4R7AB

Crystal structure of rbbp4 bound to phf6 peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
396
structure length
366
Chain Sequence
RVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords PHD finger protein 6
publication title Structural Basis of Plant Homeodomain Finger 6 (PHF6) Recognition by the Retinoblastoma Binding Protein 4 (RBBP4) Component of the Nucleosome Remodeling and Deacetylase (NuRD) Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 366
sequence length 396
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4r7aB00
1U4CA 5K19A 1PI6A 4AOWA 2BCJB 3EI1B 3NVNA 4EWRA 2H9MA 3PVWB 4O45A 3EI2B 4GQ1A 2O9KA 3SVWD 5FQDA 3IKOA 2HKRA 3ORVD 2J56H 3J80g 4FA9D 3PSCB 4OZUA 2H68A 2I3SA 4CZVA 3SCYA 2P9SC 4PC0A 4X61B 2H13A 3RLMD 4ERZA 3IJ0A 2G99A 3V7DB 4J79A 2CO0C 3EI4B 5SXMA 4L3GD 3SXTD 2Z2NA 4A0AA 2H3XA 4E5ZB 4JSPC 2PBIB 2HJBA 3PVUB 5FXYA 2HXCA 2HYEA 1NEXB 2MTAH 3UR4A 4A08A 4E54A 3F3PA 1GG2B 4BL0A 3EG6A 4LGNA 5I5MA 2YNNA 3OKWA 4H5IA 4O3UB 3AL8A 1MG3A 2YB8B 3EMHA 4X63B 4J87A 2B5MA 5CXCA 3IIWA 4BH6A 3I7HA 3N0DA 4A0AB 4PBYA 2P9IC 3L4OD 4GM9A 4CC9A 3MZLA 2J57G 2IUVA 4BUJC 3GFCA 2H9PA 4E54B 5JWZA 3K27A 1SQJA 3I7PA 2OVRB 3RMZD 2YNOA 3ODTA 3MMYA 4X3EA 2B5NA 1JMXB 1N6EA 3A0FA 3AL8B 4KFMB 1SHYB 1XIPA 2AH1A 1GOTB 2CE9A 3DWLC 5H17A 2CNXA 1TBGA 1FWXA 5CXCB 2HESX 3SJLD 2I3TA 5FKTA 2B5LA 3P4FA 2Z2PA 4FAVD 2OK6A 4ESGA 4PXWA 4GGCA 3MZKA 3W15A 4FA1D 4K3ID 2H6QA 2XL2A 5IC7A 3UVLA 4I79A 1JJUB 4A0BB 2CN2A 1S4UX 3KRXB 2Z2OA 5GXHA 4Y5RD 5HYNB 3E0CA 2AQ5A 5AFU3 4H5JA 1N6DA 1GP2B 5FKQA 2CE8A 2PM9A 4PNKB 4QL1A 3HFQA 2P9NC 4K3JB 2CN3A 2H9LA 5AJAA 4JSXC 4CI1A 5EAMA 1JMZB 5HQGA 1TYQC 3MKQA 3SMRA 3DXKC 4ZN4A 3BG1A 5IT9g 2G9AA 2YBAA 4L9OA 2CO0A 3I7OA 3OKYA 4A09A 3JZGA 4J0WA 2QXVA 5EMKB 4ZOXA 1XKSA 4J73A 3RFHA 2PM9B 4CI2A 5H1MA 4J0XA 4CZYA 2XU7A 4Z8LA 3MKSB 5IJ7E 3VH0A 4N14A 4GQBB 5IGQA 4GM3A 3N0EA 4XYHA 3OTTA 4JT5C 3U4YA 2AGLA 4PSXB 4IA9A 3OKTA 4JXMA 3ZWLB 4J77A 3UKUC 4FWWA 3UVKA 1B9XA 1VYHC 2OVPB 2H6KA 2H9NA 4A2LA 4NSXA 3SN6B 3VA6A 3V5WB 4O9DA 4A09B 2IWKA 3OKYB 4R7AB 4A7JA 2HKMA 4HDJA 5EAPA 3BG0A 3IJCA 4QQEA 2UZXB 5I5JA 4D0KA 4IMMA 4Y7RA 4FHLA 4ZOVA 5TF2A 2AGZA 5FLXg 1RI6A 5C2WB 3F3GA 4ERYA 3KRWB 4AEZA 2AH0A 1B9YA 3I8CA 3FRXA 2IUPA 4A08B 4J81A 4FAND 1MG2A 3CFVA 4J78A 3JPXA 5IJ8E 4A11A 5I5IA 4A2MA 3V9FA 2AGYA 4QRJA 5EMLB 4X60B 4LG9A 3SWSD 4CI8A 5FKSA 2H6NA 3DSMA 4CY3A 1OMWB 5KDOB 4JD2C 3CIKB 1L0QA 3EU7A 3DXMC 1GXRA 3GREA 1A0RB 5HE2B 4CY2A 2GNQA 4FA4D 5EARA 2I0TA 4GMBA 3I7NA 3UVOA 3C75H 3RN1D 3K26A 4ZOYA 1R5MA 4CY1A 5GXIA 3JROA 5TDHB 2AGWA 5H14A 1PGUA 3EI1A 2P9PC 4U7AA 3JZHA 4J86A 3UVMA 1OLZA 4D6VA 3EI2A 3PE7A 4TZ4A 4U1EI 2W18A 2OJYA 3FGBA 2XYIA 2IWFA 5HE3B 1P22A 4YVDA 2P9LC 2XL3A 4ES0A 4J8BA 2YMUA 3PXTD 5TEEA 1YFQA 3OL2A 5AMSA 2HJ4A 3AH8B 3L4MD 2IURA 1U2VC 4E5ZA 3SHFA 3UKRC 4JSNC 4QT8A 4PBZA 3EWEA 5CXBA 3RFGA 2OK4A 3I8EA 3FM0A 4L1QD 4L3HD 2IUQA 5EM2A 3PXWD 1Q47A 4CZXA 1QNIA 5B4WA 3I89A 3OL2B 2EBSA 5EALA 3CFSB 2BBKH 2P9KC 3OW8A 1NR0A 2I0RA 4JT6C 3RRMC 5K1CC 3AFCA 3RSEC 3SBQA 4FB1D 3F3FA 5C9ZB 1SQ9A 2B4EA 3JB9L 1PEVA 4JSVC 4ERQA 5CXBB 3JAMg 5CYKA 1MDAH 4UI9R 3MXXA 5A2Qg 3RN0D 5EM2B 3IIYA 2AGXA 4GGDA 2P9UC 4FA5D 5GMKn 2H47A 5HE1B 1XHMA 4OWRA 3SLED 2IAAA 3ULEC 4J82A 3I7KA 3B7FA 1ERJA 2GC7A 2PM7B 2Q7QA 2PM6B 4ZOZA 3C5MA 4O3TB 5FA5B 5FKRA 2J55H 3I7LA 3NVXA 3DM0A 4GM8A 4GGAA 3SFZA 5EMMB 2GC4A 5CYKB 2I0SA 3C9CA 4G56B 3AL9A 4A0BA 2UZYB 3PSLA 4GZ8A 5GSAA 3EI3A 2OVQB 4O1QD 4CY5A 3I2NA 5IGOA 4A11B 3BWSA 5EMJB 2H14A 3C99A 4PSWB 1PBYB 2OIZA 3IJ1A 5TEFA 1K32A 3NVQA 2TRCB 1JOFA 4J8GA 5THAA 3SBRA 4XYIA 1K8KC 3JRPA 5HE0B 2YNPA 3UVNA 5C2VB 3J81g 4MK0B 3JZNA 4CI3A 3EI3B 3SBPA 3PXSD 3VGZA 4J84A 4LG8A 1N6FA 2QC5A 3EI4A 4XEIC 4GQ2P
