3JAMg

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 53
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3jamg01
5EM2B 4LGNA 2HKRA 5KDOB 4GGDA 4O1QD 1XHMA 2XL2A 3PSLA 4A0AA 3FRXA 3JAMg 4E5ZB 5FXYA 3PVWB 5HE2B 3BG1A 5IC7A 3RSEC 2CE9A 3VA6A 2MTAH 2HJBA 1SQ9A 2YMUA 4IMMA 4J0WA 5HQGA 2P9UC 2P9PC 1RI6A 2AGXA 3IIWA 3MXXA 1PGUA 4BUJC 2OVQB 5IJ7E 4X61B 3OKYA 4JSXC 4PBYA 5FKRA 1MG2A 2XL3A 3CFSB 4GZ8A 4ZOVA 4CZVA 5CXCA 3RFHA 3RRMC 1N6DA 2XYIA 3DXKC 3IJ1A 3OKYB 3GFCA 4CZXA 5K19A 2IURA 1FWXA 3OTTA 3RLMD 2H6KA 4G56B 4JXMA 3CFVA 3ORVD 3RFGA 1JMZB 1XIPA 3HFQA 4FA9D 1JJUB 1GXRA 4FHLA 4J8GA 4E5ZA 5H17A 1P22A 3E0CA 4H5JA 3GREA 3I7KA 4J0XA 2OVRB 5EMMB 4ZOXA 1U2VC 4LG9A 3V9FA 1A0RB 2P9IC 4J73A 5CXBB 4Z8LA 3DXMC 3EI3A 4O3TB 3SVWD 4D6VA 5SXMA 3PXWD 3N0DA 2H9MA 2I0SA 5GMKn 4JD2C 2PM7B 3PE7A 3DSMA 5IJ8E 4FA4D 5EALA 4U7AA 4I79A 1N6FA 3JZHA 2OJYA 3SWSD 2AH1A 4CY3A 4ZN4A 4ERYA 4J79A 2TRCB 1TBGA 5C2WB 2P9KC 3MZLA 4A08B 3F3GA 4ERZA 1K8KC 2AGZA 3SBRA 3OW8A 3IJ0A 3NVQA 4H5IA 4PXWA 3B7FA 5GXHA 4O9DA 2Q7QA 2G9AA 4J8BA 5B4WA 3SBQA 4L3HD 3UVMA 4CI1A 3AL9A 2J56H 2QC5A 4L9OA 1NR0A 4J84A 4D0KA 2YNPA 1GG2B 2Z2NA 4CC9A 3JRPA 2J55H 2J57G 5EARA 4A09B 2UZXB 2P9LC 4JSPC 4PBZA 4Y7RA 3A0FA 5FQDA 1PBYB 2HKMA 1OLZA 2CNXA 3J81g 2AGYA 1PEVA 3BWSA 4EWRA 4CI3A 2HJ4A 2IUPA 3SLED 2I3TA 5C2VB 2BCJB 3JZGA 3IKOA 2IWFA 4GM3A 2GC4A 4Y5RD 5EMKB 4U1EI 4A2LA 5EAMA 3UR4A 4FAND 3FM0A 4GM9A 3FGBA 3W15A 2CO0A 4GMBA 4HDJA 4XEIC 3EG6A 3NVNA 3EI4A 3SHFA 4JSVC 4X63B 2HYEA 5TDHB 2H9PA 3IIYA 4GGCA 3UVOA 3RN0D 2CN3A 3L4MD 3MMYA 2Z2PA 5EMLB 3C99A 2H14A 2CO0C 2B5LA 3P4FA 3PXTD 3EWEA 2UZYB 3DWLC 1N6EA 4LG8A 1MG3A 3SCYA 5TEFA 1JOFA 3NVXA 1R5MA 4PSWB 3JB9L 5FKQA 4FWWA 3BG0A 4XYIA 3MKQA 2O9KA 1GP2B 2I3SA 4GQ1A 3EI3B 5GXIA 3I7OA 1S4UX 3PVUB 4JT6C 2P9SC 3SXTD 4QQEA 2H68A 2H13A 3EI2B 2HXCA 3KRWB 3AFCA 5I5IA 1SHYB 4E54B 1VYHC 1XKSA 2AH0A 2QXVA 2PBIB 4YVDA 3SJLD 1JMXB 4K3JB 2B5NA 2YNNA 4A0BA 3JROA 5CXBA 3VGZA 1B9XA 2I0RA 3L4OD 4QL1A 5A2Qg 4GQ2P 2OVPB 5EAPA 5AJAA 4J86A 2CE8A 2W18A 4J77A 1QNIA 2IUVA 4L3GD 5GSAA 1PI6A 1GOTB 4PNKB 4CY1A 5THAA 2B4EA 3SN6B 4A0BB 1SQJA 3V5WB 5FLXg 3F3FA 2BBKH 3F3PA 3JZNA 5CXCB 4KFMB 4NSXA 4A0AB 5H1MA 2P9NC 3C5MA 5AFU3 4X3EA 3ULEC 2AGLA 5EM2A 3C75H 4GM8A 3JPXA 4CZYA 4FAVD 3CIKB 2OK4A 4L1QD 5IT9g 2GNQA 5HYNB 4JSNC 4E54A 5EMJB 4A2MA 4IA9A 3DM0A 3N0EA 3EI2A 2OK6A 4J81A 1NEXB 4UI9R 4CI2A 4N14A 3OKTA 2I0TA 4XYHA 2XU7A 5AMSA 2H6QA 3OKWA 1MDAH 3RN1D 5I5JA 5HE0B 4OZUA 3I89A 4MK0B 3UKUC 4GQBB 5CYKB 4OWRA 3MZKA 3EI1A 4A11B 4CI8A 2H47A 2GC7A 3I8EA 3KRXB 4QRJA 3SFZA 2AGWA 2H9LA 1U4CA 3C9CA 3K26A 3RMZD 3EI4B 3I7LA 3EU7A 3OL2B 5K1CC 4R7AB 3UKRC 1B9YA 3PXSD 3AL8B 4FA5D 5HE1B 2B5MA 4ZOYA 5I5MA 3SMRA 3IJCA 3UVNA 2H3XA 3VH0A 3AL8A 4ES0A 3PSCB 4GGAA 3SBPA 3ODTA 1K32A 4X60B 3I7NA 2PM9A 5FKSA 4AEZA 2PM9B 4ESGA 5JWZA 3AH8B 2YB8B 5TEEA 1TYQC 4ERQA 4J82A 2Z2OA 5IGOA 3I7HA 3MKSB 4FB1D 5FA5B 4A7JA 1ERJA 3EMHA 1Q47A 1L0QA 2IAAA 5IGQA 4AOWA 4TZ4A 3U4YA 2IUQA 2YNOA 4A09A 5HE3B 3OL2A 3I7PA 4BH6A 2CN2A 2EBSA 2YBAA 3UVLA 5H14A 4CY5A 3EI1B 5CYKA 3I8CA 4A08A 3UVKA 4J78A 4QT8A 3J80g 1YFQA 3K27A 4ZOZA 5TF2A 3V7DB 1OMWB 2HESX 4PC0A 4PSXB 2G99A 4A11A 2H6NA 2H9NA 2PM6B 4FA1D 4O45A 4BL0A 5C9ZB 2IWKA 2AQ5A 4J87A 3I2NA 4JT5C 4O3UB 5FKTA 2OIZA 4CY2A 3ZWLB 4K3ID
chains in the Genus database with same CATH superfamily
