1YFQA

High resolution s. cerevisiae bub3 mitotic checkpoint protein
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
342
structure length
342
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell cycle arrest protein BUB3
publication title The 1.1-a structure of the spindle checkpoint protein bub3p reveals functional regions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 77
structure length 342
sequence length 342
ec nomenclature
pdb deposition date 2005-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1yfqA00
4E5ZB 4ZOVA 3EI3A 4GM9A 4J0WA 4GM3A 3I7OA 4PC0A 5TDHB 5AMSA 4A09A 2UZXB 3PXSD 4CC9A 1GXRA 3DM0A 4J84A 4J82A 3EI1A 4FB1D 1PEVA 3DWLC 3OKYA 3OKTA 2P9KC 3SN6B 1K32A 5A2Qg 3UVOA 2OK6A 4A2MA 1VYHC 1JMZB 4ESGA 3J80g 1JJUB 5FXYA 4GM8A 4FA5D 3EU7A 4ERYA 4EWRA 1GP2B 4O1QD 3N0EA 4XYHA 3EI4B 1JOFA 2B4EA 4YVDA 2H9LA 5EMKB 2J55H 3OL2A 3RN0D 4AOWA 5CXCA 2XYIA 1RI6A 3EMHA 5SXMA 4J87A 3RFHA 4HDJA 2P9SC 4FAND 5I5JA 3ORVD 5FKRA 3MZLA 3MXXA 4J8BA 3IIYA 2IUVA 4O45A 5JWZA 5EALA 3K26A 3OTTA 3EG6A 2I0TA 3C5MA 4I79A 4CZVA 1GG2B 2H9NA 2CE8A 5I5MA 4O3UB 5EAMA 3ZWLB 4BL0A 4NSXA 3EI2B 2OVRB 3JAMg 2Z2PA 1TYQC 1S4UX 4D6VA 4X63B 3MZKA 4K3ID 4H5JA 5CYKB 5FLXg 4J86A 3PXWD 2QC5A 4U1EI 4FWWA 3IJ1A 5B4WA 2IAAA 4GGDA 5TF2A 5HE1B 3SBQA 1TBGA 2CNXA 3L4OD 3RRMC 1JMXB 2YNNA 3AL8A 3ODTA 1L0QA 5IT9g 3SBRA 2IWFA 3GREA 3AL9A 5TEFA 3I7LA 3UVLA 5GXHA 4GMBA 1A0RB 2CN2A 5EMJB 5EM2A 4A08A 4GQBB 1XHMA 4CY2A 3BG1A 4IA9A 3F3GA 2H6QA 2OIZA 2PM6B 4PBZA 5K19A 3JROA 5IGQA 4E54A 1YFQA 2H68A 3RLMD 3UVMA 4H5IA 4LG9A 2YB8B 4ZN4A 4CY1A 4GGAA 4A0BA 1B9YA 4PBYA 3EI3B 5H17A 3BWSA 3HFQA 4CI2A 2H9PA 3UVNA 3MKSB 4D0KA 3CIKB 2CO0C 4QRJA 4FA1D 4GQ1A 4A09B 4UI9R 5FA5B 4AEZA 3V5WB 2P9PC 4KFMB 4Y7RA 3PXTD 2P9IC 3VH0A 3V7DB 2H14A 3P4FA 4PSXB 3EI1B 4L1QD 5FQDA 2H3XA 2BCJB 4Z8LA 3VA6A 2B5LA 3OKYB 3FM0A 2I0SA 5FKQA 5FKSA 3A0FA 2G99A 4PSWB 3C99A 5C2VB 1NEXB 3UKUC 4ERQA 3DXMC 5IC7A 2AH1A 2B5NA 4GZ8A 4Y5RD 2PM7B 2TRCB 5EAPA 2HYEA 4LG8A 3GFCA 2AGYA 2HXCA 2PBIB 2Z2OA 3W15A 2AGZA 1ERJA 2PM9A 1NR0A 5AJAA 4CI3A 2HKMA 4CY5A 3U4YA 4O9DA 5HE0B 2OVPB 3OL2B 5TEEA 4L3GD 3I7PA 1GOTB 5CXCB 4QQEA 4A11A 4MK0B 3CFVA 4JSNC 2H13A 5C2WB 1K8KC 4JSPC 5H14A 4OWRA 2OJYA 3I7NA 4BUJC 5AFU3 5IJ7E 1XKSA 2BBKH 3PVWB 4JSXC 5CXBA 4A0AA 4ZOYA 4CI1A 1MDAH 4X60B 4CZYA 3NVNA 3JRPA 4JT6C 5I5IA 5KDOB 3I7KA 2XL2A 5HE3B 2HJBA 4J73A 1OLZA 4E5ZA 5EMLB 4J0XA 4TZ4A 2YNPA 2HESX 2Q7QA 2OK4A 1SHYB 5HYNB 4O3TB 4FA4D 4PXWA 2AQ5A 2EBSA 4FHLA 3SVWD 4A2LA 3RMZD 2HJ4A 3V9FA 1PI6A 4J77A 4JSVC 3PVUB 4FAVD 4PNKB 4JXMA 2AGLA 4QT8A 3F3FA 1U2VC 3IKOA 3MMYA 2W18A 3SCYA 3RN1D 3SWSD 3AL8B 3SMRA 2P9NC 2I3SA 5IJ8E 4GGCA 3C75H 4J8GA 3I2NA 3UVKA 5GSAA 1FWXA 4X3EA 3JB9L 3CFSB 4CZXA 3NVXA 3C9CA 5EM2B 4A08B 4GQ2P 3E0CA 2H6NA 1N6DA 2XL3A 3SHFA 4ES0A 1QNIA 3EWEA 3MKQA 4A7JA 5IGOA 1N6FA 4XEIC 2O9KA 3I7HA 5K1CC 4K3JB 3EI4A 5THAA 1N6EA 4IMMA 4E54B 3SLED 3BG0A 3B7FA 3SFZA 2IUPA 4G56B 3I8CA 1SQJA 3JZNA 2IUQA 3JZGA 4A0BB 1MG3A 3I89A 1SQ9A 4JT5C 2I3TA 4N14A 2G9AA 2GC4A 4OZUA 2Z2NA 4XYIA 4BH6A 3IIWA 4J81A 1Q47A 5EARA 2CN3A 3PSCB 1MG2A 2AGXA 2AH0A 3I8EA 5HE2B 3IJ0A 1PBYB 3JZHA 1B9XA 4U7AA 2OVQB 2CO0A 4J79A 2QXVA 4CY3A 3EI2A 5EMMB 3ULEC 4FA9D 2I0RA 3F3PA 4L9OA 2MTAH 2IWKA 4ZOZA 2J56H 2IURA 3N0DA 4JD2C 2HKRA 4X61B 4J78A 2YNOA 5CYKA 2H9MA 4QL1A 4L3HD 3NVQA 3KRXB 3RSEC 1PGUA 3FGBA 2CE9A 2XU7A 5H1MA 2H6KA 1P22A 1U4CA 2UZYB 4R7AB 3UR4A 3RFGA 2PM9B 3JPXA 2YMUA 3L4MD 3UKRC 3AH8B 2P9LC 3IJCA 2B5MA 4ZOXA 3SXTD 2AGWA 1R5MA 4A11B 3PSLA 1OMWB 2H47A 5GMKn 2GNQA 4LGNA 2YBAA 3SBPA 3AFCA 3OKWA 3FRXA 2J57G 3J81g 5CXBB 4A0AB 3VGZA 1XIPA 3OW8A 5FKTA 3DXKC 2P9UC 3DSMA 3PE7A 5GXIA 5HQGA 5C9ZB 4ERZA 2GC7A 3KRWB 3SJLD 3K27A 4CI8A