chains in the Genus database with same CATH superfamily
1U4CA 5K19A 1PI6A 4AOWA 2BCJB 2XE4A 3EI1B 3NVNA 4EWRA 2H9MA 3PVWB 4O45A 3EI2B 4GQ1A 2O9KA 3SVWD 5FQDA 3IKOA 3GD1I 4G1EA 2HKRA 3ORVD 2J56H 3J80g 4FA9D 3PSCB 1UOOA 4OZUA 2H68A 2I3SA 4CZVA 3SCYA 2P9SC 4PC0A 4X61B 2H13A 3RLMD 4ERZA 3IJ0A 2G99A 3V7DB 4J79A 2CO0C 1E8NA 3EI4B 3V4VA 5SXMA 4L3GD 3SXTD 2Z2NA 4A0AA 2H3XA 4E5ZB 4JSPC 2PBIB 2HJBA 5M5RA 1E8MA 4JHPC 5E6SA 3PVUB 1E5TA 5FXYA 3ZE0A 2HXCA 4WK4A 4G55A 2HYEA 1NEXB 2MTAH 5M5VA 3UR4A 4A08A 4E54A 3F3PA 1GG2B 4BL0A 3EG6A 4LGNA 5I5MA 2YNNA 3OKWA 3O4JA 4H5IA 2VC2A 4AN0A 4O3UB 3AL8A 1MG3A 3FCUA 2YB8B 3EMHA 3NIGA 3ZDXA 4X63B 1QFMA 4J87A 4AMYA 2B5MA 4UM8A 5CXCA 3IIWA 2EIBA 4BH6A 3I7HA 3N0DA 4A0AB 4PBYA 2P9IC 3L4OD 1UOQA 4WJKA 4GQ2P 4GM9A 4CC9A 3MZLA 2J57G 2IUVA 4BUJC 3GFCA 2H9PA 4E54B 5JWZA 3K27A 1SQJA 3I7PA 2OVRB 3RMZD 2YNOA 3ODTA 3QHYB 3MMYA 4X3EA 4Z7OA 3EQ7A 2B5NA 1JMXB 1N6EA 3A0FA 1T2XA 1SHYB 3AL8B 4KFMB 1XIPA 2AH1A 1GOTB 2CE9A 3DWLC 5H17A 2CNXA 1TBGA 1FWXA 5CXCB 2HESX 3DDUA 3SJLD 2I3TA 5FKTA 3IUQA 2B5LA 1VE7A 3P4FA 2Z2PA 4FAVD 2OK6A 3O4GA 1K3IA 4ESGA 4PXWA 4GGCA 3MZKA 3W15A 2VZ3A 1VE6A 3IUMA 4FA1D 4K3ID 2H6QA 2XL2A 3EQ8A 4Z7QA 5IC7A 3UVLA 4I79A 1JJUB 3K6SA 5FFOA 2CN2A 4A0BB 3IJEA 1L5GA 1S4UX 3KRXB 4BCCA 2XZGA 2Z2OA 5GXHA 4Y5RD 5HYNB 3E0CA 2AQ5A 5AFU3 4H5JA 1N6DA 1GP2B 5FKQA 2CE8A 2PM9A 4PNKB 4QL1A 1A12A 3HFQA 2P9NC 4K3JB 4O02A 2CN3A 2H9LA 5AJAA 4JSXC 4CI1A 5EAMA 3MUNA 1JMZB 5HQGA 5E6RA 1TYQC 1H2XA 3MKQA 3SMRA 3DXKC 4ZN4A 3BG1A 5E6UA 5IT9g 4RE6A 3FCSA 2G9AA 3NIFA 2YBAA 2HU5A 3K71A 4L9OA 2CO0A 3I7OA 3OKYA 4A09A 3JZGA 2VDMA 4J0WA 2QXVA 5EMKB 4ZOXA 1XKSA 2VDOA 2VDRA 4J73A 4NENA 3RFHA 2PM9B 4G1MA 4JHNA 4CI2A 5H1MA 4J0XA 4CZYA 2XU7A 4Z8LA 3MKSB 5IJ7E 5M5UA 4N14A 4GQBB 3VH0A 5IGQA 4GM3A 3ZDZA 3N0EA 4XYHA 3OTTA 4JT5C 2VDNA 3U4YA 2AGLA 4PSXB 4IA9A 3OKTA 4JXMA 3K72A 3ZWLB 4J77A 3UKUC 4FWWA 3UVKA 5M5SA 1B9XA 1VYHC 2OVPB 2H6KA 2H9NA 4A2LA 4NSXA 3SN6B 4BCDA 3VA6A 3V5WB 4O9DA 3IUJA 2IWKA 3OKYB 4R7AB 3ZDYA 4A7JA 4A09B 2HKMA 4HDJA 5EAPA 2EICA 2VDPA 3BG0A 3IJCA 4QQEA 3OF7A 2UZXB 5I5JA 4D0KA 2EIEA 4IMMA 4Y7RA 1GOGA 4FHLA 4ZOVA 5TF2A 2QZPA 2AGZA 5FLXg 1RI6A 5C2WB 3F3GA 4ERYA 3KRWB 4AEZA 2AH0A 1B9YA 3I8CA 3FRXA 1QFSA 2IUPA 4A08B 4J81A 4FAND 1MG2A 4IRZA 3CFVA 4J78A 3JPXA 4UM9A 5IJ8E 4A11A 5I5IA 1H2YA 4A2MA 3V9FA 2VDQA 2AGYA 4QRJA 5EMLB 4X60B 4LG9A 4WK0A 3SWSD 4CI8A 5FKSA 2H6NA 3DSMA 4RE5A 4CY3A 1OMWB 2BKLA 5KDOB 4DNUA 4MMZA 4BP9A 4JD2C 3CIKB 1L0QA 4D9SA 3EU7A 3DXMC 1GXRA 1C9IA 3GREA 4BP8A 1M1XA 1A0RB 5HE2B 4CY2A 2GNQA 5M61A 4FA4D 5EARA 2I0TA 4GMBA 3I7NA 3UVOA 3C75H 3RN1D 3K26A 4ZOYA 1R5MA 4CY1A 5GXIA 4NAAA 3JROA 5TDHB 2AGWA 3IURA 1BPOA 3ZE2A 5H14A 1PGUA 3EI1A 2P9PC 4U7AA 3JZHA 4J86A 1YR2A 3UVMA 1O6GA 3KCIA 1OLZA 3NIDA 4D6VA 3EI2A 3PE7A 4TZ4A 4U1EI 2HU7A 2W18A 2OJYA 3FGBA 4NBMA 2XYIA 4AMZA 2IWFA 3IULA 5HE3B 5C92A 1P22A 4YVDA 4WK2A 4O2WA 2P9LC 2XL3A 3T3MA 4ES0A 3O4IA 4J8BA 2QR5A 2HU8A 2YMUA 3PXTD 4L1MA 5TEEA 1YFQA 1UOPA 3OL2A 5AMSA 2HJ4A 3AH8B 3L4MD 2IURA 1U2VC 4E5ZA 3SHFA 3UKRC 