3JAMg

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 53
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3jamg01
4ZOXA 4X3EA 1XIPA 4CI1A 2YNOA 2H6QA 1MG2A 3PXWD 2H9LA 4TZ4A 3RRMC 3VA6A 3N0EA 4GMBA 5CXBA 3EI4B 3EI3B 4A09B 3DXMC 3OKTA 1K8KC 1XKSA 1N6EA 5AMSA 3W15A 4J78A 1GP2B 2P9UC 2J55H 2BBKH 5C2WB 2IWFA 1B9YA 2H3XA 4L3GD 5H1MA 1GG2B 3JZHA 3I7OA 4HDJA 4KFMB 2P9IC 5FA5B 3C9CA 5FKTA 5FLXg 3V9FA 4A11A 1OMWB 4AEZA 3SN6B 5B4WA 4A0BB 1MG3A 5I5IA 4D6VA 5HE2B 2CE8A 3V5WB 2CO0A 2IUPA 1YFQA 4J77A 2PM7B 4I79A 4U7AA 4Y7RA 4X63B 3DXKC 3IIYA 4ERYA 5EALA 1SQ9A 5IJ8E 3SXTD 5K19A 3AL8A 3PVUB 4ES0A 2HJBA 1VYHC 4CI8A 4CZVA 4FA9D 1PGUA 3KRXB 2HJ4A 2UZXB 1MDAH 3MZKA 3A0FA 4GM8A 4XYIA 3AH8B 2YNPA 3MZLA 3DSMA 4UI9R 5H17A 3NVQA 5HE1B 5HQGA 1RI6A 3UVMA 3JAMg 4YVDA 2OIZA 3DWLC 2QXVA 4J84A 3UKUC 3C75H 3RLMD 5EMLB 4J81A 3SCYA 4FA4D 2YNNA 4A08B 2I3TA 4ZN4A 2CN2A 1OLZA 2H9MA 3VGZA 3FRXA 4J73A 3MKQA 4BUJC 5TEFA 3I7LA 4GM9A 5IGOA 4E54B 1PI6A 5KDOB 5TDHB 3JZNA 3CFVA 3RSEC 2H6KA 3MMYA 2XU7A 3RN1D 4JSXC 2OVPB 3BG1A 4L1QD 5FKRA 2HKMA 1U2VC 2P9LC 3KRWB 4O45A 4FA1D 5IGQA 3MXXA 3SBPA 2HKRA 5JWZA 4X60B 4LG8A 4A2MA 4ZOZA 4GQBB 4EWRA 2XYIA 4PSWB 4IA9A 5CYKB 2AGXA 3K26A 3ULEC 2GC7A 1A0RB 2I3SA 3RN0D 3SJLD 2IWKA 4J79A 4J87A 3E0CA 3SVWD 3B7FA 1JOFA 5AFU3 5EM2A 4CY3A 1XHMA 3I7HA 2AH0A 4CZXA 3L4MD 4BH6A 4J8GA 2XL3A 5EAMA 4QT8A 3PSLA 1GXRA 4U1EI 4O3UB 3I7PA 3I8EA 3EI2B 3UKRC 2CE9A 1FWXA 3OW8A 3JROA 3PVWB 4OZUA 3I7KA 3PE7A 3FGBA 4XYHA 3I8CA 3UR4A 1N6FA 3UVOA 1U4CA 4O1QD 1P22A 2IAAA 5TF2A 3EI1B 5GXHA 3U4YA 3OKWA 2YMUA 2J56H 4H5IA 2H9NA 4FHLA 5FQDA 3F3PA 4N14A 4Z8LA 4GGCA 5AJAA 4JXMA 4E5ZB 4PC0A 5CXCB 3VH0A 4ESGA 1TBGA 3BG0A 3OTTA 3EI4A 3EI3A 4QQEA 4A09A 4GQ1A 4AOWA 5CXBB 5IT9g 3K27A 4G56B 4L9OA 4A0AB 2H68A 4PSXB 4J0XA 2B4EA 2OVRB 3SLED 5FKQA 1L0QA 1B9XA 4O3TB 3ZWLB 4CI3A 4J86A 3OKYB 2XL2A 2PM9B 5C2VB 3EWEA 2OK6A 2J57G 4A0BA 4X61B 4H5JA 2Z2OA 4GGAA 3OL2B 4A11B 4A7JA 2Z2PA 4JT5C 5HYNB 3GREA 2AGYA 2B5NA 5H14A 4J82A 2UZYB 4LG9A 2AH1A 3EU7A 2P9PC 5HE3B 4PBYA 2CN3A 5FKSA 2P9SC 3IJ0A 3IIWA 4GGDA 1ERJA 3EI1A 1SHYB 2H9PA 4JD2C 3IKOA 5TEEA 2P9KC 5GXIA 4GQ2P 3ODTA 3EG6A 1GOTB 1PEVA 3JZGA 4ERZA 2AGLA 5EAPA 4OWRA 4K3ID 4E5ZA 4R7AB 5GMKn 5CXCA 2W18A 2OK4A 3GFCA 4Y5RD 4FB1D 2AGWA 4QRJA 3SWSD 5I5MA 1QNIA 2O9KA 3JPXA 5EARA 3PXTD 4O9DA 4J0WA 1SQJA 4A08A 3AL9A 2BCJB 2YB8B 4A0AA 2B5MA 4IMMA 2YBAA 1R5MA 4JSNC 3C99A 1JMZB 3OKYA 4NSXA 2Q7QA 3UVKA 2PM9A 4E54A 5GSAA 4ZOYA 3P4FA 4A2LA 3IJCA 5SXMA 3SHFA 4CY2A 4FAVD 3OL2A 1S4UX 1N6DA 5IJ7E 4K3JB 4GM3A 2Z2NA 2PM6B 3J81g 4GZ8A 4BL0A 5I5JA 3AFCA 2HESX 3SBQA 4ZOVA 3NVXA 3V7DB 3ORVD 3I89A 4LGNA 4D0KA 2PBIB 2H47A 3NVNA 1NR0A 2I0SA 3JB9L 5K1CC 2IURA 4QL1A 3SFZA 2I0RA 3JRPA 5CYKA 1JJUB 3N0DA 3SMRA 3PSCB 2B5LA 4CY5A 3RMZD 2P9NC 2OVQB 3I7NA 4FAND 4CZYA 2IUVA 5C9ZB 3IJ1A 5EMKB 3DM0A 1JMXB 3UVLA 5THAA 3RFGA 1PBYB 4PNKB 4FWWA 5HE0B 5A2Qg 2HYEA 3L4OD 3PXSD 5EM2B 4XEIC 2QC5A 2G9AA 1NEXB 3I2NA 3EI2A 4MK0B 4FA5D 1TYQC 2CO0C 3FM0A 4CY1A 5EMMB 2I0TA 4L3HD 5EMJB 3EMHA 2HXCA 3RFHA 2EBSA 3CIKB 5FXYA 4CC9A 1K32A 2AGZA 3SBRA 2GNQA 2TRCB 3C5MA 3CFSB 2CNXA 2H13A 4PBZA 2MTAH 5IC7A 2IUQA 3AL8B 2OJYA 3F3GA 4JSPC 4J8BA 2AQ5A 4CI2A 3J80g 4JSVC 4PXWA 2H14A 3F3FA 3UVNA 3BWSA 2G99A 3MKSB 4ERQA 2H6NA 4JT6C 2GC4A 1Q47A 3HFQA
chains in the Genus database with same CATH superfamily
