3JAMg

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
324
structure length
318
Chain Sequence
b'SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 53
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3jamg01
2Z2PA 2AGXA 2IAAA 4AOWA 5GSAA 3AL8B 2AH0A 4L3GD 3RFHA 4JXMA 2H13A 4UI9R 1SQJA 3BG1A 2XYIA 4A11B 2Z2OA 4LG8A 4ERZA 2HKRA 5C2WB 5K19A 4GQBB 4O9DA 4HDJA 3UKUC 1JOFA 4A2LA 3MXXA 3I7OA 4JD2C 3SCYA 2CN3A 3I89A 2CN2A 2PBIB 3RRMC 4L1QD 5EALA 4QRJA 4ZN4A 5EARA 4IA9A 3I8CA 3C75H 3JB9L 4CI8A 3IJ0A 4LG9A 3PXTD 4FHLA 2HJ4A 2YNOA 1TBGA 2H3XA 3V5WB 3OKYA 1GG2B 2Z2NA 2P9IC 3W15A 2YBAA 5GXHA 5TEFA 3EU7A 2B4EA 2P9PC 3IJCA 3SFZA 3FGBA 2H6KA 1N6DA 2O9KA 4JT5C 3SJLD 3DSMA 3JZGA 4FB1D 1GP2B 4JSPC 4R7AB 4H5IA 4GQ1A 3N0DA 5I5MA 1R5MA 4J84A 2QXVA 4QL1A 5IGOA 5HE0B 1PGUA 1PEVA 1MG2A 3ULEC 3NVQA 3HFQA 4CZXA 5A2Qg 4BL0A 2YNNA 5EM2A 2P9KC 4E5ZB 4K3JB 2HJBA 5THAA 3CFSB 2H6NA 3EI1B 4JSVC 5EMLB 5CYKB 3OW8A 4A0BB 2B5NA 1RI6A 2AGYA 5I5JA 4D6VA 5AJAA 3PSLA 2J55H 5CXBA 5IT9g 4J0XA 4MK0B 3I7NA 1S4UX 2H6QA 3K26A 2BBKH 2YNPA 4GZ8A 3C9CA 3RN1D 3RLMD 3KRXB 3UVOA 4D0KA 4ES0A 3RMZD 1N6EA 3VH0A 2HXCA 2CNXA 3MKQA 3ODTA 3OTTA 2GC4A 3SMRA 4GM3A 3SN6B 5FQDA 4PXWA 3JAMg 3E0CA 4LGNA 5GXIA 3EG6A 4GGDA 2H68A 4CY1A 3L4MD 3MMYA 4OZUA 3OL2A 4J77A 2QC5A 2OVRB 5IC7A 3DXKC 4GGAA 2W18A 4KFMB 5AMSA 3SBPA 3EI4A 3EI2A 3SXTD 1B9XA 4FA9D 3I8EA 3I7LA 4FAND 4A09A 4PC0A 3OKYB 3J80g 4QQEA 5GMKn 1OLZA 4J79A 3PSCB 4CI2A 1XHMA 2CO0C 1K32A 2H47A 4X61B 3RFGA 3I2NA 3FM0A 1U4CA 5IGQA 4PSWB 2IUVA 3SBQA 4XEIC 3AH8B 4CY3A 2H9MA 3DXMC 5HE1B 2AQ5A 2AGZA 3NVNA 5TDHB 4J78A 4J0WA 4J8GA 4O45A 4CZYA 5FKQA 4GQ2P 3EI3A 2I0TA 4CI1A 3GREA 4G56B 3V9FA 2OK6A 3OKWA 5EM2B 1A0RB 2P9NC 3JROA 5H17A 2GNQA 4JT6C 2XL2A 3UVKA 3MZKA 4ZOYA 2OVQB 2G9AA 5FKSA 3IIWA 4FAVD 3B7FA 5TF2A 1PI6A 2I0SA 3PXWD 3RSEC 4ZOXA 1N6FA 3I7HA 3PVWB 5CXBB 2OIZA 4FWWA 1VYHC 4JSNC 4J82A 3SBRA 4E54A 4BUJC 3UVNA 3SLED 3JRPA 4O3TB 4L3HD 3GFCA 1JMXB 2CE8A 3EWEA 3UVLA 2AH1A 3MZLA 4QT8A 5HE3B 2IUQA 2UZYB 2I3TA 2AGLA 5TEEA 2J56H 2I3SA 2PM9A 3IKOA 2MTAH 4A08A 4U1EI 2CO0A 5FKRA 3F3PA 2HKMA 3SWSD 3PVUB 4J87A 4U7AA 4X63B 3SHFA 4L9OA 2B5MA 5C2VB 1Q47A 5EMJB 2J57G 5CXCA 3FRXA 5H14A 4K3ID 2HYEA 1NEXB 3OL2B 4TZ4A 4A0AA 4GM8A 4FA4D 4Y7RA 5C9ZB 3U4YA 1PBYB 1NR0A 4XYHA 1SHYB 2Q7QA 4CZVA 1FWXA 4JSXC 5I5IA 4H5JA 4X3EA 3C5MA 1SQ9A 1OMWB 3EI4B 3VA6A 3EI2B 1GXRA 2H9LA 2TRCB 5FKTA 2OVPB 2GC7A 4A09B 3PXSD 2P9LC 2YB8B 2XU7A 3JZNA 4GGCA 5HYNB 5EMMB 4PSXB 1MG3A 5EAMA 2EBSA 2XL3A 4I79A 3I7PA 1XKSA 3AL8A 3CFVA 3UKRC 2IURA 2H9NA 4J81A 2IWKA 4A11A 4CI3A 3P4FA 4J8BA 2HESX 1JMZB 5FXYA 1XIPA 4FA5D 3OKTA 5B4WA 4A2MA 1GOTB 4FA1D 4AEZA 5FLXg 4EWRA 2I0RA 3I7KA 4Z8LA 3EI3B 3RN0D 3F3GA 5IJ7E 5H1MA 4GM9A 3J81g 5EMKB 3SVWD 4CC9A 3C99A 4GMBA 3DM0A 4OWRA 4XYIA 4IMMA 2H14A 4ERYA 4PNKB 5AFU3 4N14A 4PBZA 5JWZA 4ESGA 2UZXB 1ERJA 5FA5B 5K1CC 3ZWLB 4E54B 2G99A 3UVMA 4CY5A 3N0EA 1K8KC 2BCJB 2H9PA 2OK4A 2IWFA 1P22A 4J73A 3ORVD 4BH6A 3K27A 3IIYA 2PM9B 2AGWA 3BG0A 1B9YA 1JJUB 4A08B 4X60B 2B5LA 3AFCA 3CIKB 3MKSB 5SXMA 3JPXA 4ZOVA 3A0FA 2PM6B 3AL9A 4Y5RD 3UR4A 5HQGA 4E5ZA 1TYQC 1U2VC 4ZOZA 4NSXA 4PBYA 3JZHA 3EI1A 3NVXA 5CXCB 3VGZA 5CYKA 1YFQA 4A0BA 5HE2B 3PE7A 4A0AB 4YVDA 3F3FA 2CE9A 3KRWB 1MDAH 3EMHA 2P9UC 2PM7B 3IJ1A 4J86A 5IJ8E 5EAPA 4O1QD 3DWLC 2OJYA 3L4OD 2YMUA 4O3UB 5KDOB 3BWSA 1QNIA 4A7JA 3V7DB 4CY2A 2P9SC 4ERQA 1L0QA 2IUPA
