1YFQA

High resolution s. cerevisiae bub3 mitotic checkpoint protein
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
342
structure length
342
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cell cycle arrest protein BUB3
publication title The 1.1-a structure of the spindle checkpoint protein bub3p reveals functional regions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 77
structure length 342
sequence length 342
ec nomenclature
pdb deposition date 2005-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1yfqA00
2J57G 4A08B 3EI3B 1JMXB 4GMBA 1P22A 2PBIB 1XHMA 4FWWA 2IWKA 4E54B 2QXVA 4D0KA 4J84A 4A2LA 4CY2A 3BG1A 4A09B 3PVWB 4GZ8A 4ERZA 4FHLA 4JT6C 1MG3A 1JJUB 3VGZA 3C99A 2HJ4A 3EMHA 3AFCA 5IGOA 2B4EA 1L0QA 3JROA 4LG8A 2OK4A 3EI4A 4J8BA 3SLED 4CI1A 4GGAA 1N6DA 4PC0A 3F3FA 5KDOB 3SMRA 4CY5A 4U1EI 3OW8A 4H5IA 3OL2A 4XEIC 2J55H 3EI1B 5HE1B 4K3ID 5FA5B 2BBKH 3SHFA 4FB1D 4E5ZB 4JD2C 4EWRA 5AFU3 3JRPA 3K27A 3AL8A 2H3XA 4AEZA 4IMMA 4IA9A 2XU7A 2H68A 2UZYB 5FLXg 3VH0A 3DXKC 2AGXA 4GM9A 2OIZA 4J0XA 3NVQA 5HE3B 3JZGA 5EMMB 4JT5C 4G56B 4K3JB 4U7AA 2G99A 2H9PA 3VA6A 4BH6A 2CE9A 4O9DA 4GM8A 3CFSB 4JXMA 2B5LA 4O1QD 4HDJA 2AQ5A 3F3PA 1ERJA 4FA9D 3RRMC 4ESGA 4QT8A 5TEEA 3EI3A 2P9KC 4I79A 2B5MA 5GMKn 1QNIA 2CO0A 2HESX 3U4YA 4Z8LA 2AGLA 2G9AA 3EI2A 3A0FA 5FKRA 4A0AB 1RI6A 4PBYA 1MG2A 5H14A 2PM6B 4MK0B 2HJBA 2HKRA 3NVXA 4XYHA 3MZKA 3EG6A 5CYKA 3I7NA 3IJCA 3MZLA 4A0BA 2H6NA 2O9KA 4OZUA 4GGCA 2I0SA 3MKSB 4A11B 5TDHB 3DM0A 3J81g 4J79A 5EMKB 1PBYB 3SFZA 1GG2B 3IIYA 4J0WA 3UR4A 4N14A 2UZXB 3RSEC 4J82A 3RFHA 2H9NA 4J78A 4E5ZA 3RLMD 5IT9g 3PXTD 4PNKB 5CXCA 2Z2NA 1NEXB 1JOFA 3OKWA 3C5MA 4NSXA 4CZVA 3ORVD 3J80g 3JPXA 1GOTB 4FA5D 3KRXB 5K19A 2CO0C 3ZWLB 3GFCA 5C2WB 4GM3A 5B4WA 5CXBB 4O45A 2OK6A 5TF2A 4FA4D 2OVPB 5HE2B 3JZNA 2AGWA 3I89A 5EM2A 3CFVA 1SQJA 3UVMA 3JZHA 5GXHA 2IUQA 3MXXA 3SVWD 3OKYB 4CI8A 4ZOZA 4Y5RD 3KRWB 2HKMA 1K8KC 2GNQA 3IIWA 3RN1D 3PSCB 2I0TA 4ERYA 4L3HD 1XKSA 3C9CA 3OKTA 3AH8B 2CE8A 2PM9B 3OTTA 3SBPA 4CI3A 2GC7A 2I3TA 4X3EA 2H9MA 3PXSD 3I7LA 4XYIA 5AMSA 1FWXA 4J77A 3B7FA 3I7KA 1PEVA 5GXIA 4R7AB 3EWEA 5I5JA 3UKRC 3HFQA 5THAA 3W15A 5TEFA 1VYHC 3DXMC 3K26A 2XYIA 4A08A 3JAMg 3IJ0A 4YVDA 5EARA 2CN2A 3BWSA 4D6VA 4E54A 3I7OA 3EI4B 3SBRA 4A09A 2Z2OA 1U4CA 2XL2A 4PSWB 2J56H 4X61B 2GC4A 2AH1A 1JMZB 2P9NC 3UVLA 5IJ8E 4CI2A 3ULEC 4X63B 4AOWA 4CC9A 3CIKB 2W18A 5K1CC 1B9YA 3PVUB 4ZOVA 2TRCB 2YMUA 1NR0A 3AL8B 4QL1A 1SHYB 1PI6A 5AJAA 4TZ4A 3MMYA 1K32A 4O3UB 4ZOXA 4JSNC 5FKQA 3JB9L 2OVRB 3EI1A 4L3GD 3AL9A 3ODTA 1U2VC 1B9XA 3PSLA 3FM0A 4BL0A 2P9PC 4A2MA 3L4OD 4L1QD 2CN3A 1GP2B 3BG0A 2Z2PA 4FA1D 4JSPC 4GQBB 5EMJB 3EU7A 5GSAA 2B5NA 4OWRA 2HXCA 3L4MD 5C2VB 2AGYA 5H17A 3FGBA 2YNOA 2H47A 3EI2B 4QRJA 2I3SA 2H14A 4UI9R 4LG9A 2IUVA 2XL3A 1S4UX 1MDAH 3IJ1A 3SCYA 4BUJC 2BCJB 4CY3A 3IKOA 4ES0A 3V7DB 4PSXB 3RFGA 4CZYA 5CYKB 4J87A 5EAMA 3E0CA 5HQGA 5HYNB 4A0BB 3PE7A 3SWSD 1YFQA 4ZN4A 2IURA 4O3TB 1N6EA 1TYQC 1TBGA 4A0AA 3UVOA 2AGZA 5FKSA 2IUPA 4ERQA 4PXWA 3V9FA 2H6KA 5IGQA 2IWFA 5I5MA 3I2NA 4A7JA 1R5MA 4Y7RA 3RN0D 5I5IA 3DWLC 2CNXA 3C75H 2P9UC 5CXCB 4J86A 1Q47A 4GGDA 4ZOYA 4L9OA 5IC7A 3V5WB 2QC5A 4A11A 2P9LC 2AH0A 4CY1A 2HYEA 5HE0B 4H5JA 5IJ7E 3MKQA 3SJLD 4JSXC 3SXTD 3PXWD 3DSMA 3I7HA 5FQDA 4FAND 2P9SC 5EM2B 1OLZA 4X60B 5SXMA 2H6QA 2H13A 2YNPA 1PGUA 3OL2B 4LGNA 2EBSA 2IAAA 2YB8B 1A0RB 1XIPA 4J73A 5EAPA 5CXBA 2YBAA 4J81A 3UVNA 3F3GA 5A2Qg 2H9LA 1OMWB 5JWZA 2MTAH 3SN6B 3I8EA 3NVNA 4KFMB 3RMZD 3SBQA 1SQ9A 3GREA 3I8CA 2OVQB 2OJYA 4QQEA 1GXRA 2PM7B 4PBZA 5FXYA 3FRXA 3OKYA 2P9IC 4FAVD 5EMLB 4GQ1A 3UKUC 4GQ2P 5H1MA 3UVKA 5C9ZB 2YNNA 3N0EA 2Q7QA 4J8GA 1N6FA 4JSVC 3I7PA 3P4FA 2I0RA 5EALA 3N0DA 5FKTA 4CZXA 2PM9A