4ZOXA 4X3EA 1XIPA 4CI1A 2VDLA 2YNOA 2H6QA 1MG2A 3PXWD 2H9LA 4TZ4A 3RRMC 3VA6A 3N0EA 4GMBA 4DNUA 5CXBA 1A12A 3EI4B 3EI3B 4A09B 3DXMC 3OKTA 1K8KC 1C9LA 1UOQA 1XKSA 1N6EA 5AMSA 3W15A 4J78A 1GP2B 2P9UC 2J55H 4Z7OA 2BBKH 5C2WB 3K72A 2IWFA 5M61A 1B9YA 2H3XA 3ZE1A 3NIFA 4L3GD 5H1MA 1GG2B 3JZHA 3I7OA 4HDJA 4KFMB 2P9IC 5FA5B 3C9CA 5FKTA 5FLXg 3V9FA 4A11A 1OMWB 4AEZA 3SN6B 5B4WA 4A0BB 1MG3A 1GOFA 5I5IA 4AMYA 4D6VA 5HE2B 2CE8A 3V5WB 2CO0A 3ZE2A 2IUPA 5FFOA 1YFQA 4J77A 2PM7B 3ZE0A 4I79A 4U7AA 4Y7RA 1GOHA 4X63B 3DXKC 5C86A 3IIYA 4ERYA 5EALA 2JKXA 1SQ9A 1H2ZA 4AN1A 5IJ8E 3V4VA 4UM9A 4AMZA 3K6SA 3SXTD 1U8CA 5K19A 3AL8A 3PVUB 4ES0A 2HU8A 5M5SA 4AN0A 2HJBA 3K71A 1VYHC 4CI8A 4CZVA 4FA9D 1PGUA 3KRXB 2HJ4A 2UZXB 1MDAH 1E8MA 3A0FA 3MZKA 4BCDA 4GM8A 4XYIA 3AH8B 1YR2A 2YNPA 3MZLA 4D9SA 3DSMA 4UI9R 5H17A 3NVQA 5HE1B 5HQGA 1RI6A 3UVMA 3JAMg 4YVDA 3VI4A 2OIZA 3DWLC 3IUQA 2QXVA 3EQ7A 4J84A 3UKUC 3C75H 3RLMD 5EMLB 4J81A 3SCYA 4FA4D 2YNNA 3IJEA 4A08B 2I3TA 2VDNA 4MMZA 4ZN4A 2CN2A 1OLZA 2H9MA 3VGZA 3FRXA 4G55A 4J73A 3ZDZA 3MKQA 4BUJC 5TEFA 3O4IA 3I7LA 3VI3A 4QAMA 4GM9A 2HU5A 5IGOA 4E54B 1PI6A 5KDOB 5TDHB 3JZNA 3MVDK 3CFVA 3RSEC 2H6KA 3MMYA 2XU7A 3RN1D 4JSXC 2OVPB 4NAAA 3BG1A 4L1QD 5FKRA 3IUJA 2HKMA 1U2VC 2P9LC 4MMYA 3KRWB 4O45A 4FA1D 5IGQA 3MXXA 3SBPA 2HKRA 5JWZA 4X60B 4LG8A 4A2MA 4ZOZA 4GQBB 4EWRA 2XYIA 4PSWB 5E6RA 3EQ9A 4IA9A 5CYKB 2HU7A 2AGXA 3K26A 3ULEC 2GC7A 1A0RB 2I3SA 3RN0D 3SJLD 2IWKA 4J79A 2VDOA 4J87A 3MUOA 3E0CA 3SVWD 3B7FA 1BPOA 1JOFA 5AFU3 3EQ8A 1VE7A 5EM2A 4CY3A 3V4PA 1XHMA 3I7HA 2AH0A 4CZXA 3L4MD 4BH6A 4J8GA 5E6UA 4MMXA 2VDQA 2XL3A 3MUNA 5EAMA 4O02A 4QT8A 3PSLA 1GXRA 4U1EI 4O3UB 3I7PA 3I8EA 3EI2B 2XE4A 3UKRC 2CE9A 1FWXA 1I2MB 3OW8A 3JROA 3PVWB 4OZUA 3I7KA 3PE7A 3FGBA 3T3MA 4XYHA 3I8CA 3UR4A 1N6FA 3UVOA 1M1XA 1U4CA 4O1QD 1P22A 2IAAA 5TF2A 1JTDB 2VZ3A 2VDMA 3EI1B 5GXHA 2XDWA 3U4YA 3OKWA 2YMUA 2J56H 4H5IA 2EICA 2H9NA 4FHLA 3IULA 4JHNA 5FQDA 3F3PA 4N14A 4Z8LA 4GGCA 2VDPA 2QZPA 5AJAA 4JXMA 4E5ZB 4PC0A 3OF7A 5CXCB 1E8NA 3VH0A 4ESGA 4JHPC 1TBGA 5M5UA 3ZDYA 3BG0A 4AX4A 2VDRA 3OTTA 5M5TA 4L1MA 3FCSA 3EI4A 3EI3A 4QQEA 4A09A 4GQ1A 4AOWA 4O2WA 5CXBB 5IT9g 3K27A 4G56B 4L9OA 4A0AB 2H68A 1VZ3A 4PSXB 4J0XA 2B4EA 1VE6A 2OVRB 3SLED 5FKQA 1L0QA 1B9XA 4O3TB 3ZWLB 4CI3A 4J86A 1UOPA 3OKYB 2XL2A 2PM9B 5C2VB 3EWEA 3T3PA 4DNWA 2OK6A 2J57G 4A0BA 4X61B 4H5JA 2Z2OA 4GGAA 3OL2B 2XZGA 4A11B 4NC4A 1JV2A 4A7JA 2Z2PA 4G1EA 4JT5C 5HYNB 3GREA 2AGYA 2B5NA 5H14A 4J82A 2UZYB 4LG9A 2AH1A 3EU7A 2P9PC 5HE3B 3GC3B 4PBYA 2CN3A 5FKSA 2P9SC 5M5VA 3IJ0A 3IIWA 4GGDA 1ERJA 3EI1A 1SHYB 2H9PA 4JD2C 3IKOA 5TEEA 5C92A 2P9KC 5GXIA 2VZ1A 4GQ2P 3ODTA 3NIGA 1TYEA 3EG6A 1GOTB 1O6GA 5HDBA 1PEVA 3JZGA 4ERZA 2AGLA 5EAPA 4OWRA 4K3ID 1T2XA 4BCCA 4E5ZA 4R7AB 5GMKn 1O6FA 5CXCA 2W18A 2OK4A 3GFCA 4Y5RD 1H2YA 5FFGA 4FB1D 1GOGA 1E5TA 2AGWA 4QRJA 3ZDXA 3SWSD 5I5MA 1QNIA 3O4HA 2O9KA 3JPXA 5EARA 3PXTD 4O9DA 2EIBA 4J0WA 1SQJA 4BP8A 4Z7QA 4A08A 3AL9A 1QFMA 2BCJB 2YB8B 4A0AA 3QHYB 1H2XA 2B5MA 2EIEA 4IMMA 2YBAA 1R5MA 1QFSA 4JSNC 3NIDA 4Z7NA 1UOOA 3GD1I 3C99A 4G1MA 1JMZB 3OKYA 4NSXA 2Q7QA 3UVKA 2PM9A 4E54A 5GSAA 4ZOYA 3P4FA 4A2LA 3IJCA 5SXMA 3SHFA 4CY2A 4FAVD 3OL2A 1S4UX 1N6DA 5IJ7E 4K3JB 4GM3A 2Z2NA 2PM6B 3J81g 3O4JA 4GZ8A 4BL0A 4WK4A 2QR5A 5I5JA 2WQ8A 3AFCA 2HESX 3SBQA 2VDKA 3IUMA 4ZOVA 3NVXA 3FCUA 3V7DB 