3UR4A

Crystal structure of human wd repeat domain 5 with compound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
303
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/inhibitor
molecule keywords WD repeat-containing protein 5
publication title Small-molecule inhibition of MLL activity by disruption of its interaction with WDR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3ur4A00
3C5MA 5I5JA 3PXSD 4A2LA 5A2Qg 2AGWA 1FWXA 2YNPA 3JZHA 3UVOA 3PSCB 3VGZA 3RMZD 4E5ZA 1U2VC 3I7OA 5CXBA 2H13A 4Y7RA 3OL2A 4J81A 3IJ0A 2H9MA 4TZ4A 4PXWA 5IJ7E 5EMKB 4CI8A 2OK6A 3I7NA 4ES0A 4K3JB 2YNOA 2H9NA 2CE8A 2HKMA 5GXIA 4GM9A 3BWSA 3V5WB 3GREA 2QC5A 3SMRA 4MK0B 5C2WB 1PGUA 4QT8A 4GZ8A 4ERQA 3CFVA 2CO0C 4FAND 3C75H 1P22A 3MMYA 3I7PA 4E5ZB 2PM7B 4JSPC 2MTAH 4CI2A 1MG2A 1XKSA 3F3PA 5CXBB 2B5MA 3OL2B 4E54A 3J80g 5TDHB 1GXRA 3EU7A 4O1QD 4ZOYA 1B9YA 5IT9g 1QNIA 1GOTB 4FA5D 3SFZA 4FA4D 5IC7A 4PNKB 3JPXA 4PC0A 4ZOZA 3IJ1A 1N6EA 3PE7A 1GP2B 3EI3A 2Z2PA 4O3TB 2B4EA 5EALA 2Z2OA 4L9OA 5JWZA 4L1QD 2HJBA 4JXMA 1K8KC 1S4UX 4G56B 2I0SA 4A11A 3F3FA 5SXMA 2CN2A 2P9LC 2EBSA 4XEIC 4PSXB 2AGXA 3KRWB 3OKTA 3SWSD 3RN0D 4UI9R 2XYIA 5TEFA 3KRXB 4A2MA 4E54B 4A09A 2AGZA 2PBIB 4CZVA 3JROA 2XU7A 2IWFA 4J0XA 4FA1D 1N6DA 5HE1B 1K32A 3AH8B 1PBYB 2H68A 4CI3A 2I0TA 2IUPA 5EMJB 5EM2A 3OKWA 3OW8A 3UKRC 4ZOVA 5GXHA 3EI3B 5HE3B 3F3GA 3PVWB 5TEEA 2J56H 4J8GA 2IUQA 1NR0A 5FKQA 5THAA 3UVNA 3DM0A 5K19A 4A11B 2H14A 3JRPA 5EMLB 4IMMA 4A7JA 3IIYA 3ZWLB 4PBZA 3VH0A 2BCJB 3ULEC 4LG9A 3V9FA 2P9SC 1RI6A 4A09B 3U4YA 5AMSA 2H3XA 3MKSB 2Z2NA 4K3ID 3CIKB 5AFU3 5EM2B 2HXCA 2UZYB 4J0WA 1JOFA 1GG2B 2J57G 1SHYB 5H14A 2YMUA 4GQ1A 4FWWA 2O9KA 2OIZA 2I0RA 3K27A 3K26A 5CXCA 3V7DB 3ODTA 4CY1A 2B5NA 3EI1A 4J84A 1U4CA 4ZN4A 4J86A 3I2NA 5HE2B 2IAAA 3FRXA 4J79A 2OVPB 3AFCA 4R7AB 4FAVD 3FM0A 4JSVC 2HESX 1PEVA 5FKSA 2YNNA 3SHFA 2YBAA 4ERZA 2CE9A 2XL2A 3BG1A 3OTTA 2OJYA 4OWRA 2XL3A 1TBGA 4X61B 1B9XA 3AL8A 5HYNB 2I3SA 4PSWB 4H5JA 5CXCB 5AJAA 4QL1A 1MG3A 3SXTD 3EI1B 4I79A 3FGBA 3UVLA 4IA9A 3E0CA 5GSAA 2OK4A 2G9AA 2P9IC 3SLED 4CY2A 5I5IA 3ORVD 4GGDA 4GGCA 4PBYA 4A0BA 4GQBB 2CNXA 5TF2A 2IURA 3IIWA 3IJCA 4GM3A 3P4FA 4JD2C 3DSMA 4D0KA 4Y5RD 3AL8B 3L4OD 3JZNA 3EI2A 2HJ4A 3N0EA 5FLXg 4X60B 4CC9A 2AGLA 3I8EA 2HKRA 3OKYA 4YVDA 3BG0A 2AQ5A 4J73A 1OMWB 4GM8A 2IWKA 4A0BB 4O3UB 5CYKA 1XIPA 4J82A 2UZXB 2W18A 3I7LA 4CY5A 1PI6A 4GGAA 4LGNA 2QXVA 4J87A 1XHMA 5FA5B 3NVQA 2CN3A 4LG8A 3EI2B 2PM9A 5IGQA 2G99A 4FHLA 3SJLD 4GQ2P 5FKRA 5HE0B 3RN1D 1OLZA 2P9NC 3OKYB 3DXKC 4U7AA 5EMMB 3B7FA 2GC4A 3I7HA 3RRMC 3SBPA 5FQDA 3I8CA 1Q47A 4QRJA 4CZXA 3I89A 3GFCA 3RFHA 3EI4A 3RFGA 3EMHA 5CYKB 2Q7QA 4XYIA 3JZGA 4L3HD 4A0AA 5H17A 2IUVA 3RLMD 4NSXA 2H9PA 2P9UC 3DWLC 2OVRB 2YB8B 5B4WA 1JMZB 3JB9L 1JJUB 3C9CA 5HQGA 3PXTD 4BUJC 5GMKn 2PM9B 4A08A 3MZLA 4N14A 2AH1A 1R5MA 4HDJA 3MZKA 2B5LA 5EARA 2H6NA 3PXWD 3PSLA 4FB1D 2I3TA 4X3EA 2HYEA 3JAMg 2GNQA 2P9PC 2GC7A 1SQ9A 3SN6B 5FKTA 3C99A 4H5IA 4EWRA 2AGYA 5C9ZB 4AEZA 3EI4B 4D6VA 4J8BA 4O9DA 5K1CC 3UR4A 3AL9A 4A0AB 3PVUB 4O45A 3UKUC 3NVNA 3UVMA 1NEXB 1L0QA 5H1MA 4KFMB 1VYHC 5KDOB 4BL0A 4A08B 2J55H 4JSNC 4XYHA 1TYQC 2H47A 4QQEA 3MXXA 3W15A 3N0DA 3UVKA 4Z8LA 3SBRA 3EG6A 4JT6C 1JMXB 2CO0A 2P9KC 3DXMC 1YFQA 4J77A 1N6FA 4FA9D 4GMBA 4CI1A 2PM6B 1A0RB 2TRCB 3I7KA 2AH0A 3HFQA 4CY3A 2OVQB 2H6KA 4L3GD 3J81g 3A0FA 3SCYA 4ESGA 3IKOA 1SQJA 3RSEC 4JT5C 3EWEA 4ERYA 4J78A 3CFSB 4JSXC 5I5MA 5IJ8E 5IGOA 5FXYA 4OZUA 4U1EI 4X63B 3NVXA 1ERJA 5EAPA 4ZOXA 2H9LA 2BBKH 3MKQA 2H6QA 3VA6A 3SBQA 5EAMA 5C2VB 3L4MD 4BH6A 3SVWD 4AOWA 4CZYA 1MDAH