chains in the Genus database with same CATH superfamily
2Z2PA 2AGXA 2IAAA 4AOWA 5GSAA 3AL8B 2AH0A 4L3GD 3RFHA 4BCBA 4JXMA 2H13A 3KCIA 4UI9R 1SQJA 3BG1A 2XYIA 4A11B 2Z2OA 4LG8A 4ERZA 2HKRA 1QFSA 5C2WB 1QFMA 3IUJA 3K6SA 5K19A 1BPOA 4GQBB 4O9DA 4HDJA 3UKUC 1JOFA 1T2XA 4A2LA 3MXXA 2XE4A 3IUQA 3QHYB 3I7OA 4NC4A 4JD2C 3SCYA 2CN3A 3I89A 1GOFA 2CN2A 1E8NA 2PBIB 3RRMC 4L1QD 5EALA 4QRJA 3FCSA 4ZN4A 5EARA 4IA9A 3I8CA 3C75H 3NIFA 3JB9L 4CI8A 2EIBA 3IJ0A 4LG9A 3PXTD 1A12A 4FHLA 2HJ4A 2YNOA 1TBGA 2H3XA 3V5WB 3OKYA 1GG2B 2Z2NA 2P9IC 3W15A 4IRZA 2YBAA 5GXHA 5TEFA 3EU7A 2B4EA 2P9PC 3IJCA 5M5SA 3SFZA 3FGBA 2H6KA 1N6DA 2O9KA 5M5RA 4JT5C 3SJLD 3DSMA 3JZGA 4FB1D 1GP2B 4JSPC 4R7AB 4H5IA 4DNWA 4GQ1A 3N0DA 5I5MA 1R5MA 4J84A 2QXVA 3IURA 4QL1A 5IGOA 4AMZA 3K72A 5HE0B 1PGUA 1PEVA 1MG2A 2EIEA 3ULEC 3NVQA 3HFQA 4CZXA 5A2Qg 5M61A 4BL0A 1JTDB 3V4VA 2YNNA 5EM2A 2P9KC 4E5ZB 5E6UA 4K3JB 2HU7A 2HJBA 5THAA 3CFSB 2H6NA 3EI1B 4JSVC 1UOOA 5EMLB 5CYKB 2QR5A 3OW8A 3V4PA 4A0BB 2B5NA 1RI6A 2AGYA 5I5JA 4D6VA 5AJAA 3O4IA 1GOGA 3PSLA 4MMZA 2J55H 3FCUA 4WJKA 5CXBA 5IT9g 4J0XA 3DDUA 4MK0B 1JV2A 3I7NA 1S4UX 2H6QA 3K26A 2BBKH 2YNPA 4GZ8A 1K3IA 3C9CA 3RN1D 3RLMD 3KRXB 3UVOA 4D0KA 4ES0A 3RMZD 1N6EA 3VH0A 2HXCA 3ZE0A 2CNXA 3MKQA 3ODTA 3OTTA 2GC4A 5M5UA 3SMRA 4GM3A 3SN6B 4Z7NA 2VDKA 2VDQA 4PXWA 5FQDA 3JAMg 3E0CA 1I2MB 4LGNA 5GXIA 3EG6A 4GGDA 2H68A 4CY1A 3L4MD 3K71A 4UM8A 3MMYA 4OZUA 3OL2A 4J77A 2QC5A 2XZGA 2OVRB 5IC7A 3DXKC 3NIGA 4GGAA 2W18A 4KFMB 5AMSA 3SBPA 3EI4A 3EI2A 1O6GA 3SXTD 1B9XA 4WK0A 4FA9D 3I8EA 3I7LA 1C9IA 4FAND 4A09A 4PC0A 3OKYB 3J80g 4G1MA 4QQEA 5GMKn 1OLZA 4J79A 3PSCB 4CI2A 3T3PA 2VDLA 1XHMA 4NENA 2VZ1A 2CO0C 1K32A 2H47A 5FFOA 4NBMA 4X61B 3RFGA 3I2NA 3FM0A 3IVMA 1E8MA 1U4CA 4WK2A 5IGQA 4PSWB 2HU5A 4BP9A 1VZ2A 2IUVA 3SBQA 3GC3B 4XEIC 4O2WA 3AH8B 4CY3A 2H9MA 3DXMC 4BP8A 4JHNA 2AQ5A 5HE1B 1U8CA 2AGZA 4DNUA 3NVNA 5TDHB 4J78A 4J0WA 4J8GA 4O45A 4CZYA 5FKQA 4GQ2P 3EI3A 2I0TA 4CI1A 3MUOA 3GREA 4G56B 3V9FA 2OK6A 3OKWA 5EM2B 1A0RB 2P9NC 3JROA 3QI0A 5H17A 2GNQA 4JT6C 2XL2A 3UVKA 3MZKA 5M5TA 5FFGA 4ZOYA 2OVQB 2G9AA 5FKSA 3IIWA 4O02A 4QAMA 3EQ8A 4FAVD 3B7FA 5TF2A 1PI6A 2I0SA 3PXWD 3RSEC 4ZOXA 1N6FA 3O4HA 3I7HA 3PVWB 5CXBB 2OIZA 4FWWA 1VYHC 4JSNC 4J82A 4MMXA 3SBRA 3ZE1A 4E54A 4BUJC 3UVNA 3SLED 3JRPA 1TYEA 4O3TB 4L3HD 3GFCA 4NAAA 1JMXB 2CE8A 3T3MA 3EWEA 2HU8A 3NIDA 2AH1A 3MZLA 4QT8A 3UVLA 5HE3B 2IUQA 2UZYB 3MVDK 2I3TA 2AGLA 5TEEA 2J56H 2I3SA 2PM9A 2VDOA 3IKOA 2MTAH 4A08A 4U1EI 2CO0A 5FKRA 4RE6A 3F3PA 2HKMA 5E6SA 3SWSD 3PVUB 4J87A 4U7AA 4AN1A 4X63B 3SHFA 4L9OA 2B5MA 5C2VB 3ZE2A 4WK4A 1Q47A 5EMJB 4UM9A 2J57G 1H2ZA 5CXCA 3FRXA 5H14A 4K3ID 2HYEA 1NEXB 3OL2B 4TZ4A 4A0AA 4GM8A 4AX4A 4Y7RA 4AMYA 4FA4D 5C9ZB 1H2WA 3U4YA 1PBYB 1NR0A 4XYHA 1SHYB 2Q7QA 4CZVA 1FWXA 4JSXC 5I5IA 2VDNA 4G1EA 4H5JA 1C9LA 3C5MA 4X3EA 1SQ9A 1OMWB 2VC2A 3EI4B 3VA6A 3EI2B 1GXRA 4AN0A 2H9LA 2TRCB 4G55A 5FKTA 1VE7A 2OVPB 4D9SA 2GC7A 4A09B 3PXSD 2P9LC 2YB8B 2XU7A 3JZNA 4GGCA 2BKLA 5HYNB 5EMMB 1UTCA 4PSXB 1MG3A 5EAMA 2EBSA 2XL3A 3IJEA 4I79A 3I7PA 3O4GA 3VI3A 1XKSA 3AL8A 3CFVA 4JHPC 3UKRC 1L5GA 2IURA 2H9NA 3ZDXA 4J81A 2IWKA 4A11A 3ZDZA 4CI3A 4DNVA 3P4FA 4J8BA 2HESX 1JMZB 3IUMA 5FXYA 3VI4A 1XIPA 1YR2A 3OKTA 5B4WA 4FA5D 1M1XA 4A2MA 1GOTB 1O6FA 4FA1D 4AEZA 5FLXg 2VDPA 3IULA 4EWRA 2I0RA 3I7KA 