5EM2B 3QI0A 4LGNA 2HKRA 5KDOB 4GGDA 4WJKA 4O1QD 1XHMA 2XL2A 4O02A 3PSLA 1E8NA 4A0AA 3FRXA 3JAMg 1U8CA 4E5ZB 5FXYA 3PVWB 5HE2B 3BG1A 5IC7A 3RSEC 2CE9A 3VA6A 2MTAH 2HJBA 1SQ9A 2YMUA 4IMMA 4J0WA 5HQGA 2P9UC 2P9PC 1RI6A 2AGXA 3IIWA 3MXXA 1PGUA 4BUJC 2OVQB 5IJ7E 4G1MA 4X61B 4JHPC 3OKYA 2XDWA 4JSXC 4PBYA 5E6SA 5FKRA 1MG2A 2XL3A 3CFSB 4GZ8A 4ZOVA 4CZVA 5CXCA 3RFHA 3RRMC 3VI3A 3OKYB 1N6DA 2XYIA 3DXKC 3IJ1A 3GFCA 4CZXA 5K19A 3EQ9A 2IURA 1FWXA 3OTTA 3RLMD 2VZ1A 2H6KA 4G56B 1GOGA 4JXMA 3CFVA 3ZDZA 3ORVD 3ZE0A 3RFGA 5C86A 1JMZB 1XIPA 3HFQA 4FA9D 3FCUA 1JJUB 1GXRA 4FHLA 4J8GA 4E5ZA 5H17A 1P22A 4Z7QA 3E0CA 4H5JA 3GREA 3I7KA 4J0XA 2OVRB 5EMMB 4ZOXA 1U2VC 4LG9A 5M5RA 3V9FA 1A0RB 2P9IC 4J73A 4WK4A 4UM8A 4AMZA 3GD1I 5CXBB 3IJEA 4Z8LA 3DXMC 2XE4A 3EI3A 4O3TB 3SVWD 4D6VA 4DNWA 3O4IA 5SXMA 4DNUA 3PXWD 1UOPA 4O2WA 3N0DA 2H9MA 2I0SA 2VC2A 5GMKn 4JD2C 4UM9A 2PM7B 3PE7A 3DSMA 4BCBA 4G1EA 5IJ8E 4FA4D 5EALA 4U7AA 2JKXA 4I79A 1N6FA 4MMZA 1VZ2A 3JZHA 2OJYA 3SWSD 4NAAA 2AH1A 4CY3A 4ZN4A 4ERYA 4J79A 5M5UA 2TRCB 1TBGA 5C2WB 2P9KC 3MZLA 4A08B 3F3GA 4ERZA 1K8KC 2AGZA 3SBRA 3OW8A 3IJ0A 4BP8A 3NVQA 4H5IA 2VDMA 4PXWA 3B7FA 5GXHA 4O9DA 2Q7QA 3T3MA 2G9AA 4J8BA 1VZ3A 5B4WA 4L1MA 4L3HD 3SBQA 3UVMA 4CI1A 5FFOA 1O6FA 1JTDB 2J56H 2QC5A 3AL9A 4QAMA 4L9OA 1NR0A 4J84A 4D0KA 2YNPA 1GG2B 2Z2NA 4G55A 4CC9A 2VDQA 3JRPA 2J55H 2J57G 5EARA 1VE7A 3FCSA 4NC4A 2XZGA 4A09B 2UZXB 5C92A 2P9LC 4JSPC 4PBZA 4Y7RA 4MMXA 2BKLA 3A0FA 5FQDA 2EIDA 1PBYB 2HKMA 1OLZA 2CNXA 3J81g 4NENA 2AGYA 1GOFA 2WQ8A 4K3ID 4Z7NA 1PEVA 3BWSA 4EWRA 4CI3A 2HJ4A 2IUPA 3SLED 2I3TA 5C2VB 3JZGA 2BCJB 3IKOA 2VDOA 2IWFA 4GM3A 2GC4A 4Y5RD 1BPOA 5EMKB 4U1EI 3ZE2A 5HDBA 4A2LA 5EAMA 3UR4A 1UOOA 4FAND 3FM0A 4GM9A 3FGBA 3W15A 4Z7OA 3IUNA 2CO0A 4GMBA 4HDJA 4XEIC 3EG6A 3NVNA 3EI4A 3SHFA 4JSVC 4X63B 3MUNA 2HYEA 5TDHB 2H9PA 3IIYA 4GGCA 2QR5A 3ZDXA 3UVOA 3RN0D 2CN3A 2QZPA 3L4MD 2Z2PA 3MMYA 5EMLB 3C99A 2H14A 2CO0C 2B5LA 3P4FA 3PXTD 3EWEA 2UZYB 3DWLC 1N6EA 4LG8A 1MG3A 3SCYA 5TEFA 1JOFA 1UOQA 3NVXA 1R5MA 4PSWB 3JB9L 5FKQA 4FWWA 1UTCA 3BG0A 4XYIA 3MKQA 2O9KA 1GP2B 2I3SA 4GQ1A 3EI3B 2HU7A 1JV2A 1H2WA 5GXIA 3I7OA 3K71A 1QFMA 1S4UX 4DNVA 3PVUB 4JT6C 2P9SC 3SXTD 3IURA 1K3IA 4QQEA 1H2XA 2H68A 2H13A 3EI2B 2HXCA 3EQ8A 3KRWB 3AFCA 5I5IA 3T3PA 3IUQA 1SHYB 2HU5A 4E54B 1VYHC 2VDNA 1XKSA 2AH0A 3EQ7A 2QXVA 2PBIB 4YVDA 3K6SA 3SJLD 1JMXB 4K3JB 2B5NA 2YNNA 4A0BA 3V4VA 2VDPA 3JROA 5CXBA 3VGZA 1B9XA 1C9LA 2I0RA 3IVMA 3L4OD 4QL1A 5A2Qg 1H2ZA 4GQ2P 2OVPB 5EAPA 1GOHA 5AJAA 2EIEA 4J86A 2CE8A 2W18A 4J77A 1QNIA 2IUVA 4L3GD 5GSAA 1PI6A 3ZE1A 1GOTB 4PNKB 4AMYA 4CY1A 5THAA 2B4EA 5E6RA 3SN6B 4A0BB 1SQJA 3V5WB 5FLXg 3F3FA 2BBKH 3F3PA 3JZNA 5CXCB 5E6UA 4KFMB 1L5GA 4NSXA 4A0AB 5H1MA 2VDLA 5M5VA 2P9NC 4BCCA 3C5MA 4WK2A 4AX4A 5AFU3 4X3EA 3ULEC 1TYEA 4WK0A 2AGLA 3MUOA 5EM2A 3C75H 4GM8A 3JPXA 1O6GA 4CZYA 4FAVD 3CIKB 2OK4A 4L1QD 5IT9g 2GNQA 5HYNB 4JSNC 4D9SA 4E54A 5EMJB 5FFGA 5M5SA 2VZ3A 4IA9A 4A2MA 3DM0A 3IULA 3N0EA 3EI2A 2OK6A 4J81A 1NEXB 4UI9R 4CI2A 4N14A 3OKTA 2I0TA 4XYHA 3NIDA 2XU7A 5AMSA 2H6QA 3OKWA 1MDAH 3RN1D 5I5JA 5HE0B 4OZUA 3I89A 4MMYA 5M61A 2VDRA 3MVDK 4MK0B 1T2XA 3UKUC 4GQBB 5CYKB 4OWRA 3MZKA 1C9IA 3EI1A 4RE6A 1A12A 4A11B 4CI8A 2H47A 2GC7A 3I8EA 3IUJA 3KRXB 1VE6A 4QRJA 4RE5A 4IRZA 3SFZA 2AGWA 1H2YA 2H9LA 3IUMA 1U4CA 3C9CA 3K26A 3RMZD 3EI4B 4AN0A 