chains in the Genus database with same CATH superfamily
3C5MA 5I5JA 5C86A 3O4GA 3PXSD 4A2LA 3T3MA 5A2Qg 2AGWA 1FWXA 2YNPA 3JZHA 3UVOA 3PSCB 3VGZA 3RMZD 4E5ZA 2EICA 2VDQA 1U2VC 3I7OA 1H2ZA 5CXBA 2H13A 4Y7RA 3OL2A 2HU8A 4J81A 3NIDA 3IJ0A 2H9MA 4TZ4A 4PXWA 3V4VA 5IJ7E 5EMKB 4CI8A 2OK6A 3I7NA 4ES0A 4K3JB 2YNOA 2H9NA 2CE8A 2HKMA 5GXIA 2VDNA 4GM9A 3BWSA 3V5WB 3GREA 2QC5A 3SMRA 4MK0B 5C2WB 1PGUA 1H2XA 4QT8A 1UTCA 4GZ8A 4ERQA 3CFVA 2CO0C 3VI3A 4FAND 3C75H 5C92A 1P22A 3MMYA 2VDKA 3I7PA 5M5VA 4E5ZB 2PM7B 4JSPC 4NBMA 2MTAH 4CI2A 1MG2A 1XKSA 3F3PA 5CXBB 2B5MA 3OL2B 4E54A 3J80g 5TDHB 1GXRA 4O02A 4BP9A 3EU7A 2VZ1A 4O1QD 4ZOYA 1B9YA 5IT9g 1QNIA 3ZE1A 1GOTB 1GOHA 4FA5D 3SFZA 4FA4D 5IC7A 4PNKB 1M1XA 3JPXA 4PC0A 4ZOZA 3IJ1A 1N6EA 3PE7A 1GP2B 3EI3A 3MUOA 2Z2PA 4O3TB 2B4EA 5EALA 4Z7QA 2Z2OA 3DDUA 3O4HA 4G1MA 4AMZA 4BCBA 4L9OA 5JWZA 4L1QD 4BP8A 2HJBA 3GC3B 1K8KC 4JXMA 1S4UX 4G56B 2I0SA 4A11A 3F3FA 5SXMA 2CN2A 3IULA 2P9LC 2EBSA 4NENA 4XEIC 4PSXB 2AGXA 5FFOA 3KRWB 3OKTA 3SWSD 3RN0D 4UI9R 2XYIA 3GD1I 1C9IA 3K72A 5TEFA 1VE6A 3KRXB 4A2MA 4E54B 4A09A 4Z7OA 3QHYB 2AGZA 5E6SA 2PBIB 4CZVA 3JROA 5FFGA 2XU7A 2IWFA 4J0XA 4L1MA 4FA1D 1N6DA 5HE1B 1K32A 3AH8B 2VDOA 4BCDA 1PBYB 2H68A 4CI3A 2I0TA 2IUPA 5EMJB 5EM2A 3OKWA 3OW8A 3UKRC 4ZOVA 5GXHA 3EI3B 5HE3B 3F3GA 3PVWB 5TEEA 2J56H 4J8GA 2IUQA 2JKXA 1NR0A 5E6RA 5FKQA 1VZ2A 5THAA 3UVNA 3DM0A 5K19A 4BCCA 4A11B 2VDPA 2H14A 3FCSA 3JRPA 5EMLB 4IMMA 3O4IA 3T3PA 3IIYA 3ZWLB 4PBZA 4A7JA 3VH0A 2BCJB 3ULEC 4LG9A 2BKLA 3V9FA 2P9SC 2XE4A 1RI6A 4AX4A 4A09B 3ZDZA 3U4YA 5AMSA 2H3XA 3MKSB 4MMYA 1UOOA 2Z2NA 4K3ID 3CIKB 5AFU3 5EM2B 2HXCA 2UZYB 4J0WA 1JOFA 1JTDB 3EQ8A 1GG2B 2J57G 1SHYB 5H14A 2YMUA 4GQ1A 4FWWA 2O9KA 2OIZA 2I0RA 3K27A 3K26A 4IRZA 5CXCA 4WK0A 5M5UA 3V7DB 3ODTA 4CY1A 2B5NA 3EI1A 4J84A 3NIFA 1GOGA 1U4CA 4ZN4A 2VC2A 4J86A 3I2NA 5HE2B 3K6SA 2IAAA 3FRXA 4JHNA 4J79A 2OVPB 3MUNA 3AFCA 4R7AB 4FAVD 3FM0A 1C9LA 4JSVC 2EIDA 5HDBA 4DNWA 2HESX 1YR2A 1PEVA 5FKSA 2YNNA 3SHFA 2YBAA 4ERZA 2CE9A 2XL2A 3BG1A 3OTTA 2OJYA 4OWRA 1VE7A 2XL3A 1TBGA 4X61B 3VI4A 1B9XA 3AL8A 5HYNB 3KCIA 2I3SA 4DNVA 5M5RA 4PSWB 4H5JA 3IUJA 5CXCB 3NIGA 5AJAA 4QL1A 1MG3A 3ZE0A 3SXTD 3EI1B 4I79A 3FGBA 3UVLA 4IA9A 3E0CA 5GSAA 2OK4A 2G9AA 2P9IC 3SLED 4CY2A 5I5IA 3ORVD 4GGDA 4GGCA 4PBYA 4A0BA 4GQBB 2CNXA 5TF2A 2IURA 3IIWA 3IJCA 4GM3A 4NC4A 3P4FA 4JD2C 5E6UA 3DSMA 4D0KA 4Y5RD 4RE6A 1A12A 3AL8B 3L4OD 3JZNA 3EI2A 4QAMA 2HJ4A 3N0EA 5FLXg 4X60B 4CC9A 2AGLA 3I8EA 2EIEA 2HKRA 4AN1A 3OKYA 4YVDA 4G55A 1E5TA 1O6GA 3BG0A 2AQ5A 4J73A 1OMWB 3EQ9A 4GM8A 2IWKA 4UM9A 1E8NA 1E8MA 4WK2A 4O3UB 4A0BB 2EIBA 4DNUA 4G1EA 5CYKA 1JV2A 1XIPA 4J82A 2UZXB 2W18A 3V4PA 3I7LA 4CY5A 1PI6A 4GGAA 4LGNA 2QXVA 4J87A 1XHMA 5FA5B 3NVQA 1QFSA 2CN3A 4LG8A 3EI2B 2PM9A 5IGQA 2G99A 2XDWA 4FHLA 3SJLD 4GQ2P 4WK4A 5FKRA 5HE0B 3RN1D 1OLZA 2P9NC 3OKYB 3DXKC 4U7AA 3ZDXA 5EMMB 3B7FA 2GC4A 3I7HA 3RRMC 3SBPA 5FQDA 3IUQA 4MMZA 3I8CA 1Q47A 2XZGA 4QRJA 4CZXA 3I89A 3GFCA 5M5TA 3RFHA 3EI4A 3RFGA 3EMHA 4UM8A 5CYKB 2Q7QA 4XYIA 3JZGA 4L3HD 4A0AA 5H17A 2IUVA 3RLMD 4NSXA 2H9PA 2P9UC 1VZ3A 3OF7A 3DWLC 2OVRB 2YB8B 5B4WA 1JMZB 3JB9L 1JJUB 3C9CA 5HQGA 3PXTD 5M5SA 4BUJC 5GMKn 