4Z8LA 3EI3B 3RN0D 3F3GA 5IJ7E 3EQ9A 5H1MA 4GM9A 3J81g 5EMKB 3SVWD 5C86A 2XDWA 4CC9A 1VZ3A 4BCDA 3C99A 4GMBA 4L1MA 3DM0A 2VZ3A 4OWRA 2QZPA 4XYIA 5E6RA 1GOHA 4IMMA 2H14A 4ERYA 4PNKB 5AFU3 4RE5A 4N14A 1UOPA 3GD1I 4PBZA 5JWZA 2EIDA 4ESGA 2UZXB 1ERJA 5FA5B 5K1CC 1UOQA 3ZWLB 2EICA 3O4JA 4E54B 3MUNA 2G99A 3UVMA 4CY5A 3N0EA 1K8KC 1VE6A 5C92A 2BCJB 3IUNA 2VDMA 2H9PA 2OK4A 2VDRA 2IWFA 1P22A 4J73A 3ORVD 4BH6A 3K27A 3IIYA 2PM9B 1E5TA 2AGWA 3BG0A 1B9YA 1JJUB 4A08B 4X60B 5HDBA 2B5LA 3AFCA 3CIKB 3MKSB 5SXMA 3JPXA 4ZOVA 3A0FA 2PM6B 3AL9A 4Y5RD 3UR4A 5HQGA 4E5ZA 1H2YA 1TYQC 1U2VC 4ZOZA 4NSXA 4PBYA 3JZHA 3EI1A 3NVXA 5CXCB 1H2XA 3VGZA 5CYKA 1YFQA 4Z7QA 5HE2B 4A0BA 2WQ8A 3PE7A 4A0AB 4YVDA 4BCCA 3F3FA 2CE9A 3KRWB 1MDAH 3EMHA 2P9UC 2PM7B 3IJ1A 4J86A 2JKXA 5IJ8E 5EAPA 4MMYA 4O1QD 3DWLC 2OJYA 3L4OD 2YMUA 4O3UB 5KDOB 3BWSA 1QNIA 4A7JA 3OF7A 3V7DB 4CY2A 2P9SC 3ZDYA 4ERQA 4Z7OA 5M5VA 1L0QA 2IUPA 3EQ7A
chains in the Genus database with same CATH topology
2Z2PA 2AGXA 2IAAA 4AOWA 5GSAA 3AL8B 2AH0A 4L3GD 3RFHA 4JXMA 2H13A 4UI9R 1SQJA 3BG1A 2XYIA 4A11B 2Z2OA 4LG8A 4ERZA 2HKRA 5C2WB 5K19A 4GQBB 4O9DA 4HDJA 3UKUC 1JOFA 4A2LA 3MXXA 3I7OA 4JD2C 3SCYA 2CN3A 3I89A 2CN2A 2PBIB 3RRMC 4L1QD 5EALA 4QRJA 4ZN4A 5EARA 4IA9A 3I8CA 3C75H 3JB9L 4CI8A 3IJ0A 4LG9A 3PXTD 4FHLA 2HJ4A 2YNOA 1TBGA 2H3XA 3V5WB 3OKYA 1GG2B 2Z2NA 2P9IC 3W15A 2YBAA 5GXHA 5TEFA 3EU7A 2B4EA 2P9PC 3IJCA 3SFZA 3FGBA 2H6KA 1N6DA 2O9KA 4JT5C 3SJLD 3DSMA 3JZGA 4FB1D 1GP2B 4JSPC 4R7AB 4H5IA 4GQ1A 3N0DA 5I5MA 1R5MA 4J84A 2QXVA 4QL1A 5IGOA 5HE0B 1PGUA 1PEVA 1MG2A 3ULEC 3NVQA 3HFQA 4CZXA 5A2Qg 4BL0A 2YNNA 5EM2A 2P9KC 4E5ZB 4K3JB 2HJBA 5THAA 3CFSB 2H6NA 3EI1B 4JSVC 5EMLB 5CYKB 3OW8A 4A0BB 2B5NA 1RI6A 2AGYA 5I5JA 4D6VA 5AJAA 3PSLA 2J55H 5CXBA 5IT9g 4J0XA 4MK0B 3I7NA 1S4UX 2H6QA 3K26A 2BBKH 2YNPA 4GZ8A 3C9CA 3RN1D 3RLMD 3KRXB 3UVOA 4D0KA 4ES0A 3RMZD 1N6EA 3VH0A 2HXCA 2CNXA 3MKQA 3ODTA 3OTTA 2GC4A 3SMRA 4GM3A 3SN6B 5FQDA 4PXWA 3JAMg 3E0CA 4LGNA 5GXIA 3EG6A 4GGDA 2H68A 4CY1A 3L4MD 3MMYA 4OZUA 3OL2A 4J77A 2QC5A 2OVRB 5IC7A 3DXKC 4GGAA 2W18A 4KFMB 5AMSA 3SBPA 3EI4A 3EI2A 3SXTD 1B9XA 4FA9D 3I8EA 3I7LA 4FAND 4A09A 4PC0A 3OKYB 3J80g 4QQEA 5GMKn 1OLZA 4J79A 3PSCB 4CI2A 1XHMA 2CO0C 1K32A 2H47A 4X61B 3RFGA 3I2NA 3FM0A 1U4CA 5IGQA 4PSWB 2IUVA 3SBQA 4XEIC 3AH8B 4CY3A 2H9MA 3DXMC 5HE1B 2AQ5A 2AGZA 3NVNA 5TDHB 4J78A 4J0WA 4J8GA 4O45A 4CZYA 5FKQA 4GQ2P 3EI3A 2I0TA 4CI1A 3GREA 4G56B 3V9FA 2OK6A 3OKWA 5EM2B 1A0RB 2P9NC 3JROA 5H17A 2GNQA 4JT6C 2XL2A 3UVKA 3MZKA 4ZOYA 2OVQB 2G9AA 5FKSA 3IIWA 4FAVD 3B7FA 5TF2A 1PI6A 2I0SA 3PXWD 3RSEC 4ZOXA 1N6FA 3I7HA 3PVWB 5CXBB 2OIZA 4FWWA 1VYHC 4JSNC 4J82A 3SBRA 4E54A 4BUJC 3UVNA 3SLED 3JRPA 4O3TB 4L3HD 3GFCA 1JMXB 2CE8A 3EWEA 3UVLA 2AH1A 3MZLA 4QT8A 5HE3B 2IUQA 2UZYB 2I3TA 2AGLA 5TEEA 2J56H 2I3SA 2PM9A 3IKOA 2MTAH 4A08A 4U1EI 2CO0A 5FKRA 3F3PA 2HKMA 3SWSD 3PVUB 4J87A 4U7AA 4X63B 3SHFA 4L9OA 2B5MA 5C2VB 1Q47A 5EMJB 2J57G 5CXCA 3FRXA 5H14A 4K3ID 2HYEA 1NEXB 3OL2B 4TZ4A 4A0AA 4GM8A 4FA4D 4Y7RA 5C9ZB 3U4YA 1PBYB 1NR0A 4XYHA 1SHYB 2Q7QA 4CZVA 1FWXA 4JSXC 5I5IA 4H5JA 4X3EA 3C5MA 1SQ9A 1OMWB 3EI4B 3VA6A 3EI2B 1GXRA 2H9LA 2TRCB 5FKTA 2OVPB 2GC7A 4A09B 3PXSD 2P9LC 2YB8B 2XU7A 3JZNA 4GGCA 5HYNB 5EMMB 4PSXB 1MG3A 5EAMA 2EBSA 2XL3A 4I79A 3I7PA 1XKSA 3AL8A 3CFVA 3UKRC 2IURA 2H9NA 4J81A 2IWKA 4A11A 4CI3A 3P4FA 4J8BA 