1I2MB 4JSNC 4QT8A 4PBZA 3EWEA 1JV2A 5CXBA 3VI4A 3RFGA 2OK4A 1H2WA 3I8EA 3MVDK 3FM0A 4L1QD 4L3HD 2IUQA 3MUOA 5EM2A 3PXWD 1Q47A 4DNVA 4CZXA 1QNIA 3O4HA 5B4WA 3I89A 2XDWA 3OL2B 2EBSA 1JTDB 5EALA 3VI3A 3CFSB 2BBKH 2P9KC 3OW8A 1NR0A 2I0RA 4JT6C 3RRMC 5K1CC 3AFCA 3RSEC 3IVMA 3IUNA 3SBQA 4FB1D 3F3FA 5C9ZB 1SQ9A 2B4EA 3JB9L 1PEVA 4MMXA 4JSVC 4ERQA 5CXBB 5HDBA 3JAMg 1U8CA 5CYKA 1MDAH 4UI9R 3MXXA 5A2Qg 2WQ8A 5M5TA 2JKXA 4NC4A 3RN0D 5EM2B 3IIYA 2AGXA 4GGDA 2P9UC 4FA5D 5GMKn 2H47A 2VZ1A 5HE1B 2VDKA 4AN1A 1XHMA 4OWRA 3SLED 2IAAA 3ULEC 4J82A 3I7KA 3B7FA 1ERJA 2GC7A 2PM7B 3T3PA 2Q7QA 2PM6B 4ZOZA 3C5MA 4O3TB 5FA5B 4MMYA 5FKRA 4AX4A 2J55H 3I7LA 3NVXA 3DM0A 4BCBA 4GM8A 4GGAA 3SFZA 5EMMB 2GC4A 5CYKB 2I0SA 1C9LA 3C9CA 4G56B 4QAMA 3AL9A 1VZ2A 4A0BA 2UZYB 3PSLA 4GZ8A 5GSAA 3EI3A 1TYEA 1UTCA 3QI0A 2OVQB 3GC3B 4O1QD 4CY5A 3I2NA 5IGOA 4A11B 3BWSA 5EMJB 1O6FA 2H14A 3C99A 5FFGA 4PSWB 1PBYB 4DNWA 1GOHA 3EQ9A 2OIZA 3IJ1A 5TEFA 3ZE1A 1K32A 3NVQA 5C86A 2TRCB 1JOFA 4J8GA 5THAA 3SBRA 4XYIA 1K8KC 5HE0B 2VDLA 2YNPA 3UVNA 5C2VB 3J81g 1H2ZA 4MK0B 3JZNA 4CI3A 1VZ3A 3EI3B 3SBPA 3V4PA 3PXSD 3VGZA 4Z7NA 4J84A 4LG8A 1GOFA 2EIDA 1N6FA 2QC5A 3EI4A 4XEIC 3JRPA
chains in the Genus database with same CATH topology
1U4CA 5K19A 1PI6A 4AOWA 2BCJB 3EI1B 3NVNA 4EWRA 2H9MA 3PVWB 4O45A 3EI2B 4GQ1A 2O9KA 3SVWD 5FQDA 3IKOA 2HKRA 3ORVD 2J56H 3J80g 4FA9D 3PSCB 4OZUA 2H68A 2I3SA 4CZVA 3SCYA 2P9SC 4PC0A 4X61B 2H13A 3RLMD 4ERZA 3IJ0A 2G99A 3V7DB 4J79A 2CO0C 3EI4B 5SXMA 4L3GD 3SXTD 2Z2NA 4A0AA 2H3XA 4E5ZB 4JSPC 2PBIB 2HJBA 3PVUB 5FXYA 2HXCA 2HYEA 1NEXB 2MTAH 3UR4A 4A08A 4E54A 3F3PA 1GG2B 4BL0A 3EG6A 4LGNA 5I5MA 2YNNA 3OKWA 4H5IA 4O3UB 3AL8A 1MG3A 2YB8B 3EMHA 4X63B 4J87A 2B5MA 5CXCA 3IIWA 4BH6A 3I7HA 3N0DA 4A0AB 4PBYA 2P9IC 3L4OD 4GM9A 4CC9A 3MZLA 2J57G 2IUVA 4BUJC 3GFCA 2H9PA 4E54B 5JWZA 3K27A 1SQJA 3I7PA 2OVRB 3RMZD 2YNOA 3ODTA 3MMYA 4X3EA 2B5NA 1JMXB 1N6EA 3A0FA 3AL8B 4KFMB 1SHYB 1XIPA 2AH1A 1GOTB 2CE9A 3DWLC 5H17A 2CNXA 1TBGA 1FWXA 5CXCB 2HESX 3SJLD 2I3TA 5FKTA 2B5LA 3P4FA 2Z2PA 4FAVD 2OK6A 4ESGA 4PXWA 4GGCA 3MZKA 3W15A 4FA1D 4K3ID 2H6QA 2XL2A 5IC7A 3UVLA 4I79A 1JJUB 4A0BB 2CN2A 1S4UX 3KRXB 2Z2OA 5GXHA 4Y5RD 5HYNB 3E0CA 2AQ5A 5AFU3 4H5JA 1N6DA 1GP2B 5FKQA 2CE8A 2PM9A 4PNKB 4QL1A 3HFQA 2P9NC 4K3JB 2CN3A 2H9LA 5AJAA 4JSXC 4CI1A 5EAMA 1JMZB 5HQGA 1TYQC 3MKQA 3SMRA 3DXKC 4ZN4A 3BG1A 5IT9g 2G9AA 2YBAA 4L9OA 2CO0A 3I7OA 3OKYA 4A09A 3JZGA 4J0WA 2QXVA 5EMKB 4ZOXA 1XKSA 4J73A 3RFHA 2PM9B 4CI2A 5H1MA 4J0XA 4CZYA 2XU7A 4Z8LA 3MKSB 5IJ7E 3VH0A 4N14A 4GQBB 5IGQA 4GM3A 3N0EA 4XYHA 3OTTA 4JT5C 3U4YA 2AGLA 4PSXB 4IA9A 3OKTA 4JXMA 3ZWLB 4J77A 3UKUC 4FWWA 3UVKA 1B9XA 1VYHC 2OVPB 2H6KA 2H9NA 4A2LA 4NSXA 3SN6B 3VA6A 3V5WB 4O9DA 4A09B 2IWKA 3OKYB 4R7AB 4A7JA 2HKMA 4HDJA 5EAPA 3BG0A 3IJCA 4QQEA 2UZXB 5I5JA 4D0KA 4IMMA 4Y7RA 4FHLA 4ZOVA 5TF2A 2AGZA 5FLXg 1RI6A 5C2WB 3F3GA 4ERYA 3KRWB 4AEZA 2AH0A 1B9YA 3I8CA 3FRXA 2IUPA 4A08B 4J81A 4FAND 1MG2A 3CFVA 4J78A 3JPXA 5IJ8E 4A11A 5I5IA 4A2MA 3V9FA 2AGYA 4QRJA 5EMLB 4X60B 4LG9A 3SWSD 4CI8A 5FKSA 2H6NA 3DSMA 4CY3A 1OMWB 5KDOB 4JD2C 3CIKB 1L0QA 3EU7A 3DXMC 1GXRA 3GREA 1A0RB 5HE2B 4CY2A 2GNQA 4FA4D 5EARA 2I0TA 4GMBA 3I7NA 3UVOA 3C75H 3RN1D 3K26A 4ZOYA 1R5MA 4CY1A 5GXIA 3JROA 5TDHB 2AGWA 5H14A 1PGUA 3EI1A 2P9PC 4U7AA 3JZHA 4J86A 3UVMA 1OLZA 4D6VA 3EI2A 3PE7A 4TZ4A 4U1EI 2W18A 2OJYA 3FGBA 2XYIA 2IWFA 5HE3B 1P22A 4YVDA 