3CFVA

Structural basis of the interaction of rbap46/rbap48 with histone h4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
411
structure length
390
Chain Sequence
b'MAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-binding protein RBBP7
publication title Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histone/chaperone
total genus 80
structure length 390
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3cfvA00
4O3TB 4H5IA 4A08A 2PM9B 1GP2B 2Z2PA 1TYQC 2HKRA 1U2VC 2AGYA 3PXSD 5FQDA 2AQ5A 3EI2A 4JD2C 3UKRC 2IURA 2H9LA 4ZOVA 4A7JA 3L4MD 4NSXA 5TF2A 3C5MA 3GFCA 4FWWA 3SWSD 5CXCB 3DWLC 3PSLA 4J82A 3JZNA 5GMKn 4A2MA 1B9YA 4E5ZA 4A0AA 3L4OD 3IIYA 1XIPA 3IKOA 3I7NA 3A0FA 3SBQA 4XYHA 3UVKA 1SHYB 5SXMA 3NVNA 1YFQA 4PXWA 2UZYB 4BUJC 4J0WA 4K3JB 2P9PC 3C75H 4JSVC 5TEEA 4E54A 5GXIA 4GZ8A 2P9UC 3KRXB 4ERYA 3SN6B 2H14A 2H9NA 5I5JA 4R7AB 2AGLA 2BBKH 4ZN4A 3EG6A 2H9MA 4PBYA 3ULEC 3EMHA 2HESX 4FA4D 2PBIB 4FAND 4GM8A 2XU7A 4ESGA 5FKSA 3RN0D 3GREA 3U4YA 4JT5C 2OVPB 5I5MA 2H6NA 5IGQA 1GOTB 3W15A 3I89A 4X60B 4H5JA 3AL9A 1XKSA 5EAMA 1OLZA 3DXKC 5IGOA 4BH6A 1PI6A 3VA6A 5CXBA 5FXYA 3SHFA 1U4CA 2XL3A 3AL8B 3I7KA 5EAPA 5THAA 3JROA 3OKYB 4G56B 2MTAH 2HYEA 5AJAA 4GM3A 2I0SA 3UR4A 1NEXB 3NVQA 5HQGA 2J57G 1MG2A 5C9ZB 2YB8B 3K26A 4ERQA 4CI8A 4FA1D 3UVNA 4J84A 3RFGA 3SCYA 1L0QA 2H13A 3N0EA 4HDJA 4GQ1A 4J77A 4J8BA 5H14A 3JZHA 3JPXA 3CFVA 2AH0A 3F3FA 3SVWD 3N0DA 5CYKA 4ZOYA 3EI1B 3UVOA 5EMLB 5K1CC 2IWFA 3VH0A 2I3TA 4TZ4A 2OJYA 2CE8A 4O45A 1N6EA 1SQ9A 4U7AA 2OVRB 4L9OA 5A2Qg 3I2NA 1MDAH 4QRJA 2YNPA 4CZYA 4OZUA 1NR0A 4JT6C 2OK6A 2AGZA 3JZGA 3AFCA 1MG3A 4LGNA 2IWKA 5I5IA 5FKRA 3JAMg 2GC7A 4XEIC 1PBYB 3J80g 4A2LA 4PSWB 2CO0C 4EWRA 1P22A 1JOFA 2QC5A 4ZOXA 3EI4A 4I79A 5EM2A 3OL2B 2AGXA 4A09A 2CN2A 4FA9D 3UVMA 4A08B 3BG0A 3EI2B 4QT8A 2XYIA 3IJ1A 1QNIA 3RSEC 3MXXA 1JMXB 3DSMA 2P9LC 2YNNA 5IC7A 2J56H 3C9CA 3NVXA 2AH1A 5AMSA 3RN1D 2P9IC 5FA5B 3OW8A 5B4WA 4IMMA 5C2VB 4A0BA 4E5ZB 3PVWB 2B4EA 4AEZA 2I3SA 3OTTA 4L3HD 4J79A 3V5WB 1FWXA 4BL0A 3IJCA 5JWZA 3PXWD 4X3EA 4J73A 2G9AA 3SXTD 5GSAA 3B7FA 2Q7QA 2QXVA 5EMJB 3SBRA 1K8KC 3HFQA 2B5LA 2GC4A 4O1QD 3IIWA 2PM7B 2B5NA 5IT9g 5HE1B 3ORVD 2H3XA 5EARA 2H9PA 2CE9A 3C99A 4J8GA 2BCJB 1GXRA 3V9FA 4A11B 1OMWB 2IUVA 3E0CA 2O9KA 2Z2NA 3PXTD 3EI3B 4L1QD 3MKSB 2I0TA 5H17A 2EBSA 2PM9A 3MZKA 4OWRA 4QL1A 4FA5D 2H47A 1GG2B 5AFU3 2YNOA 3DXMC 5HE2B 3UVLA 4MK0B 2OK4A 5CXCA 2PM6B 3J81g 4D6VA 3PSCB 3V7DB 3JRPA 4K3ID 4Y7RA 2Z2OA 3RMZD 5HYNB 2CNXA 3F3GA 4GMBA 4QQEA 4CY1A 3I7OA 3P4FA 4GQ2P 4ERZA 3OKWA 5FKTA 2H68A 2B5MA 1VYHC 4GGCA 2CN3A 2H6KA 5EALA 2HJBA 4GQBB 2IUPA 3SFZA 5FLXg 4J81A 4J0XA 3OKTA 1JJUB 4JXMA 3CFSB 4FHLA 4JSXC 4FAVD 1K32A 3FM0A 2HJ4A 2OVQB 4IA9A 3RFHA 4ES0A 1Q47A 5CYKB 4ZOZA 5EMKB 5GXHA 2H6QA 4CY2A 3K27A 4XYIA 4O9DA 5EMMB 1PGUA 4CY5A 2W18A 4YVDA 4CI3A 2AGWA 5IJ7E 4CI2A 3AL8A 3ODTA 5HE3B 2UZXB 4PBZA 3BWSA 2I0RA 3SLED 2HKMA 3OKYA 3IJ0A 4JSNC 1S4UX 3MKQA 2CO0A 4J87A 4A0AB 3VGZA 2P9NC 1N6DA 3ZWLB 1R5MA 4J86A 3PVUB 4CZXA 3I7LA 4CY3A 3AH8B 3DM0A 4AOWA 2OIZA 4LG9A 3I7PA 4A11A 3EI4B 4E54B 5EM2B 1JMZB 4X61B 4N14A 3SBPA 4A09B 4U1EI 5C2WB 1RI6A 3SJLD 3EI3A 4CC9A 4J78A 4CI1A 5TEFA 3CIKB 3MZLA 1B9XA 4GGAA 4GM9A 2IUQA 4CZVA 2J55H 3MMYA 5H1MA 4PNKB 2P9KC 5HE0B 3EWEA 3I8EA 3RLMD 4Z8LA 3EI1A 4A0BB 3BG1A 3FGBA 2P9SC 2HXCA 3PE7A 3UKUC 1A0RB 4X63B 5CXBB 1XHMA 2XL2A 5TDHB 1SQJA 3FRXA 2G99A 4O3UB 4LG8A 5FKQA 4UI9R 1TBGA 5K19A 3I8CA 2YBAA 1N6FA 4D0KA 5IJ8E 2IAAA 2GNQA 4KFMB 4FB1D 3EU7A 1PEVA 3RRMC 4PSXB 3JB9L 4JSPC 3KRWB 4L3GD 2YMUA 4GGDA 3SMRA 4Y5RD 5KDOB 3I7HA 4PC0A 1ERJA 3OL2A 3F3PA 2TRCB