2HESX 1JMZB 5FXYA 1XIPA 4FA5D 3OKTA 5B4WA 4A2MA 1GOTB 4FA1D 4AEZA 5FLXg 4EWRA 2I0RA 3I7KA 4Z8LA 3EI3B 3RN0D 3F3GA 5IJ7E 5H1MA 4GM9A 3J81g 5EMKB 3SVWD 4CC9A 3C99A 4GMBA 3DM0A 4OWRA 4XYIA 4IMMA 2H14A 4ERYA 4PNKB 5AFU3 4N14A 4PBZA 5JWZA 4ESGA 2UZXB 1ERJA 5FA5B 5K1CC 3ZWLB 4E54B 2G99A 3UVMA 4CY5A 3N0EA 1K8KC 2BCJB 2H9PA 2OK4A 2IWFA 1P22A 4J73A 3ORVD 4BH6A 3K27A 3IIYA 2PM9B 2AGWA 3BG0A 1B9YA 1JJUB 4A08B 4X60B 2B5LA 3AFCA 3CIKB 3MKSB 5SXMA 3JPXA 4ZOVA 3A0FA 2PM6B 3AL9A 4Y5RD 3UR4A 5HQGA 4E5ZA 1TYQC 1U2VC 4ZOZA 4NSXA 4PBYA 3JZHA 3EI1A 3NVXA 5CXCB 3VGZA 5CYKA 1YFQA 4A0BA 5HE2B 3PE7A 4A0AB 4YVDA 3F3FA 2CE9A 3KRWB 1MDAH 3EMHA 2P9UC 2PM7B 3IJ1A 4J86A 5IJ8E 5EAPA 4O1QD 3DWLC 2OJYA 3L4OD 2YMUA 4O3UB 5KDOB 3BWSA 1QNIA 4A7JA 3V7DB 4CY2A 2P9SC 4ERQA 1L0QA 2IUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z2P A;  2AGX A;  2IAA A;  4AOW A;  5GSA A;  3AL8 B;  2AH0 A;  4L3G D;  3RFH A;  4JXM A;  2H13 A;  4UI9 R;  1SQJ A;  3BG1 A;  2XYI A;  4A11 B;  2Z2O A;  4LG8 A;  4ERZ A;  2HKR A;  5C2W B;  5K19 A;  4GQB B;  4O9D A;  4HDJ A;  3UKU C;  1JOF A;  4A2L A;  3MXX A;  3I7O A;  4JD2 C;  3SCY A;  2CN3 A;  3I89 A;  2CN2 A;  2PBI B;  3RRM C;  4L1Q D;  5EAL A;  4QRJ A;  4ZN4 A;  5EAR A;  4IA9 A;  3I8C A;  3C75 H;  3JB9 L;  4CI8 A;  3IJ0 A;  4LG9 A;  3PXT D;  4FHL A;  2HJ4 A;  2YNO A;  1TBG A;  2H3X A;  3V5W B;  3OKY A;  1GG2 B;  2Z2N A;  2P9I C;  3W15 A;  2YBA A;  5GXH A;  5TEF A;  3EU7 A;  2B4E A;  2P9P C;  3IJC A;  3SFZ A;  3FGB A;  2H6K A;  1N6D A;  2O9K A;  4JT5 C;  3SJL D;  3DSM A;  3JZG A;  4FB1 D;  1GP2 B;  4JSP C;  4R7A B;  4H5I A;  4GQ1 A;  3N0D A;  5I5M A;  1R5M A;  4J84 A;  2QXV A;  4QL1 A;  5IGO A;  5HE0 B;  1PGU A;  1PEV A;  1MG2 A;  3ULE C;  3NVQ A;  3HFQ A;  4CZX A;  5A2Q g;  4BL0 A;  2YNN A;  5EM2 A;  2P9K C;  4E5Z B;  4K3J B;  2HJB A;  5THA A;  3CFS B;  2H6N A;  3EI1 B;  4JSV C;  5EML B;  5CYK B;  3OW8 A;  4A0B B;  2B5N A;  1RI6 A;  2AGY A;  5I5J A;  4D6V A;  5AJA A;  3PSL A;  2J55 H;  5CXB A;  5IT9 g;  4J0X A;  4MK0 B;  3I7N A;  1S4U X;  2H6Q A;  3K26 A;  2BBK H;  2YNP A;  4GZ8 A;  3C9C A;  3RN1 D;  3RLM D;  3KRX B;  3UVO A;  4D0K A;  4ES0 A;  3RMZ D;  1N6E A;  3VH0 A;  2HXC A;  2CNX A;  3MKQ A;  3ODT A;  3OTT A;  2GC4 A;  3SMR A;  4GM3 A;  3SN6 B;  5FQD A;  4PXW A;  3JAM g;  3E0C A;  4LGN A;  5GXI A;  3EG6 A;  4GGD A;  2H68 A;  4CY1 A;  3L4M D;  3MMY A;  4OZU A;  3OL2 A;  4J77 A;  2QC5 A;  2OVR B;  5IC7 A;  3DXK C;  4GGA A;  2W18 A;  4KFM B;  5AMS A;  3SBP A;  3EI4 A;  3EI2 A;  3SXT D;  1B9X A;  4FA9 D;  3I8E A;  3I7L A;  4FAN D;  4A09 A;  4PC0 A;  3OKY B;  3J80 g;  4QQE A;  5GMK n;  1OLZ A;  4J79 A;  3PSC B;  4CI2 A;  1XHM A;  2CO0 C;  1K32 A;  2H47 A;  4X61 B;  3RFG A;  3I2N A;  3FM0 A;  1U4C A;  5IGQ A;  4PSW B;  2IUV A;  3SBQ A;  4XEI C;  3AH8 B;  4CY3 A;  2H9M A;  3DXM C;  5HE1 B;  2AQ5 A;  2AGZ A;  3NVN A;  5TDH B;  4J78 A;  4J0W A;  4J8G A;  4O45 A;  4CZY A;  5FKQ A;  4GQ2 P;  3EI3 A;  2I0T A;  4CI1 A;  3GRE A;  4G56 B;  3V9F A;  2OK6 A;  3OKW A;  5EM2 B;  1A0R B;  2P9N C;  3JRO A;  5H17 A;  2GNQ A;  4JT6 C;  2XL2 A;  3UVK A;  3MZK A;  4ZOY A;  2OVQ B;  2G9A A;  5FKS A;  3IIW A;  4FAV D;  3B7F A;  5TF2 A;  1PI6 A;  2I0S A;  3PXW D;  3RSE C;  4ZOX A;  1N6F A;  3I7H A;  3PVW B;  5CXB B;  2OIZ A;  4FWW A;  1VYH C;  4JSN C;  4J82 A;  3SBR