2PM9B 4WJKA 4A08A 3MZLA 4N14A 2AH1A 1R5MA 4HDJA 3MZKA 2QZPA 2B5LA 2HU7A 2H6NA 3PXWD 3PSLA 4RE5A 5EARA 1TYEA 4FB1D 5M61A 2I3TA 4X3EA 1UOPA 2HYEA 3JAMg 4AMYA 2GNQA 2P9PC 4NAAA 1O6FA 2GC7A 1SQ9A 4MMXA 3SN6B 5FKTA 3MVDK 3C99A 4H5IA 4EWRA 2AGYA 4D9SA 5C9ZB 4AEZA 1GOFA 3EI4B 4D6VA 4J8BA 1H2YA 4AN0A 4O9DA 5K1CC 3UR4A 3AL9A 4A0AB 4JHPC 3PVUB 4O45A 3IURA 3UKUC 2VDLA 2HU5A 3NVNA 3UVMA 1NEXB 1L0QA 1L5GA 3QI0A 5H1MA 4KFMB 1VYHC 5KDOB 4BL0A 1UOQA 1QFMA 1H2WA 4A08B 2J55H 4JSNC 3ZE2A 4XYHA 4Z7NA 1TYQC 2H47A 4QQEA 3MXXA 3W15A 3N0DA 3UVKA 4Z8LA 3IUMA 3SBRA 3EG6A 4JT6C 1JMXB 2CO0A 2P9KC 3DXMC 1YFQA 2VZ3A 3IVMA 4J77A 1N6FA 3FCUA 4FA9D 2WQ8A 4GMBA 4CI1A 2PM6B 1A0RB 2TRCB 3I7KA 2AH0A 3HFQA 4CY3A 2OVQB 2H6KA 2VDRA 4L3GD 3J81g 3O4JA 3A0FA 3SCYA 4ESGA 3IJEA 3IKOA 1SQJA 1BPOA 3RSEC 3K71A 4JT5C 3EWEA 4ERYA 4J78A 3CFSB 1I2MB 4JSXC 5I5MA 5IJ8E 5IGOA 5FXYA 4OZUA 4U1EI 4X63B 3NVXA 1ERJA 3IUNA 4ZOXA 5EAPA 2H9LA 2QR5A 2BBKH 3MKQA 2H6QA 3VA6A 1K3IA 1U8CA 3SBQA 5EAMA 3EQ7A 4O2WA 5C2VB 1T2XA 3L4MD 4BH6A 3SVWD 4AOWA 4CZYA 3ZDYA 2VDMA 1MDAH
chains in the Genus database with same CATH topology
3C5MA 5I5JA 3PXSD 4A2LA 5A2Qg 2AGWA 1FWXA 2YNPA 3JZHA 3UVOA 3PSCB 3VGZA 3RMZD 4E5ZA 1U2VC 3I7OA 5CXBA 2H13A 4Y7RA 3OL2A 4J81A 3IJ0A 2H9MA 4TZ4A 4PXWA 5IJ7E 5EMKB 4CI8A 2OK6A 3I7NA 4ES0A 4K3JB 2YNOA 2H9NA 2CE8A 2HKMA 5GXIA 4GM9A 3BWSA 3V5WB 3GREA 2QC5A 3SMRA 4MK0B 5C2WB 1PGUA 4QT8A 4GZ8A 4ERQA 3CFVA 2CO0C 4FAND 3C75H 1P22A 3MMYA 3I7PA 4E5ZB 2PM7B 4JSPC 2MTAH 4CI2A 1MG2A 1XKSA 3F3PA 5CXBB 2B5MA 3OL2B 4E54A 3J80g 5TDHB 1GXRA 3EU7A 4O1QD 4ZOYA 1B9YA 5IT9g 1QNIA 1GOTB 4FA5D 3SFZA 4FA4D 5IC7A 4PNKB 3JPXA 4PC0A 4ZOZA 3IJ1A 1N6EA 3PE7A 1GP2B 3EI3A 2Z2PA 4O3TB 2B4EA 5EALA 2Z2OA 4L9OA 5JWZA 4L1QD 2HJBA 4JXMA 1K8KC 1S4UX 4G56B 2I0SA 4A11A 3F3FA 5SXMA 2CN2A 2P9LC 2EBSA 4XEIC 4PSXB 2AGXA 3KRWB 3OKTA 3SWSD 3RN0D 4UI9R 2XYIA 5TEFA 3KRXB 4A2MA 4E54B 4A09A 2AGZA 2PBIB 4CZVA 3JROA 2XU7A 2IWFA 4J0XA 4FA1D 1N6DA 5HE1B 1K32A 3AH8B 1PBYB 2H68A 4CI3A 2I0TA 2IUPA 5EMJB 5EM2A 3OKWA 3OW8A 3UKRC 4ZOVA 5GXHA 3EI3B 5HE3B 3F3GA 3PVWB 5TEEA 2J56H 4J8GA 2IUQA 1NR0A 5FKQA 5THAA 3UVNA 3DM0A 5K19A 4A11B 2H14A 3JRPA 5EMLB 4IMMA 4A7JA 3IIYA 3ZWLB 4PBZA 3VH0A 2BCJB 3ULEC 4LG9A 3V9FA 2P9SC 1RI6A 4A09B 3U4YA 5AMSA 2H3XA 3MKSB 2Z2NA 4K3ID 3CIKB 5AFU3 5EM2B 2HXCA 2UZYB 4J0WA 1JOFA 1GG2B 2J57G 1SHYB 5H14A 2YMUA 4GQ1A 4FWWA 2O9KA 2OIZA 2I0RA 3K27A 3K26A 5CXCA 3V7DB 3ODTA 4CY1A 2B5NA 3EI1A 4J84A 1U4CA 4ZN4A 4J86A 3I2NA 5HE2B 2IAAA 3FRXA 4J79A 2OVPB 3AFCA 4R7AB 4FAVD 3FM0A 4JSVC 2HESX 1PEVA 5FKSA 2YNNA 3SHFA 2YBAA 4ERZA 2CE9A 2XL2A 3BG1A 3OTTA 2OJYA 4OWRA 2XL3A 1TBGA 4X61B 1B9XA 3AL8A 5HYNB 2I3SA 4PSWB 4H5JA 5CXCB 5AJAA 4QL1A 1MG3A 3SXTD 3EI1B 4I79A 3FGBA 3UVLA 4IA9A 3E0CA 5GSAA 2OK4A 2G9AA 2P9IC 3SLED 4CY2A 5I5IA 3ORVD 4GGDA 4GGCA 4PBYA 4A0BA 4GQBB 2CNXA 5TF2A 2IURA 3IIWA 3IJCA 4GM3A 3P4FA 4JD2C 3DSMA 4D0KA 4Y5RD 3AL8B 3L4OD 3JZNA 3EI2A 2HJ4A 3N0EA 5FLXg 4X60B 4CC9A 2AGLA 3I8EA 2HKRA 3OKYA 4YVDA 3BG0A 2AQ5A 4J73A 1OMWB 4GM8A 2IWKA 4A0BB 4O3UB 5CYKA 1XIPA 4J82A 2UZXB 2W18A 3I7LA 4CY5A 1PI6A 4GGAA 4LGNA 2QXVA 4J87A 1XHMA 5FA5B 3NVQA 2CN3A 4LG8A 3EI2B 2PM9A 5IGQA 2G99A 4FHLA 3SJLD 4GQ2P 5FKRA 5HE0B 3RN1D 1OLZA 2P9NC 3OKYB 3DXKC 4U7AA 5EMMB 3B7FA 2GC4A 3I7HA 3RRMC 3SBPA 5FQDA 3I8CA 1Q47A 4QRJA 4CZXA 3I89A 3GFCA 3RFHA 3EI4A 3RFGA 3EMHA 5CYKB 2Q7QA 4XYIA 