3I7LA 3OF7A 3EU7A 3OL2B 5K1CC 3VI4A 4R7AB 4BP9A 3UKRC 2EICA 1B9YA 3GC3B 3PXSD 3AL8B 3NIGA 4FA5D 5HE1B 2B5MA 1M1XA 4ZOYA 5I5MA 3SMRA 1I2MB 3IJCA 3UVNA 2H3XA 3VH0A 3AL8A 4ES0A 3PSCB 4GGAA 3SBPA 3ZDYA 3ODTA 4BCDA 1K32A 4X60B 3I7NA 2PM9A 5FKSA 4AEZA 2PM9B 4ESGA 5JWZA 3KCIA 3AH8B 2YB8B 5TEEA 1TYQC 3DDUA 4ERQA 1E8MA 2Z2OA 4J82A 5IGOA 3I7HA 4NBMA 3MKSB 4FB1D 5FA5B 4A7JA 1ERJA 3EMHA 1Q47A 1L0QA 2IAAA 5IGQA 4AOWA 4TZ4A 3U4YA 2IUQA 4AN1A 3V4PA 3O4GA 3QHYB 2HU8A 2YNOA 4A09A 5HE3B 3OL2A 3I7PA 4BH6A 2CN2A 2EBSA 2YBAA 3UVLA 5H14A 4CY5A 3EI1B 5CYKA 3I8CA 4A08A 3UVKA 4J78A 1YR2A 4QT8A 1YFQA 3K27A 4ZOZA 5TF2A 3V7DB 3J80g 1OMWB 2HESX 3O4HA 4PC0A 4PSXB 2G99A 4A11A 2H6NA 2H9NA 2PM6B 1E5TA 4FA1D 4O45A 5M5TA 4BL0A 5C9ZB 2IWKA 2AQ5A 3O4JA 1QFSA 3K72A 4J87A 3I2NA 4JT5C 4O3UB 5FKTA 2VDKA 3NIFA 2OIZA 4CY2A 3ZWLB 4JHNA 2EIBA
chains in the Genus database with same CATH topology
5EM2B 4LGNA 2HKRA 5KDOB 4GGDA 4O1QD 1XHMA 2XL2A 3PSLA 4A0AA 3FRXA 3JAMg 4E5ZB 5FXYA 3PVWB 5HE2B 3BG1A 5IC7A 3RSEC 2CE9A 3VA6A 2MTAH 2HJBA 1SQ9A 2YMUA 4IMMA 4J0WA 5HQGA 2P9UC 2P9PC 1RI6A 2AGXA 3IIWA 3MXXA 1PGUA 4BUJC 2OVQB 5IJ7E 4X61B 3OKYA 4JSXC 4PBYA 5FKRA 1MG2A 2XL3A 3CFSB 4GZ8A 4ZOVA 4CZVA 5CXCA 3RFHA 3RRMC 1N6DA 2XYIA 3DXKC 3IJ1A 3OKYB 3GFCA 4CZXA 5K19A 2IURA 1FWXA 3OTTA 3RLMD 2H6KA 4G56B 4JXMA 3CFVA 3ORVD 3RFGA 1JMZB 1XIPA 3HFQA 4FA9D 1JJUB 1GXRA 4FHLA 4J8GA 4E5ZA 5H17A 1P22A 3E0CA 4H5JA 3GREA 3I7KA 4J0XA 2OVRB 5EMMB 4ZOXA 1U2VC 4LG9A 3V9FA 1A0RB 2P9IC 4J73A 5CXBB 4Z8LA 3DXMC 3EI3A 4O3TB 3SVWD 4D6VA 5SXMA 3PXWD 3N0DA 2H9MA 2I0SA 5GMKn 4JD2C 2PM7B 3PE7A 3DSMA 5IJ8E 4FA4D 5EALA 4U7AA 4I79A 1N6FA 3JZHA 2OJYA 3SWSD 2AH1A 4CY3A 4ZN4A 4ERYA 4J79A 2TRCB 1TBGA 5C2WB 2P9KC 3MZLA 4A08B 3F3GA 4ERZA 1K8KC 2AGZA 3SBRA 3OW8A 3IJ0A 3NVQA 4H5IA 4PXWA 3B7FA 5GXHA 4O9DA 2Q7QA 2G9AA 4J8BA 5B4WA 3SBQA 4L3HD 3UVMA 4CI1A 3AL9A 2J56H 2QC5A 4L9OA 1NR0A 4J84A 4D0KA 2YNPA 1GG2B 2Z2NA 4CC9A 3JRPA 2J55H 2J57G 5EARA 4A09B 2UZXB 2P9LC 4JSPC 4PBZA 4Y7RA 3A0FA 5FQDA 1PBYB 2HKMA 1OLZA 2CNXA 3J81g 2AGYA 1PEVA 3BWSA 4EWRA 4CI3A 2HJ4A 2IUPA 3SLED 2I3TA 5C2VB 2BCJB 3JZGA 3IKOA 2IWFA 4GM3A 2GC4A 4Y5RD 5EMKB 4U1EI 4A2LA 5EAMA 3UR4A 4FAND 3FM0A 4GM9A 3FGBA 3W15A 2CO0A 4GMBA 4HDJA 4XEIC 3EG6A 3NVNA 3EI4A 3SHFA 4JSVC 4X63B 2HYEA 5TDHB 2H9PA 3IIYA 4GGCA 3UVOA 3RN0D 2CN3A 3L4MD 3MMYA 2Z2PA 5EMLB 3C99A 2H14A 2CO0C 2B5LA 3P4FA 3PXTD 3EWEA 2UZYB 3DWLC 1N6EA 4LG8A 1MG3A 3SCYA 5TEFA 1JOFA 3NVXA 1R5MA 4PSWB 3JB9L 5FKQA 4FWWA 3BG0A 4XYIA 3MKQA 2O9KA 1GP2B 2I3SA 4GQ1A 3EI3B 5GXIA 3I7OA 1S4UX 3PVUB 4JT6C 2P9SC 3SXTD 4QQEA 2H68A 2H13A 3EI2B 2HXCA 3KRWB 3AFCA 5I5IA 1SHYB 4E54B 1VYHC 1XKSA 2AH0A 2QXVA 2PBIB 4YVDA 3SJLD 1JMXB 4K3JB 2B5NA 2YNNA 4A0BA 3JROA 5CXBA 3VGZA 1B9XA 2I0RA 3L4OD 4QL1A 5A2Qg 4GQ2P 2OVPB 5EAPA 5AJAA 4J86A 2CE8A 2W18A 4J77A 1QNIA 2IUVA 4L3GD 5GSAA 1PI6A 1GOTB 4PNKB 4CY1A 5THAA 2B4EA 3SN6B 4A0BB 1SQJA 3V5WB 5FLXg 3F3FA 2BBKH 3F3PA 3JZNA 5CXCB 4KFMB 4NSXA 4A0AB 5H1MA 2P9NC 3C5MA 5AFU3 4X3EA 3ULEC 2AGLA 5EM2A 3C75H 4GM8A 3JPXA 4CZYA 4FAVD 3CIKB 2OK4A 4L1QD 5IT9g 2GNQA 5HYNB 4JSNC 4E54A 5EMJB 4A2MA 4IA9A 3DM0A 3N0EA 3EI2A 2OK6A 4J81A 1NEXB 4UI9R 4CI2A 4N14A 3OKTA 2I0TA 4XYHA 2XU7A 5AMSA 2H6QA 3OKWA 1MDAH 3RN1D 5I5JA 5HE0B 4OZUA 3I89A 4MK0B 3UKUC 4GQBB 5CYKB 4OWRA 3MZKA 3EI1A 4A11B 4CI8A 2H47A 2GC7A 3I8EA 3KRXB 