A;  4E54 A;  4BUJ C;  3UVN A;  3SLE D;  3JRP A;  4O3T B;  4L3H D;  3GFC A;  1JMX B;  2CE8 A;  3EWE A;  3UVL A;  2AH1 A;  3MZL A;  4QT8 A;  5HE3 B;  2IUQ A;  2UZY B;  2I3T A;  2AGL A;  5TEE A;  2J56 H;  2I3S A;  2PM9 A;  3IKO A;  2MTA H;  4A08 A;  4U1E I;  2CO0 A;  5FKR A;  3F3P A;  2HKM A;  3SWS D;  3PVU B;  4J87 A;  4U7A A;  4X63 B;  3SHF A;  4L9O A;  2B5M A;  5C2V B;  1Q47 A;  5EMJ B;  2J57 G;  5CXC A;  3FRX A;  5H14 A;  4K3I D;  2HYE A;  1NEX B;  3OL2 B;  4TZ4 A;  4A0A A;  4GM8 A;  4FA4 D;  4Y7R A;  5C9Z B;  3U4Y A;  1PBY B;  1NR0 A;  4XYH A;  1SHY B;  2Q7Q A;  4CZV A;  1FWX A;  4JSX C;  5I5I A;  4H5J A;  4X3E A;  3C5M A;  1SQ9 A;  1OMW B;  3EI4 B;  3VA6 A;  3EI2 B;  1GXR A;  2H9L A;  2TRC B;  5FKT A;  2OVP B;  2GC7 A;  4A09 B;  3PXS D;  2P9L C;  2YB8 B;  2XU7 A;  3JZN A;  4GGC A;  5HYN B;  5EMM B;  4PSX B;  1MG3 A;  5EAM A;  2EBS A;  2XL3 A;  4I79 A;  3I7P A;  1XKS A;  3AL8 A;  3CFV A;  3UKR C;  2IUR A;  2H9N A;  4J81 A;  2IWK A;  4A11 A;  4CI3 A;  3P4F A;  4J8B A;  2HES X;  1JMZ B;  5FXY A;  1XIP A;  4FA5 D;  3OKT A;  5B4W A;  4A2M A;  1GOT B;  4FA1 D;  4AEZ A;  5FLX g;  4EWR A;  2I0R A;  3I7K A;  4Z8L A;  3EI3 B;  3RN0 D;  3F3G A;  5IJ7 E;  5H1M A;  4GM9 A;  3J81 g;  5EMK B;  3SVW D;  4CC9 A;  3C99 A;  4GMB A;  3DM0 A;  4OWR A;  4XYI A;  4IMM A;  2H14 A;  4ERY A;  4PNK B;  5AFU 3;  4N14 A;  4PBZ A;  5JWZ A;  4ESG A;  2UZX B;  1ERJ A;  5FA5 B;  5K1C C;  3ZWL B;  4E54 B;  2G99 A;  3UVM A;  4CY5 A;  3N0E A;  1K8K C;  2BCJ B;  2H9P A;  2OK4 A;  2IWF A;  1P22 A;  4J73 A;  3ORV D;  4BH6 A;  3K27 A;  3IIY A;  2PM9 B;  2AGW A;  3BG0 A;  1B9Y A;  1JJU B;  4A08 B;  4X60 B;  2B5L A;  3AFC A;  3CIK B;  3MKS B;  5SXM A;  3JPX A;  4ZOV A;  3A0F A;  2PM6 B;  3AL9 A;  4Y5R D;  3UR4 A;  5HQG A;  4E5Z A;  1TYQ C;  1U2V C;  4ZOZ A;  4NSX A;  4PBY A;  3JZH A;  3EI1 A;  3NVX A;  5CXC B;  3VGZ A;  5CYK A;  1YFQ A;  4A0B A;  5HE2 B;  3PE7 A;  4A0A B;  4YVD A;  3F3F A;  2CE9 A;  3KRW B;  1MDA H;  3EMH A;  2P9U C;  2PM7 B;  3IJ1 A;  4J86 A;  5IJ8 E;  5EAP A;  4O1Q D;  3DWL C;  2OJY A;  3L4O D;  2YMU A;  4O3U B;  5KDO B;  3BWS A;  1QNI A;  4A7J A;  3V7D B;  4CY2 A;  2P9S C;  4ERQ A;  1L0Q A;  2IUP A; 
#chains in the Genus database with same CATH topology
 2Z2P A;  2AGX A;  2IAA A;  4AOW A;  5GSA A;  3AL8 B;  2AH0 A;  4L3G D;  3RFH A;  4BCB A;  4JXM A;  2H13 A;  3KCI A;  4UI9 R;  1SQJ A;  3BG1 A;  2XYI A;  4A11 B;  2Z2O A;  4LG8 A;  4ERZ A;  2HKR A;  1QFS A;  5C2W B;  1QFM A;  3IUJ A;  3K6S A;  5K19 A;  1BPO A;  4GQB B;  4O9D A;  4HDJ A;  3UKU C;  1JOF A;  1T2X A;  4A2L A;  3MXX A;  2XE4 A;  3IUQ A;  3QHY B;  3I7O A;  4NC4 A;  4JD2 C;  3SCY A;  2CN3 A;  3I89 A;  1GOF A;  2CN2 A;  1E8N A;  2PBI B;  3RRM C;  4L1Q D;  5EAL A;  4QRJ A;  3FCS A;  4ZN4 A;  5EAR A;  4IA9 A;  3I8C A;  3C75 H;  3NIF A;  3JB9 L;  4CI8 A;  2EIB A;  3IJ0 A;  4LG9 A;  3PXT D;  1A12 A;  4FHL A;  2HJ4 A;  2YNO A;  1TBG A;  2H3X A;  3V5W B;  3OKY A;  1GG2 B;  2Z2N A;  2P9I C;  3W15 A;  4IRZ A;  2YBA A;  5GXH A;  5TEF A;  3EU7 A;  2B4E A;  2P9P C;  3IJC A;  5M5S A;  3SFZ A;  3FGB A;  2H6K A;  1N6D A;  2O9K A;  5M5R A;  4JT5 C;  3SJL D;  3DSM A;  3JZG A;  4FB1 D;  1GP2 B;  4JSP C;  4R7A B;  4H5I A;  4DNW A;  4GQ1 A;  3N0D A;  5I5M A;  1R5M A;  4J84 A;  2QXV A;  3IUR A;  4QL1 A;  5IGO A;  4AMZ A;  3K72 A;  5HE0 B;  1PGU A;  1PEV A;  1MG2 A;  2EIE A;  3ULE C;  3NVQ A;  3HFQ A;  4CZX A;  5A2Q g;  5M61 A;  4BL0 A;  1JTD B;  3V4V A;  2YNN A;  5EM2 A;  2P9K C;  4E5Z B;  5E6U A;  4K3J B;  2HU7 A;  2HJB A;  5THA A;  3CFS B;  2H6N A;  3EI1 B;  4JSV C;  1UOO A;  5EML B;  5CYK B;  2QR5 A;  3OW8 A;  3V4P A;  4A0B B;  2B5N A;  1RI6 A;  2AGY A;  5I5J A;  4D6V A;  5AJA A;  3O4I A;  1GOG A;  3PSL A;  4MMZ A;  2J55 H;  3FCU A;  4WJK A;  5CXB A;  5IT9 g;  4J0X A;  3DDU A;  4MK0 B;  1JV2 A;  3I7N A;  1S4U X;  2H6Q A;  3K26 A;  2BBK H;  2YNP A;  4GZ8 A;  1K3I A;  3C9C A;  3RN1 D;  3RLM D;  3KRX B;  3UVO A;  4D0K A;  4ES0 A;  3RMZ D;  1N6E A;  3VH0 A;  2HXC A;  3ZE0 A;  2CNX A;  3MKQ A;  3ODT A;  3OTT A;  2GC4 A;  5M5U A;  3SMR A;  4GM3 A;  3SN6 B;  4Z7N A;  2VDK A;  2VDQ A;  4PXW A;  5FQD A;  3JAM g;  3E0C A;  1I2M B;  4LGN A;  5GXI A;  3EG6 A;  4GGD A;  2H68 A;  4CY1 A;  3L4M D;  3K71 A;  4UM8 A;  3MMY A;  4OZU A;  3OL2 A;  4J77 A;  2QC5 A;  2XZG A;  2OVR B;  5IC7 A;  3DXK C;  3NIG A;  4GGA A;  2W18 A;  4KFM B;  5AMS A;  3SBP A;  3EI4 A;  3EI2 A;  1O6G A;  3SXT D;  1B9X A;  4WK0 A;  4FA9 D;  3I8E A;  3I7L A;  1C9I A;  4FAN D;  4A09 A;  4PC0 A;  3OKY B;  3J80 g;  4G1M A;  4QQE A;  5GMK n;  1OLZ A;  4J79 A;  3PSC B;  4CI2 A;  3T3P A;  2VDL A;  1XHM A;  4NEN A;  2VZ1 A;  2CO0 C;  1K32 A;  2H47 A;  5FFO A;  4NBM A;  4X61 B;  3RFG A;  3I2N A;  3FM0 A;  3IVM A;  1E8M A;  1U4C A;  4WK2 A;  5IGQ A;  4PSW B;  2HU5 A;  4BP9 A;  1VZ2 A;  2IUV A;  3SBQ A;  3GC3 B;  4XEI C;  4O2W A;  3AH8 B;  4CY3 A;  2H9M A;  3DXM C;  4BP8 A;  4JHN A;  2AQ5 A;  5HE1 B;  1U8C A;  2AGZ A;  4DNU A;  3NVN A;  5TDH B;  4J78 A;  4J0W A;  4J8G A;  4O45 A;  4CZY A;  5FKQ A;  4GQ2 P;  3EI3 A;  2I0T A;  4CI1 A;  3MUO A;  3GRE A;  4G56 B;  3V9F A;  2OK6 A;  3OKW A;  5EM2 B;  1A0R B;  2P9N C;  3JRO A;  3QI0 A;  5H17 A;  2GNQ A;  4JT6 C;  2XL2 A;  3UVK A;  3MZK A;  5M5T A;  5FFG A;  4ZOY A;  2OVQ B;  2G9A A;  5FKS A;  3IIW A;  4O02 A;  4QAM A;  3EQ8 A;  4FAV D;  3B7F A;  5TF2 A;  1PI6 A;  2I0S A;  3PXW D;  3RSE C;  4ZOX A;  1N6F A;  3O4H A;  3I7H A;  3PVW B;  5CXB B;  2OIZ A;  4FWW A;  1VYH C;  4JSN C;  4J82 A;  4MMX A;  3SBR A;  3ZE1 A;  4E54 A;  4BUJ C;  3UVN A;  3SLE D;  3JRP A;  1TYE A;  4O3T B;  4L3H D;  3GFC A;  4NAA A;  1JMX B;  2CE8 A;  3T3M A;  3EWE A;  2HU8 A;  3NID A;  2AH1 A;  3MZL A;  4QT8 A;  3UVL A;  5HE3 B;  2IUQ A;  2UZY B;  3MVD K;  2I3T A;  2AGL A;  5TEE A;  2J56 H;  2I3S A;  2PM9 A;  2VDO A;  3IKO A;  2MTA H;  4A08 A;  4U1E I;  2CO0 A;  5FKR A;  4RE6 A;  3F3P A;  2HKM A;  5E6S A;  3SWS D;  3PVU B;  4J87 A;  4U7A A;  4AN1 A;  4X63 B;  3SHF A;  4L9O A;  2B5M A;  5C2V B;  3ZE2 A;  4WK4 A;  1Q47 A;  5EMJ B;  4UM9 A;  2J57 G;  1H2Z A;  5CXC A;  3FRX A;  5H14 A;  4K3I D;  2HYE A;  1NEX B;  3OL2 B;  4TZ4 A;  4A0A A;  4GM8 A;  4AX4 A;  4Y7R A;  4AMY A;  4FA4 D;  5C9Z B;  1H2W A;  3U4Y A;  1PBY B;  1NR0 A;  4XYH A;  1SHY B;  2Q7Q A;  4CZV A;  1FWX A;  4JSX C;  5I5I A;  2VDN A;  4G1E A;  4H5J A;  1C9L A;  3C5M A;  4X3E A;  1SQ9 A;  1OMW B;  2VC2 A;  3EI4 B;  3VA6 A;  3EI2 B;  1GXR A;  4AN0 A;  2H9L A;  2TRC B;  4G55 A;  5FKT A;  1VE7 A;  2OVP B;  4D9S A;  2GC7 A;  4A09 B;  3PXS D;  2P9L C;  2YB8 B;  2XU7 A;  3JZN A;  4GGC A;  2BKL A;  5HYN B;  5EMM B;  1UTC A;  4PSX