3JZGA 4L3HD 4A0AA 5H17A 2IUVA 3RLMD 4NSXA 2H9PA 2P9UC 3DWLC 2OVRB 2YB8B 5B4WA 1JMZB 3JB9L 1JJUB 3C9CA 5HQGA 3PXTD 4BUJC 5GMKn 2PM9B 4A08A 3MZLA 4N14A 2AH1A 1R5MA 4HDJA 3MZKA 2B5LA 5EARA 2H6NA 3PXWD 3PSLA 4FB1D 2I3TA 4X3EA 2HYEA 3JAMg 2GNQA 2P9PC 2GC7A 1SQ9A 3SN6B 5FKTA 3C99A 4H5IA 4EWRA 2AGYA 5C9ZB 4AEZA 3EI4B 4D6VA 4J8BA 4O9DA 5K1CC 3UR4A 3AL9A 4A0AB 3PVUB 4O45A 3UKUC 3NVNA 3UVMA 1NEXB 1L0QA 5H1MA 4KFMB 1VYHC 5KDOB 4BL0A 4A08B 2J55H 4JSNC 4XYHA 1TYQC 2H47A 4QQEA 3MXXA 3W15A 3N0DA 3UVKA 4Z8LA 3SBRA 3EG6A 4JT6C 1JMXB 2CO0A 2P9KC 3DXMC 1YFQA 4J77A 1N6FA 4FA9D 4GMBA 4CI1A 2PM6B 1A0RB 2TRCB 3I7KA 2AH0A 3HFQA 4CY3A 2OVQB 2H6KA 4L3GD 3J81g 3A0FA 3SCYA 4ESGA 3IKOA 1SQJA 3RSEC 4JT5C 3EWEA 4ERYA 4J78A 3CFSB 4JSXC 5I5MA 5IJ8E 5IGOA 5FXYA 4OZUA 4U1EI 4X63B 3NVXA 1ERJA 5EAPA 4ZOXA 2H9LA 2BBKH 3MKQA 2H6QA 3VA6A 3SBQA 5EAMA 5C2VB 3L4MD 4BH6A 3SVWD 4AOWA 4CZYA 1MDAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5M A;  5I5J A;  3PXS D;  4A2L A;  5A2Q g;  2AGW A;  1FWX A;  2YNP A;  3JZH A;  3UVO A;  3PSC B;  3VGZ A;  3RMZ D;  4E5Z A;  1U2V C;  3I7O A;  5CXB A;  2H13 A;  4Y7R A;  3OL2 A;  4J81 A;  3IJ0 A;  2H9M A;  4TZ4 A;  4PXW A;  5IJ7 E;  5EMK B;  4CI8 A;  2OK6 A;  3I7N A;  4ES0 A;  4K3J B;  2YNO A;  2H9N A;  2CE8 A;  2HKM A;  5GXI A;  4GM9 A;  3BWS A;  3V5W B;  3GRE A;  2QC5 A;  3SMR A;  4MK0 B;  5C2W B;  1PGU A;  4QT8 A;  4GZ8 A;  4ERQ A;  3CFV A;  2CO0 C;  4FAN D;  3C75 H;  1P22 A;  3MMY A;  3I7P A;  4E5Z B;  2PM7 B;  4JSP C;  2MTA H;  4CI2 A;  1MG2 A;  1XKS A;  3F3P A;  5CXB B;  2B5M A;  3OL2 B;  4E54 A;  3J80 g;  5TDH B;  1GXR A;  3EU7 A;  4O1Q D;  4ZOY A;  1B9Y A;  5IT9 g;  1QNI A;  1GOT B;  4FA5 D;  3SFZ A;  4FA4 D;  5IC7 A;  4PNK B;  3JPX A;  4PC0 A;  4ZOZ A;  3IJ1 A;  1N6E A;  3PE7 A;  1GP2 B;  3EI3 A;  2Z2P A;  4O3T B;  2B4E A;  5EAL A;  2Z2O A;  4L9O A;  5JWZ A;  4L1Q D;  2HJB A;  4JXM A;  1K8K C;  1S4U X;  4G56 B;  2I0S A;  4A11 A;  3F3F A;  5SXM A;  2CN2 A;  2P9L C;  2EBS A;  4XEI C;  4PSX B;  2AGX A;  3KRW B;  3OKT A;  3SWS D;  3RN0 D;  4UI9 R;  2XYI A;  5TEF A;  3KRX B;  4A2M A;  4E54 B;  4A09 A;  2AGZ A;  2PBI B;  4CZV A;  3JRO A;  2XU7 A;  2IWF A;  4J0X A;  4FA1 D;  1N6D A;  5HE1 B;  1K32 A;  3AH8 B;  1PBY B;  2H68 A;  4CI3 A;  2I0T A;  2IUP A;  5EMJ B;  5EM2 A;  3OKW A;  3OW8 A;  3UKR C;  4ZOV A;  5GXH A;  3EI3 B;  5HE3 B;  3F3G A;  3PVW B;  5TEE A;  2J56 H;  4J8G A;  2IUQ A;  1NR0 A;  5FKQ A;  5THA A;  3UVN A;  3DM0 A;  5K19 A;  4A11 B;  2H14 A;  3JRP A;  5EML B;  4IMM A;  4A7J A;  3IIY A;  3ZWL B;  4PBZ A;  3VH0 A;  2BCJ B;  3ULE C;  4LG9 A;  3V9F A;  2P9S C;  1RI6 A;  4A09 B;  3U4Y A;  5AMS A;  2H3X A;  3MKS B;  2Z2N A;  4K3I D;  3CIK B;  5AFU 3;  5EM2 B;  2HXC A;  2UZY B;  4J0W A;  1JOF A;  1GG2 B;  2J57 G;  1SHY B;  5H14 A;  2YMU A;  4GQ1 A;  4FWW A;  2O9K A;  2OIZ A;  2I0R A;  3K27 A;  3K26 A;  5CXC A;  3V7D B;  3ODT A;  4CY1 A;  2B5N A;  3EI1 A;  4J84 A;  1U4C A;  4ZN4 A;  4J86 A;  3I2N A;  5HE2 B;  2IAA A;  3FRX A;  4J79 A;  2OVP B;  3AFC A;  4R7A B;  4FAV D;  3FM0 A;  4JSV C;  2HES X;  1PEV A;  5FKS A;  2YNN A;  3SHF A;  2YBA A;  4ERZ A;  2CE9 A;  2XL2 A;  3BG1 A;  3OTT A;  2OJY A;  4OWR A;  2XL3 A;  1TBG A;  4X61 B;  1B9X A;  3AL8 A;  5HYN B;  2I3S A;  4PSW B;  4H5J A;  5CXC B;  5AJA A;  4QL1 A;  1MG3 A;  3SXT D;  3EI1 B;  4I79 A;  3FGB