4QRJA 3SFZA 2AGWA 2H9LA 1U4CA 3C9CA 3K26A 3RMZD 3EI4B 3I7LA 3EU7A 3OL2B 5K1CC 4R7AB 3UKRC 1B9YA 3PXSD 3AL8B 4FA5D 5HE1B 2B5MA 4ZOYA 5I5MA 3SMRA 3IJCA 3UVNA 2H3XA 3VH0A 3AL8A 4ES0A 3PSCB 4GGAA 3SBPA 3ODTA 1K32A 4X60B 3I7NA 2PM9A 5FKSA 4AEZA 2PM9B 4ESGA 5JWZA 3AH8B 2YB8B 5TEEA 1TYQC 4ERQA 4J82A 2Z2OA 5IGOA 3I7HA 3MKSB 4FB1D 5FA5B 4A7JA 1ERJA 3EMHA 1Q47A 1L0QA 2IAAA 5IGQA 4AOWA 4TZ4A 3U4YA 2IUQA 2YNOA 4A09A 5HE3B 3OL2A 3I7PA 4BH6A 2CN2A 2EBSA 2YBAA 3UVLA 5H14A 4CY5A 3EI1B 5CYKA 3I8CA 4A08A 3UVKA 4J78A 4QT8A 3J80g 1YFQA 3K27A 4ZOZA 5TF2A 3V7DB 1OMWB 2HESX 4PC0A 4PSXB 2G99A 4A11A 2H6NA 2H9NA 2PM6B 4FA1D 4O45A 4BL0A 5C9ZB 2IWKA 2AQ5A 4J87A 3I2NA 4JT5C 4O3UB 5FKTA 2OIZA 4CY2A 3ZWLB 4K3ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM2 B;  4LGN A;  2HKR A;  5KDO B;  4GGD A;  4O1Q D;  1XHM A;  2XL2 A;  3PSL A;  4A0A A;  3FRX A;  3JAM g;  4E5Z B;  5FXY A;  3PVW B;  5HE2 B;  3BG1 A;  5IC7 A;  3RSE C;  2CE9 A;  3VA6 A;  2MTA H;  2HJB A;  1SQ9 A;  2YMU A;  4IMM A;  4J0W A;  5HQG A;  2P9U C;  2P9P C;  1RI6 A;  2AGX A;  3IIW A;  3MXX A;  1PGU A;  4BUJ C;  2OVQ B;  5IJ7 E;  4X61 B;  3OKY A;  4JSX C;  4PBY A;  5FKR A;  1MG2 A;  2XL3 A;  3CFS B;  4GZ8 A;  4ZOV A;  4CZV A;  5CXC A;  3RFH A;  3RRM C;  1N6D A;  2XYI A;  3DXK C;  3IJ1 A;  3OKY B;  3GFC A;  4CZX A;  5K19 A;  2IUR A;  1FWX A;  3OTT A;  3RLM D;  2H6K A;  4G56 B;  4JXM A;  3CFV A;  3ORV D;  3RFG A;  1JMZ B;  1XIP A;  3HFQ A;  4FA9 D;  1JJU B;  1GXR A;  4FHL A;  4J8G A;  4E5Z A;  5H17 A;  1P22 A;  3E0C A;  4H5J A;  3GRE A;  3I7K A;  4J0X A;  2OVR B;  5EMM B;  4ZOX A;  1U2V C;  4LG9 A;  3V9F A;  1A0R B;  2P9I C;  4J73 A;  5CXB B;  4Z8L A;  3DXM C;  3EI3 A;  4O3T B;  3SVW D;  4D6V A;  5SXM A;  3PXW D;  3N0D A;  2H9M A;  2I0S A;  5GMK n;  4JD2 C;  2PM7 B;  3PE7 A;  3DSM A;  5IJ8 E;  4FA4 D;  5EAL A;  4U7A A;  4I79 A;  1N6F A;  3JZH A;  2OJY A;  3SWS D;  2AH1 A;  4CY3 A;  4ZN4 A;  4ERY A;  4J79 A;  2TRC B;  1TBG A;  5C2W B;  2P9K C;  3MZL A;  4A08 B;  3F3G A;  4ERZ A;  1K8K C;  2AGZ A;  3SBR A;  3OW8 A;  3IJ0 A;  3NVQ A;  4H5I A;  4PXW A;  3B7F A;  5GXH A;  4O9D A;  2Q7Q A;  2G9A A;  4J8B A;  5B4W A;  3SBQ A;  4L3H D;  3UVM A;  4CI1 A;  3AL9 A;  2J56 H;  2QC5 A;  4L9O A;  1NR0 A;  4J84 A;  4D0K A;  2YNP A;  1GG2 B;  2Z2N A;  4CC9 A;  3JRP A;  2J55 H;  2J57 G;  5EAR A;  4A09 B;  2UZX B;  2P9L C;  4JSP C;  4PBZ A;  4Y7R A;  3A0F A;  5FQD A;  1PBY B;  2HKM A;  1OLZ A;  2CNX A;  3J81 g;  2AGY A;  1PEV A;  3BWS A;  4EWR A;  4CI3 A;  2HJ4 A;  2IUP A;  3SLE D;  2I3T A;  5C2V B;  2BCJ B;  3JZG A;  3IKO A;  2IWF A;  4GM3 A;  2GC4 A;  4Y5R D;  5EMK B;  4U1E I;  4A2L A;  5EAM A;  3UR4 A;  4FAN D;  3FM0 A;  4GM9 A;  3FGB A;  3W15 A;  2CO0 A;  4GMB A;  4HDJ A;  4XEI C;  3EG6 A;  3NVN A;  3EI4 A;  3SHF A;  4JSV C;  4X63 B;  2HYE A;  5TDH B;  2H9P A;  3IIY A;  4GGC A;  3UVO A;  3RN0 D;  2CN3 A;  3L4M D;  3MMY A;  2Z2P A;  5EML B;  3C99 A;  2H14 A;  2CO0 C;  2B5L A;  3P4F A;  3PXT D;  3EWE A;  2UZY B;  3DWL C;  1N6E A;  4LG8 A;  1MG3 A;  3SCY A;  5TEF A;  1JOF A;  3NVX A;  1R5M A;  4PSW B;  3JB9 L;  5FKQ A;  4FWW A;  3BG0 A;  4XYI A;  3MKQ A;  2O9K A;  1GP2 B;  2I3S A;  4GQ1 A;  3EI3 B;  5GXI A;  3I7O A;  1S4U X;  3PVU B;  4JT6 C;  2P9S C;  3SXT D;  4QQE A;  2H68 A;  2H13 A;  3EI2 B;  2HXC A;  