2P9LC 2XL3A 4ES0A 4J8BA 2YMUA 3PXTD 5TEEA 1YFQA 3OL2A 5AMSA 2HJ4A 3AH8B 3L4MD 2IURA 1U2VC 4E5ZA 3SHFA 3UKRC 4JSNC 4QT8A 4PBZA 3EWEA 5CXBA 3RFGA 2OK4A 3I8EA 3FM0A 4L1QD 4L3HD 2IUQA 5EM2A 3PXWD 1Q47A 4CZXA 1QNIA 5B4WA 3I89A 3OL2B 2EBSA 5EALA 3CFSB 2BBKH 2P9KC 3OW8A 1NR0A 2I0RA 4JT6C 3RRMC 5K1CC 3AFCA 3RSEC 3SBQA 4FB1D 3F3FA 5C9ZB 1SQ9A 2B4EA 3JB9L 1PEVA 4JSVC 4ERQA 5CXBB 3JAMg 5CYKA 1MDAH 4UI9R 3MXXA 5A2Qg 3RN0D 5EM2B 3IIYA 2AGXA 4GGDA 2P9UC 4FA5D 5GMKn 2H47A 5HE1B 1XHMA 4OWRA 3SLED 2IAAA 3ULEC 4J82A 3I7KA 3B7FA 1ERJA 2GC7A 2PM7B 2Q7QA 2PM6B 4ZOZA 3C5MA 4O3TB 5FA5B 5FKRA 2J55H 3I7LA 3NVXA 3DM0A 4GM8A 4GGAA 3SFZA 5EMMB 2GC4A 5CYKB 2I0SA 3C9CA 4G56B 3AL9A 4A0BA 2UZYB 3PSLA 4GZ8A 5GSAA 3EI3A 2OVQB 4O1QD 4CY5A 3I2NA 5IGOA 4A11B 3BWSA 5EMJB 2H14A 3C99A 4PSWB 1PBYB 2OIZA 3IJ1A 5TEFA 1K32A 3NVQA 2TRCB 1JOFA 4J8GA 5THAA 3SBRA 4XYIA 1K8KC 3JRPA 5HE0B 2YNPA 3UVNA 5C2VB 3J81g 4MK0B 3JZNA 4CI3A 3EI3B 3SBPA 3PXSD 3VGZA 4J84A 4LG8A 1N6FA 2QC5A 3EI4A 4XEIC 4GQ2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4C A;  5K19 A;  1PI6 A;  4AOW A;  2BCJ B;  3EI1 B;  3NVN A;  4EWR A;  2H9M A;  3PVW B;  4O45 A;  3EI2 B;  4GQ1 A;  2O9K A;  3SVW D;  5FQD A;  3IKO A;  2HKR A;  3ORV D;  2J56 H;  3J80 g;  4FA9 D;  3PSC B;  4OZU A;  2H68 A;  2I3S A;  4CZV A;  3SCY A;  2P9S C;  4PC0 A;  4X61 B;  2H13 A;  3RLM D;  4ERZ A;  3IJ0 A;  2G99 A;  3V7D B;  4J79 A;  2CO0 C;  3EI4 B;  5SXM A;  4L3G D;  3SXT D;  2Z2N A;  4A0A A;  2H3X A;  4E5Z B;  4JSP C;  2PBI B;  2HJB A;  3PVU B;  5FXY A;  2HXC A;  2HYE A;  1NEX B;  2MTA H;  3UR4 A;  4A08 A;  4E54 A;  3F3P A;  1GG2 B;  4BL0 A;  3EG6 A;  4LGN A;  5I5M A;  2YNN A;  3OKW A;  4H5I A;  4O3U B;  3AL8 A;  1MG3 A;  2YB8 B;  3EMH A;  4X63 B;  4J87 A;  2B5M A;  5CXC A;  3IIW A;  4BH6 A;  3I7H A;  3N0D A;  4A0A B;  4PBY A;  2P9I C;  3L4O D;  4GM9 A;  4CC9 A;  3MZL A;  2J57 G;  2IUV A;  4BUJ C;  3GFC A;  2H9P A;  4E54 B;  5JWZ A;  3K27 A;  1SQJ A;  3I7P A;  2OVR B;  3RMZ D;  2YNO A;  3ODT A;  3MMY A;  4X3E A;  2B5N A;  1JMX B;  1N6E A;  3A0F A;  3AL8 B;  4KFM B;  1SHY B;  1XIP A;  2AH1 A;  1GOT B;  2CE9 A;  3DWL C;  5H17 A;  2CNX A;  1TBG A;  1FWX A;  5CXC B;  2HES X;  3SJL D;  2I3T A;  5FKT A;  2B5L A;  3P4F A;  2Z2P A;  4FAV D;  2OK6 A;  4ESG A;  4PXW A;  4GGC A;  3MZK A;  3W15 A;  4FA1 D;  4K3I D;  2H6Q A;  2XL2 A;  5IC7 A;  3UVL A;  4I79 A;  1JJU B;  4A0B B;  2CN2 A;  1S4U X;  3KRX B;  2Z2O A;  5GXH A;  4Y5R D;  5HYN B;  3E0C A;  2AQ5 A;  5AFU 3;  4H5J A;  1N6D A;  1GP2 B;  5FKQ A;  2CE8 A;  2PM9 A;  4PNK B;  4QL1 A;  3HFQ A;  2P9N C;  4K3J B;  2CN3 A;  2H9L A;  5AJA A;  4JSX C;  4CI1 A;  5EAM A;  1JMZ B;  5HQG A;  1TYQ C;  3MKQ A;  3SMR A;  3DXK C;  4ZN4 A;  3BG1 A;  5IT9 g;  2G9A A;  2YBA A;  4L9O A;  2CO0 A;  3I7O A;  3OKY A;  4A09 A;  3JZG A;  4J0W A;  2QXV A;  5EMK B;  4ZOX A;  1XKS A;  4J73 A;  3RFH A;  2PM9 B;  4CI2 A;  5H1M A;  4J0X A;  4CZY A;  2XU7 A;  4Z8L A;  3MKS B;  5IJ7 E;  3VH0 A;  4N14 A;  4GQB B;  5IGQ A;  4GM3 A;  3N0E A;  4XYH A;  3OTT A;  4JT5 C;  3U4Y A;  2AGL A;  4PSX B;  4IA9 A;  3OKT A;  4JXM A;  3ZWL B;  4J77 A;  3UKU C;  4FWW A;  3UVK A;  1B9X A;  1VYH C;  2OVP B;  2H6K A;  2H9N A;  4A2L A;  4NSX A;  3SN6 B;  3VA6 A;  3V5W B;  4O9D A;  4A09 B;  2IWK A;  3OKY B;  4R7A B;  4A7J A;  2HKM A;  4HDJ A;  5EAP A;  3BG0 A;  3IJC A;  4QQE A;  2UZX B;  