNA 2I0TA 3PSCB 1PEVA 3K26A 3DWLC 5I5JA 5HE1B 2B5MA 2GNQA 2O9KA 3SMRA 4OZUA 4BUJC 3EI4B 4QRJA 5I5MA 4JT6C 3MKQA 2P9PC 2B5NA 3UVNA 4HDJA 4A08B 2HXCA 5IGQA 4FAVD 3EMHA 4GQ2P 2XL2A 5FKTA 3VGZA 4AOWA 4GQBB 2J56H 3OW8A 4Y5RD 4J87A 2H3XA 2HYEA 3DXKC 3JPXA 3AFCA 4ERZA 4A2MA 1PGUA 2IWKA 4A7JA 2H9MA 4X3EA 3EI4A 4CY1A 3JAMg 2YBAA 3IJCA 1FWXA 3F3FA 4GZ8A 4A0AB 3MZKA 4O45A 3K27A 3GFCA 3PSLA 5TF2A 2IUPA 1A0RB 3EI3A 4J0XA 4QL1A 4GGCA 5FA5B 5FXYA 3V7DB 3OL2B 2J55H 4K3ID 3F3GA 3KRWB 1MG2A 1SQJA 3PXSD 1U4CA 3SN6B 4ERQA 5CXCA 5C2VB 3OTTA 2YNPA 2B4EA 1N6FA 5GSAA 3V9FA 1RI6A 4TZ4A 4A0AA 2H9PA 3B7FA 5FKRA 2G9AA 4ZN4A 3JRPA 3VH0A 2B5LA 3EI2B 3PXTD 2OVRB 5K1CC 1JMXB 1JOFA 3NVXA 2J57G 2QXVA 4L3HD 1B9XA 3UVLA 5C2WB 4CI1A 1VYHC 4GM3A 3UVKA 3I89A 3PVWB 4D0KA 4FA1D 3EI1B 5HQGA 2BCJB 3EG6A 4L9OA 5IGOA 4JSXC 3SWSD 3AL8B 4ZOXA 3MMYA 3SJLD 5FKQA 2IUVA 2Z2OA 2HESX 3NVQA 3EI2A 3I7OA 1Q47A 3EU7A 1XKSA 4JSPC 4A0BA 4J0WA 4J81A 2I3SA 3UVOA 3BWSA 5EMKB 2IWFA 4EWRA 3I7KA 4AEZA 2QC5A 2GC4A 4JSNC 1B9YA 2CE8A 5C9ZB 5EAPA 2HKMA 5CXBA 3BG0A 4FAND 4CY5A 4A09B 3ODTA 3RN0D 5B4WA 4LG8A 3SHFA 2AH0A 4J82A 5A2Qg 4XYIA 3SBQA 3FGBA 4PSXB 4Z8LA 5KDOB 1R5MA 3BG1A 4I79A 4JD2C 4CI3A 1MDAH 5EAMA 3RMZD 4PXWA 5EMJB 2UZYB 4D6VA 4J77A 4FHLA 3AL9A 4NSXA 4H5JA 4UI9R 4ERYA 4A11B 2MTAH 4ES0A 3RFHA 4L3GD 1K32A 4IA9A 4FA9D 4J78A 4X63B 3JZNA 3I8EA 4A08A 3MZLA 2CO0A 3PVUB 4JT5C 3SLED 5IJ7E 2OK6A 2HKRA 3I8CA 2OIZA 3N0DA 2H6KA 4CY3A 4O3TB 1XIPA 2Z2PA 3JZGA 4J84A 2H68A 3CFVA 3DSMA 4JXMA 2I0SA 2G99A 4BL0A 4X60B 4CC9A 4ESGA 4E54B 4GGAA 4JSVC 5AJAA 2IAAA 3C75H 2XL3A 4U1EI 3U4YA 3RN1D 3OKWA 4GGDA 1QNIA 3C99A 1P22A 5CYKB 4A2LA 2OJYA 4ZOVA 3J80g 1JJUB 3OL2A 5HE0B 2OVPB 3NVNA 4PC0A 4QQEA 2OK4A 3AH8B 4ZOYA 4KFMB 2PBIB 4QT8A 3FRXA 4YVDA 2I3TA 5GXIA 3I7HA 4N14A 5CYKA 3SVWD 3PE7A 2AGYA 2CE9A 2GC7A 1ERJA 1JMZB 1OMWB 5EMMB 4O3UB 5I5IA 3RSEC 4J8BA 3IIWA 4XYHA 2P9LC 4FA5D 1SQ9A 5JWZA 4ZOZA 3OKYB 3EI1A 2EBSA 5HYNB 3RFGA 5FKSA 3AL8A 2P9NC 2PM9B 5H14A 5GXHA 4O9DA 2P9KC 2YNOA 2CNXA 2H6NA 4IMMA 4O1QD 5IT9g 2CN3A 1TYQC 3I2NA 3SCYA 3I7PA 2HJ4A 3UKRC 5AMSA 3ULEC 3IJ0A 3IIYA 2XU7A 4PNKB 5THAA 3I7LA 4J73A 4OWRA 4G56B 2Q7QA 3SBRA 1NEXB 3P4FA 4GMBA 5GMKn 3DXMC 2PM9A 5HE2B 4FWWA 1L0QA 4A09A 5FQDA 3UKUC 2BBKH 1XHMA 4CI8A 5IC7A 3V5WB 3OKTA 5TEFA 