B;  1MG3 A;  5EAM A;  2EBS A;  2XL3 A;  3IJE A;  4I79 A;  3I7P A;  3O4G A;  3VI3 A;  1XKS A;  3AL8 A;  3CFV A;  4JHP C;  3UKR C;  1L5G A;  2IUR A;  2H9N A;  3ZDX A;  4J81 A;  2IWK A;  4A11 A;  3ZDZ A;  4CI3 A;  4DNV A;  3P4F A;  4J8B A;  2HES X;  1JMZ B;  3IUM A;  5FXY A;  3VI4 A;  1XIP A;  1YR2 A;  3OKT A;  5B4W A;  4FA5 D;  1M1X A;  4A2M A;  1GOT B;  1O6F A;  4FA1 D;  4AEZ A;  5FLX g;  2VDP A;  3IUL A;  4EWR A;  2I0R A;  3I7K A;  4Z8L A;  3EI3 B;  3RN0 D;  3F3G A;  5IJ7 E;  3EQ9 A;  5H1M A;  4GM9 A;  3J81 g;  5EMK B;  3SVW D;  5C86 A;  2XDW A;  4CC9 A;  1VZ3 A;  4BCD A;  3C99 A;  4GMB A;  4L1M A;  3DM0 A;  2VZ3 A;  4OWR A;  2QZP A;  4XYI A;  5E6R A;  1GOH A;  4IMM A;  2H14 A;  4ERY A;  4PNK B;  5AFU 3;  4RE5 A;  4N14 A;  1UOP A;  3GD1 I;  4PBZ A;  5JWZ A;  2EID A;  4ESG A;  2UZX B;  1ERJ A;  5FA5 B;  5K1C C;  1UOQ A;  3ZWL B;  2EIC A;  3O4J A;  4E54 B;  3MUN A;  2G99 A;  3UVM A;  4CY5 A;  3N0E A;  1K8K C;  1VE6 A;  5C92 A;  2BCJ B;  3IUN A;  2VDM A;  2H9P A;  2OK4 A;  2VDR A;  2IWF A;  1P22 A;  4J73 A;  3ORV D;  4BH6 A;  3K27 A;  3IIY A;  2PM9 B;  1E5T A;  2AGW A;  3BG0 A;  1B9Y A;  1JJU B;  4A08 B;  4X60 B;  5HDB A;  2B5L A;  3AFC A;  3CIK B;  3MKS B;  5SXM A;  3JPX A;  4ZOV A;  3A0F A;  2PM6 B;  3AL9 A;  4Y5R D;  3UR4 A;  5HQG A;  4E5Z A;  1H2Y A;  1TYQ C;  1U2V C;  4ZOZ A;  4NSX A;  4PBY A;  3JZH A;  3EI1 A;  3NVX A;  5CXC B;  1H2X A;  3VGZ A;  5CYK A;  1YFQ A;  4Z7Q A;  5HE2 B;  4A0B A;  2WQ8 A;  3PE7 A;  4A0A B;  4YVD A;  4BCC A;  3F3F A;  2CE9 A;  3KRW B;  1MDA H;  3EMH A;  2P9U C;  2PM7 B;  3IJ1 A;  4J86 A;  2JKX A;  5IJ8 E;  5EAP A;  4MMY A;  4O1Q D;  3DWL C;  2OJY A;  3L4O D;  2YMU A;  4O3U B;  5KDO B;  3BWS A;  1QNI A;  4A7J A;  3OF7 A;  3V7D B;  4CY2 A;  2P9S C;  3ZDY A;  4ERQ A;  4Z7O A;  5M5V A;  1L0Q A;  2IUP A;  3EQ7 A; 
#chains in the Genus database with same CATH homology
 2Z2P A;  2AGX A;  2IAA A;  4AOW A;  5GSA A;  3AL8 B;  2AH0 A;  4L3G D;  3RFH A;  4JXM A;  2H13 A;  4UI9 R;  1SQJ A;  3BG1 A;  2XYI A;  4A11 B;  2Z2O A;  4LG8 A;  4ERZ A;  2HKR A;  5C2W B;  5K19 A;  4GQB B;  4O9D A;  4HDJ A;  3UKU C;  1JOF A;  4A2L A;  3MXX A;  3I7O A;  4JD2 C;  3SCY A;  2CN3 A;  3I89 A;  2CN2 A;  2PBI B;  3RRM C;  4L1Q D;  5EAL A;  4QRJ A;  4ZN4 A;  5EAR A;  4IA9 A;  3I8C A;  3C75 H;  3JB9 L;  4CI8 A;  3IJ0 A;  4LG9 A;  3PXT D;  4FHL A;  2HJ4 A;  2YNO A;  1TBG A;  2H3X A;  3V5W B;  3OKY A;  1GG2 B;  2Z2N A;  2P9I C;  3W15 A;  2YBA A;  5GXH A;  5TEF A;  3EU7 A;  2B4E A;  2P9P C;  3IJC A;  3SFZ A;  3FGB A;  2H6K A;  1N6D A;  2O9K A;  4JT5 C;  3SJL D;  3DSM A;  3JZG A;  4FB1 D;  1GP2 B;  4JSP C;  4R7A B;  4H5I A;  4GQ1 A;  3N0D A;  5I5M A;  1R5M A;  4J84 A;  2QXV A;  4QL1 A;  5IGO A;  5HE0 B;  1PGU A;  1PEV A;  1MG2 A;  3ULE C;  3NVQ A;  3HFQ A;  4CZX A;  5A2Q g;  4BL0 A;  2YNN A;  5EM2 A;  2P9K C;  4E5Z B;  4K3J B;  2HJB A;  5THA A;  3CFS B;  2H6N A;  3EI1 B;  4JSV C;  5EML B;  5CYK B;  3OW8 A;  4A0B B;  2B5N A;  1RI6 A;  2AGY A;  5I5J A;  4D6V A;  5AJA A;  3PSL A;  2J55 H;  5CXB A;  5IT9 g;  4J0X A;  4MK0 B;  3I7N A;  1S4U X;  2H6Q A;  3K26 A;  2BBK H;  2YNP A;  4GZ8 A;  3C9C A;  3RN1 D;  3RLM D;  3KRX B;  3UVO A;  4D0K A;  4ES0 A;  3RMZ D;  1N6E A;  3VH0 A;  2HXC A;  2CNX A;  3MKQ A;  3ODT A;  3OTT A;  2GC4 A;  3SMR A;  4GM3 A;  