A;  3UVL A;  4IA9 A;  3E0C A;  5GSA A;  2OK4 A;  2G9A A;  2P9I C;  3SLE D;  4CY2 A;  5I5I A;  3ORV D;  4GGD A;  4GGC A;  4PBY A;  4A0B A;  4GQB B;  2CNX A;  5TF2 A;  2IUR A;  3IIW A;  3IJC A;  4GM3 A;  3P4F A;  4JD2 C;  3DSM A;  4D0K A;  4Y5R D;  3AL8 B;  3L4O D;  3JZN A;  3EI2 A;  2HJ4 A;  3N0E A;  5FLX g;  4X60 B;  4CC9 A;  2AGL A;  3I8E A;  2HKR A;  3OKY A;  4YVD A;  3BG0 A;  2AQ5 A;  4J73 A;  1OMW B;  4GM8 A;  2IWK A;  4A0B B;  4O3U B;  5CYK A;  1XIP A;  4J82 A;  2UZX B;  2W18 A;  3I7L A;  4CY5 A;  1PI6 A;  4GGA A;  4LGN A;  2QXV A;  4J87 A;  1XHM A;  5FA5 B;  3NVQ A;  2CN3 A;  4LG8 A;  3EI2 B;  2PM9 A;  5IGQ A;  2G99 A;  4FHL A;  3SJL D;  4GQ2 P;  5FKR A;  5HE0 B;  3RN1 D;  1OLZ A;  2P9N C;  3OKY B;  3DXK C;  4U7A A;  5EMM B;  3B7F A;  2GC4 A;  3I7H A;  3RRM C;  3SBP A;  5FQD A;  3I8C A;  1Q47 A;  4QRJ A;  4CZX A;  3I89 A;  3GFC A;  3RFH A;  3EI4 A;  3RFG A;  3EMH A;  5CYK B;  2Q7Q A;  4XYI A;  3JZG A;  4L3H D;  4A0A A;  5H17 A;  2IUV A;  3RLM D;  4NSX A;  2H9P A;  2P9U C;  3DWL C;  2OVR B;  2YB8 B;  5B4W A;  1JMZ B;  3JB9 L;  1JJU B;  3C9C A;  5HQG A;  3PXT D;  4BUJ C;  5GMK n;  2PM9 B;  4A08 A;  3MZL A;  4N14 A;  2AH1 A;  1R5M A;  4HDJ A;  3MZK A;  2B5L A;  5EAR A;  2H6N A;  3PXW D;  3PSL A;  4FB1 D;  2I3T A;  4X3E A;  2HYE A;  3JAM g;  2GNQ A;  2P9P C;  2GC7 A;  1SQ9 A;  3SN6 B;  5FKT A;  3C99 A;  4H5I A;  4EWR A;  2AGY A;  5C9Z B;  4AEZ A;  3EI4 B;  4D6V A;  4J8B A;  4O9D A;  5K1C C;  3UR4 A;  3AL9 A;  4A0A B;  3PVU B;  4O45 A;  3UKU C;  3NVN A;  3UVM A;  1NEX B;  1L0Q A;  5H1M A;  4KFM B;  1VYH C;  5KDO B;  4BL0 A;  4A08 B;  2J55 H;  4JSN C;  4XYH A;  1TYQ C;  2H47 A;  4QQE A;  3MXX A;  3W15 A;  3N0D A;  3UVK A;  4Z8L A;  3SBR A;  3EG6 A;  4JT6 C;  1JMX B;  2CO0 A;  2P9K C;  3DXM C;  1YFQ A;  4J77 A;  1N6F A;  4FA9 D;  4GMB A;  4CI1 A;  2PM6 B;  1A0R B;  2TRC B;  3I7K A;  2AH0 A;  3HFQ A;  4CY3 A;  2OVQ B;  2H6K A;  4L3G D;  3J81 g;  3A0F A;  3SCY A;  4ESG A;  3IKO A;  1SQJ A;  3RSE C;  4JT5 C;  3EWE A;  4ERY A;  4J78 A;  3CFS B;  4JSX C;  5I5M A;  5IJ8 E;  5IGO A;  5FXY A;  4OZU A;  4U1E I;  4X63 B;  3NVX A;  1ERJ A;  5EAP A;  4ZOX A;  2H9L A;  2BBK H;  3MKQ A;  2H6Q A;  3VA6 A;  3SBQ A;  5EAM A;  5C2V B;  3L4M D;  4BH6 A;  3SVW D;  4AOW A;  4CZY A;  1MDA H; 
#chains in the Genus database with same CATH topology
 3C5M A;  5I5J A;  5C86 A;  3O4G A;  3PXS D;  4A2L A;  3T3M A;  5A2Q g;  2AGW A;  1FWX A;  2YNP A;  3JZH A;  3UVO A;  3PSC B;  3VGZ A;  3RMZ D;  4E5Z A;  2EIC A;  2VDQ A;  1U2V C;  3I7O A;  1H2Z A;  5CXB A;  2H13 A;  4Y7R A;  3OL2 A;  2HU8 A;  4J81 A;  3NID A;  3IJ0 A;  2H9M A;  4TZ4 A;  4PXW A;  3V4V A;  5IJ7 E;  5EMK B;  4CI8 A;  2OK6 A;  3I7N A;  4ES0 A;  4K3J B;  2YNO A;  2H9N A;  2CE8 A;  2HKM A;  5GXI A;  2VDN A;  4GM9 A;  3BWS A;  3V5W B;  3GRE A;  2QC5 A;  3SMR A;  4MK0 B;  5C2W B;  1PGU A;  1H2X A;  4QT8 A;  1UTC A;  4GZ8 A;  4ERQ A;  3CFV A;  2CO0 C;  3VI3 A;  4FAN D;  3C75 H;  5C92 A;  1P22 A;  3MMY A;  2VDK A;  3I7P A;  5M5V A;  4E5Z B;  2PM7 B;  4JSP C;  4NBM A;  2MTA H;  4CI2 A;  1MG2 A;  1XKS A;  3F3P A;  5CXB B;  2B5M A;  3OL2 B;  4E54 A;  3J80 g;  5TDH B;  1GXR A;  4O02 A;  4BP9 A;  3EU7 A;  2VZ1 A;  4O1Q D;  4ZOY A;  1B9Y A;  5IT9 g;  1QNI A;  3ZE1 A;  1GOT B;  1GOH A;  4FA5 D;  3SFZ A;  4FA4 D;  5IC7 A;  4PNK B;  1M1X