3PXWD 3EWEA 1PI6A 5EM2B 4U7AA 2I0RA 3MXXA 1PBYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG9 A;  4XEI C;  1GG2 B;  3EI3 B;  2AH1 A;  4FA4 D;  4H5I A;  4L1Q D;  3SXT D;  3RLM D;  1GP2 B;  1S4U X;  4A11 A;  4BH6 A;  5K19 A;  1TBG A;  4GQ1 A;  3IJ1 A;  4GM8 A;  3C9C A;  3L4M D;  5CXC B;  3W15 A;  3MKS B;  4K3J B;  5EM2 A;  2H13 A;  3GRE A;  5H1M A;  2PM7 B;  2HJB A;  4GM9 A;  3E0C A;  5H17 A;  2OVQ B;  3L4O D;  4Y7R A;  3CIK B;  3JRO A;  2AGX A;  4CY2 A;  2TRC B;  2H47 A;  1K8K C;  5TDH B;  2P9S C;  2AGW A;  4MK0 B;  2CN2 A;  1SHY B;  2YB8 B;  2IUR A;  4X61 B;  5EML B;  3N0E A;  4J86 A;  3I7N A;  3HFQ A;  4E54 A;  3ORV D;  4J8G A;  2P9I C;  3SBP A;  4PBZ A;  3C5M A;  4CZY A;  1N6D A;  5SXM A;  5EAR A;  1GXR A;  3A0F A;  5TEE A;  1GOT B;  5FLX g;  4E5Z B;  1YFQ A;  4FB1 D;  1OLZ A;  3DM0 A;  2W18 A;  2P9U C;  2AQ5 A;  3KRX B;  3JB9 L;  4A0B B;  2IUQ A;  2H6Q A;  4CZX A;  2CO0 C;  2UZX B;  2AGZ A;  1N6E A;  2Z2N A;  4CI2 A;  2AGL A;  3CFS B;  5CXB B;  3RRM C;  3UR4 A;  4CZV A;  1MG3 A;  4PBY A;  4E5Z A;  3JZH A;  5AFU 3;  3IKO A;  3ZWL B;  5EAL A;  4R7A B;  2H14 A;  1U2V C;  3UVM A;  3SFZ A;  2H9N A;  4J79 A;  3J81 g;  2YMU A;  2YNN A;  4PSW B;  2PM6 B;  3FM0 A;  2H9L A;  3F3P A;  3OKY A;  3VA6 A;  1NR0 A;  5HE3 B;  5IJ8 E;  2XYI A;  4LGN A;  2I0T A;  3PSC B;  1PEV A;  3K26 A;  3DWL C;  5I5J A;  5HE1 B;  2B5M A;  2GNQ A;  2O9K A;  3SMR A;  4OZU A;  4BUJ C;  3EI4 B;  4QRJ A;  5I5M A;  4JT6 C;  3MKQ A;  2P9P C;  2B5N A;  3UVN A;  4HDJ A;  4A08 B;  2HXC A;  5IGQ A;  4FAV D;  3EMH A;  4GQ2 P;  2XL2 A;  5FKT A;  3VGZ A;  4AOW A;  4GQB B;  2J56 H;  3OW8 A;  4Y5R D;  4J87 A;  2H3X A;  2HYE A;  3DXK C;  3JPX A;  3AFC A;  4ERZ A;  4A2M A;  1PGU A;  2IWK A;  4A7J A;  2H9M A;  4X3E A;  3EI4 A;  4CY1 A;  3JAM g;  2YBA A;  3IJC A;  1FWX A;  3F3F A;  4GZ8 A;  4A0A B;  3MZK A;  4O45 A;  3K27 A;  3GFC A;  3PSL A;  5TF2 A;  2IUP A;  1A0R B;  3EI3 A;  4J0X A;  4QL1 A;  4GGC A;  5FA5 B;  5FXY A;  3V7D B;  3OL2 B;  2J55 H;  4K3I D;  3F3G A;  3KRW B;  1MG2 A;  1SQJ A;  3PXS D;  1U4C A;  3SN6 B;  4ERQ A;  5CXC A;  5C2V B;  3OTT A;  2YNP A;  2B4E A;  1N6F A;  5GSA A;  3V9F A;  1RI6 A;  4TZ4 A;  4A0A A;  2H9P A;  3B7F A;  5FKR A;  2G9A A;  4ZN4 A;  3JRP A;  