3KRW B;  3AFC A;  5I5I A;  1SHY B;  4E54 B;  1VYH C;  1XKS A;  2AH0 A;  2QXV A;  2PBI B;  4YVD A;  3SJL D;  1JMX B;  4K3J B;  2B5N A;  2YNN A;  4A0B A;  3JRO A;  5CXB A;  3VGZ A;  1B9X A;  2I0R A;  3L4O D;  4QL1 A;  5A2Q g;  4GQ2 P;  2OVP B;  5EAP A;  5AJA A;  4J86 A;  2CE8 A;  2W18 A;  4J77 A;  1QNI A;  2IUV A;  4L3G D;  5GSA A;  1PI6 A;  1GOT B;  4PNK B;  4CY1 A;  5THA A;  2B4E A;  3SN6 B;  4A0B B;  1SQJ A;  3V5W B;  5FLX g;  3F3F A;  2BBK H;  3F3P A;  3JZN A;  5CXC B;  4KFM B;  4NSX A;  4A0A B;  5H1M A;  2P9N C;  3C5M A;  5AFU 3;  4X3E A;  3ULE C;  2AGL A;  5EM2 A;  3C75 H;  4GM8 A;  3JPX A;  4CZY A;  4FAV D;  3CIK B;  2OK4 A;  4L1Q D;  5IT9 g;  2GNQ A;  5HYN B;  4JSN C;  4E54 A;  5EMJ B;  4A2M A;  4IA9 A;  3DM0 A;  3N0E A;  3EI2 A;  2OK6 A;  4J81 A;  1NEX B;  4UI9 R;  4CI2 A;  4N14 A;  3OKT A;  2I0T A;  4XYH A;  2XU7 A;  5AMS A;  2H6Q A;  3OKW A;  1MDA H;  3RN1 D;  5I5J A;  5HE0 B;  4OZU A;  3I89 A;  4MK0 B;  3UKU C;  4GQB B;  5CYK B;  4OWR A;  3MZK A;  3EI1 A;  4A11 B;  4CI8 A;  2H47 A;  2GC7 A;  3I8E A;  3KRX B;  4QRJ A;  3SFZ A;  2AGW A;  2H9L A;  1U4C A;  3C9C A;  3K26 A;  3RMZ D;  3EI4 B;  3I7L A;  3EU7 A;  3OL2 B;  5K1C C;  4R7A B;  3UKR C;  1B9Y A;  3PXS D;  3AL8 B;  4FA5 D;  5HE1 B;  2B5M A;  4ZOY A;  5I5M A;  3SMR A;  3IJC A;  3UVN A;  2H3X A;  3VH0 A;  3AL8 A;  4ES0 A;  3PSC B;  4GGA A;  3SBP A;  3ODT A;  1K32 A;  4X60 B;  3I7N A;  2PM9 A;  5FKS A;  4AEZ A;  2PM9 B;  4ESG A;  5JWZ A;  3AH8 B;  2YB8 B;  5TEE A;  1TYQ C;  4ERQ A;  4J82 A;  2Z2O A;  5IGO A;  3I7H A;  3MKS B;  4FB1 D;  5FA5 B;  4A7J A;  1ERJ A;  3EMH A;  1Q47 A;  1L0Q A;  2IAA A;  5IGQ A;  4AOW A;  4TZ4 A;  3U4Y A;  2IUQ A;  2YNO A;  4A09 A;  5HE3 B;  3OL2 A;  3I7P A;  4BH6 A;  2CN2 A;  2EBS A;  2YBA A;  3UVL A;  5H14 A;  4CY5 A;  3EI1 B;  5CYK A;  3I8C A;  4A08 A;  3UVK A;  4J78 A;  4QT8 A;  3J80 g;  1YFQ A;  3K27 A;  4ZOZ A;  5TF2 A;  3V7D B;  1OMW B;  2HES X;  4PC0 A;  4PSX B;  2G99 A;  4A11 A;  2H6N A;  2H9N A;  2PM6 B;  4FA1 D;  4O45 A;  4BL0 A;  5C9Z B;  2IWK A;  2AQ5 A;  4J87 A;  3I2N A;  4JT5 C;  4O3U B;  5FKT A;  2OIZ A;  4CY2 A;  3ZWL B;  4K3I D; 
#chains in the Genus database with same CATH topology
 5EM2 B;  3QI0 A;  4LGN A;  2HKR A;  5KDO B;  4GGD A;  4WJK A;  4O1Q D;  1XHM A;  2XL2 A;  4O02 A;  3PSL A;  1E8N A;  4A0A A;  3FRX A;  3JAM g;  1U8C A;  4E5Z B;  5FXY A;  3PVW B;  5HE2 B;  3BG1 A;  5IC7 A;  3RSE C;  2CE9 A;  3VA6 A;  2MTA H;  2HJB A;  1SQ9 A;  2YMU A;  4IMM A;  4J0W A;  5HQG A;  2P9U C;  2P9P C;  1RI6 A;  2AGX A;  3IIW A;  3MXX A;  1PGU A;  4BUJ C;  2OVQ B;  5IJ7 E;  4G1M A;  4X61 B;  4JHP C;  3OKY A;  2XDW A;  4JSX C;  4PBY A;  5E6S A;  5FKR A;  1MG2 A;  2XL3 A;  3CFS B;  4GZ8 A;  4ZOV A;  4CZV A;  5CXC A;  3RFH A;  3RRM C;  3VI3 A;  3OKY B;  1N6D A;  2XYI A;  3DXK C;  3IJ1 A;  3GFC A;  4CZX A;  5K19 A;  3EQ9 A;  2IUR A;  1FWX A;  3OTT A;  3RLM D;  2VZ1 A;  2H6K A;  4G56 B;  1GOG A;  4JXM A;  3CFV A;  3ZDZ A;  3ORV D;  3ZE0 A;  3RFG A;  5C86 A;  1JMZ B;  1XIP A;  3HFQ A;  4FA9 D;  3FCU A;  1JJU B;  1GXR A;  4FHL A;  4J8G A;  4E5Z A;  5H17 A;  1P22 A;  4Z7Q A;  3E0C A;  4H5J A;  3GRE A;  3I7K A;  4J0X A;  2OVR B;  5EMM B;  4ZOX A;  1U2V C;  4LG9 A;  5M5R A;  3V9F A;  1A0R B;  2P9I C;  4J73 A;  4WK4 A;  4UM8 A;  4AMZ A;  