chains in the Genus database with same CATH superfamily
5C86A 4E5ZB 4ZOVA 3O4JA 3EI3A 4GM9A 4J0WA 4GM3A 3I7OA 4WK4A 4PC0A 1H2XA 5TDHB 4JHPC 2WQ8A 5AMSA 5E6SA 4A09A 1UOPA 2UZXB 4BCBA 3PXSD 1H2YA 4CC9A 1GXRA 3DM0A 4J84A 4J82A 3EI1A 4FB1D 1PEVA 3DWLC 3OKYA 4MMYA 3NIFA 4Z7NA 3V4VA 3OKTA 2P9KC 3SN6B 3KCIA 1K32A 5E6UA 5A2Qg 4BP8A 4UM8A 3UVOA 2OK6A 4Z7OA 5FFGA 4A2MA 1VYHC 1JMZB 4ESGA 3J80g 1JJUB 5FXYA 4GM8A 4FA5D 4G1EA 5M61A 1TYEA 3EU7A 4L1MA 4ERYA 4EWRA 1GP2B 4O1QD 3N0EA 4XYHA 3EI4B 1VZ2A 1JOFA 2B4EA 4YVDA 2H9LA 5EMKB 2J55H 2VZ1A 3OL2A 3RN0D 4AOWA 5CXCA 2XYIA 1RI6A 2XZGA 3EMHA 5SXMA 3ZE2A 4J87A 3RFHA 4HDJA 2P9SC 4IRZA 4FAND 5I5JA 3ORVD 5FKRA 3MZLA 3MXXA 4J8BA 3IIYA 3IUJA 2IUVA 4O45A 5JWZA 5EALA 3K26A 2EIDA 3OTTA 3EG6A 2I0TA 3C5MA 4I79A 4CZVA 4WJKA 1GG2B 2H9NA 3T3MA 2CE8A 5I5MA 4O3UB 5EAMA 3ZWLB 4BL0A 4NSXA 5FFOA 5C92A 3EI2B 2OVRB 3JAMg 2Z2PA 3FCSA 3MUNA 1TYQC 1S4UX 4D6VA 4X63B 3MZKA 4AN0A 3IULA 4K3ID 4H5JA 5CYKB 5FLXg 4J86A 3PXWD 2QC5A 4U1EI 4FWWA 5M5TA 3IJ1A 2HU8A 5B4WA 2IAAA 3O4HA 4GGDA 5TF2A 5HE1B 3SBQA 1TBGA 2CNXA 3L4OD 3RRMC 1JMXB 2YNNA 2VDPA 3AL8A 3ODTA 1L0QA 5IT9g 3SBRA 2IWFA 4AN1A 2HU7A 3GREA 3AL9A 5TEFA 3I7LA 3UVLA 5GXHA 4GMBA 1A0RB 2CN2A 5EMJB 5EM2A 4A08A 4GQBB 1XHMA 4CY2A 3BG1A 4IA9A 1H2WA 3F3GA 3K71A 4QAMA 2H6QA 2OIZA 2PM6B 4PBZA 5K19A 3JROA 3IUNA 5IGQA 4E54A 1YFQA 3VI4A 2H68A 3RLMD 3UVMA 4D9SA 4H5IA 4LG9A 1C9LA 4DNVA 2YB8B 2XDWA 1E8NA 1JV2A 3GD1I 4ZN4A 1VE6A 4CY1A 4GGAA 4NC4A 4A0BA 2QZPA 1B9YA 4PBYA 3EI3B 4MMXA 5H17A 3BWSA 1A12A 3HFQA 4CI2A 2H9PA 3UVNA 3MKSB 2VDNA 4D0KA 3CIKB 2CO0C 4QRJA 4FA1D 4GQ1A 4A09B 4UI9R 5FA5B 4AEZA 3V5WB 2P9PC 4KFMB 4Y7RA 3PXTD 2P9IC 3VH0A 1K3IA 2H14A 3V7DB 3P4FA 4PSXB 3EI1B 3K72A 4L1QD 5FQDA 2H3XA 2BCJB 4G55A 4Z8LA 3NIGA 3VA6A 2B5LA 3OKYB 3FM0A 2I0SA 5FKQA 5FKSA 3A0FA 2G99A 4PSWB 3C99A 5C2VB 1NEXB 3UKUC 1GOGA 4DNWA 2EICA 4ERQA 3DXMC 5IC7A 2AH1A 2B5NA 4GZ8A 1T2XA 4Y5RD 2PM7B 2TRCB 5EAPA 2HYEA 4LG8A 3GFCA 2AGYA 2HXCA 2PBIB 2Z2OA 3W15A 2AGZA 1ERJA 2PM9A 1NR0A 5AJAA 4CI3A 4G1MA 2HKMA 3OF7A 4CY5A 4O9DA 3U4YA 3MUOA 5HE0B 1E8MA 2OVPB 3DDUA 3OL2B 5TEEA 4L3GD 3EQ8A 3I7PA 1GOTB 5CXCB 1VE7A 4QQEA 4A11A 4MK0B 3CFVA 4JSNC 2H13A 5C2WB 1K8KC 4JSPC 5H14A 5M5RA 2VDOA 4OWRA 4O2WA 5M5SA 2OJYA 4MMZA 3I7NA 4BUJC 5AFU3 5IJ7E 1XKSA 2BBKH 3PVWB 4JSXC 1VZ3A 5CXBA 4A0AA 4ZOYA 1JTDB 4CI1A 1MDAH 4WK0A 4AMZA 4X60B 4CZYA 1QFSA 2BKLA 3NVNA 3JRPA 4JT6C 2QR5A 5I5IA 5M5UA 5KDOB 3I7KA 2XL2A 5HE3B 2HJBA 2EIBA 4J73A 1OLZA 4E5ZA 2VZ3A 5EMLB 4J0XA 2HU5A 3NIDA 4WK2A 4NENA 4TZ4A 2YNPA 3IUQA 2HESX 1H2ZA 2Q7QA 2OK4A 1SHYB 5HYNB 4O3TB 3O4GA 2VDRA 4FA4D 4PXWA 1YR2A 2AQ5A 2EBSA 4FHLA 3SVWD 4A2LA 3RMZD 2HJ4A 3V9FA 1PI6A 4J77A 4JSVC 3PVUB 1BPOA 4PNKB 4JXMA 4FAVD 2AGLA 3V4PA 4QT8A 3F3FA 1U2VC 3IKOA 3MMYA 2W18A 3SCYA 3RN1D 3VI3A 4O02A 3AL8B 3SMRA 3SWSD 2P9NC 2I3SA 5IJ8E 4GGCA 3C75H 4J8GA 5E6RA 3I2NA 3UVKA 5GSAA 1FWXA 4X3EA 3JB9L 4Z7QA 3CFSB 4UM9A 4CZXA 3NVXA 3C9CA 5EM2B 4A08B 4GQ2P 3E0CA 4NBMA 2H6NA 1N6DA 2XL3A 4NAAA 3SHFA 4ES0A 1QNIA 3EWEA 3MKQA 4A7JA 5IGOA 2XE4A 1N6FA 4XEIC 2O9KA 