3VH0 A;  2B5L A;  3EI2 B;  3PXT D;  2OVR B;  5K1C C;  1JMX B;  1JOF A;  3NVX A;  2J57 G;  2QXV A;  4L3H D;  1B9X A;  3UVL A;  5C2W B;  4CI1 A;  1VYH C;  4GM3 A;  3UVK A;  3I89 A;  3PVW B;  4D0K A;  4FA1 D;  3EI1 B;  5HQG A;  2BCJ B;  3EG6 A;  4L9O A;  5IGO A;  4JSX C;  3SWS D;  3AL8 B;  4ZOX A;  3MMY A;  3SJL D;  5FKQ A;  2IUV A;  2Z2O A;  2HES X;  3NVQ A;  3EI2 A;  3I7O A;  1Q47 A;  3EU7 A;  1XKS A;  4JSP C;  4A0B A;  4J0W A;  4J81 A;  2I3S A;  3UVO A;  3BWS A;  5EMK B;  2IWF A;  4EWR A;  3I7K A;  4AEZ A;  2QC5 A;  2GC4 A;  4JSN C;  1B9Y A;  2CE8 A;  5C9Z B;  5EAP A;  2HKM A;  5CXB A;  3BG0 A;  4FAN D;  4CY5 A;  4A09 B;  3ODT A;  3RN0 D;  5B4W A;  4LG8 A;  3SHF A;  2AH0 A;  4J82 A;  5A2Q g;  4XYI A;  3SBQ A;  3FGB A;  4PSX B;  4Z8L A;  5KDO B;  1R5M A;  3BG1 A;  4I79 A;  4JD2 C;  4CI3 A;  1MDA H;  5EAM A;  3RMZ D;  4PXW A;  5EMJ B;  2UZY B;  4D6V A;  4J77 A;  4FHL A;  3AL9 A;  4NSX A;  4H5J A;  4UI9 R;  4ERY A;  4A11 B;  2MTA H;  4ES0 A;  3RFH A;  4L3G D;  1K32 A;  4IA9 A;  4FA9 D;  4J78 A;  4X63 B;  3JZN A;  3I8E A;  4A08 A;  3MZL A;  2CO0 A;  3PVU B;  4JT5 C;  3SLE D;  5IJ7 E;  2OK6 A;  2HKR A;  3I8C A;  2OIZ A;  3N0D A;  2H6K A;  4CY3 A;  4O3T B;  1XIP A;  2Z2P A;  3JZG A;  4J84 A;  2H68 A;  3CFV A;  3DSM A;  4JXM A;  2I0S A;  2G99 A;  4BL0 A;  4X60 B;  4CC9 A;  4ESG A;  4E54 B;  4GGA A;  4JSV C;  5AJA A;  2IAA A;  3C75 H;  2XL3 A;  4U1E I;  3U4Y A;  3RN1 D;  3OKW A;  4GGD A;  1QNI A;  3C99 A;  1P22 A;  5CYK B;  4A2L A;  2OJY A;  4ZOV A;  3J80 g;  1JJU B;  3OL2 A;  5HE0 B;  2OVP B;  3NVN A;  4PC0 A;  4QQE A;  2OK4 A;  3AH8 B;  4ZOY A;  4KFM B;  2PBI B;  4QT8 A;  3FRX A;  4YVD A;  2I3T A;  5GXI A;  3I7H A;  4N14 A;  5CYK A;  3SVW D;  3PE7 A;  2AGY A;  2CE9 A;  2GC7 A;  1ERJ A;  1JMZ B;  1OMW B;  5EMM B;  4O3U B;  5I5I A;  3RSE C;  4J8B A;  3IIW A;  4XYH A;  2P9L C;  4FA5 D;  1SQ9 A;  5JWZ A;  4ZOZ A;  3OKY B;  3EI1 A;  2EBS A;  5HYN B;  3RFG A;  5FKS A;  3AL8 A;  2P9N C;  2PM9 B;  5H14 A;  5GXH A;  4O9D A;  2P9K C;  2YNO A;  2CNX A;  2H6N A;  4IMM A;  4O1Q D;  5IT9 g;  2CN3 A;  1TYQ C;  3I2N A;  3SCY A;  3I7P A;  2HJ4 A;  3UKR C;  5AMS A;  3ULE C;  3IJ0 A;  3IIY A;  2XU7 A;  4PNK B;  5THA A;  3I7L A;  4J73 A;  4OWR A;  4G56 B;  2Q7Q A;  3SBR A;  1NEX B;  3P4F A;  4GMB A;  5GMK n;  3DXM C;  2PM9 A;  5HE2 B;  4FWW A;  1L0Q A;  4A09 A;  5FQD A;  3UKU C;  2BBK H;  1XHM A;  4CI8 A;  5IC7 A;  3V5W B;  3OKT A;  5TEF A;  3PXW D;  3EWE A;  1PI6 A;  5EM2 B;  4U7A A;  2I0R A;  3MXX A;  1PBY B; 