A;  3JPX A;  4PC0 A;  4ZOZ A;  3IJ1 A;  1N6E A;  3PE7 A;  1GP2 B;  3EI3 A;  3MUO A;  2Z2P A;  4O3T B;  2B4E A;  5EAL A;  4Z7Q A;  2Z2O A;  3DDU A;  3O4H A;  4G1M A;  4AMZ A;  4BCB A;  4L9O A;  5JWZ A;  4L1Q D;  4BP8 A;  2HJB A;  3GC3 B;  1K8K C;  4JXM A;  1S4U X;  4G56 B;  2I0S A;  4A11 A;  3F3F A;  5SXM A;  2CN2 A;  3IUL A;  2P9L C;  2EBS A;  4NEN A;  4XEI C;  4PSX B;  2AGX A;  5FFO A;  3KRW B;  3OKT A;  3SWS D;  3RN0 D;  4UI9 R;  2XYI A;  3GD1 I;  1C9I A;  3K72 A;  5TEF A;  1VE6 A;  3KRX B;  4A2M A;  4E54 B;  4A09 A;  4Z7O A;  3QHY B;  2AGZ A;  5E6S A;  2PBI B;  4CZV A;  3JRO A;  5FFG A;  2XU7 A;  2IWF A;  4J0X A;  4L1M A;  4FA1 D;  1N6D A;  5HE1 B;  1K32 A;  3AH8 B;  2VDO A;  4BCD A;  1PBY B;  2H68 A;  4CI3 A;  2I0T A;  2IUP A;  5EMJ B;  5EM2 A;  3OKW A;  3OW8 A;  3UKR C;  4ZOV A;  5GXH A;  3EI3 B;  5HE3 B;  3F3G A;  3PVW B;  5TEE A;  2J56 H;  4J8G A;  2IUQ A;  2JKX A;  1NR0 A;  5E6R A;  5FKQ A;  1VZ2 A;  5THA A;  3UVN A;  3DM0 A;  5K19 A;  4BCC A;  4A11 B;  2VDP A;  2H14 A;  3FCS A;  3JRP A;  5EML B;  4IMM A;  3O4I A;  3T3P A;  3IIY A;  3ZWL B;  4PBZ A;  4A7J A;  3VH0 A;  2BCJ B;  3ULE C;  4LG9 A;  2BKL A;  3V9F A;  2P9S C;  2XE4 A;  1RI6 A;  4AX4 A;  4A09 B;  3ZDZ A;  3U4Y A;  5AMS A;  2H3X A;  3MKS B;  4MMY A;  1UOO A;  2Z2N A;  4K3I D;  3CIK B;  5AFU 3;  5EM2 B;  2HXC A;  2UZY B;  4J0W A;  1JOF A;  1JTD B;  3EQ8 A;  1GG2 B;  2J57 G;  1SHY B;  5H14 A;  2YMU A;  4GQ1 A;  4FWW A;  2O9K A;  2OIZ A;  2I0R A;  3K27 A;  3K26 A;  4IRZ A;  5CXC A;  4WK0 A;  5M5U A;  3V7D B;  3ODT A;  4CY1 A;  2B5N A;  3EI1 A;  4J84 A;  3NIF A;  1GOG A;  1U4C A;  4ZN4 A;  2VC2 A;  4J86 A;  3I2N A;  5HE2 B;  3K6S A;  2IAA A;  3FRX A;  4JHN A;  4J79 A;  2OVP B;  3MUN A;  3AFC A;  4R7A B;  4FAV D;  3FM0 A;  1C9L A;  4JSV C;  2EID A;  5HDB A;  4DNW A;  2HES X;  1YR2 A;  1PEV A;  5FKS A;  2YNN A;  3SHF A;  2YBA A;  4ERZ A;  2CE9 A;  2XL2 A;  3BG1 A;  3OTT A;  2OJY A;  4OWR A;  1VE7 A;  2XL3 A;  1TBG A;  4X61 B;  3VI4 A;  1B9X A;  3AL8 A;  5HYN B;  3KCI A;  2I3S A;  4DNV A;  5M5R A;  4PSW B;  4H5J A;  3IUJ A;  5CXC B;  3NIG A;  5AJA A;  4QL1 A;  1MG3 A;  3ZE0 A;  3SXT D;  3EI1 B;  4I79 A;  3FGB A;  3UVL A;  4IA9 A;  3E0C A;  5GSA A;  2OK4 A;  2G9A A;  2P9I C;  3SLE D;  4CY2 A;  5I5I A;  3ORV D;  4GGD A;  4GGC A;  4PBY A;  4A0B A;  4GQB B;  2CNX A;  5TF2 A;  2IUR A;  3IIW A;  3IJC A;  4GM3 A;  4NC4 A;  3P4F A;  4JD2 C;  5E6U A;  3DSM A;  4D0K A;  4Y5R D;  4RE6 A;  1A12 A;  3AL8 B;  3L4O D;  3JZN A;  3EI2 A;  4QAM A;  2HJ4 A;  3N0E A;  5FLX g;  4X60 B;  4CC9 A;  2AGL A;  3I8E A;  2EIE A;  2HKR A;  4AN1 A;  3OKY A;  4YVD A;  4G55 A;  1E5T A;  1O6G A;  3BG0 A;  2AQ5 A;  4J73 A;  1OMW B;  3EQ9 A;  4GM8 A;  2IWK A;  4UM9 A;  1E8N A;  1E8M A;  4WK2 A;  4O3U B;  4A0B B;  2EIB A;  4DNU A;  4G1E A;  5CYK A;  1JV2 A;  1XIP A;  4J82 A;  2UZX B;  2W18 A;  3V4P A;  3I7L A;  4CY5 A;  1PI6 A;  4GGA A;  4LGN A;  2QXV A;  4J87 A;  1XHM A;  5FA5 B;  3NVQ A;  1QFS A;  2CN3 A;  4LG8 A;  3EI2 B;  2PM9 A;  5IGQ A;  2G99 A;  2XDW A;  4FHL A;  3SJL D;  4GQ2 P;  4WK4 A;  5FKR A;  5HE0 B;  3RN1 D;  1OLZ A;  2P9N C;  3OKY B;  3DXK C;  4U7A A;  3ZDX A;  5EMM B;  3B7F A;  2GC4 A;  3I7H A;  3RRM C;  3SBP A;  5FQD A;  3IUQ A;  4MMZ A;  3I8C A;  1Q47 A;  2XZG A;  4QRJ A;  4CZX A;  3I89 A;  3GFC A;  5M5T A;  3RFH