5I5J A;  4D0K A;  4IMM A;  4Y7R A;  4FHL A;  4ZOV A;  5TF2 A;  2AGZ A;  5FLX g;  1RI6 A;  5C2W B;  3F3G A;  4ERY A;  3KRW B;  4AEZ A;  2AH0 A;  1B9Y A;  3I8C A;  3FRX A;  2IUP A;  4A08 B;  4J81 A;  4FAN D;  1MG2 A;  3CFV A;  4J78 A;  3JPX A;  5IJ8 E;  4A11 A;  5I5I A;  4A2M A;  3V9F A;  2AGY A;  4QRJ A;  5EML B;  4X60 B;  4LG9 A;  3SWS D;  4CI8 A;  5FKS A;  2H6N A;  3DSM A;  4CY3 A;  1OMW B;  5KDO B;  4JD2 C;  3CIK B;  1L0Q A;  3EU7 A;  3DXM C;  1GXR A;  3GRE A;  1A0R B;  5HE2 B;  4CY2 A;  2GNQ A;  4FA4 D;  5EAR A;  2I0T A;  4GMB A;  3I7N A;  3UVO A;  3C75 H;  3RN1 D;  3K26 A;  4ZOY A;  1R5M A;  4CY1 A;  5GXI A;  3JRO A;  5TDH B;  2AGW A;  5H14 A;  1PGU A;  3EI1 A;  2P9P C;  4U7A A;  3JZH A;  4J86 A;  3UVM A;  1OLZ A;  4D6V A;  3EI2 A;  3PE7 A;  4TZ4 A;  4U1E I;  2W18 A;  2OJY A;  3FGB A;  2XYI A;  2IWF A;  5HE3 B;  1P22 A;  4YVD A;  2P9L C;  2XL3 A;  4ES0 A;  4J8B A;  2YMU A;  3PXT D;  5TEE A;  1YFQ A;  3OL2 A;  5AMS A;  2HJ4 A;  3AH8 B;  3L4M D;  2IUR A;  1U2V C;  4E5Z A;  3SHF A;  3UKR C;  4JSN C;  4QT8 A;  4PBZ A;  3EWE A;  5CXB A;  3RFG A;  2OK4 A;  3I8E A;  3FM0 A;  4L1Q D;  4L3H D;  2IUQ A;  5EM2 A;  3PXW D;  1Q47 A;  4CZX A;  1QNI A;  5B4W A;  3I89 A;  3OL2 B;  2EBS A;  5EAL A;  3CFS B;  2BBK H;  2P9K C;  3OW8 A;  1NR0 A;  2I0R A;  4JT6 C;  3RRM C;  5K1C C;  3AFC A;  3RSE C;  3SBQ A;  4FB1 D;  3F3F A;  5C9Z B;  1SQ9 A;  2B4E A;  3JB9 L;  1PEV A;  4JSV C;  4ERQ A;  5CXB B;  3JAM g;  5CYK A;  1MDA H;  4UI9 R;  3MXX A;  5A2Q g;  3RN0 D;  5EM2 B;  3IIY A;  2AGX A;  4GGD A;  2P9U C;  4FA5 D;  5GMK n;  2H47 A;  5HE1 B;  1XHM A;  4OWR A;  3SLE D;  2IAA A;  3ULE C;  4J82 A;  3I7K A;  3B7F A;  1ERJ A;  2GC7 A;  2PM7 B;  2Q7Q A;  2PM6 B;  4ZOZ A;  3C5M A;  4O3T B;  5FA5 B;  5FKR A;  2J55 H;  3I7L A;  3NVX A;  3DM0 A;  4GM8 A;  4GGA A;  3SFZ A;  5EMM B;  2GC4 A;  5CYK B;  2I0S A;  3C9C A;  4G56 B;  3AL9 A;  4A0B A;  2UZY B;  3PSL A;  4GZ8 A;  5GSA A;  3EI3 A;  2OVQ B;  4O1Q D;  4CY5 A;  3I2N A;  5IGO A;  4A11 B;  3BWS A;  5EMJ B;  2H14 A;  3C99 A;  4PSW B;  1PBY B;  2OIZ A;  3IJ1 A;  5TEF A;  1K32 A;  3NVQ A;  2TRC B;  1JOF A;  4J8G A;  5THA A;  3SBR A;  4XYI A;  1K8K C;  3JRP A;  5HE0 B;  2YNP A;  3UVN A;  5C2V B;  3J81 g;  4MK0 B;  3JZN A;  4CI3 A;  3EI3 B;  3SBP A;  3PXS D;  3VGZ A;  4J84 A;  4LG8 A;  1N6F A;  2QC5 A;  3EI4 A;  4XEI C;  4GQ2 P; 
#chains in the Genus database with same CATH topology
 1U4C A;  5K19 A;  1PI6 A;  4AOW A;  2BCJ B;  2XE4 A;  3EI1 B;  3NVN A;  4EWR A;  2H9M A;  3PVW B;  4O45 A;  3EI2 B;  4GQ1 A;  2O9K A;  3SVW D;  5FQD A;  3IKO A;  3GD1 I;  4G1E A;  2HKR A;  3ORV D;  2J56 H;  3J80 g;  4FA9 D;  3PSC B;  1UOO A;  4OZU A;  2H68 A;  2I3S A;  4CZV A;  3SCY A;  2P9S C;  4PC0 A;  4X61 B;  2H13 A;  3RLM D;  4ERZ A;  3IJ0 A;  2G99 A;  3V7D B;  4J79 A;  2CO0 C;  1E8N A;  3EI4 B;  3V4V A;  5SXM A;  4L3G D;  3SXT D;  2Z2N A;  4A0A A;  2H3X A;  4E5Z B;  4JSP C;  2PBI B;  2HJB A;  5M5R A;  1E8M A;  4JHP C;  5E6S A;  3PVU B;  1E5T A;  5FXY A;  3ZE0 A;  2HXC A;  4WK4 A;  4G55 A;  2HYE A;  1NEX B;  2MTA H;  5M5V A;  3UR4 A;  4A08 A;  4E54 A;  3F3P A;  1GG2 B;  4BL0 A;  3EG6 A;  4LGN A;  5I5M A;  2YNN A;  3OKW A;  3O4J A;  4H5I A;  2VC2 A;  4AN0 A;  4O3U B;  3AL8 A;  1MG3 A;  3FCU A;  2YB8 B;  3EMH A;  3NIG A;  3ZDX A;  4X63 B;  1QFM A;  4J87 A;  4AMY A;  2B5M A;  