#chains in the Genus database with same CATH topology
 4LG9 A;  4XEI C;  2VDO A;  1GG2 B;  3EI3 B;  2AH1 A;  4FA4 D;  1JTD B;  4H5I A;  4L1Q D;  3SXT D;  3RLM D;  5E6U A;  1H2Y A;  5FFG A;  5C92 A;  1GP2 B;  2VDK A;  1S4U X;  4A11 A;  3MUO A;  3EQ9 A;  4BH6 A;  5K19 A;  1TBG A;  1VE6 A;  4GQ1 A;  3IJ1 A;  4GM8 A;  3C9C A;  3L4M D;  5CXC B;  3W15 A;  3MKS B;  3NIF A;  4K3J B;  2HU5 A;  5EM2 A;  3O4H A;  2H13 A;  1C9L A;  3GRE A;  5H1M A;  2PM7 B;  2HJB A;  4GM9 A;  4MMX A;  3E0C A;  5H17 A;  4AMY A;  2OVQ B;  3L4O D;  4Y7R A;  2JKX A;  3GC3 B;  3CIK B;  3JRO A;  2AGX A;  4CY2 A;  4DNU A;  1VZ3 A;  2TRC B;  2H47 A;  1K8K C;  5TDH B;  2P9S C;  2AGW A;  4MK0 B;  2CN2 A;  1SHY B;  2YB8 B;  2IUR A;  4X61 B;  4BCB A;  5EML B;  3N0E A;  4J86 A;  3I7N A;  3HFQ A;  4E54 A;  3GD1 I;  3ORV D;  4J8G A;  1BPO A;  2P9I C;  4PBZ A;  3SBP A;  3C5M A;  4CZY A;  1N6D A;  4Z7N A;  5SXM A;  5EAR A;  1GXR A;  3A0F A;  5TEE A;  1GOT B;  5FLX g;  4E5Z B;  1YFQ A;  4FB1 D;  4G55 A;  1OLZ A;  3DM0 A;  2W18 A;  2P9U C;  3IJE A;  2AQ5 A;  3KRX B;  3JB9 L;  2XDW A;  1U8C A;  4RE6 A;  4A0B B;  2IUQ A;  2H6Q A;  4CZX A;  2CO0 C;  2UZX B;  2AGZ A;  1N6E A;  3QHY B;  1TYE A;  2Z2N A;  4CI2 A;  4JHP C;  2AGL A;  3CFS B;  1E8M A;  5CXB B;  3RRM C;  3UR4 A;  4CZV A;  1MG3 A;  4RE5 A;  4PBY A;  4E5Z A;  3JZH A;  1UOO A;  1I2M B;  5AFU 3;  3IKO A;  3ZWL B;  5EAL A;  3MVD K;  4R7A B;  2VDQ A;  2H14 A;  4UM8 A;  1U2V C;  3UVM A;  2VDR A;  3SFZ A;  2H9N A;  4J79 A;  3J81 g;  1GOF A;  2YMU A;  2HU8 A;  2YNN A;  4PSW B;  2PM6 B;  3FM0 A;  1QFM A;  2H9L A;  3F3P A;  3OKY A;  2EIB A;  3EQ7 A;  3VA6 A;  1NR0 A;  5HE3 B;  5IJ8 E;  2XYI A;  3PSC B;  2I0T A;  4LGN A;  1PEV A;  3K26 A;  3DDU A;  3DWL C;  1UOQ A;  5I5J A;  5HE1 B;  4Z7Q A;  4WJK A;  2B5M A;  3IUL A;  2GNQ A;  2O9K A;  3SMR A;  4OZU A;  3MUN A;  4BUJ C;  3EI4 B;  4QRJ A;  5I5M A;  4G1M A;  3ZE0 A;  4JT6 C;  4BCD A;  5M5U A;  3MKQ A;  2P9P C;  2EID A;  3IUR A;  2B5N A;  3UVN A;  