chains in the Genus database with same CATH superfamily
1JV2A 5M5UA 2J57G 4A08B 4Z7NA 3EI3B 1JMXB 1I2MB 4GMBA 1P22A 2PBIB 3NIDA 1XHMA 4FWWA 4NAAA 5E6SA 2IWKA 5FFGA 4E54B 2QXVA 4D0KA 4J84A 4A2LA 4CY2A 3BG1A 4A09B 3PVWB 4GZ8A 4ERZA 4FHLA 4JT6C 5M61A 1MG3A 1JJUB 3O4HA 3VGZA 2EIDA 3C99A 2HJ4A 3EMHA 3AFCA 5IGOA 5M5SA 4BP8A 2B4EA 1O6FA 1L0QA 3JROA 3QI0A 4LG8A 2EIBA 2OK4A 3EI4A 4J8BA 3SLED 4CI1A 4GGAA 1N6DA 4PC0A 3F3FA 3O4JA 5KDOB 3SMRA 1C9LA 4CY5A 4U1EI 3OW8A 4H5IA 4O2WA 3OL2A 4XEIC 2J55H 3EI1B 5HE1B 4K3ID 5FA5B 2BBKH 3SHFA 4FB1D 4E5ZB 4JD2C 4EWRA 1VZ3A 5AFU3 3JRPA 3K27A 4WK4A 3AL8A 2H3XA 2HU5A 4AEZA 4IMMA 4IA9A 2XU7A 2H68A 2UZYB 5FLXg 3VH0A 3DXKC 2AGXA 4GM9A 2OIZA 1QFMA 4J0XA 3NVQA 5HE3B 3JZGA 2XE4A 5EMMB 4JT5C 4G56B 1VE7A 1K3IA 2G99A 1UTCA 2H9PA 3IVMA 4K3JB 4U7AA 3VA6A 3ZE1A 4BH6A 2CE9A 4O9DA 4DNUA 4GM8A 3CFSB 4JXMA 2B5LA 4O1QD 4HDJA 2AQ5A 3F3PA 4Z7OA 1ERJA 3K72A 1H2XA 4FA9D 2HU7A 3RRMC 4ESGA 4QT8A 5TEEA 5E6UA 3EI3A 2P9KC 3ZDZA 4I79A 2B5MA 4BP9A 5GMKn 1QNIA 2CO0A 2HESX 3U4YA 4Z8LA 2AGLA 2G9AA 3EI2A 3A0FA 5FKRA 4A0AB 1RI6A 4Z7QA 4PBYA 1MG2A 3O4GA 1A12A 5H14A 4QAMA 2PM6B 3O4IA 4MK0B 2HJBA 3DDUA 2HKRA 3NVXA 4XYHA 1YR2A 3MZKA 3EG6A 5CYKA 4JHNA 3I7NA 3IJCA 3MZLA 3MVDK 1E5TA 4A0BA 2H6NA 2O9KA 3FCUA 4OZUA 4GGCA 2I0SA 3MKSB 1GOGA 4MMXA 4A11B 5TDHB 3DM0A 3J81g 4J79A 5EMKB 1PBYB 3SFZA 1GG2B 3IIYA 4D9SA 5FFOA 4J0WA 3UR4A 3ZDXA 1M1XA 3EQ7A 4N14A 2UZXB 3RSEC 4J82A 3RFHA 3EQ8A 2H9NA 4J78A 1VZ2A 4E5ZA 4UM8A 1GOFA 3T3MA 3RLMD 5IT9g 3PXTD 4PNKB 5CXCA 2Z2NA 4DNVA 1NEXB 1JOFA 3OKWA 3C5MA 3NIFA 4NSXA 4CZVA 3ORVD 3J80g 3JPXA 1GOTB 4FA5D 3KRXB 3VI3A 5K19A 3IULA 2CO0C 3ZWLB 3GFCA 4AN1A 5C2WB 4GM3A 3GD1I 5B4WA 5CXBB 4O45A 2OK6A 5TF2A 4FA4D 2OVPB 5HE2B 3JZNA 2AGWA 3I89A 5EM2A 3CFVA 1SQJA 2WQ8A 4RE5A 5M5RA 3UVMA 4NENA 3JZHA 5GXHA 1O6GA 3K6SA 2XDWA 2IUQA 3MXXA 3SVWD 3OKYB 4RE6A 4CI8A 4ZOZA 4Y5RD 3KRWB 2HKMA 4BCBA 3IIWA 1GOHA 1H2YA 1K8KC 2GNQA 1UOQA 3RN1D 3PSCB 2BKLA 2I0TA 4ERYA 3QHYB 4L3HD 4UM9A 1XKSA 3C9CA 3OKTA 3AH8B 2CE8A 2PM9B 3OTTA 3SBPA 4CI3A 2GC7A 2EIEA 5C92A 2I3TA 4WK2A 4X3EA 2H9MA 4AX4A 1UOOA 3PXSD 1H2ZA 3I7LA 4XYIA 2VDOA 5AMSA 5M5TA 1FWXA 2VDMA 4J77A 3B7FA 3I7KA 1PEVA 5GXIA 4R7AB 3EWEA 5I5JA 3UKRC 3HFQA 5THAA 1UOPA 5TEFA 5E6RA 3W15A 1VYHC 3DXMC 3IUNA 3K26A 3ZDYA 2XYIA 4A08A 3JAMg 4NBMA 3IJ0A 4YVDA 5EARA 2CN2A 3NIGA 3BWSA 2VDRA 4D6VA 4E54A 3I7OA 3EI4B 3SBRA 4A09A 2Z2OA 1U4CA 2XL2A 4G1MA 4PSWB 2J56H 4X61B 2GC4A 2AH1A 1JMZB 2P9NC 3UVLA 5IJ8E 1QFSA 4CI2A 3ULEC 4AMYA 4X63B 4AOWA 4CC9A 3CIKB 2W18A 5K1CC 1B9YA 3PVUB 4ZOVA 1TYEA 2TRCB 2YMUA 1NR0A 3AL8B 4QL1A 4MMYA 1SHYB 1PI6A 5AJAA 4TZ4A 1E8MA 3MMYA 1K32A 4O3UB 4ZOXA 4JSNC 5FKQA 3JB9L 2OVRB 3EI1A 4L3GD 3MUNA 3AL9A 3ODTA 1U2VC 1B9XA 3PSLA 3FM0A 4BL0A 2P9PC 4A2MA 1U8CA 3L4OD 4L1QD 2CN3A 1GP2B 4DNWA 3BG0A 2Z2PA 4FA1D 4JSPC 2JKXA 4GQBB 5EMJB 3V4VA 3EU7A 5GSAA 3OF7A 2B5NA 4OWRA 2QZPA 2HXCA 3L4MD 5C2VB 4O02A 2AGYA 4WJKA 5H17A 2VDLA 3FGBA 2YNOA 2H47A 5C86A 3EI2B 4QRJA 2I3SA 2H14A 2VDQA 4UI9R 4LG9A 2IUVA 3T3PA 4G55A 2XL3A 1S4UX 1MDAH 3IJ1A 3SCYA 4BUJC 