3I7HA 5K1CC 3EI4A 4K3JB 3EQ7A 1N6EA 4IMMA 5THAA 4E54B 3SLED 3BG0A 3B7FA 3O4IA 3SFZA 2IUPA 4G56B 3IVMA 3I8CA 1QFMA 1SQJA 3JZNA 2IUQA 1GOHA 3FCUA 3JZGA 4BCDA 4A0BB 1MG3A 1UOOA 1M1XA 3I89A 1SQ9A 3ZDXA 4JT5C 2I3TA 4N14A 3IURA 2G9AA 2GC4A 4OZUA 2Z2NA 3IJEA 4XYIA 3ZDZA 4BH6A 3IIWA 4J81A 1Q47A 5EARA 2CN3A 3PSCB 1MG2A 2AGXA 3IUMA 2AH0A 2VDMA 3I8EA 3GC3B 5HE2B 3IJ0A 1PBYB 3JZHA 1E5TA 1B9XA 4U7AA 2OVQB 2CO0A 4J79A 2QXVA 4CY3A 3QHYB 4BCCA 5EMMB 3EI2A 3ULEC 4FA9D 2I0RA 3F3PA 1O6GA 4L9OA 2MTAH 2IWKA 4ZOZA 3T3PA 2J56H 3MVDK 2IURA 3N0DA 4JD2C 2HKRA 4X61B 1GOFA 4J78A 2YNOA 5CYKA 2H9MA 4QL1A 4L3HD 3NVQA 3KRXB 3RSEC 1PGUA 3FGBA 1C9IA 2CE9A 2XU7A 2H6KA 1P22A 1U4CA 2UZYB 4R7AB 5H1MA 3UR4A 3RFGA 2PM9B 3JPXA 4AX4A 5M5VA 3ZDYA 2YMUA 3L4MD 3UKRC 3AH8B 1O6FA 2P9LC 3K6SA 3IJCA 2B5MA 4ZOXA 4BP9A 3ZE0A 2VDQA 3SXTD 5HDBA 2EIEA 2AGWA 1R5MA 1UTCA 3PSLA 4A11B 1OMWB 2H47A 4DNUA 1I2MB 4AMYA 5GMKn 4RE6A 2VC2A 3EQ9A 2GNQA 3QI0A 4LGNA 3ZE1A 4RE5A 2YBAA 3SBPA 3AFCA 3OKWA 1UOQA 3FRXA 2VDKA 2J57G 3J81g 5CXBB 4A0AB 3VGZA 1XIPA 2VDLA 1L5GA 3OW8A 4JHNA 5FKTA 3DXKC 1U8CA 2P9UC 3DSMA 3PE7A 5GXIA 5HQGA 5C9ZB 4ERZA 2GC7A 3KRWB 3SJLD 3K27A 4CI8A 2JKXA
chains in the Genus database with same CATH topology
4E5ZB 4ZOVA 3EI3A 4GM9A 4J0WA 4GM3A 3I7OA 4PC0A 5TDHB 5AMSA 4A09A 2UZXB 3PXSD 4CC9A 1GXRA 3DM0A 4J84A 4J82A 3EI1A 4FB1D 1PEVA 3DWLC 3OKYA 3OKTA 2P9KC 3SN6B 1K32A 5A2Qg 3UVOA 2OK6A 4A2MA 1VYHC 1JMZB 4ESGA 3J80g 1JJUB 5FXYA 4GM8A 4FA5D 3EU7A 4ERYA 4EWRA 1GP2B 4O1QD 3N0EA 4XYHA 3EI4B 1JOFA 2B4EA 4YVDA 2H9LA 5EMKB 2J55H 3OL2A 3RN0D 4AOWA 5CXCA 2XYIA 1RI6A 3EMHA 5SXMA 4J87A 3RFHA 4HDJA 2P9SC 4FAND 5I5JA 3ORVD 5FKRA 3MZLA 3MXXA 4J8BA 3IIYA 2IUVA 4O45A 5JWZA 5EALA 3K26A 3OTTA 3EG6A 2I0TA 3C5MA 4I79A 4CZVA 1GG2B 2H9NA 2CE8A 5I5MA 4O3UB 5EAMA 3ZWLB 4BL0A 4NSXA 3EI2B 2OVRB 3JAMg 2Z2PA 1TYQC 1S4UX 4D6VA 4X63B 3MZKA 4K3ID 4H5JA 5CYKB 5FLXg 4J86A 3PXWD 2QC5A 4U1EI 4FWWA 3IJ1A 5B4WA 2IAAA 4GGDA 5TF2A 5HE1B 3SBQA 1TBGA 2CNXA 3L4OD 3RRMC 1JMXB 2YNNA 3AL8A 3ODTA 1L0QA 5IT9g 3SBRA 2IWFA 3GREA 3AL9A 5TEFA 3I7LA 3UVLA 5GXHA 4GMBA 1A0RB 2CN2A 5EMJB 5EM2A 4A08A 4GQBB 1XHMA 4CY2A 3BG1A 4IA9A 3F3GA 2H6QA 2OIZA 2PM6B 4PBZA 5K19A 3JROA 5IGQA 4E54A 1YFQA 2H68A 3RLMD 3UVMA 4H5IA 4LG9A 2YB8B 4ZN4A 4CY1A 4GGAA 4A0BA 1B9YA 4PBYA 3EI3B 5H17A 3BWSA 3HFQA 4CI2A 2H9PA 3UVNA 3MKSB 4D0KA 3CIKB 2CO0C 4QRJA 4FA1D 4GQ1A 4A09B 4UI9R 5FA5B 4AEZA 3V5WB 2P9PC 4KFMB 4Y7RA 3PXTD 2P9IC 3VH0A 3V7DB 2H14A 3P4FA 4PSXB 3EI1B 4L1QD 5FQDA 2H3XA 2BCJB 4Z8LA 3VA6A 2B5LA 3OKYB 3FM0A 2I0SA 5FKQA 5FKSA 3A0FA 2G99A 4PSWB 3C99A 5C2VB 1NEXB 3UKUC 4ERQA 3DXMC 5IC7A 2AH1A 2B5NA 4GZ8A 4Y5RD 2PM7B 2TRCB 5EAPA 2HYEA 4LG8A 3GFCA 2AGYA 2HXCA 2PBIB 2Z2OA 3W15A 2AGZA 1ERJA 2PM9A 1NR0A 5AJAA 4CI3A 2HKMA 4CY5A 3U4YA 4O9DA 5HE0B 2OVPB 3OL2B 5TEEA 4L3GD 3I7PA 1GOTB 5CXCB 4QQEA 4A11A 4MK0B 3CFVA 4JSNC 2H13A 5C2WB 1K8KC 4JSPC 5H14A 4OWRA 2OJYA 3I7NA 4BUJC 5AFU3 5IJ7E 1XKSA 2BBKH 3PVWB 4JSXC 5CXBA 4A0AA 4ZOYA 4CI1A 1MDAH 4X60B 4CZYA 3NVNA 3JRPA 4JT6C 5I5IA 5KDOB 3I7KA 2XL2A 5HE3B 2HJBA 4J73A 1OLZA 4E5ZA 5EMLB 4J0XA 4TZ4A 2YNPA 2HESX 2Q7QA 2OK4A 1SHYB 5HYNB 4O3TB 4FA4D 4PXWA 2AQ5A 2EBSA 4FHLA 3SVWD 4A2LA 3RMZD 2HJ4A 3V9FA 1PI6A 4J77A 4JSVC 3PVUB 4FAVD 4PNKB 4JXMA 2AGLA 4QT8A 3F3FA 1U2VC 3IKOA 3MMYA 2W18A 3SCYA 3RN1D 3SWSD 3AL8B 3SMRA 2P9NC 2I3SA 5IJ8E 4GGCA 3C75H 4J8GA 3I2NA 3UVKA 5GSAA 1FWXA 4X3EA 