1C9I A;  4HDJ A;  3IVM A;  1JV2 A;  4DNV A;  4A08 B;  2HXC A;  5IGQ A;  4FAV D;  3EMH A;  4GQ2 P;  2XL2 A;  5FKT A;  3VGZ A;  4AOW A;  4GQB B;  2J56 H;  5FFO A;  3ZDX A;  3OW8 A;  4Y5R D;  4DNW A;  4J87 A;  2H3X A;  2HYE A;  3DXK C;  3JPX A;  3AFC A;  4ERZ A;  4A2M A;  1PGU A;  2IWK A;  4A7J A;  2H9M A;  4X3E A;  3O4I A;  5M61 A;  3EI4 A;  4CY1 A;  4MMZ A;  3JAM g;  2YBA A;  3IJC A;  1FWX A;  3F3F A;  4GZ8 A;  4A0A B;  3MZK A;  4O45 A;  3K27 A;  3GFC A;  3PSL A;  1O6G A;  4BP8 A;  5TF2 A;  1UTC A;  1A0R B;  2IUP A;  3EI3 A;  4J0X A;  4GGC A;  4QL1 A;  5FA5 B;  5FXY A;  3V7D B;  3V4P A;  3OL2 B;  2J55 H;  4K3I D;  5M5S A;  3F3G A;  3KRW B;  4WK2 A;  1MG2 A;  3FCU A;  5E6R A;  5C86 A;  1SQJ A;  3PXS D;  1U4C A;  3SN6 B;  3T3P A;  4ERQ A;  5CXC A;  5C2V B;  3OTT A;  2YNP A;  2B4E A;  1N6F A;  5GSA A;  2VDN A;  3V9F A;  1RI6 A;  4TZ4 A;  4A0A A;  2H9P A;  3K6S A;  3B7F A;  5FKR A;  2G9A A;  4ZN4 A;  3JRP A;  3VH0 A;  2B5L A;  3EI2 B;  4NEN A;  3PXT D;  5HDB A;  2OVR B;  5K1C C;  3O4J A;  1JMX B;  1JOF A;  1UOP A;  3NVX A;  2J57 G;  2QXV A;  4AX4 A;  4L3H D;  1B9X A;  3UVL A;  4MMY A;  4O2W A;  5C2W B;  4CI1 A;  1VYH C;  4GM3 A;  1YR2 A;  3UVK A;  3I89 A;  1QFS A;  3PVW B;  4D0K A;  4FA1 D;  3EI1 B;  5HQG A;  2BCJ B;  3EG6 A;  4L9O A;  5IGO A;  4JSX C;  3SWS D;  1K3I A;  3AL8 B;  4ZOX A;  3MMY A;  3SJL D;  5FKQ A;  4NC4 A;  4NAA A;  3OF7 A;  2IUV A;  2Z2O A;  2QR5 A;  2HES X;  3NVQ A;  3VI4 A;  3EI2 A;  3I7O A;  1Q47 A;  3EU7 A;  1XKS A;  4JSP C;  4A0B A;  4J0W A;  2EIC A;  4J81 A;  2I3S A;  3UVO A;  3BWS A;  2VZ3 A;  5EMK B;  2IWF A;  4EWR A;  3I7K A;  4AEZ A;  2QC5 A;  2GC4 A;  4JSN C;  1B9Y A;  2CE8 A;  5C9Z B;  5EAP A;  1VZ2 A;  3KCI A;  2HKM A;  5CXB A;  1A12 A;  3BG0 A;  4FAN D;  4G1E A;  5M5T A;  3ZE1 A;  4CY5 A;  4A09 B;  3ODT A;  3RN0 D;  3K71 A;  5B4W A;  4IRZ A;  4LG8 A;  3SHF A;  2AH0 A;  3VI3 A;  4J82 A;  5E6S A;  5A2Q g;  4XYI A;  3SBQ A;  3FGB A;  4PSX B;  2VDP A;  4WK4 A;  4Z8L A;  5KDO B;  1R5M A;  3BG1 A;  4I79 A;  3T3M A;  4JD2 C;  4CI3 A;  1MDA H;  3FCS A;  4UM9 A;  5EAM A;  3RMZ D;  4PXW A;  5EMJ B;  4AN0 A;  2UZY B;  4O02 A;  4D6V A;  4J77 A;  4FHL A;  3AL9 A;  4NSX A;  4H5J A;  4UI9 R;  4ERY A;  4A11 B;  2MTA H;  1O6F A;  1VE7 