3DDUA 3ORVD 3I89A 4WJKA 4LGNA 4D0KA 2VC2A 2PBIB 1L5GA 2H47A 4IRZA 3NVNA 1NR0A 2I0SA 3JB9L 5K1CC 5E6SA 2IURA 4QL1A 3SFZA 2I0RA 3JRPA 5CYKA 1JJUB 3N0DA 3SMRA 3PSCB 2B5LA 4CY5A 3RMZD 2P9NC 2OVQB 1C9IA 3I7NA 4FAND 4CZYA 2IUVA 3IURA 5C9ZB 3IJ1A 5EMKB 4BP9A 3DM0A 1JMXB 3UVLA 5THAA 3RFGA 3IUNA 1PBYB 4PNKB 4FWWA 4RE5A 5HE0B 5A2Qg 2HYEA 3L4OD 4NENA 2EIDA 3PXSD 5EM2B 4XEIC 2QC5A 2G9AA 1NEXB 2BKLA 3I2NA 4BCBA 1H2WA 4DNVA 3EI2A 4MK0B 4FA5D 3IVMA 1TYQC 2CO0C 3FM0A 4CY1A 5EMMB 2I0TA 4L3HD 4WK2A 5EMJB 3EMHA 2HXCA 1K3IA 3RFHA 2EBSA 4WK0A 4NBMA 1VZ2A 3CIKB 4RE6A 5FXYA 4CC9A 1K32A 2AGZA 3SBRA 2GNQA 2TRCB 3C5MA 3CFSB 2CNXA 2H13A 4PBZA 2MTAH 5IC7A 3QI0A 2IUQA 3AL8B 4UM8A 3KCIA 2OJYA 3F3GA 4JSPC 4J8BA 2AQ5A 4CI2A 3J80g 4JSVC 4PXWA 2H14A 3F3FA 3UVNA 3BWSA 2G99A 3MKSB 3O4GA 2H6NA 4ERQA 5M5RA 4JT6C 1UTCA 2GC4A 1Q47A 3HFQA
chains in the Genus database with same CATH topology
4ZOXA 4X3EA 1XIPA 4CI1A 2YNOA 2H6QA 1MG2A 3PXWD 2H9LA 4TZ4A 3RRMC 3VA6A 3N0EA 4GMBA 5CXBA 3EI4B 3EI3B 4A09B 3DXMC 3OKTA 1K8KC 1XKSA 1N6EA 5AMSA 3W15A 4J78A 1GP2B 2P9UC 2J55H 2BBKH 5C2WB 2IWFA 1B9YA 2H3XA 4L3GD 5H1MA 1GG2B 3JZHA 3I7OA 4HDJA 4KFMB 2P9IC 5FA5B 3C9CA 5FKTA 5FLXg 3V9FA 4A11A 1OMWB 4AEZA 3SN6B 5B4WA 4A0BB 1MG3A 5I5IA 4D6VA 5HE2B 2CE8A 3V5WB 2CO0A 2IUPA 1YFQA 4J77A 2PM7B 4I79A 4U7AA 4Y7RA 4X63B 3DXKC 3IIYA 4ERYA 5EALA 1SQ9A 5IJ8E 3SXTD 5K19A 3AL8A 3PVUB 4ES0A 2HJBA 1VYHC 4CI8A 4CZVA 4FA9D 1PGUA 3KRXB 2HJ4A 2UZXB 1MDAH 3MZKA 3A0FA 4GM8A 4XYIA 3AH8B 2YNPA 3MZLA 3DSMA 4UI9R 5H17A 3NVQA 5HE1B 5HQGA 1RI6A 3UVMA 3JAMg 4YVDA 2OIZA 3DWLC 2QXVA 4J84A 3UKUC 3C75H 3RLMD 5EMLB 4J81A 3SCYA 4FA4D 2YNNA 4A08B 2I3TA 4ZN4A 2CN2A 1OLZA 2H9MA 3VGZA 3FRXA 4J73A 3MKQA 4BUJC 5TEFA 3I7LA 4GM9A 5IGOA 4E54B 1PI6A 5KDOB 5TDHB 3JZNA 3CFVA 3RSEC 2H6KA 3MMYA 2XU7A 3RN1D 4JSXC 2OVPB 3BG1A 4L1QD 5FKRA 2HKMA 1U2VC 2P9LC 3KRWB 4O45A 4FA1D 5IGQA 3MXXA 3SBPA 2HKRA 5JWZA 4X60B 4LG8A 4A2MA 4ZOZA 4GQBB 4EWRA 2XYIA 4PSWB 4IA9A 5CYKB 2AGXA 3K26A 3ULEC 2GC7A 1A0RB 2I3SA 3RN0D 3SJLD 2IWKA 4J79A 4J87A 3E0CA 3SVWD 3B7FA 1JOFA 5AFU3 5EM2A 4CY3A 1XHMA 3I7HA 2AH0A 4CZXA 3L4MD 4BH6A 4J8GA 2XL3A 5EAMA 4QT8A 3PSLA 1GXRA 4U1EI 4O3UB 3I7PA 3I8EA 3EI2B 3UKRC 2CE9A 1FWXA 3OW8A 3JROA 3PVWB 4OZUA 3I7KA 3PE7A 3FGBA 4XYHA 3I8CA 3UR4A 1N6FA 3UVOA 1U4CA 4O1QD 1P22A 2IAAA 5TF2A 3EI1B 5GXHA 3U4YA 3OKWA 2YMUA 2J56H 4H5IA 2H9NA 4FHLA 5FQDA 3F3PA 4N14A 4Z8LA 4GGCA 5AJAA 4JXMA 4E5ZB 4PC0A 5CXCB 3VH0A 4ESGA 1TBGA 3BG0A 3OTTA 3EI4A 3EI3A 4QQEA 4A09A 4GQ1A 4AOWA 5CXBB 5IT9g 3K27A 4G56B 4L9OA 4A0AB 2H68A 4PSXB 4J0XA 2B4EA 2OVRB 3SLED 5FKQA 1L0QA 1B9XA 4O3TB 3ZWLB 4CI3A 4J86A 3OKYB 2XL2A 2PM9B 5C2VB 3EWEA 2OK6A 2J57G 4A0BA 4X61B 4H5JA 2Z2OA 4GGAA 3OL2B 4A11B 4A7JA 2Z2PA 4JT5C 5HYNB 3GREA 2AGYA 2B5NA 5H14A 4J82A 2UZYB 4LG9A 2AH1A 3EU7A 2P9PC 5HE3B 4PBYA 2CN3A 5FKSA 2P9SC 3IJ0A 3IIWA 4GGDA 1ERJA 3EI1A 1SHYB 2H9PA 4JD2C 3IKOA 5TEEA 2P9KC 5GXIA 4GQ2P 3ODTA 3EG6A 1GOTB 1PEVA 3JZGA 4ERZA 2AGLA 5EAPA 4OWRA 4K3ID 4E5ZA 4R7AB 5GMKn 5CXCA 2W18A 2OK4A 3GFCA 4Y5RD 4FB1D 2AGWA 4QRJA 3SWSD 5I5MA 1QNIA 2O9KA 3JPXA 5EARA 3PXTD 4O9DA 4J0WA 1SQJA 4A08A 3AL9A 2BCJB 2YB8B 4A0AA 2B5MA 4IMMA 2YBAA 1R5MA 4JSNC 3C99A 1JMZB 3OKYA 4NSXA 2Q7QA 3UVKA 2PM9A 4E54A 5GSAA 4ZOYA 3P4FA 4A2LA 3IJCA 5SXMA 3SHFA 4CY2A 4FAVD 3OL2A 1S4UX 1N6DA 5IJ7E 4K3JB 4GM3A 2Z2NA 2PM6B 