2BCJB 3IJEA 4CY3A 3IKOA 4ES0A 3V7DB 4PSXB 3RFGA 4CZYA 5CYKB 4J87A 5EAMA 3E0CA 2QR5A 5HQGA 3EQ9A 5HYNB 4A0BB 3PE7A 3SWSD 1YFQA 4ZN4A 2IURA 4O3TB 1N6EA 1TYQC 1TBGA 3IUQA 4A0AA 3UVOA 4IRZA 2AGZA 3V4PA 5FKSA 2IUPA 4ERQA 3GC3B 2VC2A 4PXWA 3V9FA 2H6KA 5IGQA 1H2WA 2IWFA 2EICA 5I5MA 3I2NA 4A7JA 1R5MA 4Y7RA 3RN0D 5I5IA 3DWLC 2CNXA 3C75H 2P9UC 5CXCB 4JHPC 4J86A 1Q47A 1E8NA 4GGDA 4ZOYA 4L9OA 5IC7A 3V5WB 4G1EA 2QC5A 4A11A 3IUJA 2VZ1A 3ZE0A 2P9LC 2AH0A 4CY1A 2HYEA 4AMZA 5HE0B 4H5JA 5IJ7E 3MKQA 4AN0A 5M5VA 3SJLD 4JSXC 4BCDA 4L1MA 3PXWD 4MMZA 3SXTD 3DSMA 3I7HA 5FQDA 2HU8A 2XZGA 4FAND 2P9SC 3KCIA 5EM2B 1T2XA 3K71A 1OLZA 1BPOA 4X60B 5SXMA 2H6QA 2H13A 2YNPA 1PGUA 3OL2B 4LGNA 3FCSA 2EBSA 2IAAA 2YB8B 1A0RB 1XIPA 4J73A 5EAPA 5CXBA 2YBAA 4J81A 3UVNA 3F3GA 3IURA 5A2Qg 2H9LA 1OMWB 5JWZA 2MTAH 3SN6B 3I8EA 2VDNA 3NVNA 4KFMB 4NC4A 3RMZD 1C9IA 3SBQA 3IUMA 1SQ9A 3GREA 1L5GA 3I8CA 2OVQB 2OJYA 4QQEA 1GXRA 2PM7B 1VE6A 4PBZA 5FXYA 3FRXA 4BCCA 3OKYA 2P9IC 4FAVD 1JTDB 5EMLB 4GQ1A 2VDKA 3UKUC 3ZE2A 4GQ2P 5H1MA 4WK0A 3MUOA 3UVKA 5C9ZB 2VDPA 2YNNA 3VI4A 2VZ3A 3N0EA 2Q7QA 4J8GA 1N6FA 4JSVC 3I7PA 3P4FA 2I0RA 5EALA 3N0DA 5FKTA 4CZXA 2PM9A 5HDBA
chains in the Genus database with same CATH topology
2J57G 4A08B 3EI3B 1JMXB 4GMBA 1P22A 2PBIB 1XHMA 4FWWA 2IWKA 4E54B 2QXVA 4D0KA 4J84A 4A2LA 4CY2A 3BG1A 4A09B 3PVWB 4GZ8A 4ERZA 4FHLA 4JT6C 1MG3A 1JJUB 3VGZA 3C99A 2HJ4A 3EMHA 3AFCA 5IGOA 2B4EA 1L0QA 3JROA 4LG8A 2OK4A 3EI4A 4J8BA 3SLED 4CI1A 4GGAA 1N6DA 4PC0A 3F3FA 5KDOB 3SMRA 4CY5A 4U1EI 3OW8A 4H5IA 3OL2A 4XEIC 2J55H 3EI1B 5HE1B 4K3ID 5FA5B 2BBKH 3SHFA 4FB1D 4E5ZB 4JD2C 4EWRA 5AFU3 3JRPA 3K27A 3AL8A 2H3XA 4AEZA 4IMMA 4IA9A 2XU7A 2H68A 2UZYB 5FLXg 3VH0A 3DXKC 2AGXA 4GM9A 2OIZA 4J0XA 3NVQA 5HE3B 3JZGA 5EMMB 4JT5C 4G56B 4K3JB 4U7AA 2G99A 2H9PA 3VA6A 4BH6A 2CE9A 4O9DA 4GM8A 3CFSB 4JXMA 2B5LA 4O1QD 4HDJA 2AQ5A 3F3PA 1ERJA 4FA9D 3RRMC 4ESGA 4QT8A 5TEEA 3EI3A 2P9KC 4I79A 2B5MA 5GMKn 1QNIA 2CO0A 2HESX 3U4YA 4Z8LA 2AGLA 2G9AA 3EI2A 3A0FA 5FKRA 4A0AB 1RI6A 4PBYA 1MG2A 5H14A 2PM6B 4MK0B 2HJBA 2HKRA 3NVXA 4XYHA 3MZKA 3EG6A 5CYKA 3I7NA 3IJCA 3MZLA 4A0BA 2H6NA 2O9KA 4OZUA 4GGCA 2I0SA 3MKSB 4A11B 5TDHB 3DM0A 3J81g 4J79A 5EMKB 1PBYB 3SFZA 1GG2B 3IIYA 4J0WA 3UR4A 4N14A 2UZXB 3RSEC 4J82A 3RFHA 2H9NA 4J78A 4E5ZA 3RLMD 5IT9g 3PXTD 4PNKB 5CXCA 2Z2NA 1NEXB 1JOFA 3OKWA 3C5MA 4NSXA 4CZVA 3ORVD 3J80g 3JPXA 1GOTB 4FA5D 3KRXB 5K19A 2CO0C 3ZWLB 3GFCA 5C2WB 4GM3A 5B4WA 5CXBB 4O45A 2OK6A 5TF2A 4FA4D 2OVPB 5HE2B 3JZNA 2AGWA 3I89A 5EM2A 3CFVA 1SQJA 3UVMA 3JZHA 5GXHA 2IUQA 3MXXA 3SVWD 3OKYB 4CI8A 4ZOZA 4Y5RD 3KRWB 2HKMA 1K8KC 2GNQA 3IIWA 3RN1D 3PSCB 2I0TA 4ERYA 4L3HD 1XKSA 3C9CA 3OKTA 3AH8B 2CE8A 2PM9B 3OTTA 3SBPA 4CI3A 2GC7A 2I3TA 4X3EA 2H9MA 3PXSD 3I7LA 4XYIA 5AMSA 1FWXA 4J77A 3B7FA 3I7KA 1PEVA 5GXIA 4R7AB 3EWEA 5I5JA 3UKRC 3HFQA 5THAA 3W15A 5TEFA 1VYHC 3DXMC 3K26A 2XYIA 4A08A 3JAMg 3IJ0A 4YVDA 5EARA 2CN2A 3BWSA 4D6VA 4E54A 3I7OA 3EI4B 3SBRA 4A09A 2Z2OA 1U4CA 2XL2A 4PSWB 2J56H 4X61B 2GC4A 2AH1A 1JMZB 2P9NC 3UVLA 5IJ8E 4CI2A 3ULEC 4X63B 4AOWA 4CC9A 3CIKB 2W18A 5K1CC 1B9YA 3PVUB 4ZOVA 2TRCB 2YMUA 1NR0A 3AL8B 4QL1A 1SHYB 1PI6A 5AJAA 4TZ4A 3MMYA 1K32A 4O3UB 4ZOXA 4JSNC 5FKQA 3JB9L 2OVRB 3EI1A 4L3GD 3AL9A 3ODTA 1U2VC 1B9XA 3PSLA 3FM0A 4BL0A 2P9PC 4A2MA 3L4OD 4L1QD 2CN3A 1GP2B 3BG0A 2Z2PA 4FA1D 4JSPC 4GQBB 5EMJB 3EU7A 5GSAA 2B5NA 4OWRA 2HXCA 3L4MD 5C2VB 2AGYA 