3JB9L 3CFSB 4CZXA 3NVXA 3C9CA 5EM2B 4A08B 4GQ2P 3E0CA 2H6NA 1N6DA 2XL3A 3SHFA 4ES0A 1QNIA 3EWEA 3MKQA 4A7JA 5IGOA 1N6FA 4XEIC 2O9KA 3I7HA 5K1CC 4K3JB 3EI4A 5THAA 1N6EA 4IMMA 4E54B 3SLED 3BG0A 3B7FA 3SFZA 2IUPA 4G56B 3I8CA 1SQJA 3JZNA 2IUQA 3JZGA 4A0BB 1MG3A 3I89A 1SQ9A 4JT5C 2I3TA 4N14A 2G9AA 2GC4A 4OZUA 2Z2NA 4XYIA 4BH6A 3IIWA 4J81A 1Q47A 5EARA 2CN3A 3PSCB 1MG2A 2AGXA 2AH0A 3I8EA 5HE2B 3IJ0A 1PBYB 3JZHA 1B9XA 4U7AA 2OVQB 2CO0A 4J79A 2QXVA 4CY3A 3EI2A 5EMMB 3ULEC 4FA9D 2I0RA 3F3PA 4L9OA 2MTAH 2IWKA 4ZOZA 2J56H 2IURA 3N0DA 4JD2C 2HKRA 4X61B 4J78A 2YNOA 5CYKA 2H9MA 4QL1A 4L3HD 3NVQA 3KRXB 3RSEC 1PGUA 3FGBA 2CE9A 2XU7A 5H1MA 2H6KA 1P22A 1U4CA 2UZYB 4R7AB 3UR4A 3RFGA 2PM9B 3JPXA 2YMUA 3L4MD 3UKRC 3AH8B 2P9LC 3IJCA 2B5MA 4ZOXA 3SXTD 2AGWA 1R5MA 4A11B 3PSLA 1OMWB 2H47A 5GMKn 2GNQA 4LGNA 2YBAA 3SBPA 3AFCA 3OKWA 3FRXA 2J57G 3J81g 5CXBB 4A0AB 3VGZA 1XIPA 3OW8A 5FKTA 3DXKC 2P9UC 3DSMA 3PE7A 5GXIA 5HQGA 5C9ZB 4ERZA 2GC7A 3KRWB 3SJLD 3K27A 4CI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E5Z B;  4ZOV A;  3EI3 A;  4GM9 A;  4J0W A;  4GM3 A;  3I7O A;  4PC0 A;  5TDH B;  5AMS A;  4A09 A;  2UZX B;  3PXS D;  4CC9 A;  1GXR A;  3DM0 A;  4J84 A;  4J82 A;  3EI1 A;  4FB1 D;  1PEV A;  3DWL C;  3OKY A;  3OKT A;  2P9K C;  3SN6 B;  1K32 A;  5A2Q g;  3UVO A;  2OK6 A;  4A2M A;  1VYH C;  1JMZ B;  4ESG A;  3J80 g;  1JJU B;  5FXY A;  4GM8 A;  4FA5 D;  3EU7 A;  4ERY A;  4EWR A;  1GP2 B;  4O1Q D;  3N0E A;  4XYH A;  3EI4 B;  1JOF A;  2B4E A;  4YVD A;  2H9L A;  5EMK B;  2J55 H;  3OL2 A;  3RN0 D;  4AOW A;  5CXC A;  2XYI A;  1RI6 A;  3EMH A;  5SXM A;  4J87 A;  3RFH A;  4HDJ A;  2P9S C;  4FAN D;  5I5J A;  3ORV D;  5FKR A;  3MZL A;  3MXX A;  4J8B A;  3IIY A;  2IUV A;  4O45 A;  5JWZ A;  5EAL A;  3K26 A;  3OTT A;  3EG6 A;  2I0T A;  3C5M A;  4I79 A;  4CZV A;  1GG2 B;  2H9N A;  2CE8 A;  5I5M A;  4O3U B;  5EAM A;  3ZWL B;  4BL0 A;  4NSX A;  3EI2 B;  2OVR B;  3JAM g;  2Z2P A;  1TYQ C;  1S4U X;  4D6V A;  4X63 B;  3MZK A;  4K3I D;  4H5J A;  5CYK B;  5FLX g;  4J86 A;  3PXW D;  2QC5 A;  4U1E I;  4FWW A;  3IJ1 A;  5B4W A;  2IAA A;  4GGD A;  5TF2 A;  5HE1 B;  3SBQ A;  1TBG A;  2CNX A;  3L4O D;  3RRM C;  1JMX B;  2YNN A;  3AL8 A;  3ODT A;  1L0Q A;  5IT9 g;  3SBR A;  2IWF A;  3GRE A;  3AL9 A;  5TEF A;  3I7L A;  3UVL A;  5GXH A;  4GMB A;  1A0R B;  2CN2 A;  5EMJ B;  5EM2 A;  4A08 A;  4GQB B;  1XHM A;  4CY2 A;  3BG1 A;  4IA9 A;  3F3G A;  2H6Q A;  2OIZ A;  2PM6 B;  4PBZ A;  5K19 A;  3JRO A;  5IGQ A;  4E54 A;  1YFQ A;  2H68 A;  3RLM D;  3UVM A;  4H5I A;  4LG9 A;  2YB8 B;  4ZN4 A;  4CY1 A;  4GGA A;  4A0B A;  1B9Y A;  4PBY A;  3EI3 B;  5H17 A;  3BWS A;  3HFQ A;  4CI2 A;  2H9P A;  3UVN A;  3MKS B;  4D0K A;  3CIK B;  2CO0 C;  4QRJ A;  4FA1 D;  4GQ1 A;  4A09 B;  4UI9 R;  5FA5 B;  4AEZ A;  3V5W B;  2P9P C;  4KFM B;  4Y7R A;  3PXT D;  2P9I C;  3VH0 A;  3V7D B;  2H14 A;  3P4F A;  4PSX B;  3EI1 B;  4L1Q D;  5FQD A;  2H3X A;  2BCJ B;  4Z8L A;  3VA6 A;  2B5L A;  3OKY B;  3FM0 A;  2I0S A;  5FKQ A;  5FKS A;  3A0F A;  2G99 A;  4PSW B;  3C99 A;  5C2V B;  1NEX B;  3UKU C;  4ERQ A;  3DXM C;  5IC7 A;  2AH1 A;  2B5N A;  4GZ8 A;  4Y5R D;  2PM7 B;  2TRC B;  5EAP A;  2HYE A;  4LG8 A;  3GFC A;  2AGY A;  2HXC A;  2PBI B;  2Z2O A;  3W15 A;  2AGZ A;  1ERJ A;  2PM9 A;  1NR0 A;  5AJA A;  4CI3 A;  2HKM A;  4CY5 A;  3U4Y A;  4O9D A;  5HE0 B;  2OVP B;  