3GD1 I;  5CXB B;  3IJE A;  4Z8L A;  3DXM C;  2XE4 A;  3EI3 A;  4O3T B;  3SVW D;  4D6V A;  4DNW A;  3O4I A;  5SXM A;  4DNU A;  3PXW D;  1UOP A;  4O2W A;  3N0D A;  2H9M A;  2I0S A;  2VC2 A;  5GMK n;  4JD2 C;  4UM9 A;  2PM7 B;  3PE7 A;  3DSM A;  4BCB A;  4G1E A;  5IJ8 E;  4FA4 D;  5EAL A;  4U7A A;  2JKX A;  4I79 A;  1N6F A;  4MMZ A;  1VZ2 A;  3JZH A;  2OJY A;  3SWS D;  4NAA A;  2AH1 A;  4CY3 A;  4ZN4 A;  4ERY A;  4J79 A;  5M5U A;  2TRC B;  1TBG A;  5C2W B;  2P9K C;  3MZL A;  4A08 B;  3F3G A;  4ERZ A;  1K8K C;  2AGZ A;  3SBR A;  3OW8 A;  3IJ0 A;  4BP8 A;  3NVQ A;  4H5I A;  2VDM A;  4PXW A;  3B7F A;  5GXH A;  4O9D A;  2Q7Q A;  3T3M A;  2G9A A;  4J8B A;  1VZ3 A;  5B4W A;  4L1M A;  4L3H D;  3SBQ A;  3UVM A;  4CI1 A;  5FFO A;  1O6F A;  1JTD B;  2J56 H;  2QC5 A;  3AL9 A;  4QAM A;  4L9O A;  1NR0 A;  4J84 A;  4D0K A;  2YNP A;  1GG2 B;  2Z2N A;  4G55 A;  4CC9 A;  2VDQ A;  3JRP A;  2J55 H;  2J57 G;  5EAR A;  1VE7 A;  3FCS A;  4NC4 A;  2XZG A;  4A09 B;  2UZX B;  5C92 A;  2P9L C;  4JSP C;  4PBZ A;  4Y7R A;  4MMX A;  2BKL A;  3A0F A;  5FQD A;  2EID A;  1PBY B;  2HKM A;  1OLZ A;  2CNX A;  3J81 g;  4NEN A;  2AGY A;  1GOF A;  2WQ8 A;  4K3I D;  4Z7N A;  1PEV A;  3BWS A;  4EWR A;  4CI3 A;  2HJ4 A;  2IUP A;  3SLE D;  2I3T A;  5C2V B;  3JZG A;  2BCJ B;  3IKO A;  2VDO A;  2IWF A;  4GM3 A;  2GC4 A;  4Y5R D;  1BPO A;  5EMK B;  4U1E I;  3ZE2 A;  5HDB A;  4A2L A;  5EAM A;  3UR4 A;  1UOO A;  4FAN D;  3FM0 A;  4GM9 A;  3FGB A;  3W15 A;  4Z7O A;  3IUN A;  2CO0 A;  4GMB A;  4HDJ A;  4XEI C;  3EG6 A;  3NVN A;  3EI4 A;  3SHF A;  4JSV C;  4X63 B;  3MUN A;  2HYE A;  5TDH B;  2H9P A;  3IIY A;  4GGC A;  2QR5 A;  3ZDX A;  3UVO A;  3RN0 D;  2CN3 A;  2QZP A;  3L4M D;  2Z2P A;  3MMY A;  5EML B;  3C99 A;  2H14 A;  2CO0 C;  2B5L A;  3P4F A;  3PXT D;  3EWE A;  2UZY B;  3DWL C;  1N6E A;  4LG8 A;  1MG3 A;  3SCY A;  5TEF A;  1JOF A;  1UOQ A;  3NVX A;  1R5M A;  4PSW B;  3JB9 L;  5FKQ A;  4FWW A;  1UTC A;  3BG0 A;  4XYI A;  3MKQ A;  2O9K A;  1GP2 B;  2I3S A;  4GQ1 A;  3EI3 B;  2HU7 A;  1JV2 A;  1H2W A;  5GXI A;  3I7O A;  3K71 A;  1QFM A;  1S4U X;  4DNV A;  3PVU B;  4JT6 C;  2P9S C;  3SXT D;  3IUR A;  1K3I A;  4QQE A;  1H2X A;  2H68 A;  2H13 A;  3EI2 B;  2HXC A;  3EQ8 A;  3KRW B;  3AFC A;  5I5I A;  3T3P A;  3IUQ A;  1SHY B;  2HU5 A;  4E54 B;  1VYH C;  2VDN A;  1XKS A;  2AH0 A;  3EQ7 A;  2QXV A;  2PBI B;  4YVD A;  3K6S A;  3SJL D;  1JMX B;  4K3J B;  2B5N A;  2YNN A;  4A0B A;  3V4V A;  2VDP A;  3JRO A;  5CXB A;  3VGZ A;  1B9X A;  1C9L A;  2I0R A;  3IVM A;  3L4O D;  4QL1 A;  5A2Q g;  1H2Z A;  4GQ2 P;  2OVP B;  5EAP A;  1GOH A;  5AJA A;  2EIE A;  4J86 A;  2CE8 A;  2W18 A;  4J77 A;  1QNI A;  2IUV A;  4L3G D;  5GSA A;  1PI6 A;  3ZE1 A;  1GOT B;  4PNK B;  4AMY A;  4CY1 A;  5THA A;  2B4E A;  5E6R A;  3SN6 B;  4A0B B;  1SQJ A;  3V5W B;  5FLX g;  3F3F A;  2BBK H;  3F3P A;  3JZN A;  5CXC B;  5E6U A;  4KFM B;  1L5G A;  4NSX A;  4A0A B;  5H1M A;  2VDL A;  5M5V A;  2P9N C;  4BCC A;  3C5M A;  4WK2 A;  4AX4 A;  5AFU 3;  4X3E A;  3ULE C;  1TYE A;  4WK0 A;  2AGL A;  3MUO A;  5EM2 A;  3C75 H;  4GM8 A;  3JPX A;  1O6G A;  4CZY A;  4FAV D;  3CIK B;  2OK4 A;  4L1Q D;  5IT9 g;  2GNQ A;  5HYN B;  4JSN C;  4D9S A;  4E54 A;  5EMJ B;  5FFG A;  5M5S A;  2VZ3 A;  4IA9 A;  4A2M A;  3DM0 A;  3IUL A;  3N0E