A;  4ES0 A;  3RFH A;  4L3G D;  1K32 A;  3IUN A;  4IA9 A;  1H2W A;  4FA9 D;  4JHN A;  4J78 A;  4X63 B;  3EQ8 A;  3JZN A;  1H2Z A;  2XZG A;  3I8E A;  4A08 A;  3MZL A;  2CO0 A;  3PVU B;  4JT5 C;  3SLE D;  5IJ7 E;  2OK6 A;  2HKR A;  3I8C A;  2OIZ A;  3N0D A;  2H6K A;  2VZ1 A;  4CY3 A;  4O3T B;  1XIP A;  2Z2P A;  4BP9 A;  3JZG A;  4D9S A;  4J84 A;  2H68 A;  3CFV A;  3DSM A;  4JXM A;  3NIG A;  2I0S A;  5M5R A;  2G99 A;  4BL0 A;  4X60 B;  4CC9 A;  4ESG A;  4E54 B;  4GGA A;  4JSV C;  5AJA A;  4BCC A;  2IAA A;  3C75 H;  2XL3 A;  1E8N A;  4U1E I;  3ZDZ A;  3U4Y A;  1L5G A;  3RN1 D;  3OKW A;  4GGD A;  5M5V A;  1QNI A;  3C99 A;  1P22 A;  5CYK B;  4A2L A;  2OJY A;  4ZOV A;  3J80 g;  1JJU B;  2QZP A;  3OL2 A;  5HE0 B;  1GOG A;  2OVP B;  3NVN A;  2HU7 A;  4PC0 A;  4QQE A;  2OK4 A;  3AH8 B;  4NBM A;  1GOH A;  4ZOY A;  2WQ8 A;  4AMZ A;  4KFM B;  2PBI B;  4QT8 A;  3FRX A;  3NID A;  4YVD A;  2I3T A;  5GXI A;  3I7H A;  4N14 A;  1M1X A;  3ZDY A;  3K72 A;  5CYK A;  3SVW D;  4WK0 A;  3PE7 A;  2AGY A;  2CE9 A;  2GC7 A;  1ERJ A;  1JMZ B;  1OMW B;  5EMM B;  4O3U B;  1H2X A;  5I5I A;  3RSE C;  4J8B A;  3IIW A;  4XYH A;  2P9L C;  3O4G A;  4FA5 D;  1SQ9 A;  5JWZ A;  4ZOZ A;  2BKL A;  3OKY B;  4AN1 A;  3EI1 A;  2EBS A;  3ZE2 A;  5HYN B;  2VDL A;  3RFG A;  5FKS A;  4L1M A;  3AL8 A;  2P9N C;  2PM9 B;  5H14 A;  5GXH A;  4O9D A;  2P9K C;  3V4V A;  4Z7O A;  2YNO A;  2CNX A;  2H6N A;  4IMM A;  4O1Q D;  2VC2 A;  5IT9 g;  2CN3 A;  1TYQ C;  3I2N A;  3SCY A;  3I7P A;  2HJ4 A;  2VDM A;  3IUM A;  3UKR C;  5AMS A;  1E5T A;  3ULE C;  3IJ0 A;  3IIY A;  2XU7 A;  1T2X A;  4PNK B;  5THA A;  3I7L A;  4J73 A;  4OWR A;  4G56 B;  2Q7Q A;  3IUJ A;  3SBR A;  1NEX B;  3P4F A;  4GMB A;  5GMK n;  3DXM C;  2PM9 A;  3QI0 A;  4QAM A;  5HE2 B;  4FWW A;  1L0Q A;  2XE4 A;  4A09 A;  5FQD A;  3UKU C;  2BBK H;  1XHM A;  3IUQ A;  4CI8 A;  5IC7 A;  3V5W B;  3OKT A;  5TEF A;  3PXW D;  3EWE A;  2EIE A;  1PI6 A;  5EM2 B;  4U7A A;  2I0R A;  3MXX A;  1PBY B; 
#chains in the Genus database with same CATH homology