A;  3EI4 A;  3RFG A;  3EMH A;  4UM8 A;  5CYK B;  2Q7Q A;  4XYI A;  3JZG A;  4L3H D;  4A0A A;  5H17 A;  2IUV A;  3RLM D;  4NSX A;  2H9P A;  2P9U C;  1VZ3 A;  3OF7 A;  3DWL C;  2OVR B;  2YB8 B;  5B4W A;  1JMZ B;  3JB9 L;  1JJU B;  3C9C A;  5HQG A;  3PXT D;  5M5S A;  4BUJ C;  5GMK n;  2PM9 B;  4WJK A;  4A08 A;  3MZL A;  4N14 A;  2AH1 A;  1R5M A;  4HDJ A;  3MZK A;  2QZP A;  2B5L A;  2HU7 A;  2H6N A;  3PXW D;  3PSL A;  4RE5 A;  5EAR A;  1TYE A;  4FB1 D;  5M61 A;  2I3T A;  4X3E A;  1UOP A;  2HYE A;  3JAM g;  4AMY A;  2GNQ A;  2P9P C;  4NAA A;  1O6F A;  2GC7 A;  1SQ9 A;  4MMX A;  3SN6 B;  5FKT A;  3MVD K;  3C99 A;  4H5I A;  4EWR A;  2AGY A;  4D9S A;  5C9Z B;  4AEZ A;  1GOF A;  3EI4 B;  4D6V A;  4J8B A;  1H2Y A;  4AN0 A;  4O9D A;  5K1C C;  3UR4 A;  3AL9 A;  4A0A B;  4JHP C;  3PVU B;  4O45 A;  3IUR A;  3UKU C;  2VDL A;  2HU5 A;  3NVN A;  3UVM A;  1NEX B;  1L0Q A;  1L5G A;  3QI0 A;  5H1M A;  4KFM B;  1VYH C;  5KDO B;  4BL0 A;  1UOQ A;  1QFM A;  1H2W A;  4A08 B;  2J55 H;  4JSN C;  3ZE2 A;  4XYH A;  4Z7N A;  1TYQ C;  2H47 A;  4QQE A;  3MXX A;  3W15 A;  3N0D A;  3UVK A;  4Z8L A;  3IUM A;  3SBR A;  3EG6 A;  4JT6 C;  1JMX B;  2CO0 A;  2P9K C;  3DXM C;  1YFQ A;  2VZ3 A;  3IVM A;  4J77 A;  1N6F A;  3FCU A;  4FA9 D;  2WQ8 A;  4GMB A;  4CI1 A;  2PM6 B;  1A0R B;  2TRC B;  3I7K A;  2AH0 A;  3HFQ A;  4CY3 A;  2OVQ B;  2H6K A;  2VDR A;  4L3G D;  3J81 g;  3O4J A;  3A0F A;  3SCY A;  4ESG A;  3IJE A;  3IKO A;  1SQJ A;  1BPO A;  3RSE C;  3K71 A;  4JT5 C;  3EWE A;  4ERY A;  4J78 A;  3CFS B;  1I2M B;  4JSX C;  5I5M A;  5IJ8 E;  5IGO A;  5FXY A;  4OZU A;  4U1E I;  4X63 B;  3NVX A;  1ERJ A;  3IUN A;  4ZOX A;  5EAP A;  2H9L A;  2QR5 A;  2BBK H;  3MKQ A;  2H6Q A;  3VA6 A;  1K3I A;  1U8C A;  3SBQ A;  5EAM A;  3EQ7 A;  4O2W A;  5C2V B;  1T2X A;  3L4M D;  4BH6 A;  3SVW D;  4AOW A;  4CZY A;  3ZDY A;  2VDM A;  1MDA H; 
#chains in the Genus database with same CATH homology
 3C5M A;  5I5J A;  3PXS D;  4A2L A;  5A2Q g;  2AGW A;  1FWX A;  2YNP A;  3JZH A;  3UVO A;  3PSC B;  3VGZ A;  3RMZ D;  4E5Z A;  1U2V C;  3I7O A;  5CXB A;  2H13 A;  4Y7R A;  3OL2 A;  4J81 A;  3IJ0 A;  2H9M A;  4TZ4 A;  4PXW A;  5IJ7 E;  5EMK B;  4CI8 A;  2OK6 A;  3I7N A;  4ES0 A;  4K3J B;  2YNO A;  2H9N A;  2CE8 A;  2HKM A;  5GXI A;  4GM9 A;  3BWS A;  3V5W B;  3GRE A;  2QC5 A;  3SMR A;  4MK0 B;  5C2W B;  1PGU A;  4QT8 A;  4GZ8 A;  4ERQ A;  3CFV A;  2CO0 C;  4FAN D;  3C75 H;  1P22 A;  3MMY A;  3I7P A;  4E5Z B;  2PM7 B;  4JSP C;  2MTA H;  4CI2 A;  1MG2 A;  1XKS A;  3F3P A;  5CXB B;  2B5M A;  3OL2 B;  4E54 A;  3J80 g;  5TDH B;  1GXR A;  3EU7 A;  4O1Q D;  4ZOY A;  1B9Y A;  5IT9 g;  1QNI A;  1GOT B;  4FA5 D;  3SFZ A;  4FA4 D;  5IC7 A;  4PNK B;  3JPX A;  4PC0 A;  4ZOZ A;  3IJ1 A;  1N6E A;  3PE7 A;  1GP2 B;  3EI3 A;  2Z2P A;  4O3T B;  2B4E A;  5EAL A;  2Z2O A;  4L9O A;  5JWZ A;  4L1Q D;  2HJB A;  4JXM A;  1K8K C;  1S4U X;  4G56 B;  2I0S A;  4A11 A;  3F3F A;  5SXM A;  2CN2 A;  2P9L C;  2EBS A;  4XEI C;  4PSX B;  2AGX A;  3KRW B;  3OKT A;  3SWS D;  3RN0 D;  4UI9 R;  2XYI A;  5TEF A;  3KRX B;  4A2M A;  4E54 B;  4A09 A;  2AGZ A;  2PBI B;  4CZV A;  3JRO A;  2XU7 A;  2IWF A;  4J0X A;  4FA1 D;  1N6D A;  5HE1 B;  1K32 A;  3AH8 B;  1PBY B;  2H68 A;  4CI3 A;  2I0T A;  2IUP A;  5EMJ B;  5EM2 A;  3OKW A;  3OW8 A;  3UKR C;  4ZOV A;  5GXH A;  3EI3 