5H17A 3FGBA 2YNOA 2H47A 3EI2B 4QRJA 2I3SA 2H14A 4UI9R 4LG9A 2IUVA 2XL3A 1S4UX 1MDAH 3IJ1A 3SCYA 4BUJC 2BCJB 4CY3A 3IKOA 4ES0A 3V7DB 4PSXB 3RFGA 4CZYA 5CYKB 4J87A 5EAMA 3E0CA 5HQGA 5HYNB 4A0BB 3PE7A 3SWSD 1YFQA 4ZN4A 2IURA 4O3TB 1N6EA 1TYQC 1TBGA 4A0AA 3UVOA 2AGZA 5FKSA 2IUPA 4ERQA 4PXWA 3V9FA 2H6KA 5IGQA 2IWFA 5I5MA 3I2NA 4A7JA 1R5MA 4Y7RA 3RN0D 5I5IA 3DWLC 2CNXA 3C75H 2P9UC 5CXCB 4J86A 1Q47A 4GGDA 4ZOYA 4L9OA 5IC7A 3V5WB 2QC5A 4A11A 2P9LC 2AH0A 4CY1A 2HYEA 5HE0B 4H5JA 5IJ7E 3MKQA 3SJLD 4JSXC 3SXTD 3PXWD 3DSMA 3I7HA 5FQDA 4FAND 2P9SC 5EM2B 1OLZA 4X60B 5SXMA 2H6QA 2H13A 2YNPA 1PGUA 3OL2B 4LGNA 2EBSA 2IAAA 2YB8B 1A0RB 1XIPA 4J73A 5EAPA 5CXBA 2YBAA 4J81A 3UVNA 3F3GA 5A2Qg 2H9LA 1OMWB 5JWZA 2MTAH 3SN6B 3I8EA 3NVNA 4KFMB 3RMZD 3SBQA 1SQ9A 3GREA 3I8CA 2OVQB 2OJYA 4QQEA 1GXRA 2PM7B 4PBZA 5FXYA 3FRXA 3OKYA 2P9IC 4FAVD 5EMLB 4GQ1A 3UKUC 4GQ2P 5H1MA 3UVKA 5C9ZB 2YNNA 3N0EA 2Q7QA 4J8GA 1N6FA 4JSVC 3I7PA 3P4FA 2I0RA 5EALA 3N0DA 5FKTA 4CZXA 2PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J57 G;  4A08 B;  3EI3 B;  1JMX B;  4GMB A;  1P22 A;  2PBI B;  1XHM A;  4FWW A;  2IWK A;  4E54 B;  2QXV A;  4D0K A;  4J84 A;  4A2L A;  4CY2 A;  3BG1 A;  4A09 B;  3PVW B;  4GZ8 A;  4ERZ A;  4FHL A;  4JT6 C;  1MG3 A;  1JJU B;  3VGZ A;  3C99 A;  2HJ4 A;  3EMH A;  3AFC A;  5IGO A;  2B4E A;  1L0Q A;  3JRO A;  4LG8 A;  2OK4 A;  3EI4 A;  4J8B A;  3SLE D;  4CI1 A;  4GGA A;  1N6D A;  4PC0 A;  3F3F A;  5KDO B;  3SMR A;  4CY5 A;  4U1E I;  3OW8 A;  4H5I A;  3OL2 A;  4XEI C;  2J55 H;  3EI1 B;  5HE1 B;  4K3I D;  5FA5 B;  2BBK H;  3SHF A;  4FB1 D;  4E5Z B;  4JD2 C;  4EWR A;  5AFU 3;  3JRP A;  3K27 A;  3AL8 A;  2H3X A;  4AEZ A;  4IMM A;  4IA9 A;  2XU7 A;  2H68 A;  2UZY B;  5FLX g;  3VH0 A;  3DXK C;  2AGX A;  4GM9 A;  2OIZ A;  4J0X A;  3NVQ A;  5HE3 B;  3JZG A;  5EMM B;  4JT5 C;  4G56 B;  4K3J B;  4U7A A;  2G99 A;  2H9P A;  3VA6 A;  4BH6 A;  2CE9 A;  4O9D A;  4GM8 A;  3CFS B;  4JXM A;  2B5L A;  4O1Q D;  4HDJ A;  2AQ5 A;  3F3P A;  1ERJ A;  4FA9 D;  3RRM C;  4ESG A;  4QT8 A;  5TEE A;  3EI3 A;  2P9K C;  4I79 A;  2B5M A;  5GMK n;  1QNI A;  2CO0 A;  2HES X;  3U4Y A;  4Z8L A;  2AGL A;  2G9A A;  3EI2 A;  3A0F A;  5FKR A;  4A0A B;  1RI6 A;  4PBY A;  1MG2 A;  5H14 A;  2PM6 B;  4MK0 B;  2HJB A;  2HKR A;  3NVX A;  4XYH A;  3MZK A;  3EG6 A;  5CYK A;  3I7N A;  3IJC A;  3MZL A;  4A0B A;  2H6N A;  2O9K A;  4OZU A;  4GGC A;  2I0S A;  3MKS B;  4A11 B;  5TDH B;  3DM0 A;  3J81 g;  4J79 A;  5EMK B;  1PBY B;  3SFZ A;  1GG2 B;  3IIY A;  4J0W A;  3UR4 A;  4N14 A;  2UZX B;  3RSE C;  4J82 A;  3RFH A;  2H9N A;  4J78 A;  4E5Z A;  3RLM D;  5IT9 g;  3PXT D;  4PNK B;  5CXC A;  2Z2N A;  1NEX B;  1JOF A;  3OKW A;  3C5M A;  4NSX A;  4CZV A;  3ORV D;  3J80 g;  3JPX A;  1GOT B;  4FA5 D;  3KRX B;  5K19 A;  2CO0 C;  3ZWL B;  3GFC A;  5C2W B;  4GM3 A;  5B4W A;  5CXB B;  4O45 A;  2OK6 A;  5TF2 A;  4FA4 D;  2OVP B;  5HE2 B;  3JZN A;  2AGW A;  3I89 A;  5EM2 A;  3CFV A;  1SQJ A;  3UVM A;  3JZH A;  5GXH A;  2IUQ A;  3MXX A;  3SVW D;  3OKY B;  4CI8 A;  4ZOZ A;  4Y5R D;  3KRW B;  2HKM A;  1K8K C;  2GNQ A;  3IIW A;  3RN1 D;  3PSC B;  2I0T A;  4ERY A;  4L3H D;  1XKS A;  3C9C A;  3OKT A;  3AH8 B;  2CE8 A;  2PM9 B;  3OTT A;  3SBP A;  4CI3 A;  2GC7 A;  2I3T A;  4X3E A;  2H9M A;  3PXS D;  3I7L A;  4XYI A;  5AMS A;  1FWX A;  4J77 A;  3B7F A;  3I7K A;  1PEV A;  