 4LG9 A;  4XEI C;  1GG2 B;  3EI3 B;  2AH1 A;  4FA4 D;  4H5I A;  4L1Q D;  3SXT D;  3RLM D;  1GP2 B;  1S4U X;  4A11 A;  4BH6 A;  5K19 A;  1TBG A;  4GQ1 A;  3IJ1 A;  4GM8 A;  3C9C A;  3L4M D;  5CXC B;  3W15 A;  3MKS B;  4K3J B;  5EM2 A;  2H13 A;  3GRE A;  5H1M A;  2PM7 B;  2HJB A;  4GM9 A;  3E0C A;  5H17 A;  2OVQ B;  3L4O D;  4Y7R A;  3CIK B;  3JRO A;  2AGX A;  4CY2 A;  2TRC B;  2H47 A;  1K8K C;  5TDH B;  2P9S C;  2AGW A;  4MK0 B;  2CN2 A;  1SHY B;  2YB8 B;  2IUR A;  4X61 B;  5EML B;  3N0E A;  4J86 A;  3I7N A;  3HFQ A;  4E54 A;  3ORV D;  4J8G A;  2P9I C;  3SBP A;  4PBZ A;  3C5M A;  4CZY A;  1N6D A;  5SXM A;  5EAR A;  1GXR A;  3A0F A;  5TEE A;  1GOT B;  5FLX g;  4E5Z B;  1YFQ A;  4FB1 D;  1OLZ A;  3DM0 A;  2W18 A;  2P9U C;  2AQ5 A;  3KRX B;  3JB9 L;  4A0B B;  2IUQ A;  2H6Q A;  4CZX A;  2CO0 C;  2UZX B;  2AGZ A;  1N6E A;  2Z2N A;  4CI2 A;  2AGL A;  3CFS B;  5CXB B;  3RRM C;  3UR4 A;  4CZV A;  1MG3 A;  4PBY A;  4E5Z A;  3JZH A;  5AFU 3;  3IKO A;  3ZWL B;  5EAL A;  4R7A B;  2H14 A;  1U2V C;  3UVM A;  3SFZ A;  2H9N A;  4J79 A;  3J81 g;  2YMU A;  2YNN A;  4PSW B;  2PM6 B;  3FM0 A;  2H9L A;  3F3P A;  3OKY A;  3VA6 A;  1NR0 A;  5HE3 B;  5IJ8 E;  2XYI A;  4LGN A;  2I0T A;  3PSC B;  1PEV A;  3K26 A;  3DWL C;  5I5J A;  5HE1 B;  2B5M A;  2GNQ A;  2O9K A;  3SMR A;  4OZU A;  4BUJ C;  3EI4 B;  4QRJ A;  5I5M A;  4JT6 C;  3MKQ A;  2P9P C;  2B5N A;  3UVN A;  4HDJ A;  4A08 B;  2HXC A;  5IGQ A;  4FAV D;  3EMH A;  4GQ2 P;  2XL2 A;  5FKT A;  3VGZ A;  4AOW A;  4GQB B;  2J56 H;  3OW8 A;  4Y5R D;  4J87 A;  2H3X A;  2HYE A;  3DXK C;  3JPX A;  3AFC A;  4ERZ A;  4A2M A;  1PGU A;  2IWK A;  4A7J A;  2H9M A;  4X3E A;  3EI4 A;  4CY1 A;  3JAM g;  2YBA A;  3IJC A;  1FWX A;  3F3F A;  4GZ8 A;  4A0A B;  3MZK A;  4O45 A;  3K27 A;  3GFC A;  3PSL A;  5TF2 A;  2IUP A;  1A0R B;  3EI3 A;  4J0X A;  4QL1 A;  4GGC A;  5FA5 B;  5FXY A;  3V7D B;  3OL2 B;  2J55 H;  4K3I D;  3F3G A;  3KRW B;  1MG2 A;  1SQJ A;  3PXS D;  1U4C A;  3SN6 B;  4ERQ A;  5CXC A;  5C2V B;  3OTT A;  2YNP A;  2B4E A;  1N6F A;  5GSA A;  3V9F A;  1RI6 A;  4TZ4 A;  4A0A A;  2H9P A;  3B7F A;  5FKR A;  2G9A A;  4ZN4 A;  3JRP A;  3VH0 A;  2B5L A;  3EI2 B;  3PXT D;  2OVR B;  5K1C C;  1JMX B;  1JOF A;  3NVX A;  2J57 G;  2QXV A;  4L3H D;  1B9X A;  3UVL A;  5C2W B;  4CI1 A;  1VYH C;  4GM3 A;  3UVK A;  3I89 A;  3PVW B;  4D0K A;  4FA1 D;  3EI1 B;  5HQG A;  2BCJ B;  3EG6 A;  4L9O A;  5IGO A;  4JSX C;  3SWS D;  3AL8 B;  4ZOX A;  3MMY