4UM8 A;  5CXC A;  3IIW A;  2EIB A;  4BH6 A;  3I7H A;  3N0D A;  4A0A B;  4PBY A;  2P9I C;  3L4O D;  1UOQ A;  4WJK A;  4GQ2 P;  4GM9 A;  4CC9 A;  3MZL A;  2J57 G;  2IUV A;  4BUJ C;  3GFC A;  2H9P A;  4E54 B;  5JWZ A;  3K27 A;  1SQJ A;  3I7P A;  2OVR B;  3RMZ D;  2YNO A;  3ODT A;  3QHY B;  3MMY A;  4X3E A;  4Z7O A;  3EQ7 A;  2B5N A;  1JMX B;  1N6E A;  3A0F A;  1T2X A;  1SHY B;  3AL8 B;  4KFM B;  1XIP A;  2AH1 A;  1GOT B;  2CE9 A;  3DWL C;  5H17 A;  2CNX A;  1TBG A;  1FWX A;  5CXC B;  2HES X;  3DDU A;  3SJL D;  2I3T A;  5FKT A;  3IUQ A;  2B5L A;  1VE7 A;  3P4F A;  2Z2P A;  4FAV D;  2OK6 A;  3O4G A;  1K3I A;  4ESG A;  4PXW A;  4GGC A;  3MZK A;  3W15 A;  2VZ3 A;  1VE6 A;  3IUM A;  4FA1 D;  4K3I D;  2H6Q A;  2XL2 A;  3EQ8 A;  4Z7Q A;  5IC7 A;  3UVL A;  4I79 A;  1JJU B;  3K6S A;  5FFO A;  2CN2 A;  4A0B B;  3IJE A;  1L5G A;  1S4U X;  3KRX B;  4BCC A;  2XZG A;  2Z2O A;  5GXH A;  4Y5R D;  5HYN B;  3E0C A;  2AQ5 A;  5AFU 3;  4H5J A;  1N6D A;  1GP2 B;  5FKQ A;  2CE8 A;  2PM9 A;  4PNK B;  4QL1 A;  1A12 A;  3HFQ A;  2P9N C;  4K3J B;  4O02 A;  2CN3 A;  2H9L A;  5AJA A;  4JSX C;  4CI1 A;  5EAM A;  3MUN A;  1JMZ B;  5HQG A;  5E6R A;  1TYQ C;  1H2X A;  3MKQ A;  3SMR A;  3DXK C;  4ZN4 A;  3BG1 A;  5E6U A;  5IT9 g;  4RE6 A;  3FCS A;  2G9A A;  3NIF A;  2YBA A;  2HU5 A;  3K71 A;  4L9O A;  2CO0 A;  3I7O A;  3OKY A;  4A09 A;  3JZG A;  2VDM A;  4J0W A;  2QXV A;  5EMK B;  4ZOX A;  1XKS A;  2VDO A;  2VDR A;  4J73 A;  4NEN A;  3RFH A;  2PM9 B;  4G1M A;  4JHN A;  4CI2 A;  5H1M A;  4J0X A;  4CZY A;  2XU7 A;  4Z8L A;  3MKS B;  5IJ7 E;  5M5U A;  4N14 A;  4GQB B;  3VH0 A;  5IGQ A;  4GM3 A;  3ZDZ A;  3N0E A;  4XYH A;  3OTT A;  4JT5 C;  2VDN A;  3U4Y A;  2AGL A;  4PSX B;  4IA9 A;  3OKT A;  4JXM A;  3K72 A;  3ZWL B;  4J77 A;  3UKU C;  4FWW A;  3UVK A;  5M5S A;  1B9X A;  1VYH C;  2OVP B;  2H6K A;  2H9N A;  4A2L A;  4NSX A;  3SN6 B;  4BCD A;  3VA6 A;  3V5W B;  4O9D A;  3IUJ A;  2IWK A;  3OKY B;  4R7A B;  3ZDY A;  4A7J A;  4A09 B;  2HKM A;  4HDJ A;  5EAP A;  2EIC A;  2VDP A;  3BG0 A;  3IJC A;  4QQE A;  3OF7 A;  2UZX B;  5I5J A;  4D0K A;  2EIE A;  4IMM A;  4Y7R A;  1GOG A;  4FHL A;  4ZOV A;  5TF2 A;  2QZP A;  2AGZ A;  5FLX g;  1RI6 A;  5C2W B;  3F3G A;  4ERY A;  3KRW B;  4AEZ A;  2AH0 A;  1B9Y A;  3I8C A;  3FRX A;  1QFS A;  2IUP A;  4A08 B;  4J81 A;  4FAN D;  1MG2 A;  4IRZ A;  3CFV A;  4J78 A;  3JPX A;  4UM9 A;  5IJ8 E;  4A11 A;  5I5I A;  1H2Y A;  4A2M A;  3V9F A;  2VDQ A;  2AGY A;  4QRJ A;  5EML B;  4X60 B;  4LG9 A;  4WK0 A;  3SWS D;  4CI8 A;  5FKS A;  2H6N A;  3DSM A;  4RE5 A;  4CY3 A;  1OMW B;  2BKL A;  5KDO B;  4DNU A;  4MMZ A;  4BP9 A;  4JD2 C;  3CIK B;  1L0Q A;  4D9S A;  3EU7 A;  3DXM C;  1GXR A;  1C9I A;  3GRE A;  4BP8 A;  1M1X A;  1A0R B;  5HE2 B;  4CY2 A;  2GNQ A;  5M61 A;  4FA4 D;  5EAR A;  2I0T A;  4GMB A;  3I7N A;  3UVO A;  3C75 H;  3RN1 D;  3K26 A;  4ZOY A;  1R5M A;  4CY1 A;  5GXI A;  4NAA A;  3JRO A;  5TDH B;  2AGW A;  3IUR A;  1BPO A;  3ZE2 A;  5H14 A;  1PGU A;  3EI1 A;  2P9P C;  4U7A A;  3JZH A;  4J86 A;  1YR2 A;  3UVM A;  1O6G A;  3KCI A;  1OLZ A;  3NID A;  4D6V A;  3EI2 A;  3PE7 A;  4TZ4 A;  4U1E I;  2HU7 A;  2W18 A;  2OJY A;  3FGB A;  4NBM A;  2XYI A;  4AMZ A;  2IWF A;  3IUL A;  5HE3 B;  5C92 A;  1P22 A;  4YVD A;  4WK2 A;  4O2W A;  2P9L C;  2XL3 A;  3T3M A;  4ES0 A;  3O4I A;  4J8B A;  2QR5 A;  