3OL2 B;  5TEE A;  4L3G D;  3I7P A;  1GOT B;  5CXC B;  4QQE A;  4A11 A;  4MK0 B;  3CFV A;  4JSN C;  2H13 A;  5C2W B;  1K8K C;  4JSP C;  5H14 A;  4OWR A;  2OJY A;  3I7N A;  4BUJ C;  5AFU 3;  5IJ7 E;  1XKS A;  2BBK H;  3PVW B;  4JSX C;  5CXB A;  4A0A A;  4ZOY A;  4CI1 A;  1MDA H;  4X60 B;  4CZY A;  3NVN A;  3JRP A;  4JT6 C;  5I5I A;  5KDO B;  3I7K A;  2XL2 A;  5HE3 B;  2HJB A;  4J73 A;  1OLZ A;  4E5Z A;  5EML B;  4J0X A;  4TZ4 A;  2YNP A;  2HES X;  2Q7Q A;  2OK4 A;  1SHY B;  5HYN B;  4O3T B;  4FA4 D;  4PXW A;  2AQ5 A;  2EBS A;  4FHL A;  3SVW D;  4A2L A;  3RMZ D;  2HJ4 A;  3V9F A;  1PI6 A;  4J77 A;  4JSV C;  3PVU B;  4FAV D;  4PNK B;  4JXM A;  2AGL A;  4QT8 A;  3F3F A;  1U2V C;  3IKO A;  3MMY A;  2W18 A;  3SCY A;  3RN1 D;  3SWS D;  3AL8 B;  3SMR A;  2P9N C;  2I3S A;  5IJ8 E;  4GGC A;  3C75 H;  4J8G A;  3I2N A;  3UVK A;  5GSA A;  1FWX A;  4X3E A;  3JB9 L;  3CFS B;  4CZX A;  3NVX A;  3C9C A;  5EM2 B;  4A08 B;  4GQ2 P;  3E0C A;  2H6N A;  1N6D A;  2XL3 A;  3SHF A;  4ES0 A;  1QNI A;  3EWE A;  3MKQ A;  4A7J A;  5IGO A;  1N6F A;  4XEI C;  2O9K A;  3I7H A;  5K1C C;  4K3J B;  3EI4 A;  5THA A;  1N6E A;  4IMM A;  4E54 B;  3SLE D;  3BG0 A;  3B7F A;  3SFZ A;  2IUP A;  4G56 B;  3I8C A;  1SQJ A;  3JZN A;  2IUQ A;  3JZG A;  4A0B B;  1MG3 A;  3I89 A;  1SQ9 A;  4JT5 C;  2I3T A;  4N14 A;  2G9A A;  2GC4 A;  4OZU A;  2Z2N A;  4XYI A;  4BH6 A;  3IIW A;  4J81 A;  1Q47 A;  5EAR A;  2CN3 A;  3PSC B;  1MG2 A;  2AGX A;  2AH0 A;  3I8E A;  5HE2 B;  3IJ0 A;  1PBY B;  3JZH A;  1B9X A;  4U7A A;  2OVQ B;  2CO0 A;  4J79 A;  2QXV A;  4CY3 A;  3EI2 A;  5EMM B;  3ULE C;  4FA9 D;  2I0R A;  3F3P A;  4L9O A;  2MTA H;  2IWK A;  4ZOZ A;  2J56 H;  2IUR A;  3N0D A;  4JD2 C;  2HKR A;  4X61 B;  4J78 A;  2YNO A;  5CYK A;  2H9M A;  4QL1 A;  4L3H D;  3NVQ A;  3KRX B;  3RSE C;  1PGU A;  3FGB A;  2CE9 A;  2XU7 A;  5H1M A;  2H6K A;  1P22 A;  1U4C A;  2UZY B;  4R7A B;  3UR4 A;  3RFG A;  2PM9 B;  3JPX A;  2YMU A;  3L4M D;  3UKR C;  3AH8 B;  2P9L C;  3IJC A;  2B5M A;  4ZOX A;  3SXT D;  2AGW A;  1R5M A;  4A11 B;  3PSL A;  1OMW B;  2H47 A;  5GMK n;  2GNQ A;  4LGN A;  2YBA A;  3SBP A;  3AFC A;  3OKW A;  3FRX A;  2J57 G;  3J81 g;  5CXB B;  4A0A B;  3VGZ A;  1XIP A;  3OW8 A;  5FKT A;  3DXK C;  2P9U C;  3DSM A;  3PE7 A;  5GXI A;  5HQG A;  5C9Z B;  4ERZ A;  2GC7 A;  3KRW B;  3SJL D;  3K27 A;  4CI8 A; 
#chains in the Genus database with same CATH topology
 5C86 A;  4E5Z B;  4ZOV A;  3O4J A;  3EI3 A;  4GM9 A;  4J0W A;  4GM3 A;  3I7O A;  4WK4 A;  4PC0 A;  1H2X A;  5TDH B;  4JHP C;  2WQ8 A;  5AMS A;  5E6S A;  4A09 A;  1UOP A;  2UZX B;  4BCB A;  3PXS D;  1H2Y A;  4CC9 A;  1GXR A;  3DM0 A;  4J84 A;  4J82 A;  3EI1 A;  4FB1 D;  1PEV A;  3DWL C;  3OKY A;  4MMY A;  3NIF A;  4Z7N A;  3V4V A;  3OKT A;  2P9K C;  3SN6 B;  3KCI A;  1K32 A;  5E6U A;  5A2Q g;  4BP8 A;  4UM8 A;  3UVO A;  2OK6 A;  4Z7O A;  5FFG A;  4A2M A;  1VYH C;  1JMZ B;  4ESG A;  3J80 g;  1JJU B;  5FXY A;  4GM8 A;  4FA5 D;  4G1E A;  5M61 A;  1TYE A;  3EU7 A;  4L1M A;  4ERY A;  4EWR A;  1GP2 B;  4O1Q D;  3N0E A;  4XYH A;  3EI4 B;  1VZ2 A;  1JOF A;  2B4E A;  4YVD A;  2H9L A;  5EMK B;  2J55 H;  2VZ1 A;  3OL2 A;  3RN0 D;  4AOW A;  5CXC A;  2XYI A;  1RI6 A;  2XZG A;  3EMH A;  5SXM A;  3ZE2 A;  4J87 A;  3RFH A;  4HDJ A;  2P9S C;  4IRZ A;  4FAN D;  5I5J A;  3ORV D;  5FKR A;  3MZL A;  3MXX A;  