chains in the Genus database with same CATH superfamily
4O3TB 3QHYB 4H5IA 4A08A 2PM9B 1GP2B 2Z2PA 1O6GA 1TYQC 2HKRA 3GC3B 1U2VC 2AGYA 3PXSD 5FQDA 2AQ5A 3EI2A 4JD2C 3UKRC 4AMZA 2IURA 2H9LA 4ZOVA 4A7JA 3L4MD 4NSXA 5TF2A 3C5MA 4NC4A 3GFCA 2VZ1A 1L5GA 4FWWA 3SWSD 5CXCB 3DWLC 3PSLA 4J82A 3JZNA 3KCIA 5GMKn 4A2MA 1B9YA 4E5ZA 4A0AA 3L4OD 3IIYA 1XIPA 4O2WA 3IKOA 3I7NA 3A0FA 2HU8A 3SBQA 4XYHA 3UVKA 5E6SA 1SHYB 3ZDZA 5E6RA 5SXMA 4AMYA 3NVNA 1YFQA 4PXWA 2UZYB 4L1MA 4BUJC 4J0WA 4K3JB 2P9PC 3C75H 4JSVC 5TEEA 5C92A 4E54A 3IURA 4O02A 4GZ8A 5GXIA 2P9UC 3KRXB 4ERYA 3SN6B 4JHNA 2H14A 2HU5A 2H9NA 3NIFA 4R7AB 5I5JA 2AGLA 2BBKH 4ZN4A 3EG6A 3T3PA 2VDMA 2H9MA 4BP9A 4PBYA 3ULEC 3EMHA 2HESX 4FA4D 4IRZA 2PBIB 4FAND 4GM8A 2XU7A 3QI0A 4ESGA 5FKSA 3RN0D 3GREA 3U4YA 4JT5C 2OVPB 5I5MA 2H6NA 1C9IA 5IGQA 1GOTB 3W15A 3K6SA 3I89A 4X60B 3AL9A 4H5JA 1XKSA 5EAMA 1OLZA 3DXKC 3IVMA 5IGOA 4BH6A 1PI6A 3VA6A 5CXBA 2JKXA 4Z7QA 1TYEA 5FXYA 3SHFA 1U4CA 2XL3A 3AL8B 4NAAA 3I7KA 5EAPA 5THAA 3MVDK 3ZE2A 1C9LA 1H2ZA 4BCCA 1E8MA 3JROA 3OKYB 4G56B 2MTAH 2HYEA 5AJAA 4GM3A 2I0SA 3UR4A 1NEXB 3IUMA 3O4HA 2VDLA 3NVQA 3IJEA 1E8NA 5HQGA 2J57G 1MG2A 5C9ZB 2YB8B 3K26A 4ERQA 4CI8A 3MUOA 4FA1D 3UVNA 4J84A 3RFGA 3SCYA 1L0QA 2EIBA 2H13A 3N0EA 1E5TA 4HDJA 4GQ1A 4J77A 2WQ8A 4J8BA 1O6FA 5H14A 3JZHA 3IUJA 3JPXA 4G1MA 3CFVA 3IUQA 3K71A 2AH0A 3F3FA 3SVWD 3N0DA 5CYKA 4ZOYA 3EI1B 2XZGA 3UVOA 5EMLB 2XE4A 3NIGA 1I2MB 3DDUA 2IWFA 5K1CC 3VH0A 2I3TA 4TZ4A 2OJYA 2CE8A 4O45A 1N6EA 1SQ9A 1H2WA 4U7AA 3VI4A 2OVRB 4L9OA 5A2Qg 3I2NA 1MDAH 4QRJA 2YNPA 4CZYA 4UM9A 4OZUA 1NR0A 5M61A 4JT6C 1VZ2A 1BPOA 2OK6A 3OF7A 4BP8A 2AGZA 3JZGA 3AFCA 1MG3A 4LGNA 2IWKA 4DNWA 5I5IA 4MMZA 4RE5A 5FKRA 3JAMg 2GC7A 4XEIC 1PBYB 3J80g 4A2LA 4D9SA 4PSWB 2CO0C 4EWRA 4AN1A 1P22A 1JOFA 2VZ3A 2QC5A 4ZOXA 1T2XA 3EI4A 4I79A 5EM2A 4BCBA 3OL2B 2AGXA 4A09A 2CN2A 4FA9D 4BCDA 3UVMA 4A08B 2VDKA 3BG0A 4NENA 3EI2B 4QT8A 2XYIA 3IJ1A 1QNIA 1VE7A 3RSEC 2BKLA 3MXXA 3T3MA 1JMXB 3DSMA 2P9LC 2YNNA 5IC7A 2J56H 3C9CA 3NVXA 2AH1A 5AMSA 3RN1D 5C86A 2P9IC 5FA5B 4RE6A 3OW8A 5B4WA 4IMMA 5C2VB 4A0BA 4E5ZB 3PVWB 2B4EA 4AEZA 2I3SA 2EIEA 3OTTA 4L3HD 4J79A 3V5WB 1FWXA 4BL0A 3IJCA 5JWZA 3PXWD 4X3EA 4J73A 2G9AA 3SXTD 3FCUA 4Z7NA 3IUNA 5GSAA 3B7FA 2Q7QA 1K3IA 2QXVA 5EMJB 3SBRA 1K8KC 3HFQA 3ZDXA 2B5LA 2GC4A 4O1QD 4UM8A 3IIWA 5FFGA 1YR2A 2PM7B 2B5NA 5M5RA 5IT9g 5HE1B 3ORVD 2H3XA 4G1EA 5EARA 1VZ3A 4AN0A 2H9PA 2CE9A 1GOGA 3C99A 4J8GA 2BCJB 1GXRA 4WK2A 3V9FA 4A11B 5M5TA 1OMWB 3V4PA 2IUVA 3E0CA 2O9KA 2QZPA 2Z2NA 3PXTD 3EI3B 4L1QD 3K72A 1H2XA 2I0TA 3MKSB 5H17A 1UOOA 4DNUA 1QFMA 2EBSA 2PM9A 3MZKA 4OWRA 4QL1A 4FA5D 4Z7OA 2H47A 1GG2B 5AFU3 2YNOA 4WK0A 4AX4A 3DXMC 5HE2B 3UVLA 4MK0B 2OK4A 5CXCA 2PM6B 3J81g 4D6VA 3PSCB 3V7DB 3JRPA 4K3ID 4Y7RA 2Z2OA 3RMZD 5HYNB 2CNXA 3F3GA 4GMBA 3O4IA 1UOQA 4QQEA 4CY1A 3I7OA 3P4FA 4GQ2P 4ERZA 3OKWA 5FKTA 2H68A 2B5MA 1VYHC 2HU7A 2CN3A 2H6KA 4GGCA 5EALA 4MMYA 2VDPA 3IULA 1UTCA 2HJBA 3MUNA 4GQBB 2IUPA 3SFZA 5FLXg 4J81A 4J0XA 3OKTA 1JJUB 5M5VA 4JXMA 3CFSB 4FHLA 4JSXC 4FAVD 1K32A 3FM0A 2HJ4A 3EQ9A 2OVQB 4IA9A 3RFHA 3O4JA 4ES0A 1Q47A 5CYKB 4ZOZA 5EMKB 5GXHA 2EICA 1U8CA 4G55A 