5GXI A;  4R7A B;  3EWE A;  5I5J A;  3UKR C;  3HFQ A;  5THA A;  3W15 A;  5TEF A;  1VYH C;  3DXM C;  3K26 A;  2XYI A;  4A08 A;  3JAM g;  3IJ0 A;  4YVD A;  5EAR A;  2CN2 A;  3BWS A;  4D6V A;  4E54 A;  3I7O A;  3EI4 B;  3SBR A;  4A09 A;  2Z2O A;  1U4C A;  2XL2 A;  4PSW B;  2J56 H;  4X61 B;  2GC4 A;  2AH1 A;  1JMZ B;  2P9N C;  3UVL A;  5IJ8 E;  4CI2 A;  3ULE C;  4X63 B;  4AOW A;  4CC9 A;  3CIK B;  2W18 A;  5K1C C;  1B9Y A;  3PVU B;  4ZOV A;  2TRC B;  2YMU A;  1NR0 A;  3AL8 B;  4QL1 A;  1SHY B;  1PI6 A;  5AJA A;  4TZ4 A;  3MMY A;  1K32 A;  4O3U B;  4ZOX A;  4JSN C;  5FKQ A;  3JB9 L;  2OVR B;  3EI1 A;  4L3G D;  3AL9 A;  3ODT A;  1U2V C;  1B9X A;  3PSL A;  3FM0 A;  4BL0 A;  2P9P C;  4A2M A;  3L4O D;  4L1Q D;  2CN3 A;  1GP2 B;  3BG0 A;  2Z2P A;  4FA1 D;  4JSP C;  4GQB B;  5EMJ B;  3EU7 A;  5GSA A;  2B5N A;  4OWR A;  2HXC A;  3L4M D;  5C2V B;  2AGY A;  5H17 A;  3FGB A;  2YNO A;  2H47 A;  3EI2 B;  4QRJ A;  2I3S A;  2H14 A;  4UI9 R;  4LG9 A;  2IUV A;  2XL3 A;  1S4U X;  1MDA H;  3IJ1 A;  3SCY A;  4BUJ C;  2BCJ B;  4CY3 A;  3IKO A;  4ES0 A;  3V7D B;  4PSX B;  3RFG A;  4CZY A;  5CYK B;  4J87 A;  5EAM A;  3E0C A;  5HQG A;  5HYN B;  4A0B B;  3PE7 A;  3SWS D;  1YFQ A;  4ZN4 A;  2IUR A;  4O3T B;  1N6E A;  1TYQ C;  1TBG A;  4A0A A;  3UVO A;  2AGZ A;  5FKS A;  2IUP A;  4ERQ A;  4PXW A;  3V9F A;  2H6K A;  5IGQ A;  2IWF A;  5I5M A;  3I2N A;  4A7J A;  1R5M A;  4Y7R A;  3RN0 D;  5I5I A;  3DWL C;  2CNX A;  3C75 H;  2P9U C;  5CXC B;  4J86 A;  1Q47 A;  4GGD A;  4ZOY A;  4L9O A;  5IC7 A;  3V5W B;  2QC5 A;  4A11 A;  2P9L C;  2AH0 A;  4CY1 A;  2HYE A;  5HE0 B;  4H5J A;  5IJ7 E;  3MKQ A;  3SJL D;  4JSX C;  3SXT D;  3PXW D;  3DSM A;  3I7H A;  5FQD A;  4FAN D;  2P9S C;  5EM2 B;  1OLZ A;  4X60 B;  5SXM A;  2H6Q A;  2H13 A;  2YNP A;  1PGU A;  3OL2 B;  4LGN A;  2EBS A;  2IAA A;  2YB8 B;  1A0R B;  1XIP A;  4J73 A;  5EAP A;  5CXB A;  2YBA A;  4J81 A;  3UVN A;  3F3G A;  5A2Q g;  2H9L A;  1OMW B;  5JWZ A;  2MTA H;  3SN6 B;  3I8E A;  3NVN A;  4KFM B;  3RMZ D;  3SBQ A;  1SQ9 A;  3GRE A;  3I8C A;  2OVQ B;  2OJY A;  4QQE A;  1GXR A;  2PM7 B;  4PBZ A;  5FXY A;  3FRX A;  3OKY A;  2P9I C;  4FAV D;  5EML B;  4GQ1 A;  3UKU C;  4GQ2 P;  5H1M A;  3UVK A;  5C9Z B;  2YNN A;  3N0E A;  2Q7Q A;  4J8G A;  1N6F A;  4JSV C;  3I7P A;  3P4F A;  2I0R A;  5EAL A;  3N0D A;  5FKT A;  4CZX A;  2PM9 A; 
#chains in the Genus database with same CATH topology
 1JV2 A;  5M5U A;  2J57 G;  4A08 B;  4Z7N A;  3EI3 B;  1JMX B;  1I2M B;  4GMB A;  1P22 A;  2PBI B;  3NID A;  1XHM A;  4FWW A;  4NAA A;  5E6S A;  2IWK A;  5FFG A;  4E54 B;  2QXV A;  4D0K A;  4J84 A;  4A2L A;  4CY2 A;  3BG1 A;  4A09 B;  3PVW B;  4GZ8 A;  4ERZ A;  4FHL A;  4JT6 C;  5M61 A;  1MG3 A;  1JJU B;  3O4H A;  3VGZ A;  2EID A;  3C99 A;  2HJ4 A;  3EMH A;  3AFC A;  5IGO A;  5M5S A;  4BP8 A;  2B4E A;  1O6F A;  1L0Q A;  3JRO A;  3QI0 A;  4LG8 A;  2EIB A;  2OK4 A;  3EI4 A;  4J8B A;  3SLE D;  4CI1 A;  4GGA A;  1N6D A;  4PC0 A;  3F3F A;  3O4J A;  5KDO B;  3SMR A;  1C9L A;  4CY5 A;  4U1E I;  3OW8 A;  4H5I A;  4O2W A;  3OL2 A;  4XEI C;  2J55 H;  3EI1 B;  5HE1 B;  4K3I D;  5FA5 B;  2BBK H;  3SHF A;  4FB1 D;  4E5Z B;  4JD2 C;  4EWR A;  1VZ3 A;  5AFU 3;  3JRP A;  3K27 A;  4WK4 A;  3AL8 A;  2H3X A;  2HU5 A;  4AEZ A;  4IMM A;  4IA9 A;  2XU7 A;  2H68 A;  2UZY B;  5FLX g;  3VH0 A;  3DXK C;  2AGX A;  