3J81g 4GZ8A 4BL0A 5I5JA 3AFCA 2HESX 3SBQA 4ZOVA 3NVXA 3V7DB 3ORVD 3I89A 4LGNA 4D0KA 2PBIB 2H47A 3NVNA 1NR0A 2I0SA 3JB9L 5K1CC 2IURA 4QL1A 3SFZA 2I0RA 3JRPA 5CYKA 1JJUB 3N0DA 3SMRA 3PSCB 2B5LA 4CY5A 3RMZD 2P9NC 2OVQB 3I7NA 4FAND 4CZYA 2IUVA 5C9ZB 3IJ1A 5EMKB 3DM0A 1JMXB 3UVLA 5THAA 3RFGA 1PBYB 4PNKB 4FWWA 5HE0B 5A2Qg 2HYEA 3L4OD 3PXSD 5EM2B 4XEIC 2QC5A 2G9AA 1NEXB 3I2NA 3EI2A 4MK0B 4FA5D 1TYQC 2CO0C 3FM0A 4CY1A 5EMMB 2I0TA 4L3HD 5EMJB 3EMHA 2HXCA 3RFHA 2EBSA 3CIKB 5FXYA 4CC9A 1K32A 2AGZA 3SBRA 2GNQA 2TRCB 3C5MA 3CFSB 2CNXA 2H13A 4PBZA 2MTAH 5IC7A 2IUQA 3AL8B 2OJYA 3F3GA 4JSPC 4J8BA 2AQ5A 4CI2A 3J80g 4JSVC 4PXWA 2H14A 3F3FA 3UVNA 3BWSA 2G99A 3MKSB 4ERQA 2H6NA 4JT6C 2GC4A 1Q47A 3HFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZOX A;  4X3E A;  1XIP A;  4CI1 A;  2YNO A;  2H6Q A;  1MG2 A;  3PXW D;  2H9L A;  4TZ4 A;  3RRM C;  3VA6 A;  3N0E A;  4GMB A;  5CXB A;  3EI4 B;  3EI3 B;  4A09 B;  3DXM C;  3OKT A;  1K8K C;  1XKS A;  1N6E A;  5AMS A;  3W15 A;  4J78 A;  1GP2 B;  2P9U C;  2J55 H;  2BBK H;  5C2W B;  2IWF A;  1B9Y A;  2H3X A;  4L3G D;  5H1M A;  1GG2 B;  3JZH A;  3I7O A;  4HDJ A;  4KFM B;  2P9I C;  5FA5 B;  3C9C A;  5FKT A;  5FLX g;  3V9F A;  4A11 A;  1OMW B;  4AEZ A;  3SN6 B;  5B4W A;  4A0B B;  1MG3 A;  5I5I A;  4D6V A;  5HE2 B;  2CE8 A;  3V5W B;  2CO0 A;  2IUP A;  1YFQ A;  4J77 A;  2PM7 B;  4I79 A;  4U7A A;  4Y7R A;  4X63 B;  3DXK C;  3IIY A;  4ERY A;  5EAL A;  1SQ9 A;  5IJ8 E;  3SXT D;  5K19 A;  3AL8 A;  3PVU B;  4ES0 A;  2HJB A;  1VYH C;  4CI8 A;  4CZV A;  4FA9 D;  1PGU A;  3KRX B;  2HJ4 A;  2UZX B;  1MDA H;  3MZK A;  3A0F A;  4GM8 A;  4XYI A;  3AH8 B;  2YNP A;  3MZL A;  3DSM A;  4UI9 R;  5H17 A;  3NVQ A;  5HE1 B;  5HQG A;  1RI6 A;  3UVM A;  3JAM g;  4YVD A;  2OIZ A;  3DWL C;  2QXV A;  4J84 A;  3UKU C;  3C75 H;  3RLM D;  5EML B;  4J81 A;  3SCY A;  4FA4 D;  2YNN A;  4A08 B;  2I3T A;  4ZN4 A;  2CN2 A;  1OLZ A;  2H9M A;  3VGZ A;  3FRX A;  4J73 A;  3MKQ A;  4BUJ C;  5TEF A;  3I7L A;  4GM9 A;  5IGO A;  4E54 B;  1PI6 A;  5KDO B;  5TDH B;  3JZN A;  3CFV A;  3RSE C;  2H6K A;  3MMY A;  2XU7 A;  3RN1 D;  4JSX C;  2OVP B;  3BG1 A;  4L1Q D;  5FKR A;  2HKM A;  1U2V C;  2P9L C;  3KRW B;  4O45 A;  4FA1 D;  5IGQ A;  3MXX A;  3SBP A;  2HKR A;  5JWZ A;  4X60 B;  4LG8 A;  4A2M A;  4ZOZ A;  4GQB B;  4EWR A;  2XYI A;  4PSW B;  4IA9 A;  5CYK B;  2AGX A;  3K26 A;  3ULE C;  2GC7 A;  1A0R B;  2I3S A;  3RN0 D;  3SJL D;  2IWK A;  4J79 A;  4J87 A;  3E0C A;  3SVW D;  3B7F A;  1JOF A;  5AFU 3;  5EM2 A;  4CY3 A;  1XHM A;  3I7H A;  2AH0 A;  4CZX A;  3L4M D;  4BH6 A;  4J8G A;  2XL3 A;  5EAM A;  4QT8 A;  3PSL A;  1GXR A;  4U1E I;  4O3U B;  3I7P A;  3I8E A;  3EI2 B;  3UKR C;  2CE9 A;  1FWX A;  3OW8 A;  3JRO A;  3PVW B;  4OZU A;  3I7K A;  3PE7 A;  3FGB A;  4XYH A;  3I8C A;  3UR4 A;  1N6F A;  3UVO A;  1U4C A;  4O1Q D;  1P22 A;  2IAA A;  5TF2 A;  3EI1 B;  5GXH A;  3U4Y A;  3OKW A;  2YMU A;  2J56 H;  4H5I A;  2H9N A;  4FHL A;  5FQD A;  3F3P A;  4N14 A;  4Z8L A;  4GGC A;  5AJA A;  4JXM A;  4E5Z B;  4PC0 A;  5CXC B;  3VH0 A;  4ESG A;  1TBG A;  3BG0 A;  3OTT A;  3EI4 A;  3EI3 A;  4QQE A;  4A09 A;  4GQ1 A;  4AOW A;  5CXB B;  5IT9 g;  3K27 A;  4G56 B;  4L9O A;  4A0A B;  2H68 A;  4PSX B;  4J0X A;  2B4E A;  2OVR B;  3SLE D;  5FKQ A;  1L0Q A;  1B9X A;  4O3T B;  