2H6QA 4CY2A 3K27A 4XYIA 4O9DA 5EMMB 1PGUA 4CY5A 2W18A 4WJKA 4YVDA 4CI3A 2AGWA 5IJ7E 2VDQA 4CI2A 3AL8A 3ODTA 5HE3B 2UZXB 4PBZA 1GOHA 3BWSA 2I0RA 3SLED 2HKMA 3OKYA 3IJ0A 4JSNC 5E6UA 1S4UX 3MKQA 2CO0A 4J87A 4A0AB 3VGZA 2P9NC 3ZE1A 1N6DA 3EQ7A 3ZE0A 3ZWLB 1R5MA 4J86A 3PVUB 4CZXA 3I7LA 5M5SA 4CY3A 2QR5A 3AH8B 3DM0A 4AOWA 3V4VA 3ZDYA 2OIZA 1H2YA 4LG9A 3I7PA 4A11A 1A12A 3EI4B 4E54B 5EM2B 1JMZB 4X61B 4N14A 3SBPA 4A09B 4U1EI 1QFSA 5C2WB 1RI6A 3SJLD 3EI3A 4CC9A 4J78A 4CI1A 5TEFA 5M5UA 1JV2A 5HDBA 2VC2A 3CIKB 1JTDB 3MZLA 1B9XA 4GGAA 4GM9A 2IUQA 4CZVA 2J55H 3MMYA 5H1MA 4PNKB 2P9KC 5HE0B 3EWEA 3I8EA 4NBMA 3RLMD 4Z8LA 3EI1A 4A0BB 3BG1A 3FGBA 2P9SC 2HXCA 3PE7A 3UKUC 1A0RB 1GOFA 3GD1I 4X63B 5CXBB 1XHMA 2XL2A 1UOPA 3O4GA 3NIDA 5TDHB 1SQJA 3FRXA 2G99A 3EQ8A 4O3UB 4LG8A 2VDNA 3FCSA 5FKQA 4UI9R 1TBGA 5K19A 3I8CA 3VI3A 1M1XA 2YBAA 1N6FA 4D0KA 5IJ8E 4MMXA 4DNVA 2IAAA 2GNQA 2EIDA 1VE6A 4KFMB 4FB1D 3EU7A 1PEVA 3RRMC 4PSXB 5FFOA 3JB9L 2XDWA 2VDRA 3KRWB 4JSPC 4QAMA 4L3GD 2VDOA 2YMUA 4GGDA 4JHPC 3SMRA 4Y5RD 5KDOB 3I7HA 4PC0A 4WK4A 1ERJA 3OL2A 3F3PA 2TRCB
chains in the Genus database with same CATH topology
4O3TB 4H5IA 4A08A 2PM9B 1GP2B 2Z2PA 1TYQC 2HKRA 1U2VC 2AGYA 3PXSD 5FQDA 2AQ5A 3EI2A 4JD2C 3UKRC 2IURA 2H9LA 4ZOVA 4A7JA 3L4MD 4NSXA 5TF2A 3C5MA 3GFCA 4FWWA 3SWSD 5CXCB 3DWLC 3PSLA 4J82A 3JZNA 5GMKn 4A2MA 1B9YA 4E5ZA 4A0AA 3L4OD 3IIYA 1XIPA 3IKOA 3I7NA 3A0FA 3SBQA 4XYHA 3UVKA 1SHYB 5SXMA 3NVNA 1YFQA 4PXWA 2UZYB 4BUJC 4J0WA 4K3JB 2P9PC 3C75H 4JSVC 5TEEA 4E54A 5GXIA 4GZ8A 2P9UC 3KRXB 4ERYA 3SN6B 2H14A 2H9NA 5I5JA 4R7AB 2AGLA 2BBKH 4ZN4A 3EG6A 2H9MA 4PBYA 3ULEC 3EMHA 2HESX 4FA4D 2PBIB 4FAND 4GM8A 2XU7A 4ESGA 5FKSA 3RN0D 3GREA 3U4YA 4JT5C 2OVPB 5I5MA 2H6NA 5IGQA 1GOTB 3W15A 3I89A 4X60B 4H5JA 3AL9A 1XKSA 5EAMA 1OLZA 3DXKC 5IGOA 4BH6A 1PI6A 3VA6A 5CXBA 5FXYA 3SHFA 1U4CA 2XL3A 3AL8B 3I7KA 5EAPA 5THAA 3JROA 3OKYB 4G56B 2MTAH 2HYEA 5AJAA 4GM3A 2I0SA 3UR4A 1NEXB 3NVQA 5HQGA 2J57G 1MG2A 5C9ZB 2YB8B 3K26A 4ERQA 4CI8A 4FA1D 3UVNA 4J84A 3RFGA 3SCYA 1L0QA 2H13A 3N0EA 4HDJA 4GQ1A 4J77A 4J8BA 5H14A 3JZHA 3JPXA 3CFVA 2AH0A 3F3FA 3SVWD 3N0DA 5CYKA 4ZOYA 3EI1B 3UVOA 5EMLB 5K1CC 2IWFA 3VH0A 2I3TA 4TZ4A 2OJYA 2CE8A 4O45A 1N6EA 1SQ9A 4U7AA 2OVRB 4L9OA 5A2Qg 3I2NA 1MDAH 4QRJA 2YNPA 4CZYA 4OZUA 1NR0A 4JT6C 2OK6A 2AGZA 3JZGA 3AFCA 1MG3A 4LGNA 2IWKA 5I5IA 5FKRA 3JAMg 2GC7A 4XEIC 1PBYB 3J80g 4A2LA 4PSWB 2CO0C 4EWRA 1P22A 1JOFA 2QC5A 4ZOXA 3EI4A 4I79A 5EM2A 3OL2B 2AGXA 4A09A 2CN2A 4FA9D 3UVMA 4A08B 3BG0A 3EI2B 4QT8A 2XYIA 3IJ1A 1QNIA 3RSEC 3MXXA 1JMXB 3DSMA 2P9LC 2YNNA 5IC7A 2J56H 3C9CA 3NVXA 2AH1A 5AMSA 3RN1D 2P9IC 5FA5B 3OW8A 5B4WA 4IMMA 5C2VB 4A0BA 4E5ZB 3PVWB 2B4EA 4AEZA 2I3SA 3OTTA 4L3HD 4J79A 3V5WB 1FWXA 4BL0A 3IJCA 5JWZA 3PXWD 4X3EA 4J73A 2G9AA 3SXTD 5GSAA 3B7FA 2Q7QA 2QXVA 5EMJB 3SBRA 1K8KC 3HFQA 2B5LA 2GC4A 4O1QD 3IIWA 2PM7B 2B5NA 5IT9g 5HE1B 3ORVD 2H3XA 5EARA 2H9PA 2CE9A 3C99A 4J8GA 2BCJB 1GXRA 3V9FA 4A11B 1OMWB 2IUVA 3E0CA 2O9KA 2Z2NA 3PXTD 3EI3B 4L1QD 3MKSB 2I0TA 5H17A 2EBSA 2PM9A 3MZKA 4OWRA 4QL1A 4FA5D 2H47A 1GG2B 5AFU3 2YNOA 3DXMC 5HE2B 3UVLA 4MK0B 2OK4A 5CXCA 2PM6B 3J81g 4D6VA 3PSCB 3V7DB 3JRPA 4K3ID 4Y7RA 2Z2OA 3RMZD 5HYNB 2CNXA 3F3GA 4GMBA 4QQEA 4CY1A 3I7OA 3P4FA 4GQ2P 4ERZA 3OKWA 5FKTA 2H68A 2B5MA 1VYHC 4GGCA 2CN3A 2H6KA 5EALA 2HJBA 4GQBB 2IUPA 3SFZA 5FLXg 4J81A 4J0XA 3OKTA 1JJUB 4JXMA 3CFSB 