4GM9 A;  2OIZ A;  1QFM A;  4J0X A;  3NVQ A;  5HE3 B;  3JZG A;  2XE4 A;  5EMM B;  4JT5 C;  4G56 B;  1VE7 A;  1K3I A;  2G99 A;  1UTC A;  2H9P A;  3IVM A;  4K3J B;  4U7A A;  3VA6 A;  3ZE1 A;  4BH6 A;  2CE9 A;  4O9D A;  4DNU A;  4GM8 A;  3CFS B;  4JXM A;  2B5L A;  4O1Q D;  4HDJ A;  2AQ5 A;  3F3P A;  4Z7O A;  1ERJ A;  3K72 A;  1H2X A;  4FA9 D;  2HU7 A;  3RRM C;  4ESG A;  4QT8 A;  5TEE A;  5E6U A;  3EI3 A;  2P9K C;  3ZDZ A;  4I79 A;  2B5M A;  4BP9 A;  5GMK n;  1QNI A;  2CO0 A;  2HES X;  3U4Y A;  4Z8L A;  2AGL A;  2G9A A;  3EI2 A;  3A0F A;  5FKR A;  4A0A B;  1RI6 A;  4Z7Q A;  4PBY A;  1MG2 A;  3O4G A;  1A12 A;  5H14 A;  4QAM A;  2PM6 B;  3O4I A;  4MK0 B;  2HJB A;  3DDU A;  2HKR A;  3NVX A;  4XYH A;  1YR2 A;  3MZK A;  3EG6 A;  5CYK A;  4JHN A;  3I7N A;  3IJC A;  3MZL A;  3MVD K;  1E5T A;  4A0B A;  2H6N A;  2O9K A;  3FCU A;  4OZU A;  4GGC A;  2I0S A;  3MKS B;  1GOG A;  4MMX A;  4A11 B;  5TDH B;  3DM0 A;  3J81 g;  4J79 A;  5EMK B;  1PBY B;  3SFZ A;  1GG2 B;  3IIY A;  4D9S A;  5FFO A;  4J0W A;  3UR4 A;  3ZDX A;  1M1X A;  3EQ7 A;  4N14 A;  2UZX B;  3RSE C;  4J82 A;  3RFH A;  3EQ8 A;  2H9N A;  4J78 A;  1VZ2 A;  4E5Z A;  4UM8 A;  1GOF A;  3T3M A;  3RLM D;  5IT9 g;  3PXT D;  4PNK B;  5CXC A;  2Z2N A;  4DNV A;  1NEX B;  1JOF A;  3OKW A;  3C5M A;  3NIF A;  4NSX A;  4CZV A;  3ORV D;  3J80 g;  3JPX A;  1GOT B;  4FA5 D;  3KRX B;  3VI3 A;  5K19 A;  3IUL A;  2CO0 C;  3ZWL B;  3GFC A;  4AN1 A;  5C2W B;  4GM3 A;  3GD1 I;  5B4W A;  5CXB B;  4O45 A;  2OK6 A;  5TF2 A;  4FA4 D;  2OVP B;  5HE2 B;  3JZN A;  2AGW A;  3I89 A;  5EM2 A;  3CFV A;  1SQJ A;  2WQ8 A;  4RE5 A;  5M5R A;  3UVM A;  4NEN A;  3JZH A;  5GXH A;  1O6G A;  3K6S A;  2XDW A;  2IUQ A;  3MXX A;  3SVW D;  3OKY B;  4RE6 A;  4CI8 A;  4ZOZ A;  4Y5R D;  3KRW B;  2HKM A;  4BCB A;  3IIW A;  1GOH A;  1H2Y A;  1K8K C;  2GNQ A;  1UOQ A;  3RN1 D;  3PSC B;  2BKL A;  2I0T A;  4ERY A;  3QHY B;  4L3H D;  4UM9 A;  1XKS A;  3C9C A;  3OKT A;  3AH8 B;  2CE8 A;  2PM9 B;  3OTT A;  3SBP A;  4CI3 A;  2GC7 A;  2EIE A;  5C92 A;  2I3T A;  4WK2 A;  4X3E A;  2H9M A;  4AX4 A;  1UOO A;  3PXS D;  1H2Z A;  3I7L A;  4XYI A;  2VDO A;  5AMS A;  5M5T A;  1FWX A;  2VDM A;  4J77 A;  3B7F A;  3I7K A;  1PEV A;  5GXI A;  4R7A B;  3EWE A;  5I5J A;  3UKR C;  3HFQ A;  5THA A;  1UOP A;  5TEF A;  5E6R A;  3W15 A;  1VYH C;  3DXM C;  3IUN A;  3K26 A;  3ZDY A;  2XYI A;  4A08 A;  3JAM g;  4NBM A;  3IJ0 A;  4YVD A;  5EAR A;  2CN2 A;  3NIG A;  3BWS A;  2VDR A;  4D6V A;  4E54 A;  3I7O A;  3EI4 B;  3SBR A;  4A09 A;  2Z2O A;  1U4C A;  2XL2 A;  4G1M A;  4PSW B;  2J56 H;  4X61 B;  2GC4 A;  2AH1 A;  1JMZ B;  2P9N C;  3UVL A;  5IJ8 E;  1QFS A;  4CI2 A;  3ULE C;  4AMY A;  4X63 B;  4AOW A;  4CC9 A;  3CIK B;  2W18 A;  5K1C C;  1B9Y A;  3PVU B;  4ZOV A;  1TYE A;  2TRC B;  2YMU A;  1NR0 A;  3AL8 B;  4QL1 A;  4MMY A;  1SHY B;  1PI6 A;  5AJA A;  4TZ4 A;  1E8M A;  3MMY A;  1K32 A;  4O3U B;  4ZOX A;  4JSN C;  5FKQ A;  3JB9 L;  2OVR B;  3EI1 A;  4L3G D;  3MUN A;  3AL9 A;  3ODT A;  1U2V C;  1B9X A;  3PSL A;  3FM0 A;  4BL0 A;  2P9P C;  4A2M A;  1U8C A;  3L4O D;  4L1Q D;  2CN3 A;  1GP2 B;  4DNW A;  3BG0 A;  2Z2P A;  4FA1 D;  4JSP C;  2JKX A;  4GQB B;  5EMJ B;  3V4V A;  3EU7 A;  5GSA A;  3OF7 A;  2B5N A;  4OWR A;  2QZP A;  2HXC A;  3L4M D;  5C2V B;  4O02 A;  2AGY A;  4WJK A;  5H17 A;  2VDL A;  3FGB A;  2YNO A;  2H47 A;  5C86 A;  3EI2 B;  4QRJ A;  2I3S A;  2H14 A;  2VDQ A;  4UI9 R;  4LG9 A;  2IUV A;  3T3P A;  4G55 A;  2XL3 A;  1S4U X;  1MDA H;  3IJ1 A;  3SCY A;  4BUJ C;  2BCJ B;  3IJE A;  4CY3 A;  3IKO A;  4ES0 A;  3V7D B;  4PSX B;  3RFG A;  4CZY A;  5CYK B;  4J87 A;  5EAM A;  3E0C A;  2QR5 A;  5HQG A;  3EQ9 A;  5HYN B;  4A0B B;  3PE7 A;  3SWS D;  1YFQ A;  4ZN4 A;  2IUR A;  4O3T B;  1N6E A;  1TYQ C;  1TBG A;  3IUQ A;  4A0A A;  3UVO A;  4IRZ A;  2AGZ A;  3V4P A;  5FKS A;  2IUP A;  4ERQ A;  3GC3 B;  2VC2 A;  4PXW A;  3V9F A;  2H6K A;  5IGQ A;  1H2W A;  2IWF A;  2EIC A;  5I5M A;  3I2N A;  4A7J A;  1R5M A;  4Y7R A;  3RN0 D;  5I5I A;  3DWL C;  2CNX A;  3C75 H;  2P9U C;  5CXC B;  4JHP C;  4J86 A;  1Q47 A;  1E8N A;  4GGD A;  4ZOY A;  4L9O A;  5IC7 A;  3V5W B;  4G1E A;  2QC5 A;  4A11 A;  3IUJ A;  2VZ1 A;  3ZE0 A;  2P9L C;  2AH0 A;  4CY1 A;  2HYE A;  4AMZ A;  5HE0 B;  4H5J A;  5IJ7 E;  3MKQ A;  4AN0 A;  5M5V A;  3SJL D;  4JSX C;  4BCD A;  4L1M A;  3PXW D;  4MMZ A;  3SXT D;  3DSM A;  3I7H A;  5FQD A;  2HU8 A;  2XZG A;  4FAN D;  2P9S C;  3KCI A;  5EM2 B;  1T2X A;  3K71 A;  1OLZ A;  1BPO A;  4X60 B;  5SXM A;  2H6Q A;  2H13 A;  2YNP A;  1PGU A;  3OL2 B;  4LGN A;  3FCS A;  2EBS A;  2IAA A;  2YB8 B;  1A0R B;  1XIP A;  4J73 A;  5EAP A;  5CXB A;  2YBA A;  4J81 A;  3UVN A;  3F3G A;  3IUR A;  5A2Q g;  2H9L A;  1OMW B;  5JWZ A;  2MTA H;  3SN6 B;  3I8E A;  2VDN A;  3NVN A;  4KFM B;  4NC4 A;  3RMZ D;  1C9I A;  3SBQ A;  3IUM A;  1SQ9 A;  3GRE A;  1L5G A;  3I8C A;  2OVQ B;  2OJY A;  4QQE A;  1GXR A;  2PM7 B;  1VE6 A;  4PBZ A;  5FXY A;  3FRX A;  4BCC A;  3OKY A;  2P9I C;  4FAV D;  1JTD B;  5EML B;  4GQ1 A;  2VDK A;  3UKU C;  3ZE2 A;  4GQ2 P;  5H1M A;  4WK0 A;  3MUO A;  3UVK A;  5C9Z B;  2VDP A;  2YNN A;  3VI4 A;  2VZ3 A;  3N0E A;  2Q7Q A;  4J8G A;  1N6F A;  4JSV C;  3I7P A;  3P4F A;  2I0R A;  5EAL A;  3N0D A;  5FKT A;  4CZX A;  2PM9 A;  5HDB A; 
#chains in the Genus database with same CATH homology
 2J57 G;  4A08 B;  3EI3 B;  1JMX B;  4GMB A;  1P22 A;  2PBI B;  1XHM A;  4FWW A;  2IWK A;  4E54 B;  2QXV A;  4D0K A;  4J84 A;  4A2L A;  4CY2 A;  3BG1 A;  4A09 B;  3PVW B;  4GZ8 A;  4ERZ A;  4FHL A;  4JT6 C;  1MG3 A;  1JJU B;  3VGZ A;  3C99 A;  2HJ4 A;  3EMH A;  3AFC A;  5IGO A;  2B4E A;  1L0Q A;  3JRO A;  4LG8 A;  2OK4 A;  3EI4 A;  4J8B A;  3SLE D;  4CI1 A;  4GGA A;  1N6D A;  4PC0 A;  3F3F A;  5KDO B;  3SMR A;  4CY5 A;  4U1E I;  3OW8 A;  4H5I A;  3OL2 A;  4XEI C;  2J55 H;  3EI1 B;  5HE1 B;  4K3I D;  5FA5 B;  2BBK H;  3SHF A;  4FB1 D;  4E5Z B;  4JD2 C;  4EWR A;  5AFU 3;  3JRP A;  3K27 A;  3AL8 A;  2H3X A;  4AEZ A;  4IMM A;  4IA9 A;  2XU7 A;  2H68 A;  2UZY B;  5FLX g;  3VH0 A;  3DXK C;  2AGX A;  4GM9 A;  2OIZ A;  4J0X A;  3NVQ A;  5HE3 B;  3JZG A;  5EMM B;  4JT5 C;  4G56 B;  4K3J B;  4U7A A;  2G99 A;  2H9P A;  3VA6 A;  4BH6 A;  2CE9 A;  4O9D A;  4GM8 A;  3CFS B;  4JXM A;  2B5L A;  4O1Q D;  4HDJ A;  2AQ5 A;  3F3P A;  1ERJ A;  4FA9 D;  3RRM C;  4ESG A;  4QT8 A;  5TEE A;  3EI3 A;  2P9K C;  4I79 A;  2B5M A;  5GMK n;  1QNI A;  2CO0 A;  2HES X;  3U4Y A;  4Z8L A;  2AGL A;  2G9A A;  3EI2 A;  3A0F A;  5FKR A;  4A0A B;  1RI6 A;  4PBY A;  1MG2 A;  5H14 A;  2PM6 B;  4MK0 B;  2HJB A;  2HKR A;  3NVX A;  4XYH A;  3MZK A;  3EG6 A;  5CYK A;  3I7N A;  3IJC A;  3MZL A;  4A0B A;  2H6N A;  2O9K A;  4OZU A;  4GGC A;  2I0S A;  3MKS