A;  3EI2 A;  2OK6 A;  4J81 A;  1NEX B;  4UI9 R;  4CI2 A;  4N14 A;  3OKT A;  2I0T A;  4XYH A;  3NID A;  2XU7 A;  5AMS A;  2H6Q A;  3OKW A;  1MDA H;  3RN1 D;  5I5J A;  5HE0 B;  4OZU A;  3I89 A;  4MMY A;  5M61 A;  2VDR A;  3MVD K;  4MK0 B;  1T2X A;  3UKU C;  4GQB B;  5CYK B;  4OWR A;  3MZK A;  1C9I A;  3EI1 A;  4RE6 A;  1A12 A;  4A11 B;  4CI8 A;  2H47 A;  2GC7 A;  3I8E A;  3IUJ A;  3KRX B;  1VE6 A;  4QRJ A;  4RE5 A;  4IRZ A;  3SFZ A;  2AGW A;  1H2Y A;  2H9L A;  3IUM A;  1U4C A;  3C9C A;  3K26 A;  3RMZ D;  3EI4 B;  4AN0 A;  3I7L A;  3OF7 A;  3EU7 A;  3OL2 B;  5K1C C;  3VI4 A;  4R7A B;  4BP9 A;  3UKR C;  2EIC A;  1B9Y A;  3GC3 B;  3PXS D;  3AL8 B;  3NIG A;  4FA5 D;  5HE1 B;  2B5M A;  1M1X A;  4ZOY A;  5I5M A;  3SMR A;  1I2M B;  3IJC A;  3UVN A;  2H3X A;  3VH0 A;  3AL8 A;  4ES0 A;  3PSC B;  4GGA A;  3SBP A;  3ZDY A;  3ODT A;  4BCD A;  1K32 A;  4X60 B;  3I7N A;  2PM9 A;  5FKS A;  4AEZ A;  2PM9 B;  4ESG A;  5JWZ A;  3KCI A;  3AH8 B;  2YB8 B;  5TEE A;  1TYQ C;  3DDU A;  4ERQ A;  1E8M A;  2Z2O A;  4J82 A;  5IGO A;  3I7H A;  4NBM A;  3MKS B;  4FB1 D;  5FA5 B;  4A7J A;  1ERJ A;  3EMH A;  1Q47 A;  1L0Q A;  2IAA A;  5IGQ A;  4AOW A;  4TZ4 A;  3U4Y A;  2IUQ A;  4AN1 A;  3V4P A;  3O4G A;  3QHY B;  2HU8 A;  2YNO A;  4A09 A;  5HE3 B;  3OL2 A;  3I7P A;  4BH6 A;  2CN2 A;  2EBS A;  2YBA A;  3UVL A;  5H14 A;  4CY5 A;  3EI1 B;  5CYK A;  3I8C A;  4A08 A;  3UVK A;  4J78 A;  1YR2 A;  4QT8 A;  1YFQ A;  3K27 A;  4ZOZ A;  5TF2 A;  3V7D B;  3J80 g;  1OMW B;  2HES X;  3O4H A;  4PC0 A;  4PSX B;  2G99 A;  4A11 A;  2H6N A;  2H9N A;  2PM6 B;  1E5T A;  4FA1 D;  4O45 A;  5M5T A;  4BL0 A;  5C9Z B;  2IWK A;  2AQ5 A;  3O4J A;  1QFS A;  3K72 A;  4J87 A;  3I2N A;  4JT5 C;  4O3U B;  5FKT A;  2VDK A;  3NIF A;  2OIZ A;  4CY2 A;  3ZWL B;  4JHN A;  2EIB A; 
#chains in the Genus database with same CATH homology
 5EM2 B;  4LGN A;  2HKR A;  5KDO B;  4GGD A;  4O1Q D;  1XHM A;  2XL2 A;  3PSL A;  4A0A A;  3FRX A;  3JAM g;  4E5Z B;  5FXY A;  3PVW B;  5HE2 B;  3BG1 A;  5IC7 A;  3RSE C;  2CE9 A;  3VA6 A;  2MTA H;  2HJB A;  1SQ9 A;  2YMU A;  4IMM A;  4J0W A;  5HQG A;  2P9U C;  2P9P C;  1RI6 A;  2AGX A;  3IIW A;  3MXX A;  1PGU A;  4BUJ C;  2OVQ B;  5IJ7 E;  4X61 B;  3OKY A;  4JSX C;  4PBY A;  5FKR A;  1MG2 A;  2XL3 A;  3CFS B;  4GZ8 A;  4ZOV A;  4CZV A;  5CXC A;  3RFH A;  3RRM C;  1N6D A;  2XYI A;  3DXK C;  3IJ1 A;  3OKY B;  3GFC A;  4CZX A;  5K19 A;  2IUR A;  1FWX A;  3OTT A;  3RLM D;  2H6K A;  4G56 B;  4JXM A;  3CFV A;  3ORV D;  3RFG A;  1JMZ B;  1XIP A;  3HFQ A;  4FA9 D;  1JJU B;  1GXR A;  4FHL A;  4J8G A;  4E5Z A;  5H17 A;  1P22 A;  3E0C A;  4H5J A;  3GRE A;  3I7K A;  4J0X A;  2OVR B;  5EMM B;  4ZOX A;  1U2V C;  4LG9 A;  3V9F A;  1A0R B;  2P9I C;  4J73 A;  5CXB B;  4Z8L A;  3DXM C;  3EI3 A;  4O3T B;  3SVW D;  4D6V A;  5SXM A;  3PXW D;  3N0D A;  2H9M A;  2I0S A;  5GMK n;  4JD2 C;  2PM7 B;  3PE7 A;  3DSM A;  5IJ8 E;  4FA4 D;  5EAL A;  4U7A A;  4I79 A;  1N6F A;  3JZH A;  2OJY A;  3SWS D;  2AH1 A;  4CY3 A;  4ZN4 A;  4ERY A;  4J79 A;  2TRC B;  1TBG A;  5C2W B;  2P9K C;  3MZL A;  4A08 B;  3F3G A;  4ERZ A;  1K8K C;  2AGZ A;  3SBR A;  3OW8 A;  3IJ0 A;  3NVQ A;  4H5I A;  4PXW A;  3B7F A;  5GXH A;  4O9D A;  2Q7Q A;  2G9A A;  4J8B A;  5B4W A;  3SBQ A;  4L3H D;  3UVM A;  4CI1 A;  3AL9 