4FHLA 4JSXC 4FAVD 1K32A 3FM0A 2HJ4A 2OVQB 4IA9A 3RFHA 4ES0A 1Q47A 5CYKB 4ZOZA 5EMKB 5GXHA 2H6QA 4CY2A 3K27A 4XYIA 4O9DA 5EMMB 1PGUA 4CY5A 2W18A 4YVDA 4CI3A 2AGWA 5IJ7E 4CI2A 3AL8A 3ODTA 5HE3B 2UZXB 4PBZA 3BWSA 2I0RA 3SLED 2HKMA 3OKYA 3IJ0A 4JSNC 1S4UX 3MKQA 2CO0A 4J87A 4A0AB 3VGZA 2P9NC 1N6DA 3ZWLB 1R5MA 4J86A 3PVUB 4CZXA 3I7LA 4CY3A 3AH8B 3DM0A 4AOWA 2OIZA 4LG9A 3I7PA 4A11A 3EI4B 4E54B 5EM2B 1JMZB 4X61B 4N14A 3SBPA 4A09B 4U1EI 5C2WB 1RI6A 3SJLD 3EI3A 4CC9A 4J78A 4CI1A 5TEFA 3CIKB 3MZLA 1B9XA 4GGAA 4GM9A 2IUQA 4CZVA 2J55H 3MMYA 5H1MA 4PNKB 2P9KC 5HE0B 3EWEA 3I8EA 3RLMD 4Z8LA 3EI1A 4A0BB 3BG1A 3FGBA 2P9SC 2HXCA 3PE7A 3UKUC 1A0RB 4X63B 5CXBB 1XHMA 2XL2A 5TDHB 1SQJA 3FRXA 2G99A 4O3UB 4LG8A 5FKQA 4UI9R 1TBGA 5K19A 3I8CA 2YBAA 1N6FA 4D0KA 5IJ8E 2IAAA 2GNQA 4KFMB 4FB1D 3EU7A 1PEVA 3RRMC 4PSXB 3JB9L 4JSPC 3KRWB 4L3GD 2YMUA 4GGDA 3SMRA 4Y5RD 5KDOB 3I7HA 4PC0A 1ERJA 3OL2A 3F3PA 2TRCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3T B;  4H5I A;  4A08 A;  2PM9 B;  1GP2 B;  2Z2P A;  1TYQ C;  2HKR A;  1U2V C;  2AGY A;  3PXS D;  5FQD A;  2AQ5 A;  3EI2 A;  4JD2 C;  3UKR C;  2IUR A;  2H9L A;  4ZOV A;  4A7J A;  3L4M D;  4NSX A;  5TF2 A;  3C5M A;  3GFC A;  4FWW A;  3SWS D;  5CXC B;  3DWL C;  3PSL A;  4J82 A;  3JZN A;  5GMK n;  4A2M A;  1B9Y A;  4E5Z A;  4A0A A;  3L4O D;  3IIY A;  1XIP A;  3IKO A;  3I7N A;  3A0F A;  3SBQ A;  4XYH A;  3UVK A;  1SHY B;  5SXM A;  3NVN A;  1YFQ A;  4PXW A;  2UZY B;  4BUJ C;  4J0W A;  4K3J B;  2P9P C;  3C75 H;  4JSV C;  5TEE A;  4E54 A;  5GXI A;  4GZ8 A;  2P9U C;  3KRX B;  4ERY A;  3SN6 B;  2H14 A;  2H9N A;  5I5J A;  4R7A B;  2AGL A;  2BBK H;  4ZN4 A;  3EG6 A;  2H9M A;  4PBY A;  3ULE C;  3EMH A;  2HES X;  4FA4 D;  2PBI B;  4FAN D;  4GM8 A;  2XU7 A;  4ESG A;  5FKS A;  3RN0 D;  3GRE A;  3U4Y A;  4JT5 C;  2OVP B;  5I5M A;  2H6N A;  5IGQ A;  1GOT B;  3W15 A;  3I89 A;  4X60 B;  4H5J A;  3AL9 A;  1XKS A;  5EAM A;  1OLZ A;  3DXK C;  5IGO A;  4BH6 A;  1PI6 A;  3VA6 A;  5CXB A;  5FXY A;  3SHF A;  1U4C A;  2XL3 A;  3AL8 B;  3I7K A;  5EAP A;  5THA A;  3JRO A;  3OKY B;  4G56 B;  2MTA H;  2HYE A;  5AJA A;  4GM3 A;  2I0S A;  3UR4 A;  1NEX B;  3NVQ A;  5HQG A;  2J57 G;  1MG2 A;  5C9Z B;  2YB8 B;  3K26 A;  4ERQ A;  4CI8 A;  4FA1 D;  3UVN A;  4J84 A;  3RFG A;  3SCY A;  1L0Q A;  2H13 A;  3N0E A;  4HDJ A;  4GQ1 A;  4J77 A;  4J8B A;  5H14 A;  3JZH A;  3JPX A;  3CFV A;  2AH0 A;  3F3F A;  3SVW D;  3N0D A;  5CYK A;  4ZOY A;  3EI1 B;  3UVO A;  5EML B;  5K1C C;  2IWF A;  3VH0 A;  2I3T A;  4TZ4 A;  2OJY A;  2CE8 A;  4O45 A;  1N6E A;  1SQ9 A;  4U7A A;  2OVR B;  4L9O A;  5A2Q g;  3I2N A;  1MDA H;  4QRJ A;  2YNP A;  4CZY A;  4OZU A;  1NR0 A;  4JT6 C;  2OK6 A;  2AGZ A;  3JZG A;  3AFC A;  1MG3 A;  4LGN A;  2IWK A;  5I5I A;  5FKR A;  3JAM g;  2GC7 A;  4XEI C;  1PBY B;  3J80 g;  4A2L A;  4PSW B;  2CO0 C;  4EWR A;  1P22 A;  1JOF A;  2QC5 A;  4ZOX A;  3EI4 A;  4I79 A;  5EM2 A;  3OL2 B;  2AGX A;  4A09 A;  2CN2 A;  4FA9 D;  3UVM A;  4A08 B;  3BG0 A;  3EI2 B;  4QT8 A;  2XYI A;  3IJ1 A;  1QNI A;  3RSE C;  3MXX A;  1JMX B;  3DSM A;  2P9L C;  2YNN A;  5IC7 A;  2J56 H;  3C9C A;  3NVX A;  2AH1 A;  5AMS A;  3RN1 D;  2P9I C;  5FA5 B;  3OW8 A;  5B4W A;  4IMM A;  5C2V B;  4A0B A;  4E5Z B;  3PVW B;  2B4E A;  4AEZ A;  2I3S A;  3OTT A;  4L3H D;  4J79 A;  3V5W B;  1FWX A;  4BL0 A;  3IJC A;  5JWZ A;  3PXW D;  4X3E A;  4J73 A;  2G9A A;  3SXT D;  5GSA A;  3B7F A;  2Q7Q A;  2QXV A;  5EMJ B;  3SBR A;  1K8K C;  3HFQ A;  2B5L A;  2GC4 A;  4O1Q D;  3IIW A;  2PM7 B;  2B5N A;  5IT9 g;  5HE1 B;  3ORV D;  2H3X A;  5EAR A;  2H9P A;  2CE9 A;  3C99 A;  4J8G A;  2BCJ B;  1GXR A;  3V9F A;  4A11 B;  1OMW B;  2IUV A;  3E0C A;  2O9K A;  2Z2N A;  3PXT D;  3EI3 B;  4L1Q D;  3MKS B;  2I0T A;  5H17 A;  2EBS A;  2PM9 A;  3MZK A;  4OWR A;  4QL1 A;  4FA5 D;  2H47 A;  1GG2 B;  5AFU 3;  2YNO A;  3DXM C;  5HE2 B;  3UVL A;  4MK0 B;  2OK4 A;  5CXC A;  2PM6 B;  3J81 g;  4D6V A;  3PSC B;  3V7D B;  3JRP A;  4K3I D;  4Y7R A;  2Z2O A;  3RMZ D;  5HYN B;  2CNX A;  3F3G A;  4GMB A;  4QQE A;  4CY1 A;  3I7O A;  3P4F A;  4GQ2 P;  4ERZ A;  3OKW A;  5FKT A;  2H68 A;  2B5M A;  1VYH C;  4GGC A;  2CN3 A;  2H6K A;  5EAL A;  2HJB A;  4GQB B;  2IUP A;  3SFZ A;  5FLX g;  4J81 A;  4J0X A;  3OKT A;  1JJU B;  4JXM A;  3CFS B;  4FHL A;  4JSX C;  4FAV D;  1K32 A;  3FM0 A;  2HJ4 A;  2OVQ B;  4IA9 A;  3RFH A;  4ES0 A;  1Q47 A;  5CYK B;  4ZOZ A;  5EMK B;  5GXH A;  2H6Q A;  4CY2 A;  3K27 A;  4XYI A;  4O9D A;  5EMM B;  1PGU A;  4CY5 A;  2W18 A;  4YVD A;  4CI3 A;  2AGW A;  5IJ7 E;  4CI2 A;  3AL8 A;  3ODT A;  5HE3 B;  2UZX B;  4PBZ A;  3BWS A;  2I0R A;  3SLE D;  2HKM A;  3OKY A;  3IJ0 A;  4JSN C;  1S4U X;  3MKQ A;  2CO0 A;  4J87 A;  4A0A B;  3VGZ A;  2P9N C;  1N6D A;  3ZWL B;  1R5M A;  4J86 A;  3PVU B;  4CZX A;  3I7L A;  4CY3 A;  3AH8 B;  3DM0 A;  4AOW A;  2OIZ A;  4LG9 A;  3I7P A;  4A11 A;  3EI4 B;  4E54 B;  5EM2 B;  1JMZ B;  4X61 B;  4N14 A;  3SBP A;  4A09 B;  4U1E I;  5C2W B;  1RI6 A;  3SJL D;  3EI3 A;  4CC9 A;  4J78 A;  4CI1 A;  5TEF A;  3CIK B;  3MZL A;  1B9X A;  4GGA A;  4GM9 A;  2IUQ A;  4CZV A;  2J55 H;  3MMY A;  5H1M A;  4PNK B;  2P9K C;  5HE0 B;  3EWE A;  3I8E A;  3RLM D;  4Z8L A;  3EI1 A;  4A0B B;  3BG1 A;  3FGB A;  2P9S C;  2HXC A;  3PE7 A;  3UKU C;  1A0R B;  4X63 B;  5CXB B;  1XHM A;  2XL2 A;  5TDH B;  1SQJ A;  3FRX A;  2G99 A;  4O3U B;  4LG8 A;  5FKQ A;  4UI9 R;  1TBG A;  5K19 A;  3I8C A;  2YBA A;  1N6F A;  4D0K A;  5IJ8 E;  2IAA A;  2GNQ A;  4KFM B;  4FB1 D;  3EU7 A;  1PEV A;  3RRM C;  4PSX B;  3JB9 L;  4JSP C;  3KRW B;  4L3G D;  2YMU A;  4GGD A;  3SMR A;  4Y5R D;  5KDO B;  3I7H A;  4PC0 A;  1ERJ A;  3OL2 A;  3F3P A;  2TRC B; 
#chains in the Genus database with same CATH topology
 4O3T B;  3QHY B;  4H5I A;  4A08 A;  2PM9 B;  1GP2 B;  2Z2P A;  1O6G A;  1TYQ C;  2HKR A;  3GC3 B;  1U2V C;  2AGY A;  3PXS D;  5FQD A;  2AQ5 A;  3EI2 A;  4JD2 C;  3UKR C;  4AMZ A;  2IUR A;  2H9L A;  4ZOV A;  4A7J A;  3L4M D;  4NSX A;  5TF2 A;  3C5M A;  4NC4 A;  3GFC A;  2VZ1 A;  1L5G A;  4FWW A;  3SWS D;  5CXC B;  3DWL C;  3PSL A;  4J82 A;  3JZN A;  3KCI A;  5GMK n;  4A2M A;  1B9Y A;  4E5Z A;  4A0A A;  3L4O D;  3IIY A;  1XIP A;  4O2W A;  3IKO A;  3I7N A;  3A0F A;  2HU8 A;  3SBQ A;  4XYH A;  3UVK A;  5E6S A;  1SHY B;  3ZDZ A;  5E6R A;  5SXM A;  4AMY A;  3NVN A;  1YFQ A;  4PXW A;  2UZY B;  4L1M A;  4BUJ C;  4J0W A;  4K3J B;  2P9P C;  3C75 H;  4JSV C;  5TEE A;  5C92 A;  4E54 A;  3IUR A;  4O02 A;  4GZ8 A;  5GXI A;  2P9U C;  3KRX B;  4ERY A;  3SN6 B;  4JHN A;  2H14 A;  2HU5 A;  2H9N A;  3NIF A;  4R7A B;  5I5J A;  2AGL A;  2BBK H;  4ZN4 A;  3EG6 A;  3T3P A;  2VDM A;  2H9M A;  4BP9 A;  4PBY A;  3ULE C;  3EMH A;  2HES X;  4FA4 D;  