B;  5HE3 B;  3F3G A;  3PVW B;  5TEE A;  2J56 H;  4J8G A;  2IUQ A;  1NR0 A;  5FKQ A;  5THA A;  3UVN A;  3DM0 A;  5K19 A;  4A11 B;  2H14 A;  3JRP A;  5EML B;  4IMM A;  4A7J A;  3IIY A;  3ZWL B;  4PBZ A;  3VH0 A;  2BCJ B;  3ULE C;  4LG9 A;  3V9F A;  2P9S C;  1RI6 A;  4A09 B;  3U4Y A;  5AMS A;  2H3X A;  3MKS B;  2Z2N A;  4K3I D;  3CIK B;  5AFU 3;  5EM2 B;  2HXC A;  2UZY B;  4J0W A;  1JOF A;  1GG2 B;  2J57 G;  1SHY B;  5H14 A;  2YMU A;  4GQ1 A;  4FWW A;  2O9K A;  2OIZ A;  2I0R A;  3K27 A;  3K26 A;  5CXC A;  3V7D B;  3ODT A;  4CY1 A;  2B5N A;  3EI1 A;  4J84 A;  1U4C A;  4ZN4 A;  4J86 A;  3I2N A;  5HE2 B;  2IAA A;  3FRX A;  4J79 A;  2OVP B;  3AFC A;  4R7A B;  4FAV D;  3FM0 A;  4JSV C;  2HES X;  1PEV A;  5FKS A;  2YNN A;  3SHF A;  2YBA A;  4ERZ A;  2CE9 A;  2XL2 A;  3BG1 A;  3OTT A;  2OJY A;  4OWR A;  2XL3 A;  1TBG A;  4X61 B;  1B9X A;  3AL8 A;  5HYN B;  2I3S A;  4PSW B;  4H5J A;  5CXC B;  5AJA A;  4QL1 A;  1MG3 A;  3SXT D;  3EI1 B;  4I79 A;  3FGB A;  3UVL A;  4IA9 A;  3E0C A;  5GSA A;  2OK4 A;  2G9A A;  2P9I C;  3SLE D;  4CY2 A;  5I5I A;  3ORV D;  4GGD A;  4GGC A;  4PBY A;  4A0B A;  4GQB B;  2CNX A;  5TF2 A;  2IUR A;  3IIW A;  3IJC A;  4GM3 A;  3P4F A;  4JD2 C;  3DSM A;  4D0K A;  4Y5R D;  3AL8 B;  3L4O D;  3JZN A;  3EI2 A;  2HJ4 A;  3N0E A;  5FLX g;  4X60 B;  4CC9 A;  2AGL A;  3I8E A;  2HKR A;  3OKY A;  4YVD A;  3BG0 A;  2AQ5 A;  4J73 A;  1OMW B;  4GM8 A;  2IWK A;  4A0B B;  4O3U B;  5CYK A;  1XIP A;  4J82 A;  2UZX B;  2W18 A;  3I7L A;  4CY5 A;  1PI6 A;  4GGA A;  4LGN A;  2QXV A;  4J87 A;  1XHM A;  5FA5 B;  3NVQ A;  2CN3 A;  4LG8 A;  3EI2 B;  2PM9 A;  5IGQ A;  2G99 A;  4FHL A;  3SJL D;  4GQ2 P;  5FKR A;  5HE0 B;  3RN1 D;  1OLZ A;  2P9N C;  3OKY B;  3DXK C;  4U7A A;  5EMM B;  3B7F A;  2GC4 A;  3I7H A;  3RRM C;  3SBP A;  5FQD A;  3I8C A;  1Q47 A;  4QRJ A;  4CZX A;  3I89 A;  3GFC A;  3RFH A;  3EI4 A;  3RFG A;  3EMH A;  5CYK B;  2Q7Q A;  4XYI A;  3JZG A;  4L3H D;  4A0A A;  5H17 A;  2IUV A;  3RLM D;  4NSX A;  2H9P A;  2P9U C;  3DWL C;  2OVR B;  2YB8 B;  5B4W A;  1JMZ B;  3JB9 L;  1JJU B;  3C9C A;  5HQG A;  3PXT D;  4BUJ C;  5GMK n;  2PM9 B;  4A08 A;  3MZL A;  4N14 A;  2AH1 A;  1R5M A;  4HDJ A;  3MZK A;  2B5L A;  5EAR A;  2H6N A;  3PXW D;  3PSL A;  4FB1 D;  2I3T A;  4X3E A;  2HYE A;  3JAM g;  2GNQ A;  2P9P C;  2GC7 A;  1SQ9 A;  3SN6 B;  5FKT A;  3C99 A;  4H5I A;  4EWR A;  2AGY A;  5C9Z B;  4AEZ A;  3EI4 B;  4D6V A;  4J8B A;  4O9D A;  5K1C C;  3UR4 A;  3AL9 A;  4A0A B;  3PVU B;  4O45 A;  3UKU C;  3NVN A;  3UVM A;  1NEX B;  1L0Q A;  5H1M A;  4KFM B;  1VYH C;  5KDO B;  4BL0 A;  4A08 B;  2J55 H;  4JSN C;  4XYH A;  1TYQ C;  2H47 A;  4QQE A;  3MXX A;  3W15 A;  3N0D A;  3UVK A;  4Z8L A;  3SBR A;  3EG6 A;  4JT6 C;  1JMX B;  2CO0 A;  2P9K C;  3DXM C;  1YFQ A;  4J77 A;  1N6F A;  4FA9 D;  4GMB A;  4CI1 A;  2PM6 B;  1A0R B;  2TRC B;  3I7K A;  2AH0 A;  3HFQ A;  4CY3 A;  2OVQ B;  2H6K A;  4L3G D;  3J81 g;  3A0F A;  3SCY A;  4ESG A;  3IKO A;  1SQJ A;  3RSE C;  4JT5 C;  3EWE A;  4ERY A;  4J78 A;  3CFS B;  4JSX C;  5I5M A;  5IJ8 E;  5IGO A;  5FXY A;  4OZU A;  4U1E I;  4X63 B;  3NVX A;  1ERJ A;  5EAP A;  4ZOX A;  2H9L A;  2BBK H;  3MKQ A;  2H6Q A;  3VA6 A;  3SBQ A;  5EAM A;  5C2V B;  3L4M D;  4BH6 A;  3SVW D;  4AOW A;  4CZY A;  1MDA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...