B;  4A11 B;  5TDH B;  3DM0 A;  3J81 g;  4J79 A;  5EMK B;  1PBY B;  3SFZ A;  1GG2 B;  3IIY A;  4J0W A;  3UR4 A;  4N14 A;  2UZX B;  3RSE C;  4J82 A;  3RFH A;  2H9N A;  4J78 A;  4E5Z A;  3RLM D;  5IT9 g;  3PXT D;  4PNK B;  5CXC A;  2Z2N A;  1NEX B;  1JOF A;  3OKW A;  3C5M A;  4NSX A;  4CZV A;  3ORV D;  3J80 g;  3JPX A;  1GOT B;  4FA5 D;  3KRX B;  5K19 A;  2CO0 C;  3ZWL B;  3GFC A;  5C2W B;  4GM3 A;  5B4W A;  5CXB B;  4O45 A;  2OK6 A;  5TF2 A;  4FA4 D;  2OVP B;  5HE2 B;  3JZN A;  2AGW A;  3I89 A;  5EM2 A;  3CFV A;  1SQJ A;  3UVM A;  3JZH A;  5GXH A;  2IUQ A;  3MXX A;  3SVW D;  3OKY B;  4CI8 A;  4ZOZ A;  4Y5R D;  3KRW B;  2HKM A;  1K8K C;  2GNQ A;  3IIW A;  3RN1 D;  3PSC B;  2I0T A;  4ERY A;  4L3H D;  1XKS A;  3C9C A;  3OKT A;  3AH8 B;  2CE8 A;  2PM9 B;  3OTT A;  3SBP A;  4CI3 A;  2GC7 A;  2I3T A;  4X3E A;  2H9M A;  3PXS D;  3I7L A;  4XYI A;  5AMS A;  1FWX A;  4J77 A;  3B7F A;  3I7K A;  1PEV A;  5GXI A;  4R7A B;  3EWE A;  5I5J A;  3UKR C;  3HFQ A;  5THA A;  3W15 A;  5TEF A;  1VYH C;  3DXM C;  3K26 A;  2XYI A;  4A08 A;  3JAM g;  3IJ0 A;  4YVD A;  5EAR A;  2CN2 A;  3BWS A;  4D6V A;  4E54 A;  3I7O A;  3EI4 B;  3SBR A;  4A09 A;  2Z2O A;  1U4C A;  2XL2 A;  4PSW B;  2J56 H;  4X61 B;  2GC4 A;  2AH1 A;  1JMZ B;  2P9N C;  3UVL A;  5IJ8 E;  4CI2 A;  3ULE C;  4X63 B;  4AOW A;  4CC9 A;  3CIK B;  2W18 A;  5K1C C;  1B9Y A;  3PVU B;  4ZOV A;  2TRC B;  2YMU A;  1NR0 A;  3AL8 B;  4QL1 A;  1SHY B;  1PI6 A;  5AJA A;  4TZ4 A;  3MMY A;  1K32 A;  4O3U B;  4ZOX A;  4JSN C;  5FKQ A;  3JB9 L;  2OVR B;  3EI1 A;  4L3G D;  3AL9 A;  3ODT A;  1U2V C;  1B9X A;  3PSL A;  3FM0 A;  4BL0 A;  2P9P C;  4A2M A;  3L4O D;  4L1Q D;  2CN3 A;  1GP2 B;  3BG0 A;  2Z2P A;  4FA1 D;  4JSP C;  4GQB B;  5EMJ B;  3EU7 A;  5GSA A;  2B5N A;  4OWR A;  2HXC A;  3L4M D;  5C2V B;  2AGY A;  5H17 A;  3FGB A;  2YNO A;  2H47 A;  3EI2 B;  4QRJ A;  2I3S A;  2H14 A;  4UI9 R;  4LG9 A;  2IUV A;  2XL3 A;  1S4U X;  1MDA H;  3IJ1 A;  3SCY A;  4BUJ C;  2BCJ B;  4CY3 A;  3IKO A;  4ES0 A;  3V7D B;  4PSX B;  3RFG A;  4CZY A;  5CYK B;  4J87 A;  5EAM A;  3E0C A;  5HQG A;  5HYN B;  4A0B B;  3PE7 A;  3SWS D;  1YFQ A;  4ZN4 A;  2IUR A;  4O3T B;  1N6E A;  1TYQ C;  1TBG A;  4A0A A;  3UVO A;  2AGZ A;  5FKS A;  2IUP A;  4ERQ A;  4PXW A;  3V9F A;  2H6K A;  5IGQ A;  2IWF A;  5I5M A;  3I2N A;  4A7J A;  1R5M A;  4Y7R A;  3RN0 D;  5I5I A;  3DWL C;  2CNX A;  3C75 H;  2P9U C;  5CXC B;  4J86 A;  1Q47 A;  4GGD A;  4ZOY A;  4L9O A;  5IC7 A;  3V5W B;  2QC5 A;  4A11 A;  2P9L C;  2AH0 A;  4CY1 A;  2HYE A;  5HE0 B;  4H5J A;  5IJ7 E;  3MKQ A;  3SJL D;  4JSX C;  3SXT D;  3PXW D;  3DSM A;  3I7H A;  5FQD A;  4FAN D;  2P9S C;  5EM2 B;  1OLZ A;  4X60 B;  5SXM A;  2H6Q A;  2H13 A;  2YNP A;  1PGU A;  3OL2 B;  4LGN A;  2EBS A;  2IAA A;  2YB8 B;  1A0R B;  1XIP A;  4J73 A;  5EAP A;  5CXB A;  2YBA A;  4J81 A;  3UVN A;  3F3G A;  5A2Q g;  2H9L A;  1OMW B;  5JWZ A;  2MTA H;  3SN6 B;  3I8E A;  3NVN A;  4KFM B;  3RMZ D;  3SBQ A;  1SQ9 A;  3GRE A;  3I8C A;  2OVQ B;  2OJY A;  4QQE A;  1GXR A;  2PM7 B;  4PBZ A;  5FXY A;  3FRX A;  3OKY A;  2P9I C;  4FAV D;  5EML B;  4GQ1 A;  3UKU C;  4GQ2 P;  5H1M A;  3UVK A;  5C9Z B;  2YNN A;  3N0E A;  2Q7Q A;  4J8G A;  1N6F A;  4JSV C;  3I7P A;  3P4F A;  2I0R A;  5EAL A;  3N0D A;  5FKT A;  4CZX A;  2PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...