4J8B A;  3IIY A;  3IUJ A;  2IUV A;  4O45 A;  5JWZ A;  5EAL A;  3K26 A;  2EID A;  3OTT A;  3EG6 A;  2I0T A;  3C5M A;  4I79 A;  4CZV A;  4WJK A;  1GG2 B;  2H9N A;  3T3M A;  2CE8 A;  5I5M A;  4O3U B;  5EAM A;  3ZWL B;  4BL0 A;  4NSX A;  5FFO A;  5C92 A;  3EI2 B;  2OVR B;  3JAM g;  2Z2P A;  3FCS A;  3MUN A;  1TYQ C;  1S4U X;  4D6V A;  4X63 B;  3MZK A;  4AN0 A;  3IUL A;  4K3I D;  4H5J A;  5CYK B;  5FLX g;  4J86 A;  3PXW D;  2QC5 A;  4U1E I;  4FWW A;  5M5T A;  3IJ1 A;  2HU8 A;  5B4W A;  2IAA A;  3O4H A;  4GGD A;  5TF2 A;  5HE1 B;  3SBQ A;  1TBG A;  2CNX A;  3L4O D;  3RRM C;  1JMX B;  2YNN A;  2VDP A;  3AL8 A;  3ODT A;  1L0Q A;  5IT9 g;  3SBR A;  2IWF A;  4AN1 A;  2HU7 A;  3GRE A;  3AL9 A;  5TEF A;  3I7L A;  3UVL A;  5GXH A;  4GMB A;  1A0R B;  2CN2 A;  5EMJ B;  5EM2 A;  4A08 A;  4GQB B;  1XHM A;  4CY2 A;  3BG1 A;  4IA9 A;  1H2W A;  3F3G A;  3K71 A;  4QAM A;  2H6Q A;  2OIZ A;  2PM6 B;  4PBZ A;  5K19 A;  3JRO A;  3IUN A;  5IGQ A;  4E54 A;  1YFQ A;  3VI4 A;  2H68 A;  3RLM D;  3UVM A;  4D9S A;  4H5I A;  4LG9 A;  1C9L A;  4DNV A;  2YB8 B;  2XDW A;  1E8N A;  1JV2 A;  3GD1 I;  4ZN4 A;  1VE6 A;  4CY1 A;  4GGA A;  4NC4 A;  4A0B A;  2QZP A;  1B9Y A;  4PBY A;  3EI3 B;  4MMX A;  5H17 A;  3BWS A;  1A12 A;  3HFQ A;  4CI2 A;  2H9P A;  3UVN A;  3MKS B;  2VDN A;  4D0K A;  3CIK B;  2CO0 C;  4QRJ A;  4FA1 D;  4GQ1 A;  4A09 B;  4UI9 R;  5FA5 B;  4AEZ A;  3V5W B;  2P9P C;  4KFM B;  4Y7R A;  3PXT D;  2P9I C;  3VH0 A;  1K3I A;  2H14 A;  3V7D B;  3P4F A;  4PSX B;  3EI1 B;  3K72 A;  4L1Q D;  5FQD A;  2H3X A;  2BCJ B;  4G55 A;  4Z8L A;  3NIG A;  3VA6 A;  2B5L A;  3OKY B;  3FM0 A;  2I0S A;  5FKQ A;  5FKS A;  3A0F A;  2G99 A;  4PSW B;  3C99 A;  5C2V B;  1NEX B;  3UKU C;  1GOG A;  4DNW A;  2EIC A;  4ERQ A;  3DXM C;  5IC7 A;  2AH1 A;  2B5N A;  4GZ8 A;  1T2X A;  4Y5R D;  2PM7 B;  2TRC B;  5EAP A;  2HYE A;  4LG8 A;  3GFC A;  2AGY A;  2HXC A;  2PBI B;  2Z2O A;  3W15 A;  2AGZ A;  1ERJ A;  2PM9 A;  1NR0 A;  5AJA A;  4CI3 A;  4G1M A;  2HKM A;  3OF7 A;  4CY5 A;  4O9D A;  3U4Y A;  3MUO A;  5HE0 B;  1E8M A;  2OVP B;  3DDU A;  3OL2 B;  5TEE A;  4L3G D;  3EQ8 A;  3I7P A;  1GOT B;  5CXC B;  1VE7 A;  4QQE A;  4A11 A;  4MK0 B;  3CFV A;  4JSN C;  2H13 A;  5C2W B;  1K8K C;  4JSP C;  5H14 A;  5M5R A;  2VDO A;  4OWR A;  4O2W A;  5M5S A;  2OJY A;  4MMZ A;  3I7N A;  4BUJ C;  5AFU 3;  5IJ7 E;  1XKS A;  2BBK H;  3PVW B;  4JSX C;  1VZ3 A;  5CXB A;  4A0A A;  4ZOY A;  1JTD B;  4CI1 A;  1MDA H;  4WK0 A;  4AMZ A;  4X60 B;  4CZY A;  1QFS A;  2BKL A;  3NVN A;  3JRP A;  4JT6 C;  2QR5 A;  5I5I A;  5M5U A;  5KDO B;  3I7K A;  2XL2 A;  5HE3 B;  2HJB A;  2EIB A;  4J73 A;  1OLZ A;  4E5Z A;  2VZ3 A;  5EML B;  4J0X A;  2HU5 A;  3NID A;  4WK2 A;  4NEN A;  4TZ4 A;  2YNP A;  3IUQ A;  2HES X;  1H2Z A;  2Q7Q A;  2OK4 A;  1SHY B;  5HYN B;  4O3T B;  3O4G A;  2VDR A;  4FA4 D;  4PXW A;  1YR2 A;  2AQ5 A;  2EBS A;  4FHL A;  3SVW D;  4A2L A;  3RMZ D;  2HJ4 A;  3V9F A;  1PI6 A;  4J77 A;  4JSV C;  3PVU B;  1BPO A;  4PNK B;  4JXM A;  4FAV D;  2AGL A;  3V4P A;  4QT8 A;  3F3F A;  1U2V C;  3IKO A;  3MMY A;  2W18 A;  3SCY A;  3RN1 D;  3VI3 A;  4O02 A;  3AL8 B;  3SMR A;  3SWS D;  2P9N C;  2I3S A;  5IJ8 E;  4GGC A;  3C75 H;  4J8G A;  5E6R A;  3I2N A;  3UVK A;  5GSA A;  1FWX A;  4X3E A;  3JB9 L;  4Z7Q A;  3CFS B;  4UM9 A;  4CZX A;  3NVX A;  3C9C A;  5EM2 B;  4A08 B;  