3SN6 B;  5FQD A;  4PXW A;  3JAM g;  3E0C A;  4LGN A;  5GXI A;  3EG6 A;  4GGD A;  2H68 A;  4CY1 A;  3L4M D;  3MMY A;  4OZU A;  3OL2 A;  4J77 A;  2QC5 A;  2OVR B;  5IC7 A;  3DXK C;  4GGA A;  2W18 A;  4KFM B;  5AMS A;  3SBP A;  3EI4 A;  3EI2 A;  3SXT D;  1B9X A;  4FA9 D;  3I8E A;  3I7L A;  4FAN D;  4A09 A;  4PC0 A;  3OKY B;  3J80 g;  4QQE A;  5GMK n;  1OLZ A;  4J79 A;  3PSC B;  4CI2 A;  1XHM A;  2CO0 C;  1K32 A;  2H47 A;  4X61 B;  3RFG A;  3I2N A;  3FM0 A;  1U4C A;  5IGQ A;  4PSW B;  2IUV A;  3SBQ A;  4XEI C;  3AH8 B;  4CY3 A;  2H9M A;  3DXM C;  5HE1 B;  2AQ5 A;  2AGZ A;  3NVN A;  5TDH B;  4J78 A;  4J0W A;  4J8G A;  4O45 A;  4CZY A;  5FKQ A;  4GQ2 P;  3EI3 A;  2I0T A;  4CI1 A;  3GRE A;  4G56 B;  3V9F A;  2OK6 A;  3OKW A;  5EM2 B;  1A0R B;  2P9N C;  3JRO A;  5H17 A;  2GNQ A;  4JT6 C;  2XL2 A;  3UVK A;  3MZK A;  4ZOY A;  2OVQ B;  2G9A A;  5FKS A;  3IIW A;  4FAV D;  3B7F A;  5TF2 A;  1PI6 A;  2I0S A;  3PXW D;  3RSE C;  4ZOX A;  1N6F A;  3I7H A;  3PVW B;  5CXB B;  2OIZ A;  4FWW A;  1VYH C;  4JSN C;  4J82 A;  3SBR A;  4E54 A;  4BUJ C;  3UVN A;  3SLE D;  3JRP A;  4O3T B;  4L3H D;  3GFC A;  1JMX B;  2CE8 A;  3EWE A;  3UVL A;  2AH1 A;  3MZL A;  4QT8 A;  5HE3 B;  2IUQ A;  2UZY B;  2I3T A;  2AGL A;  5TEE A;  2J56 H;  2I3S A;  2PM9 A;  3IKO A;  2MTA H;  4A08 A;  4U1E I;  2CO0 A;  5FKR A;  3F3P A;  2HKM A;  3SWS D;  3PVU B;  4J87 A;  4U7A A;  4X63 B;  3SHF A;  4L9O A;  2B5M A;  5C2V B;  1Q47 A;  5EMJ B;  2J57 G;  5CXC A;  3FRX A;  5H14 A;  4K3I D;  2HYE A;  1NEX B;  3OL2 B;  4TZ4 A;  4A0A A;  4GM8 A;  4FA4 D;  4Y7R A;  5C9Z B;  3U4Y A;  1PBY B;  1NR0 A;  4XYH A;  1SHY B;  2Q7Q A;  4CZV A;  1FWX A;  4JSX C;  5I5I A;  4H5J A;  4X3E A;  3C5M A;  1SQ9 A;  1OMW B;  3EI4 B;  3VA6 A;  3EI2 B;  1GXR A;  2H9L A;  2TRC B;  5FKT A;  2OVP B;  2GC7 A;  4A09 B;  3PXS D;  2P9L C;  2YB8 B;  2XU7 A;  3JZN A;  4GGC A;  5HYN B;  5EMM B;  4PSX B;  1MG3 A;  5EAM A;  2EBS A;  2XL3 A;  4I79 A;  3I7P A;  1XKS A;  3AL8 A;  3CFV A;  3UKR C;  2IUR A;  2H9N A;  4J81 A;  2IWK A;  4A11 A;  4CI3 A;  3P4F A;  4J8B A;  2HES X;  1JMZ B;  5FXY A;  1XIP A;  4FA5 D;  3OKT A;  5B4W A;  4A2M A;  1GOT B;  4FA1 D;  4AEZ A;  5FLX g;  4EWR A;  2I0R A;  3I7K A;  4Z8L A;  3EI3 B;  3RN0 D;  3F3G A;  5IJ7 E;  5H1M A;  4GM9 A;  3J81 g;  5EMK B;  3SVW D;  4CC9 A;  3C99 A;  4GMB A;  3DM0 A;  4OWR A;  4XYI A;  4IMM A;  2H14 A;  4ERY A;  4PNK B;  5AFU 3;  4N14 A;  4PBZ A;  5JWZ A;  4ESG A;  2UZX B;  1ERJ A;  5FA5 B;  5K1C C;  3ZWL B;  4E54 B;  2G99 A;  3UVM A;  4CY5 A;  3N0E A;  1K8K C;  2BCJ B;  2H9P A;  2OK4 A;  2IWF A;  1P22 A;  4J73 A;  3ORV D;  4BH6 A;  3K27 A;  3IIY A;  2PM9 B;  2AGW A;  3BG0 A;  1B9Y A;  1JJU B;  4A08 B;  4X60 B;  2B5L A;  3AFC A;  3CIK B;  3MKS B;  5SXM A;  3JPX A;  4ZOV A;  3A0F A;  2PM6 B;  3AL9 A;  4Y5R D;  3UR4 A;  5HQG A;  4E5Z A;  1TYQ C;  1U2V C;  4ZOZ A;  4NSX A;  4PBY A;  3JZH A;  3EI1 A;  3NVX A;  5CXC B;  3VGZ A;  5CYK A;  1YFQ A;  4A0B A;  5HE2 B;  3PE7 A;  4A0A B;  4YVD A;  3F3F A;  2CE9 A;  3KRW B;  1MDA H;  3EMH A;  2P9U C;  2PM7 B;  3IJ1 A;  4J86 A;  5IJ8 E;  5EAP A;  4O1Q D;  3DWL C;  2OJY A;  3L4O D;  2YMU A;  4O3U B;  5KDO B;  3BWS A;  1QNI A;  4A7J A;  3V7D B;  4CY2 A;  2P9S C;  4ERQ A;  1L0Q A;  2IUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...