4IRZ A;  2PBI B;  4FAN D;  4GM8 A;  2XU7 A;  3QI0 A;  4ESG A;  5FKS A;  3RN0 D;  3GRE A;  3U4Y A;  4JT5 C;  2OVP B;  5I5M A;  2H6N A;  1C9I A;  5IGQ A;  1GOT B;  3W15 A;  3K6S A;  3I89 A;  4X60 B;  3AL9 A;  4H5J A;  1XKS A;  5EAM A;  1OLZ A;  3DXK C;  3IVM A;  5IGO A;  4BH6 A;  1PI6 A;  3VA6 A;  5CXB A;  2JKX A;  4Z7Q A;  1TYE A;  5FXY A;  3SHF A;  1U4C A;  2XL3 A;  3AL8 B;  4NAA A;  3I7K A;  5EAP A;  5THA A;  3MVD K;  3ZE2 A;  1C9L A;  1H2Z A;  4BCC A;  1E8M A;  3JRO A;  3OKY B;  4G56 B;  2MTA H;  2HYE A;  5AJA A;  4GM3 A;  2I0S A;  3UR4 A;  1NEX B;  3IUM A;  3O4H A;  2VDL A;  3NVQ A;  3IJE A;  1E8N A;  5HQG A;  2J57 G;  1MG2 A;  5C9Z B;  2YB8 B;  3K26 A;  4ERQ A;  4CI8 A;  3MUO A;  4FA1 D;  3UVN A;  4J84 A;  3RFG A;  3SCY A;  1L0Q A;  2EIB A;  2H13 A;  3N0E A;  1E5T A;  4HDJ A;  4GQ1 A;  4J77 A;  2WQ8 A;  4J8B A;  1O6F A;  5H14 A;  3JZH A;  3IUJ A;  3JPX A;  4G1M A;  3CFV A;  3IUQ A;  3K71 A;  2AH0 A;  3F3F A;  3SVW D;  3N0D A;  5CYK A;  4ZOY A;  3EI1 B;  2XZG A;  3UVO A;  5EML B;  2XE4 A;  3NIG A;  1I2M B;  3DDU A;  2IWF A;  5K1C C;  3VH0 A;  2I3T A;  4TZ4 A;  2OJY A;  2CE8 A;  4O45 A;  1N6E A;  1SQ9 A;  1H2W A;  4U7A A;  3VI4 A;  2OVR B;  4L9O A;  5A2Q g;  3I2N A;  1MDA H;  4QRJ A;  2YNP A;  4CZY A;  4UM9 A;  4OZU A;  1NR0 A;  5M61 A;  4JT6 C;  1VZ2 A;  1BPO A;  2OK6 A;  3OF7 A;  4BP8 A;  2AGZ A;  3JZG A;  3AFC A;  1MG3 A;  4LGN A;  2IWK A;  4DNW A;  5I5I A;  4MMZ A;  4RE5 A;  5FKR A;  3JAM g;  2GC7 A;  4XEI C;  1PBY B;  3J80 g;  4A2L A;  4D9S A;  4PSW B;  2CO0 C;  4EWR A;  4AN1 A;  1P22 A;  1JOF A;  2VZ3 A;  2QC5 A;  4ZOX A;  1T2X A;  3EI4 A;  4I79 A;  5EM2 A;  4BCB A;  3OL2 B;  2AGX A;  4A09 A;  2CN2 A;  4FA9 D;  4BCD A;  3UVM A;  4A08 B;  2VDK A;  3BG0 A;  4NEN A;  3EI2 B;  4QT8 A;  2XYI A;  3IJ1 A;  1QNI A;  1VE7 A;  3RSE C;  2BKL A;  3MXX A;  3T3M A;  1JMX B;  3DSM A;  2P9L C;  2YNN A;  5IC7 A;  2J56 H;  3C9C A;  3NVX A;  2AH1 A;  5AMS A;  3RN1 D;  5C86 A;  2P9I C;  5FA5 B;  4RE6 A;  3OW8 A;  5B4W A;  4IMM A;  5C2V B;  4A0B A;  4E5Z B;  3PVW B;  2B4E A;  4AEZ A;  2I3S A;  2EIE A;  3OTT A;  4L3H D;  4J79 A;  3V5W B;  1FWX A;  4BL0 A;  3IJC A;  5JWZ A;  3PXW D;  4X3E A;  4J73 A;  2G9A A;  3SXT D;  3FCU A;  4Z7N A;  3IUN A;  5GSA A;  3B7F A;  2Q7Q A;  1K3I A;  2QXV A;  5EMJ B;  3SBR A;  1K8K C;  3HFQ A;  3ZDX A;  2B5L A;  2GC4 A;  4O1Q D;  4UM8 A;  3IIW A;  5FFG A;  1YR2 A;  2PM7 B;  2B5N A;  5M5R A;  5IT9 g;  5HE1 B;  3ORV D;  2H3X A;  4G1E A;  5EAR A;  1VZ3 A;  4AN0 A;  2H9P A;  2CE9 A;  1GOG A;  3C99 A;  4J8G A;  2BCJ B;  1GXR A;  4WK2 A;  3V9F A;  4A11 B;  5M5T A;  1OMW B;  3V4P A;  2IUV A;  3E0C A;  2O9K A;  2QZP A;  2Z2N A;  3PXT D;  3EI3 B;  4L1Q D;  3K72 A;  1H2X A;  2I0T A;  3MKS B;  5H17 A;  1UOO A;  4DNU A;  1QFM A;  2EBS A;  2PM9 A;  3MZK A;  4OWR A;  4QL1 A;  4FA5 D;  4Z7O A;  2H47 A;  1GG2 B;  5AFU 3;  2YNO A;  4WK0 A;  4AX4 A;  3DXM C;  5HE2 B;  3UVL A;  4MK0 B;  2OK4 A;  5CXC A;  2PM6 B;  3J81 g;  4D6V A;  3PSC B;  3V7D B;  3JRP A;  4K3I D;  4Y7R A;  2Z2O A;  3RMZ D;  5HYN B;  2CNX A;  3F3G A;  4GMB A;  3O4I A;  1UOQ A;  4QQE A;  4CY1 A;  3I7O A;  3P4F A;  4GQ2 P;  4ERZ A;  3OKW A;  5FKT A;  2H68 A;  2B5M A;  1VYH C;  2HU7 A;  2CN3 A;  2H6K A;  4GGC A;  5EAL A;  4MMY A;  2VDP A;  3IUL A;  1UTC A;  2HJB A;  3MUN A;  4GQB B;  2IUP A;  3SFZ A;  5FLX g;  4J81 A;  4J0X A;  3OKT A;  1JJU B;  5M5V A;  4JXM A;  3CFS B;  4FHL A;  4JSX C;  4FAV D;  1K32 A;  3FM0 A;  2HJ4 A;  3EQ9 A;  2OVQ B;  4IA9 A;  3RFH A;  3O4J A;  4ES0 A;  1Q47 A;  5CYK B;  4ZOZ A;  5EMK B;  5GXH A;  2EIC A;  1U8C A;  4G55 A;  2H6Q A;  4CY2 A;  3K27 A;  4XYI A;  4O9D A;  5EMM B;  1PGU A;  4CY5 A;  2W18 A;  4WJK A;  4YVD A;  4CI3 A;  2AGW A;  5IJ7 E;  2VDQ A;  4CI2 A;  3AL8 A;  3ODT A;  5HE3 B;  2UZX B;  4PBZ A;  1GOH A;  3BWS A;  2I0R A;  3SLE D;  2HKM A;  3OKY A;  3IJ0 A;  4JSN C;  5E6U A;  1S4U X;  3MKQ A;  2CO0 A;  4J87 A;  4A0A B;  3VGZ A;  2P9N C;  3ZE1 A;  1N6D A;  3EQ7 A;  3ZE0 A;  3ZWL B;  1R5M A;  4J86 A;  3PVU B;  4CZX A;  3I7L A;  5M5S A;  4CY3 A;  2QR5 A;  3AH8 B;  3DM0 A;  4AOW A;  3V4V A;  3ZDY A;  2OIZ A;  1H2Y A;  4LG9 A;  3I7P A;  4A11 A;  1A12 A;  3EI4 B;  4E54 B;  5EM2 B;  1JMZ B;  4X61 B;  4N14 A;  3SBP A;  4A09 B;  4U1E I;  1QFS A;  5C2W B;  1RI6 A;  3SJL D;  3EI3 A;  4CC9 A;  4J78 A;  4CI1 A;  5TEF A;  5M5U A;  1JV2 A;  5HDB A;  2VC2 A;  3CIK B;  1JTD B;  3MZL A;  1B9X A;  4GGA A;  4GM9 A;  2IUQ A;  4CZV A;  2J55 H;  3MMY A;  5H1M A;  4PNK B;  2P9K C;  5HE0 B;  3EWE A;  3I8E A;  4NBM A;  3RLM D;  4Z8L A;  3EI1 A;  4A0B B;  3BG1 A;  3FGB A;  2P9S C;  2HXC A;  3PE7 A;  3UKU C;  1A0R B;  1GOF A;  3GD1 I;  4X63 B;  5CXB B;  1XHM A;  2XL2 A;  1UOP A;  3O4G A;  3NID A;  5TDH B;  1SQJ A;  3FRX A;  2G99 A;  3EQ8 A;  4O3U B;  4LG8 A;  2VDN A;  3FCS A;  5FKQ A;  4UI9 R;  1TBG A;  5K19 A;  3I8C A;  3VI3 A;  1M1X A;  2YBA A;  1N6F A;  4D0K A;  5IJ8 E;  4MMX A;  4DNV A;  2IAA A;  2GNQ A;  2EID A;  1VE6 A;  4KFM B;  4FB1 D;  3EU7 A;  1PEV A;  3RRM C;  4PSX B;  5FFO A;  3JB9 L;  2XDW A;  2VDR A;  3KRW B;  4JSP C;  4QAM A;  4L3G D;  2VDO A;  2YMU A;  4GGD A;  4JHP C;  3SMR A;  4Y5R D;  5KDO B;  3I7H A;  4PC0 A;  4WK4 A;  1ERJ A;  3OL2 A;  3F3P A;  2TRC B; 
#chains in the Genus database with same CATH homology
 4O3T B;  4H5I A;  4A08 A;  2PM9 B;  1GP2 B;  2Z2P A;  1TYQ C;  2HKR A;  1U2V C;  2AGY A;  3PXS D;  5FQD A;  2AQ5 A;  3EI2 A;  4JD2 C;  3UKR C;  2IUR A;  2H9L A;  4ZOV A;  4A7J A;  3L4M D;  4NSX A;  5TF2 A;  3C5M A;  3GFC A;  4FWW A;  3SWS D;  5CXC B;  3DWL C;  3PSL A;  4J82 A;  3JZN A;  5GMK n;  4A2M A;  1B9Y A;  4E5Z A;  4A0A A;  3L4O D;  3IIY A;  1XIP A;  3IKO A;  3I7N A;  3A0F A;  3SBQ A;  4XYH A;  3UVK A;  1SHY B;  5SXM A;  3NVN A;  1YFQ A;  4PXW A;  2UZY B;  4BUJ C;  4J0W A;  4K3J B;  2P9P C;  3C75 H;  4JSV C;  5TEE A;  4E54 A;  5GXI A;  4GZ8 A;  2P9U C;  3KRX B;  4ERY A;  3SN6 B;  2H14 A;  2H9N A;  5I5J A;  4R7A B;  2AGL A;  2BBK H;  4ZN4 A;  3EG6 A;  2H9M A;  4PBY A;  3ULE C;  3EMH A;  2HES X;  4FA4 D;  2PBI B;  4FAN D;  4GM8 A;  2XU7 A;  4ESG A;  5FKS A;  3RN0 D;  3GRE A;  3U4Y A;  4JT5 C;  2OVP B;  5I5M A;  2H6N A;  5IGQ A;  1GOT B;  3W15 A;  3I89 A;  4X60 B;  4H5J A;  3AL9 A;  1XKS A;  5EAM A;  1OLZ A;  3DXK C;  5IGO A;  4BH6 A;  1PI6 A;  3VA6 A;  5CXB A;  5FXY A;  3SHF A;  1U4C A;  2XL3 A;  3AL8 B;  3I7K A;  5EAP A;  5THA A;  3JRO A;  3OKY B;  4G56 B;  2MTA H;  2HYE A;  5AJA A;  4GM3 A;  2I0S A;  3UR4 A;  1NEX B;  3NVQ A;  5HQG A;  2J57 G;  1MG2 A;  5C9Z B;  2YB8 B;  3K26 A;  4ERQ A;  4CI8 A;  4FA1 D;  3UVN A;  4J84 A;  3RFG A;  3SCY A;  1L0Q A;  2H13 A;  3N0E A;  4HDJ A;  4GQ1 A;  4J77 A;  4J8B A;  5H14 A;  