A;  2J56 H;  2QC5 A;  4L9O A;  1NR0 A;  4J84 A;  4D0K A;  2YNP A;  1GG2 B;  2Z2N A;  4CC9 A;  3JRP A;  2J55 H;  2J57 G;  5EAR A;  4A09 B;  2UZX B;  2P9L C;  4JSP C;  4PBZ A;  4Y7R A;  3A0F A;  5FQD A;  1PBY B;  2HKM A;  1OLZ A;  2CNX A;  3J81 g;  2AGY A;  1PEV A;  3BWS A;  4EWR A;  4CI3 A;  2HJ4 A;  2IUP A;  3SLE D;  2I3T A;  5C2V B;  2BCJ B;  3JZG A;  3IKO A;  2IWF A;  4GM3 A;  2GC4 A;  4Y5R D;  5EMK B;  4U1E I;  4A2L A;  5EAM A;  3UR4 A;  4FAN D;  3FM0 A;  4GM9 A;  3FGB A;  3W15 A;  2CO0 A;  4GMB A;  4HDJ A;  4XEI C;  3EG6 A;  3NVN A;  3EI4 A;  3SHF A;  4JSV C;  4X63 B;  2HYE A;  5TDH B;  2H9P A;  3IIY A;  4GGC A;  3UVO A;  3RN0 D;  2CN3 A;  3L4M D;  3MMY A;  2Z2P A;  5EML B;  3C99 A;  2H14 A;  2CO0 C;  2B5L A;  3P4F A;  3PXT D;  3EWE A;  2UZY B;  3DWL C;  1N6E A;  4LG8 A;  1MG3 A;  3SCY A;  5TEF A;  1JOF A;  3NVX A;  1R5M A;  4PSW B;  3JB9 L;  5FKQ A;  4FWW A;  3BG0 A;  4XYI A;  3MKQ A;  2O9K A;  1GP2 B;  2I3S A;  4GQ1 A;  3EI3 B;  5GXI A;  3I7O A;  1S4U X;  3PVU B;  4JT6 C;  2P9S C;  3SXT D;  4QQE A;  2H68 A;  2H13 A;  3EI2 B;  2HXC A;  3KRW B;  3AFC A;  5I5I A;  1SHY B;  4E54 B;  1VYH C;  1XKS A;  2AH0 A;  2QXV A;  2PBI B;  4YVD A;  3SJL D;  1JMX B;  4K3J B;  2B5N A;  2YNN A;  4A0B A;  3JRO A;  5CXB A;  3VGZ A;  1B9X A;  2I0R A;  3L4O D;  4QL1 A;  5A2Q g;  4GQ2 P;  2OVP B;  5EAP A;  5AJA A;  4J86 A;  2CE8 A;  2W18 A;  4J77 A;  1QNI A;  2IUV A;  4L3G D;  5GSA A;  1PI6 A;  1GOT B;  4PNK B;  4CY1 A;  5THA A;  2B4E A;  3SN6 B;  4A0B B;  1SQJ A;  3V5W B;  5FLX g;  3F3F A;  2BBK H;  3F3P A;  3JZN A;  5CXC B;  4KFM B;  4NSX A;  4A0A B;  5H1M A;  2P9N C;  3C5M A;  5AFU 3;  4X3E A;  3ULE C;  2AGL A;  5EM2 A;  3C75 H;  4GM8 A;  3JPX A;  4CZY A;  4FAV D;  3CIK B;  2OK4 A;  4L1Q D;  5IT9 g;  2GNQ A;  5HYN B;  4JSN C;  4E54 A;  5EMJ B;  4A2M A;  4IA9 A;  3DM0 A;  3N0E A;  3EI2 A;  2OK6 A;  4J81 A;  1NEX B;  4UI9 R;  4CI2 A;  4N14 A;  3OKT A;  2I0T A;  4XYH A;  2XU7 A;  5AMS A;  2H6Q A;  3OKW A;  1MDA H;  3RN1 D;  5I5J A;  5HE0 B;  4OZU A;  3I89 A;  4MK0 B;  3UKU C;  4GQB B;  5CYK B;  4OWR A;  3MZK A;  3EI1 A;  4A11 B;  4CI8 A;  2H47 A;  2GC7 A;  3I8E A;  3KRX B;  4QRJ A;  3SFZ A;  2AGW A;  2H9L A;  1U4C A;  3C9C A;  3K26 A;  3RMZ D;  3EI4 B;  3I7L A;  3EU7 A;  3OL2 B;  5K1C C;  4R7A B;  3UKR C;  1B9Y A;  3PXS D;  3AL8 B;  4FA5 D;  5HE1 B;  2B5M A;  4ZOY A;  5I5M A;  3SMR A;  3IJC A;  3UVN A;  2H3X A;  3VH0 A;  3AL8 A;  4ES0 A;  3PSC B;  4GGA A;  3SBP A;  3ODT A;  1K32 A;  4X60 B;  3I7N A;  2PM9 A;  5FKS A;  4AEZ A;  2PM9 B;  4ESG A;  5JWZ A;  3AH8 B;  2YB8 B;  5TEE A;  1TYQ C;  4ERQ A;  4J82 A;  2Z2O A;  5IGO A;  3I7H A;  3MKS B;  4FB1 D;  5FA5 B;  4A7J A;  1ERJ A;  3EMH A;  1Q47 A;  1L0Q A;  2IAA A;  5IGQ A;  4AOW A;  4TZ4 A;  3U4Y A;  2IUQ A;  2YNO A;  4A09 A;  5HE3 B;  3OL2 A;  3I7P A;  4BH6 A;  2CN2 A;  2EBS A;  2YBA A;  3UVL A;  5H14 A;  4CY5 A;  3EI1 B;  5CYK A;  3I8C A;  4A08 A;  3UVK A;  4J78 A;  4QT8 A;  3J80 g;  1YFQ A;  3K27 A;  4ZOZ A;  5TF2 A;  3V7D B;  1OMW B;  2HES X;  4PC0 A;  4PSX B;  2G99 A;  4A11 A;  2H6N A;  2H9N A;  2PM6 B;  4FA1 D;  4O45 A;  4BL0 A;  5C9Z B;  2IWK A;  2AQ5 A;  4J87 A;  3I2N A;  4JT5 C;  4O3U B;  5FKT A;  2OIZ A;  4CY2 A;  3ZWL B;  4K3I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...