A;  3SJL D;  5FKQ A;  2IUV A;  2Z2O A;  2HES X;  3NVQ A;  3EI2 A;  3I7O A;  1Q47 A;  3EU7 A;  1XKS A;  4JSP C;  4A0B A;  4J0W A;  4J81 A;  2I3S A;  3UVO A;  3BWS A;  5EMK B;  2IWF A;  4EWR A;  3I7K A;  4AEZ A;  2QC5 A;  2GC4 A;  4JSN C;  1B9Y A;  2CE8 A;  5C9Z B;  5EAP A;  2HKM A;  5CXB A;  3BG0 A;  4FAN D;  4CY5 A;  4A09 B;  3ODT A;  3RN0 D;  5B4W A;  4LG8 A;  3SHF A;  2AH0 A;  4J82 A;  5A2Q g;  4XYI A;  3SBQ A;  3FGB A;  4PSX B;  4Z8L A;  5KDO B;  1R5M A;  3BG1 A;  4I79 A;  4JD2 C;  4CI3 A;  1MDA H;  5EAM A;  3RMZ D;  4PXW A;  5EMJ B;  2UZY B;  4D6V A;  4J77 A;  4FHL A;  3AL9 A;  4NSX A;  4H5J A;  4UI9 R;  4ERY A;  4A11 B;  2MTA H;  4ES0 A;  3RFH A;  4L3G D;  1K32 A;  4IA9 A;  4FA9 D;  4J78 A;  4X63 B;  3JZN A;  3I8E A;  4A08 A;  3MZL A;  2CO0 A;  3PVU B;  4JT5 C;  3SLE D;  5IJ7 E;  2OK6 A;  2HKR A;  3I8C A;  2OIZ A;  3N0D A;  2H6K A;  4CY3 A;  4O3T B;  1XIP A;  2Z2P A;  3JZG A;  4J84 A;  2H68 A;  3CFV A;  3DSM A;  4JXM A;  2I0S A;  2G99 A;  4BL0 A;  4X60 B;  4CC9 A;  4ESG A;  4E54 B;  4GGA A;  4JSV C;  5AJA A;  2IAA A;  3C75 H;  2XL3 A;  4U1E I;  3U4Y A;  3RN1 D;  3OKW A;  4GGD A;  1QNI A;  3C99 A;  1P22 A;  5CYK B;  4A2L A;  2OJY A;  4ZOV A;  3J80 g;  1JJU B;  3OL2 A;  5HE0 B;  2OVP B;  3NVN A;  4PC0 A;  4QQE A;  2OK4 A;  3AH8 B;  4ZOY A;  4KFM B;  2PBI B;  4QT8 A;  3FRX A;  4YVD A;  2I3T A;  5GXI A;  3I7H A;  4N14 A;  5CYK A;  3SVW D;  3PE7 A;  2AGY A;  2CE9 A;  2GC7 A;  1ERJ A;  1JMZ B;  1OMW B;  5EMM B;  4O3U B;  5I5I A;  3RSE C;  4J8B A;  3IIW A;  4XYH A;  2P9L C;  4FA5 D;  1SQ9 A;  5JWZ A;  4ZOZ A;  3OKY B;  3EI1 A;  2EBS A;  5HYN B;  3RFG A;  5FKS A;  3AL8 A;  2P9N C;  2PM9 B;  5H14 A;  5GXH A;  4O9D A;  2P9K C;  2YNO A;  2CNX A;  2H6N A;  4IMM A;  4O1Q D;  5IT9 g;  2CN3 A;  1TYQ C;  3I2N A;  3SCY A;  3I7P A;  2HJ4 A;  3UKR C;  5AMS A;  3ULE C;  3IJ0 A;  3IIY A;  2XU7 A;  4PNK B;  5THA A;  3I7L A;  4J73 A;  4OWR A;  4G56 B;  2Q7Q A;  3SBR A;  1NEX B;  3P4F A;  4GMB A;  5GMK n;  3DXM C;  2PM9 A;  5HE2 B;  4FWW A;  1L0Q A;  4A09 A;  5FQD A;  3UKU C;  2BBK H;  1XHM A;  4CI8 A;  5IC7 A;  3V5W B;  3OKT A;  5TEF A;  3PXW D;  3EWE A;  1PI6 A;  5EM2 B;  4U7A A;  2I0R A;  3MXX A;  1PBY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...