3JZH A;  3JPX A;  3CFV A;  2AH0 A;  3F3F A;  3SVW D;  3N0D A;  5CYK A;  4ZOY A;  3EI1 B;  3UVO A;  5EML B;  5K1C C;  2IWF A;  3VH0 A;  2I3T A;  4TZ4 A;  2OJY A;  2CE8 A;  4O45 A;  1N6E A;  1SQ9 A;  4U7A A;  2OVR B;  4L9O A;  5A2Q g;  3I2N A;  1MDA H;  4QRJ A;  2YNP A;  4CZY A;  4OZU A;  1NR0 A;  4JT6 C;  2OK6 A;  2AGZ A;  3JZG A;  3AFC A;  1MG3 A;  4LGN A;  2IWK A;  5I5I A;  5FKR A;  3JAM g;  2GC7 A;  4XEI C;  1PBY B;  3J80 g;  4A2L A;  4PSW B;  2CO0 C;  4EWR A;  1P22 A;  1JOF A;  2QC5 A;  4ZOX A;  3EI4 A;  4I79 A;  5EM2 A;  3OL2 B;  2AGX A;  4A09 A;  2CN2 A;  4FA9 D;  3UVM A;  4A08 B;  3BG0 A;  3EI2 B;  4QT8 A;  2XYI A;  3IJ1 A;  1QNI A;  3RSE C;  3MXX A;  1JMX B;  3DSM A;  2P9L C;  2YNN A;  5IC7 A;  2J56 H;  3C9C A;  3NVX A;  2AH1 A;  5AMS A;  3RN1 D;  2P9I C;  5FA5 B;  3OW8 A;  5B4W A;  4IMM A;  5C2V B;  4A0B A;  4E5Z B;  3PVW B;  2B4E A;  4AEZ A;  2I3S A;  3OTT A;  4L3H D;  4J79 A;  3V5W B;  1FWX A;  4BL0 A;  3IJC A;  5JWZ A;  3PXW D;  4X3E A;  4J73 A;  2G9A A;  3SXT D;  5GSA A;  3B7F A;  2Q7Q A;  2QXV A;  5EMJ B;  3SBR A;  1K8K C;  3HFQ A;  2B5L A;  2GC4 A;  4O1Q D;  3IIW A;  2PM7 B;  2B5N A;  5IT9 g;  5HE1 B;  3ORV D;  2H3X A;  5EAR A;  2H9P A;  2CE9 A;  3C99 A;  4J8G A;  2BCJ B;  1GXR A;  3V9F A;  4A11 B;  1OMW B;  2IUV A;  3E0C A;  2O9K A;  2Z2N A;  3PXT D;  3EI3 B;  4L1Q D;  3MKS B;  2I0T A;  5H17 A;  2EBS A;  2PM9 A;  3MZK A;  4OWR A;  4QL1 A;  4FA5 D;  2H47 A;  1GG2 B;  5AFU 3;  2YNO A;  3DXM C;  5HE2 B;  3UVL A;  4MK0 B;  2OK4 A;  5CXC A;  2PM6 B;  3J81 g;  4D6V A;  3PSC B;  3V7D B;  3JRP A;  4K3I D;  4Y7R A;  2Z2O A;  3RMZ D;  5HYN B;  2CNX A;  3F3G A;  4GMB A;  4QQE A;  4CY1 A;  3I7O A;  3P4F A;  4GQ2 P;  4ERZ A;  3OKW A;  5FKT A;  2H68 A;  2B5M A;  1VYH C;  4GGC A;  2CN3 A;  2H6K A;  5EAL A;  2HJB A;  4GQB B;  2IUP A;  3SFZ A;  5FLX g;  4J81 A;  4J0X A;  3OKT A;  1JJU B;  4JXM A;  3CFS B;  4FHL A;  4JSX C;  4FAV D;  1K32 A;  3FM0 A;  2HJ4 A;  2OVQ B;  4IA9 A;  3RFH A;  4ES0 A;  1Q47 A;  5CYK B;  4ZOZ A;  5EMK B;  5GXH A;  2H6Q A;  4CY2 A;  3K27 A;  4XYI A;  4O9D A;  5EMM B;  1PGU A;  4CY5 A;  2W18 A;  4YVD A;  4CI3 A;  2AGW A;  5IJ7 E;  4CI2 A;  3AL8 A;  3ODT A;  5HE3 B;  2UZX B;  4PBZ A;  3BWS A;  2I0R A;  3SLE D;  2HKM A;  3OKY A;  3IJ0 A;  4JSN C;  1S4U X;  3MKQ A;  2CO0 A;  4J87 A;  4A0A B;  3VGZ A;  2P9N C;  1N6D A;  3ZWL B;  1R5M A;  4J86 A;  3PVU B;  4CZX A;  3I7L A;  4CY3 A;  3AH8 B;  3DM0 A;  4AOW A;  2OIZ A;  4LG9 A;  3I7P A;  4A11 A;  3EI4 B;  4E54 B;  5EM2 B;  1JMZ B;  4X61 B;  4N14 A;  3SBP A;  4A09 B;  4U1E I;  5C2W B;  1RI6 A;  3SJL D;  3EI3 A;  4CC9 A;  4J78 A;  4CI1 A;  5TEF A;  3CIK B;  3MZL A;  1B9X A;  4GGA A;  4GM9 A;  2IUQ A;  4CZV A;  2J55 H;  3MMY A;  5H1M A;  4PNK B;  2P9K C;  5HE0 B;  3EWE A;  3I8E A;  3RLM D;  4Z8L A;  3EI1 A;  4A0B B;  3BG1 A;  3FGB A;  2P9S C;  2HXC A;  3PE7 A;  3UKU C;  1A0R B;  4X63 B;  5CXB B;  1XHM A;  2XL2 A;  5TDH B;  1SQJ A;  3FRX A;  2G99 A;  4O3U B;  4LG8 A;  5FKQ A;  4UI9 R;  1TBG A;  5K19 A;  3I8C A;  2YBA A;  1N6F A;  4D0K A;  5IJ8 E;  2IAA A;  2GNQ A;  4KFM B;  4FB1 D;  3EU7 A;  1PEV A;  3RRM C;  4PSX B;  3JB9 L;  4JSP C;  3KRW B;  4L3G D;  2YMU A;  4GGD A;  3SMR A;  4Y5R D;  5KDO B;  3I7H A;  4PC0 A;  1ERJ A;  3OL2 A;  3F3P A;  2TRC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...