2HU8 A;  2YMU A;  3PXT D;  4L1M A;  5TEE A;  1YFQ A;  1UOP A;  3OL2 A;  5AMS A;  2HJ4 A;  3AH8 B;  3L4M D;  2IUR A;  1U2V C;  4E5Z A;  3SHF A;  3UKR C;  1I2M B;  4JSN C;  4QT8 A;  4PBZ A;  3EWE A;  1JV2 A;  5CXB A;  3VI4 A;  3RFG A;  2OK4 A;  1H2W A;  3I8E A;  3MVD K;  3FM0 A;  4L1Q D;  4L3H D;  2IUQ A;  3MUO A;  5EM2 A;  3PXW D;  1Q47 A;  4DNV A;  4CZX A;  1QNI A;  3O4H A;  5B4W A;  3I89 A;  2XDW A;  3OL2 B;  2EBS A;  1JTD B;  5EAL A;  3VI3 A;  3CFS B;  2BBK H;  2P9K C;  3OW8 A;  1NR0 A;  2I0R A;  4JT6 C;  3RRM C;  5K1C C;  3AFC A;  3RSE C;  3IVM A;  3IUN A;  3SBQ A;  4FB1 D;  3F3F A;  5C9Z B;  1SQ9 A;  2B4E A;  3JB9 L;  1PEV A;  4MMX A;  4JSV C;  4ERQ A;  5CXB B;  5HDB A;  3JAM g;  1U8C A;  5CYK A;  1MDA H;  4UI9 R;  3MXX A;  5A2Q g;  2WQ8 A;  5M5T A;  2JKX A;  4NC4 A;  3RN0 D;  5EM2 B;  3IIY A;  2AGX A;  4GGD A;  2P9U C;  4FA5 D;  5GMK n;  2H47 A;  2VZ1 A;  5HE1 B;  2VDK A;  4AN1 A;  1XHM A;  4OWR A;  3SLE D;  2IAA A;  3ULE C;  4J82 A;  3I7K A;  3B7F A;  1ERJ A;  2GC7 A;  2PM7 B;  3T3P A;  2Q7Q A;  2PM6 B;  4ZOZ A;  3C5M A;  4O3T B;  5FA5 B;  4MMY A;  5FKR A;  4AX4 A;  2J55 H;  3I7L A;  3NVX A;  3DM0 A;  4BCB A;  4GM8 A;  4GGA A;  3SFZ A;  5EMM B;  2GC4 A;  5CYK B;  2I0S A;  1C9L A;  3C9C A;  4G56 B;  4QAM A;  3AL9 A;  1VZ2 A;  4A0B A;  2UZY B;  3PSL A;  4GZ8 A;  5GSA A;  3EI3 A;  1TYE A;  1UTC A;  3QI0 A;  2OVQ B;  3GC3 B;  4O1Q D;  4CY5 A;  3I2N A;  5IGO A;  4A11 B;  3BWS A;  5EMJ B;  1O6F A;  2H14 A;  3C99 A;  5FFG A;  4PSW B;  1PBY B;  4DNW A;  1GOH A;  3EQ9 A;  2OIZ A;  3IJ1 A;  5TEF A;  3ZE1 A;  1K32 A;  3NVQ A;  5C86 A;  2TRC B;  1JOF A;  4J8G A;  5THA A;  3SBR A;  4XYI A;  1K8K C;  5HE0 B;  2VDL A;  2YNP A;  3UVN A;  5C2V B;  3J81 g;  1H2Z A;  4MK0 B;  3JZN A;  4CI3 A;  1VZ3 A;  3EI3 B;  3SBP A;  3V4P A;  3PXS D;  3VGZ A;  4Z7N A;  4J84 A;  4LG8 A;  1GOF A;  2EID A;  1N6F A;  2QC5 A;  3EI4 A;  4XEI C;  3JRP A; 
#chains in the Genus database with same CATH homology
 1U4C A;  5K19 A;  1PI6 A;  4AOW A;  2BCJ B;  3EI1 B;  3NVN A;  4EWR A;  2H9M A;  3PVW B;  4O45 A;  3EI2 B;  4GQ1 A;  2O9K A;  3SVW D;  5FQD A;  3IKO A;  2HKR A;  3ORV D;  2J56 H;  3J80 g;  4FA9 D;  3PSC B;  4OZU A;  2H68 A;  2I3S A;  4CZV A;  3SCY A;  2P9S C;  4PC0 A;  4X61 B;  2H13 A;  3RLM D;  4ERZ A;  3IJ0 A;  2G99 A;  3V7D B;  4J79 A;  2CO0 C;  3EI4 B;  5SXM A;  4L3G D;  3SXT D;  2Z2N A;  4A0A A;  2H3X A;  4E5Z B;  4JSP C;  2PBI B;  2HJB A;  3PVU B;  5FXY A;  2HXC A;  2HYE A;  1NEX B;  2MTA H;  3UR4 A;  4A08 A;  4E54 A;  3F3P A;  1GG2 B;  4BL0 A;  3EG6 A;  4LGN A;  5I5M A;  2YNN A;  3OKW A;  4H5I A;  4O3U B;  3AL8 A;  1MG3 A;  2YB8 B;  3EMH A;  4X63 B;  4J87 A;  2B5M A;  5CXC A;  3IIW A;  4BH6 A;  3I7H A;  3N0D A;  4A0A B;  4PBY A;  2P9I C;  3L4O D;  4GM9 A;  4CC9 A;  3MZL A;  2J57 G;  2IUV A;  4BUJ C;  3GFC A;  2H9P A;  4E54 B;  5JWZ A;  3K27 A;  1SQJ A;  3I7P A;  2OVR B;  3RMZ D;  2YNO A;  3ODT A;  3MMY A;  4X3E A;  2B5N A;  1JMX B;  1N6E A;  3A0F A;  3AL8 B;  4KFM B;  1SHY B;  1XIP A;  2AH1 A;  1GOT B;  2CE9 A;  3DWL C;  5H17 A;  2CNX A;  1TBG A;  1FWX A;  5CXC B;  2HES X;  3SJL D;  2I3T A;  5FKT A;  2B5L A;  3P4F A;  2Z2P A;  4FAV D;  2OK6 A;  4ESG A;  4PXW A;  4GGC A;  3MZK A;  3W15 A;  4FA1 D;  4K3I D;  2H6Q A;  2XL2 A;  5IC7 A;  3UVL A;  4I79 A;  1JJU B;  4A0B B;  2CN2 A;  1S4U X;  3KRX B;  2Z2O