4GQ2 P;  3E0C A;  4NBM A;  2H6N A;  1N6D A;  2XL3 A;  4NAA A;  3SHF A;  4ES0 A;  1QNI A;  3EWE A;  3MKQ A;  4A7J A;  5IGO A;  2XE4 A;  1N6F A;  4XEI C;  2O9K A;  3I7H A;  5K1C C;  3EI4 A;  4K3J B;  3EQ7 A;  1N6E A;  4IMM A;  5THA A;  4E54 B;  3SLE D;  3BG0 A;  3B7F A;  3O4I A;  3SFZ A;  2IUP A;  4G56 B;  3IVM A;  3I8C A;  1QFM A;  1SQJ A;  3JZN A;  2IUQ A;  1GOH A;  3FCU A;  3JZG A;  4BCD A;  4A0B B;  1MG3 A;  1UOO A;  1M1X A;  3I89 A;  1SQ9 A;  3ZDX A;  4JT5 C;  2I3T A;  4N14 A;  3IUR A;  2G9A A;  2GC4 A;  4OZU A;  2Z2N A;  3IJE A;  4XYI A;  3ZDZ A;  4BH6 A;  3IIW A;  4J81 A;  1Q47 A;  5EAR A;  2CN3 A;  3PSC B;  1MG2 A;  2AGX A;  3IUM A;  2AH0 A;  2VDM A;  3I8E A;  3GC3 B;  5HE2 B;  3IJ0 A;  1PBY B;  3JZH A;  1E5T A;  1B9X A;  4U7A A;  2OVQ B;  2CO0 A;  4J79 A;  2QXV A;  4CY3 A;  3QHY B;  4BCC A;  5EMM B;  3EI2 A;  3ULE C;  4FA9 D;  2I0R A;  3F3P A;  1O6G A;  4L9O A;  2MTA H;  2IWK A;  4ZOZ A;  3T3P A;  2J56 H;  3MVD K;  2IUR A;  3N0D A;  4JD2 C;  2HKR A;  4X61 B;  1GOF A;  4J78 A;  2YNO A;  5CYK A;  2H9M A;  4QL1 A;  4L3H D;  3NVQ A;  3KRX B;  3RSE C;  1PGU A;  3FGB A;  1C9I A;  2CE9 A;  2XU7 A;  2H6K A;  1P22 A;  1U4C A;  2UZY B;  4R7A B;  5H1M A;  3UR4 A;  3RFG A;  2PM9 B;  3JPX A;  4AX4 A;  5M5V A;  3ZDY A;  2YMU A;  3L4M D;  3UKR C;  3AH8 B;  1O6F A;  2P9L C;  3K6S A;  3IJC A;  2B5M A;  4ZOX A;  4BP9 A;  3ZE0 A;  2VDQ A;  3SXT D;  5HDB A;  2EIE A;  2AGW A;  1R5M A;  1UTC A;  3PSL A;  4A11 B;  1OMW B;  2H47 A;  4DNU A;  1I2M B;  4AMY A;  5GMK n;  4RE6 A;  2VC2 A;  3EQ9 A;  2GNQ A;  3QI0 A;  4LGN A;  3ZE1 A;  4RE5 A;  2YBA A;  3SBP A;  3AFC A;  3OKW A;  1UOQ A;  3FRX A;  2VDK A;  2J57 G;  3J81 g;  5CXB B;  4A0A B;  3VGZ A;  1XIP A;  2VDL A;  1L5G A;  3OW8 A;  4JHN A;  5FKT A;  3DXK C;  1U8C A;  2P9U C;  3DSM A;  3PE7 A;  5GXI A;  5HQG A;  5C9Z B;  4ERZ A;  2GC7 A;  3KRW B;  3SJL D;  3K27 A;  4CI8 A;  2JKX A; 
#chains in the Genus database with same CATH homology
 4E5Z B;  4ZOV A;  3EI3 A;  4GM9 A;  4J0W A;  4GM3 A;  3I7O A;  4PC0 A;  5TDH B;  5AMS A;  4A09 A;  2UZX B;  3PXS D;  4CC9 A;  1GXR A;  3DM0 A;  4J84 A;  4J82 A;  3EI1 A;  4FB1 D;  1PEV A;  3DWL C;  3OKY A;  3OKT A;  2P9K C;  3SN6 B;  1K32 A;  5A2Q g;  3UVO A;  2OK6 A;  4A2M A;  1VYH C;  1JMZ B;  4ESG A;  3J80 g;  1JJU B;  5FXY A;  4GM8 A;  4FA5 D;  3EU7 A;  4ERY A;  4EWR A;  1GP2 B;  4O1Q D;  3N0E A;  4XYH A;  3EI4 B;  1JOF A;  2B4E A;  4YVD A;  2H9L A;  5EMK B;  2J55 H;  3OL2 A;  3RN0 D;  4AOW A;  5CXC A;  2XYI A;  1RI6 A;  3EMH A;  5SXM A;  4J87 A;  3RFH A;  4HDJ A;  2P9S C;  4FAN D;  5I5J A;  3ORV D;  5FKR A;  3MZL A;  3MXX A;  4J8B A;  3IIY A;  2IUV A;  4O45 A;  5JWZ A;  5EAL A;  3K26 A;  3OTT A;  3EG6 A;  2I0T A;  3C5M A;  4I79 A;  4CZV A;  1GG2 B;  2H9N A;  2CE8 A;  5I5M A;  4O3U B;  5EAM A;  3ZWL B;  4BL0 A;  4NSX A;  3EI2 B;  2OVR B;  3JAM g;  2Z2P A;  1TYQ C;  1S4U X;  4D6V A;  4X63 B;  3MZK A;  4K3I D;  4H5J A;  5CYK B;  5FLX g;  4J86 A;  3PXW D;  2QC5 A;  4U1E I;  4FWW A;  3IJ1 A;  5B4W A;  2IAA A;  4GGD A;  5TF2 A;  5HE1 B;  3SBQ A;  1TBG A;  2CNX A;  3L4O D;  3RRM C;  1JMX B;  2YNN A;  3AL8 A;  3ODT A;  1L0Q A;  5IT9 g;  3SBR A;  2IWF A;  3GRE A;  3AL9 A;  5TEF A;  3I7L A;  3UVL A;  5GXH A;  4GMB A;  1A0R B;  2CN2 A;  5EMJ B;  5EM2 A;  4A08 A;  4GQB B;  1XHM A;  4CY2 A;  3BG1 A;  4IA9 A;  3F3G