3ZWL B;  4CI3 A;  4J86 A;  3OKY B;  2XL2 A;  2PM9 B;  5C2V B;  3EWE A;  2OK6 A;  2J57 G;  4A0B A;  4X61 B;  4H5J A;  2Z2O A;  4GGA A;  3OL2 B;  4A11 B;  4A7J A;  2Z2P A;  4JT5 C;  5HYN B;  3GRE A;  2AGY A;  2B5N A;  5H14 A;  4J82 A;  2UZY B;  4LG9 A;  2AH1 A;  3EU7 A;  2P9P C;  5HE3 B;  4PBY A;  2CN3 A;  5FKS A;  2P9S C;  3IJ0 A;  3IIW A;  4GGD A;  1ERJ A;  3EI1 A;  1SHY B;  2H9P A;  4JD2 C;  3IKO A;  5TEE A;  2P9K C;  5GXI A;  4GQ2 P;  3ODT A;  3EG6 A;  1GOT B;  1PEV A;  3JZG A;  4ERZ A;  2AGL A;  5EAP A;  4OWR A;  4K3I D;  4E5Z A;  4R7A B;  5GMK n;  5CXC A;  2W18 A;  2OK4 A;  3GFC A;  4Y5R D;  4FB1 D;  2AGW A;  4QRJ A;  3SWS D;  5I5M A;  1QNI A;  2O9K A;  3JPX A;  5EAR A;  3PXT D;  4O9D A;  4J0W A;  1SQJ A;  4A08 A;  3AL9 A;  2BCJ B;  2YB8 B;  4A0A A;  2B5M A;  4IMM A;  2YBA A;  1R5M A;  4JSN C;  3C99 A;  1JMZ B;  3OKY A;  4NSX A;  2Q7Q A;  3UVK A;  2PM9 A;  4E54 A;  5GSA A;  4ZOY A;  3P4F A;  4A2L A;  3IJC A;  5SXM A;  3SHF A;  4CY2 A;  4FAV D;  3OL2 A;  1S4U X;  1N6D A;  5IJ7 E;  4K3J B;  4GM3 A;  2Z2N A;  2PM6 B;  3J81 g;  4GZ8 A;  4BL0 A;  5I5J A;  3AFC A;  2HES X;  3SBQ A;  4ZOV A;  3NVX A;  3V7D B;  3ORV D;  3I89 A;  4LGN A;  4D0K A;  2PBI B;  2H47 A;  3NVN A;  1NR0 A;  2I0S A;  3JB9 L;  5K1C C;  2IUR A;  4QL1 A;  3SFZ A;  2I0R A;  3JRP A;  5CYK A;  1JJU B;  3N0D A;  3SMR A;  3PSC B;  2B5L A;  4CY5 A;  3RMZ D;  2P9N C;  2OVQ B;  3I7N A;  4FAN D;  4CZY A;  2IUV A;  5C9Z B;  3IJ1 A;  5EMK B;  3DM0 A;  1JMX B;  3UVL A;  5THA A;  3RFG A;  1PBY B;  4PNK B;  4FWW A;  5HE0 B;  5A2Q g;  2HYE A;  3L4O D;  3PXS D;  5EM2 B;  4XEI C;  2QC5 A;  2G9A A;  1NEX B;  3I2N A;  3EI2 A;  4MK0 B;  4FA5 D;  1TYQ C;  2CO0 C;  3FM0 A;  4CY1 A;  5EMM B;  2I0T A;  4L3H D;  5EMJ B;  3EMH A;  2HXC A;  3RFH A;  2EBS A;  3CIK B;  5FXY A;  4CC9 A;  1K32 A;  2AGZ A;  3SBR A;  2GNQ A;  2TRC B;  3C5M A;  3CFS B;  2CNX A;  2H13 A;  4PBZ A;  2MTA H;  5IC7 A;  2IUQ A;  3AL8 B;  2OJY A;  3F3G A;  4JSP C;  4J8B A;  2AQ5 A;  4CI2 A;  3J80 g;  4JSV C;  4PXW A;  2H14 A;  3F3F A;  3UVN A;  3BWS A;  2G99 A;  3MKS B;  4ERQ A;  2H6N A;  4JT6 C;  2GC4 A;  1Q47 A;  3HFQ A; 
#chains in the Genus database with same CATH topology
 4ZOX A;  4X3E A;  1XIP A;  4CI1 A;  2VDL A;  2YNO A;  2H6Q A;  1MG2 A;  3PXW D;  2H9L A;  4TZ4 A;  3RRM C;  3VA6 A;  3N0E A;  4GMB A;  4DNU A;  5CXB A;  1A12 A;  3EI4 B;  3EI3 B;  4A09 B;  3DXM C;  3OKT A;  1K8K C;  1C9L A;  1UOQ A;  1XKS A;  1N6E A;  5AMS A;  3W15 A;  4J78 A;  1GP2 B;  2P9U C;  2J55 H;  4Z7O A;  2BBK H;  5C2W B;  3K72 A;  2IWF A;  5M61 A;  1B9Y A;  2H3X A;  3ZE1 A;  3NIF A;  4L3G D;  5H1M A;  1GG2 B;  3JZH A;  3I7O A;  4HDJ A;  4KFM B;  2P9I C;  5FA5 B;  3C9C A;  5FKT A;  5FLX g;  3V9F A;  4A11 A;  1OMW B;  4AEZ A;  3SN6 B;  5B4W A;  4A0B B;  1MG3 A;  1GOF A;  5I5I A;  4AMY A;  4D6V A;  5HE2 B;  2CE8 A;  3V5W B;  2CO0 A;  3ZE2 A;  2IUP A;  5FFO A;  1YFQ A;  4J77 A;  2PM7 B;  3ZE0 A;  4I79 A;  4U7A A;  4Y7R A;  1GOH A;  4X63 B;  3DXK C;  5C86 A;  3IIY A;  4ERY A;  5EAL A;  2JKX A;  1SQ9 A;  1H2Z A;  4AN1 A;  5IJ8 E;  3V4V A;  4UM9 A;  4AMZ A;  3K6S A;  3SXT D;  1U8C A;  5K19 A;  3AL8 A;  3PVU B;  4ES0 A;  2HU8 A;  5M5S A;  4AN0 A;  2HJB A;  3K71 A;  1VYH C;  4CI8 A;  4CZV A;  4FA9 D;  1PGU A;  3KRX B;  2HJ4 A;  2UZX B;  