A;  5GXH A;  4Y5R D;  5HYN B;  3E0C A;  2AQ5 A;  5AFU 3;  4H5J A;  1N6D A;  1GP2 B;  5FKQ A;  2CE8 A;  2PM9 A;  4PNK B;  4QL1 A;  3HFQ A;  2P9N C;  4K3J B;  2CN3 A;  2H9L A;  5AJA A;  4JSX C;  4CI1 A;  5EAM A;  1JMZ B;  5HQG A;  1TYQ C;  3MKQ A;  3SMR A;  3DXK C;  4ZN4 A;  3BG1 A;  5IT9 g;  2G9A A;  2YBA A;  4L9O A;  2CO0 A;  3I7O A;  3OKY A;  4A09 A;  3JZG A;  4J0W A;  2QXV A;  5EMK B;  4ZOX A;  1XKS A;  4J73 A;  3RFH A;  2PM9 B;  4CI2 A;  5H1M A;  4J0X A;  4CZY A;  2XU7 A;  4Z8L A;  3MKS B;  5IJ7 E;  3VH0 A;  4N14 A;  4GQB B;  5IGQ A;  4GM3 A;  3N0E A;  4XYH A;  3OTT A;  4JT5 C;  3U4Y A;  2AGL A;  4PSX B;  4IA9 A;  3OKT A;  4JXM A;  3ZWL B;  4J77 A;  3UKU C;  4FWW A;  3UVK A;  1B9X A;  1VYH C;  2OVP B;  2H6K A;  2H9N A;  4A2L A;  4NSX A;  3SN6 B;  3VA6 A;  3V5W B;  4O9D A;  4A09 B;  2IWK A;  3OKY B;  4R7A B;  4A7J A;  2HKM A;  4HDJ A;  5EAP A;  3BG0 A;  3IJC A;  4QQE A;  2UZX B;  5I5J A;  4D0K A;  4IMM A;  4Y7R A;  4FHL A;  4ZOV A;  5TF2 A;  2AGZ A;  5FLX g;  1RI6 A;  5C2W B;  3F3G A;  4ERY A;  3KRW B;  4AEZ A;  2AH0 A;  1B9Y A;  3I8C A;  3FRX A;  2IUP A;  4A08 B;  4J81 A;  4FAN D;  1MG2 A;  3CFV A;  4J78 A;  3JPX A;  5IJ8 E;  4A11 A;  5I5I A;  4A2M A;  3V9F A;  2AGY A;  4QRJ A;  5EML B;  4X60 B;  4LG9 A;  3SWS D;  4CI8 A;  5FKS A;  2H6N A;  3DSM A;  4CY3 A;  1OMW B;  5KDO B;  4JD2 C;  3CIK B;  1L0Q A;  3EU7 A;  3DXM C;  1GXR A;  3GRE A;  1A0R B;  5HE2 B;  4CY2 A;  2GNQ A;  4FA4 D;  5EAR A;  2I0T A;  4GMB A;  3I7N A;  3UVO A;  3C75 H;  3RN1 D;  3K26 A;  4ZOY A;  1R5M A;  4CY1 A;  5GXI A;  3JRO A;  5TDH B;  2AGW A;  5H14 A;  1PGU A;  3EI1 A;  2P9P C;  4U7A A;  3JZH A;  4J86 A;  3UVM A;  1OLZ A;  4D6V A;  3EI2 A;  3PE7 A;  4TZ4 A;  4U1E I;  2W18 A;  2OJY A;  3FGB A;  2XYI A;  2IWF A;  5HE3 B;  1P22 A;  4YVD A;  2P9L C;  2XL3 A;  4ES0 A;  4J8B A;  2YMU A;  3PXT D;  5TEE A;  1YFQ A;  3OL2 A;  5AMS A;  2HJ4 A;  3AH8 B;  3L4M D;  2IUR A;  1U2V C;  4E5Z A;  3SHF A;  3UKR C;  4JSN C;  4QT8 A;  4PBZ A;  3EWE A;  5CXB A;  3RFG A;  2OK4 A;  3I8E A;  3FM0 A;  4L1Q D;  4L3H D;  2IUQ A;  5EM2 A;  3PXW D;  1Q47 A;  4CZX A;  1QNI A;  5B4W A;  3I89 A;  3OL2 B;  2EBS A;  5EAL A;  3CFS B;  2BBK H;  2P9K C;  3OW8 A;  1NR0 A;  2I0R A;  4JT6 C;  3RRM C;  5K1C C;  3AFC A;  3RSE C;  3SBQ A;  4FB1 D;  3F3F A;  5C9Z B;  1SQ9 A;  2B4E A;  3JB9 L;  1PEV A;  4JSV C;  4ERQ A;  5CXB B;  3JAM g;  5CYK A;  1MDA H;  4UI9 R;  3MXX A;  5A2Q g;  3RN0 D;  5EM2 B;  3IIY A;  2AGX A;  4GGD A;  2P9U C;  4FA5 D;  5GMK n;  2H47 A;  5HE1 B;  1XHM A;  4OWR A;  3SLE D;  2IAA A;  3ULE C;  4J82 A;  3I7K A;  3B7F A;  1ERJ A;  2GC7 A;  2PM7 B;  2Q7Q A;  2PM6 B;  4ZOZ A;  3C5M A;  4O3T B;  5FA5 B;  5FKR A;  2J55 H;  3I7L A;  3NVX A;  3DM0 A;  4GM8 A;  4GGA A;  3SFZ A;  5EMM B;  2GC4 A;  5CYK B;  2I0S A;  3C9C A;  4G56 B;  3AL9 A;  4A0B A;  2UZY B;  3PSL A;  4GZ8 A;  5GSA A;  3EI3 A;  2OVQ B;  4O1Q D;  4CY5 A;  3I2N A;  5IGO A;  4A11 B;  3BWS A;  5EMJ B;  2H14 A;  3C99 A;  4PSW B;  1PBY B;  2OIZ A;  3IJ1 A;  5TEF A;  1K32 A;  3NVQ A;  2TRC B;  1JOF A;  4J8G A;  5THA A;  3SBR A;  4XYI A;  1K8K C;  3JRP A;  5HE0 B;  2YNP A;  3UVN A;  5C2V B;  3J81 g;  4MK0 B;  3JZN A;  4CI3 A;  3EI3 B;  3SBP A;  3PXS D;  3VGZ A;  4J84 A;  4LG8 A;  1N6F A;  2QC5 A;  3EI4 A;  4XEI C;  4GQ2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...