A;  2H6Q A;  2OIZ A;  2PM6 B;  4PBZ A;  5K19 A;  3JRO A;  5IGQ A;  4E54 A;  1YFQ A;  2H68 A;  3RLM D;  3UVM A;  4H5I A;  4LG9 A;  2YB8 B;  4ZN4 A;  4CY1 A;  4GGA A;  4A0B A;  1B9Y A;  4PBY A;  3EI3 B;  5H17 A;  3BWS A;  3HFQ A;  4CI2 A;  2H9P A;  3UVN A;  3MKS B;  4D0K A;  3CIK B;  2CO0 C;  4QRJ A;  4FA1 D;  4GQ1 A;  4A09 B;  4UI9 R;  5FA5 B;  4AEZ A;  3V5W B;  2P9P C;  4KFM B;  4Y7R A;  3PXT D;  2P9I C;  3VH0 A;  3V7D B;  2H14 A;  3P4F A;  4PSX B;  3EI1 B;  4L1Q D;  5FQD A;  2H3X A;  2BCJ B;  4Z8L A;  3VA6 A;  2B5L A;  3OKY B;  3FM0 A;  2I0S A;  5FKQ A;  5FKS A;  3A0F A;  2G99 A;  4PSW B;  3C99 A;  5C2V B;  1NEX B;  3UKU C;  4ERQ A;  3DXM C;  5IC7 A;  2AH1 A;  2B5N A;  4GZ8 A;  4Y5R D;  2PM7 B;  2TRC B;  5EAP A;  2HYE A;  4LG8 A;  3GFC A;  2AGY A;  2HXC A;  2PBI B;  2Z2O A;  3W15 A;  2AGZ A;  1ERJ A;  2PM9 A;  1NR0 A;  5AJA A;  4CI3 A;  2HKM A;  4CY5 A;  3U4Y A;  4O9D A;  5HE0 B;  2OVP B;  3OL2 B;  5TEE A;  4L3G D;  3I7P A;  1GOT B;  5CXC B;  4QQE A;  4A11 A;  4MK0 B;  3CFV A;  4JSN C;  2H13 A;  5C2W B;  1K8K C;  4JSP C;  5H14 A;  4OWR A;  2OJY A;  3I7N A;  4BUJ C;  5AFU 3;  5IJ7 E;  1XKS A;  2BBK H;  3PVW B;  4JSX C;  5CXB A;  4A0A A;  4ZOY A;  4CI1 A;  1MDA H;  4X60 B;  4CZY A;  3NVN A;  3JRP A;  4JT6 C;  5I5I A;  5KDO B;  3I7K A;  2XL2 A;  5HE3 B;  2HJB A;  4J73 A;  1OLZ A;  4E5Z A;  5EML B;  4J0X A;  4TZ4 A;  2YNP A;  2HES X;  2Q7Q A;  2OK4 A;  1SHY B;  5HYN B;  4O3T B;  4FA4 D;  4PXW A;  2AQ5 A;  2EBS A;  4FHL A;  3SVW D;  4A2L A;  3RMZ D;  2HJ4 A;  3V9F A;  1PI6 A;  4J77 A;  4JSV C;  3PVU B;  4FAV D;  4PNK B;  4JXM A;  2AGL A;  4QT8 A;  3F3F A;  1U2V C;  3IKO A;  3MMY A;  2W18 A;  3SCY A;  3RN1 D;  3SWS D;  3AL8 B;  3SMR A;  2P9N C;  2I3S A;  5IJ8 E;  4GGC A;  3C75 H;  4J8G A;  3I2N A;  3UVK A;  5GSA A;  1FWX A;  4X3E A;  3JB9 L;  3CFS B;  4CZX A;  3NVX A;  3C9C A;  5EM2 B;  4A08 B;  4GQ2 P;  3E0C A;  2H6N A;  1N6D A;  2XL3 A;  3SHF A;  4ES0 A;  1QNI A;  3EWE A;  3MKQ A;  4A7J A;  5IGO A;  1N6F A;  4XEI C;  2O9K A;  3I7H A;  5K1C C;  4K3J B;  3EI4 A;  5THA A;  1N6E A;  4IMM A;  4E54 B;  3SLE D;  3BG0 A;  3B7F A;  3SFZ A;  2IUP A;  4G56 B;  3I8C A;  1SQJ A;  3JZN A;  2IUQ A;  3JZG A;  4A0B B;  1MG3 A;  3I89 A;  1SQ9 A;  4JT5 C;  2I3T A;  4N14 A;  2G9A A;  2GC4 A;  4OZU A;  2Z2N A;  4XYI A;  4BH6 A;  3IIW A;  4J81 A;  1Q47 A;  5EAR A;  2CN3 A;  3PSC B;  1MG2 A;  2AGX A;  2AH0 A;  3I8E A;  5HE2 B;  3IJ0 A;  1PBY B;  3JZH A;  1B9X A;  4U7A A;  2OVQ B;  2CO0 A;  4J79 A;  2QXV A;  4CY3 A;  3EI2 A;  5EMM B;  3ULE C;  4FA9 D;  2I0R A;  3F3P A;  4L9O A;  2MTA H;  2IWK A;  4ZOZ A;  2J56 H;  2IUR A;  3N0D A;  4JD2 C;  2HKR A;  4X61 B;  4J78 A;  2YNO A;  5CYK A;  2H9M A;  4QL1 A;  4L3H D;  3NVQ A;  3KRX B;  3RSE C;  1PGU A;  3FGB A;  2CE9 A;  2XU7 A;  5H1M A;  2H6K A;  1P22 A;  1U4C A;  2UZY B;  4R7A B;  3UR4 A;  3RFG A;  2PM9 B;  3JPX A;  2YMU A;  3L4M D;  3UKR C;  3AH8 B;  2P9L C;  3IJC A;  2B5M A;  4ZOX A;  3SXT D;  2AGW A;  1R5M A;  4A11 B;  3PSL A;  1OMW B;  2H47 A;  5GMK n;  2GNQ A;  4LGN A;  2YBA A;  3SBP A;  3AFC A;  3OKW A;  3FRX A;  2J57 G;  3J81 g;  5CXB B;  4A0A B;  3VGZ A;  1XIP A;  3OW8 A;  5FKT A;  3DXK C;  2P9U C;  3DSM A;  3PE7 A;  5GXI A;  5HQG A;  5C9Z B;  4ERZ A;  2GC7 A;  3KRW B;  3SJL D;  3K27 A;  4CI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...