1MDA H;  1E8M A;  3A0F A;  3MZK A;  4BCD A;  4GM8 A;  4XYI A;  3AH8 B;  1YR2 A;  2YNP A;  3MZL A;  4D9S A;  3DSM A;  4UI9 R;  5H17 A;  3NVQ A;  5HE1 B;  5HQG A;  1RI6 A;  3UVM A;  3JAM g;  4YVD A;  3VI4 A;  2OIZ A;  3DWL C;  3IUQ A;  2QXV A;  3EQ7 A;  4J84 A;  3UKU C;  3C75 H;  3RLM D;  5EML B;  4J81 A;  3SCY A;  4FA4 D;  2YNN A;  3IJE A;  4A08 B;  2I3T A;  2VDN A;  4MMZ A;  4ZN4 A;  2CN2 A;  1OLZ A;  2H9M A;  3VGZ A;  3FRX A;  4G55 A;  4J73 A;  3ZDZ A;  3MKQ A;  4BUJ C;  5TEF A;  3O4I A;  3I7L A;  3VI3 A;  4QAM A;  4GM9 A;  2HU5 A;  5IGO A;  4E54 B;  1PI6 A;  5KDO B;  5TDH B;  3JZN A;  3MVD K;  3CFV A;  3RSE C;  2H6K A;  3MMY A;  2XU7 A;  3RN1 D;  4JSX C;  2OVP B;  4NAA A;  3BG1 A;  4L1Q D;  5FKR A;  3IUJ A;  2HKM A;  1U2V C;  2P9L C;  4MMY A;  3KRW B;  4O45 A;  4FA1 D;  5IGQ A;  3MXX A;  3SBP A;  2HKR A;  5JWZ A;  4X60 B;  4LG8 A;  4A2M A;  4ZOZ A;  4GQB B;  4EWR A;  2XYI A;  4PSW B;  5E6R A;  3EQ9 A;  4IA9 A;  5CYK B;  2HU7 A;  2AGX A;  3K26 A;  3ULE C;  2GC7 A;  1A0R B;  2I3S A;  3RN0 D;  3SJL D;  2IWK A;  4J79 A;  2VDO A;  4J87 A;  3MUO A;  3E0C A;  3SVW D;  3B7F A;  1BPO A;  1JOF A;  5AFU 3;  3EQ8 A;  1VE7 A;  5EM2 A;  4CY3 A;  3V4P A;  1XHM A;  3I7H A;  2AH0 A;  4CZX A;  3L4M D;  4BH6 A;  4J8G A;  5E6U A;  4MMX A;  2VDQ A;  2XL3 A;  3MUN A;  5EAM A;  4O02 A;  4QT8 A;  3PSL A;  1GXR A;  4U1E I;  4O3U B;  3I7P A;  3I8E A;  3EI2 B;  2XE4 A;  3UKR C;  2CE9 A;  1FWX A;  1I2M B;  3OW8 A;  3JRO A;  3PVW B;  4OZU A;  3I7K A;  3PE7 A;  3FGB A;  3T3M A;  4XYH A;  3I8C A;  3UR4 A;  1N6F A;  3UVO A;  1M1X A;  1U4C A;  4O1Q D;  1P22 A;  2IAA A;  5TF2 A;  1JTD B;  2VZ3 A;  2VDM A;  3EI1 B;  5GXH A;  2XDW A;  3U4Y A;  3OKW A;  2YMU A;  2J56 H;  4H5I A;  2EIC A;  2H9N A;  4FHL A;  3IUL A;  4JHN A;  5FQD A;  3F3P A;  4N14 A;  4Z8L A;  4GGC A;  2VDP A;  2QZP A;  5AJA A;  4JXM A;  4E5Z B;  4PC0 A;  3OF7 A;  5CXC B;  1E8N A;  3VH0 A;  4ESG A;  4JHP C;  1TBG A;  5M5U A;  3ZDY A;  3BG0 A;  4AX4 A;  2VDR A;  3OTT A;  5M5T A;  4L1M A;  3FCS A;  3EI4 A;  3EI3 A;  4QQE A;  4A09 A;  4GQ1 A;  4AOW A;  4O2W A;  5CXB B;  5IT9 g;  3K27 A;  4G56 B;  4L9O A;  4A0A B;  2H68 A;  1VZ3 A;  4PSX B;  4J0X A;  2B4E A;  1VE6 A;  2OVR B;  3SLE D;  5FKQ A;  1L0Q A;  1B9X A;  4O3T B;  3ZWL B;  4CI3 A;  4J86 A;  1UOP A;  3OKY B;  2XL2 A;  2PM9 B;  5C2V B;  3EWE A;  3T3P A;  4DNW A;  2OK6 A;  2J57 G;  4A0B A;  4X61 B;  4H5J A;  2Z2O A;  4GGA A;  3OL2 B;  2XZG A;  4A11 B;  4NC4 A;  1JV2 A;  4A7J A;  2Z2P A;  4G1E A;  4JT5 C;  5HYN B;  3GRE A;  2AGY A;  2B5N A;  5H14 A;  4J82 A;  2UZY B;  4LG9 A;  2AH1 A;  3EU7 A;  2P9P C;  5HE3 B;  3GC3 B;  4PBY A;  2CN3 A;  5FKS A;  2P9S C;  5M5V A;  3IJ0 A;  3IIW A;  4GGD A;  1ERJ A;  3EI1 A;  1SHY B;  2H9P A;  4JD2 C;  3IKO A;  5TEE A;  5C92 A;  2P9K C;  5GXI A;  2VZ1 A;  4GQ2 P;  3ODT A;  3NIG A;  1TYE A;  3EG6 A;  1GOT B;  1O6G A;  5HDB A;  1PEV A;  3JZG A;  4ERZ A;  2AGL A;  5EAP A;  4OWR A;  4K3I D;  1T2X A;  4BCC A;  4E5Z A;  4R7A B;  5GMK n;  1O6F A;  5CXC A;  2W18 A;  2OK4 A;  3GFC A;  4Y5R D;  1H2Y A;  5FFG A;  4FB1 D;  1GOG A;  1E5T A;  2AGW A;  4QRJ A;  3ZDX A;  3SWS D;  5I5M A;  1QNI A;  3O4H A;  2O9K A;  3JPX A;  5EAR A;  3PXT D;  4O9D A;  2EIB A;  4J0W A;  1SQJ A;  4BP8 A;  4Z7Q A;  4A08 A;  3AL9 A;  1QFM A;  2BCJ B;  2YB8 B;  4A0A A;  3QHY B;  1H2X A;  2B5M A;  2EIE A;  4IMM A;  2YBA A;  1R5M A;  1QFS A;  4JSN C;  3NID A;  4Z7N A;  1UOO A;  3GD1 I;  3C99 A;  4G1M A;  1JMZ B;  3OKY A;  4NSX A;  2Q7Q A;  3UVK A;  2PM9 A;  4E54 A;  5GSA A;  4ZOY A;  3P4F A;  4A2L A;  3IJC A;  5SXM A;  3SHF A;  4CY2 A;  4FAV D;  3OL2 A;  1S4U X;  1N6D A;  5IJ7 E;  4K3J B;  4GM3 A;  2Z2N A;  2PM6 B;  3J81 g;  3O4J A;  4GZ8 A;  4BL0 A;  4WK4 A;  2QR5 A;  5I5J A;  2WQ8 A;  3AFC A;  2HES X;  3SBQ A;  2VDK A;  3IUM A;  4ZOV A;  3NVX A;  3FCU A;  3V7D B;  3DDU A;  3ORV D;  3I89 A;  4WJK A;  4LGN A;  4D0K A;  2VC2 A;  2PBI B;  1L5G A;  2H47 A;  4IRZ A;  3NVN A;  1NR0 A;  2I0S A;  3JB9 L;  5K1C C;  5E6S A;  2IUR A;  4QL1 A;  3SFZ A;  2I0R A;  3JRP A;  5CYK A;  1JJU B;  3N0D A;  3SMR A;  3PSC B;  2B5L A;  4CY5 A;  3RMZ D;  2P9N C;  2OVQ B;  1C9I A;  3I7N A;  4FAN D;  4CZY A;  2IUV A;  3IUR A;  5C9Z B;  3IJ1 A;  5EMK B;  4BP9 A;  3DM0 A;  1JMX B;  3UVL A;  5THA A;  3RFG A;  3IUN A;  1PBY B;  4PNK B;  4FWW A;  4RE5 A;  5HE0 B;  5A2Q g;  2HYE A;  3L4O D;  4NEN A;  2EID A;  3PXS D;  5EM2 B;  4XEI C;  2QC5 A;  2G9A A;  1NEX B;  2BKL A;  3I2N A;  4BCB A;  1H2W A;  4DNV A;  3EI2 A;  4MK0 B;  4FA5 D;  3IVM A;  1TYQ C;  2CO0 C;  3FM0 A;  4CY1 A;  5EMM B;  2I0T A;  4L3H D;  4WK2 A;  5EMJ B;  3EMH A;  2HXC A;  1K3I A;  3RFH A;  2EBS A;  4WK0 A;  4NBM A;  1VZ2 A;  3CIK B;  4RE6 A;  5FXY A;  4CC9 A;  1K32 A;  2AGZ A;  3SBR A;  2GNQ A;  2TRC B;  3C5M A;  3CFS B;  2CNX A;  2H13 A;  4PBZ A;  2MTA H;  5IC7 A;  3QI0 A;  2IUQ A;  3AL8 B;  4UM8 A;  3KCI A;  2OJY A;  3F3G A;  4JSP C;  4J8B A;  2AQ5 A;  4CI2 A;  3J80 g;  4JSV C;  4PXW A;  2H14 A;  3F3F A;  3UVN A;  3BWS A;  2G99 A;  3MKS B;  3O4G A;  2H6N A;  4ERQ A;  5M5R A;  4JT6 C;  1UTC A;  2GC4 A;  1Q47 A;  3HFQ A; 
#chains in the Genus database with same CATH homology
 4ZOX A;  4X3E A;  1XIP A;  4CI1 A;  2YNO A;  2H6Q A;  1MG2 A;  3PXW D;  2H9L A;  4TZ4 A;  3RRM C;  3VA6 A;  3N0E A;  4GMB A;  5CXB A;  3EI4 B;  3EI3 B;  4A09 B;  3DXM C;  3OKT A;  1K8K C;  1XKS A;  1N6E A;  5AMS A;  3W15 A;  4J78 A;  1GP2 B;  2P9U C;  2J55 H;  2BBK H;  5C2W B;  2IWF A;  1B9Y A;  2H3X A;  4L3G D;  5H1M A;  1GG2 B;  3JZH A;  3I7O A;  4HDJ A;  4KFM B;  2P9I C;  5FA5 B;  3C9C A;  5FKT A;  5FLX g;  3V9F A;  4A11 A;  1OMW B;  4AEZ A;  3SN6 B;  5B4W A;  4A0B B;  1MG3 A;  5I5I A;  4D6V A;  5HE2 B;  2CE8 A;  3V5W B;  2CO0 A;  2IUP A;  1YFQ A;  4J77 A;  2PM7 B;  4I79 A;  4U7A A;  4Y7R A;  4X63 B;  3DXK C;  3IIY A;  4ERY A;  5EAL A;  1SQ9 A;  5IJ8 E;  3SXT D;  5K19 A;  3AL8 A;  3PVU B;  4ES0 A;  2HJB A;  1VYH C;  4CI8 A;  4CZV A;  4FA9 D;  1PGU A;  3KRX B;  2HJ4 A;  2UZX B;  1MDA H;  3MZK A;  3A0F A;  4GM8 A;  4XYI A;  3AH8 B;  2YNP A;  3MZL A;  3DSM A;  4UI9 R;  5H17 A;  3NVQ A;  5HE1 B;  5HQG A;  1RI6 A;  3UVM A;  3JAM g;  4YVD A;  2OIZ A;  3DWL C;  2QXV A;  4J84 A;  3UKU C;  3C75 H;  3RLM D;  5EML B;  4J81 A;  3SCY A;  4FA4 D;  2YNN A;  4A08 B;  2I3T A;  4ZN4 A;  2CN2 A;  1OLZ A;  2H9M A;  3VGZ A;  3FRX A;  4J73 A;  3MKQ A;  4BUJ C;  5TEF A;  3I7L A;  4GM9 A;  5IGO A;  4E54 B;  1PI6 A;  5KDO B;  5TDH B;  3JZN A;  3CFV A;  3RSE C;  2H6K A;  3MMY A;  2XU7 A;  3RN1 D;  4JSX C;  2OVP B;  3BG1 A;  4L1Q D;  5FKR A;  2HKM A;  1U2V C;  2P9L C;  3KRW B;  4O45 A;  4FA1 D;  5IGQ A;  3MXX A;  3SBP A;  2HKR A;  5JWZ A;  4X60 B;  4LG8 A;  4A2M A;  4ZOZ A;  4GQB B;  4EWR A;  2XYI A;  4PSW B;  4IA9 A;  5CYK B;  2AGX A;  3K26 A;  3ULE C;  2GC7 A;  1A0R B;  2I3S A;  3RN0 D;  3SJL D;  2IWK A;  4J79 A;  4J87 A;  3E0C A;  3SVW D;  3B7F A;  1JOF A;  5AFU 3;  5EM2 A;  4CY3 A;  1XHM A;  3I7H A;  2AH0 A;  4CZX A;  3L4M D;  4BH6 A;  4J8G A;  2XL3 A;  5EAM A;  4QT8 A;  3PSL A;  1GXR A;  4U1E I;  4O3U B;  3I7P A;  3I8E A;  3EI2 B;  3UKR C;  2CE9 A;  1FWX A;  3OW8 A;  3JRO A;  3PVW B;  4OZU A;  3I7K A;  3PE7 A;  3FGB A;  4XYH A;  3I8C A;  3UR4 A;  1N6F A;  3UVO A;  1U4C A;  4O1Q D;  1P22 A;  2IAA A;  5TF2 A;  3EI1 B;  5GXH A;  3U4Y A;  3OKW A;  2YMU A;  2J56 H;  4H5I A;  2H9N A;  4FHL A;  5FQD A;  3F3P A;  4N14 A;  4Z8L A;  4GGC A;  5AJA A;  4JXM A;  4E5Z B;  4PC0 A;  5CXC B;  3VH0 A;  4ESG A;  1TBG A;  3BG0 A;  3OTT A;  3EI4 A;  3EI3 A;  4QQE A;  4A09 A;  4GQ1 A;  4AOW A;  5CXB B;  5IT9 g;  3K27 A;  4G56 B;  4L9O A;  4A0A B;  2H68 A;  4PSX B;  4J0X A;  2B4E A;  2OVR B;  3SLE D;  5FKQ A;  1L0Q A;  1B9X A;  4O3T B;  3ZWL B;  4CI3 A;  4J86 A;  3OKY B;  2XL2 A;  2PM9 B;  5C2V B;  3EWE A;  2OK6 A;  2J57 G;  4A0B A;  4X61 B;  4H5J A;  2Z2O A;  4GGA A;  3OL2 B;  4A11 B;  4A7J A;  2Z2P A;  4JT5 C;  5HYN B;  3GRE A;  2AGY A;  2B5N A;  5H14 A;  4J82 A;  2UZY B;  4LG9 A;  2AH1 A;  3EU7 A;  2P9P C;  5HE3 B;  4PBY A;  2CN3 A;  5FKS A;  2P9S C;  3IJ0 A;  3IIW A;  4GGD A;  1ERJ A;  3EI1 A;  1SHY B;  2H9P A;  4JD2 C;  3IKO A;  5TEE A;  2P9K C;  5GXI A;  4GQ2 P;  3ODT A;  3EG6 A;  1GOT B;  1PEV A;  3JZG A;  4ERZ A;  2AGL A;  5EAP A;  4OWR A;  4K3I D;  4E5Z A;  4R7A B;  5GMK n;  5CXC A;  2W18 A;  2OK4 A;  3GFC A;  4Y5R D;  4FB1 D;  2AGW A;  4QRJ A;  3SWS D;  5I5M A;  1QNI A;  2O9K A;  3JPX A;  5EAR A;  3PXT D;  4O9D A;  4J0W A;  1SQJ A;  4A08 A;  3AL9 A;  2BCJ B;  2YB8 B;  4A0A A;  2B5M A;  4IMM A;  2YBA A;  1R5M A;  4JSN C;  3C99 A;  1JMZ B;  3OKY A;  4NSX A;  2Q7Q A;  3UVK A;  2PM9 A;  4E54 A;  5GSA A;  4ZOY A;  3P4F A;  4A2L A;  3IJC A;  5SXM A;  3SHF A;  4CY2 A;  4FAV D;  3OL2 A;  1S4U X;  1N6D A;  5IJ7 E;  4K3J B;  4GM3 A;  2Z2N A;  2PM6 B;  3J81 g;  4GZ8 A;  4BL0 A;  5I5J A;  3AFC A;  2HES X;  3SBQ A;  4ZOV A;  3NVX A;  3V7D B;  3ORV D;  3I89 A;  4LGN A;  4D0K A;  2PBI B;  2H47 A;  3NVN A;  1NR0 A;  2I0S A;  3JB9 L;  5K1C C;  2IUR A;  4QL1 A;  3SFZ A;  2I0R A;  3JRP A;  5CYK A;  1JJU B;  3N0D A;  3SMR A;  3PSC B;  2B5L A;  4CY5 A;  3RMZ D;  2P9N C;  2OVQ B;  3I7N A;  4FAN D;  4CZY A;  2IUV A;  5C9Z B;  3IJ1 A;  5EMK B;  3DM0 A;  1JMX B;  3UVL A;  5THA A;  3RFG A;  1PBY B;  4PNK B;  4FWW A;  5HE0 B;  5A2Q g;  2HYE A;  3L4O D;  3PXS D;  5EM2 B;  4XEI C;  2QC5 A;  2G9A A;  1NEX B;  3I2N A;  3EI2 A;  4MK0 B;  4FA5 D;  1TYQ C;  2CO0 C;  3FM0 A;  4CY1 A;  5EMM B;  2I0T A;  4L3H D;  5EMJ B;  3EMH A;  2HXC A;  3RFH A;  2EBS A;  3CIK B;  5FXY A;  4CC9 A;  1K32 A;  2AGZ A;  3SBR A;  2GNQ A;  2TRC B;  3C5M A;  3CFS B;  2CNX A;  2H13 A;  4PBZ A;  2MTA H;  5IC7 A;  2IUQ A;  3AL8 B;  2OJY A;  3F3G A;  4JSP C;  4J8B A;  2AQ5 A;  4CI2 A;  3J80 g;  4JSV C;  4PXW A;  2H14 A;  3F3F A;  3UVN A;  3BWS A;  2G99 A;  3MKS B;  4ERQ A;  2H6N A;  4JT6 C;  2GC4 A;  1Q47 A;  3HFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...