4R7AB

Crystal structure of rbbp4 bound to phf6 peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
396
structure length
366
Chain Sequence
RVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 6
publication title Structural Basis of Plant Homeodomain Finger 6 (PHF6) Recognition by the Retinoblastoma Binding Protein 4 (RBBP4) Component of the Nucleosome Remodeling and Deacetylase (NuRD) Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 98
structure length 366
sequence length 396
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4r7aB00
3AFCA 1SHYB 2H9NA 4FA4D 2OVRB 2I3TA 1TBGA 5HYNB 2J55H 3UVLA 2AQ5A 4X60B 4ZOZA 3JZHA 3PVUB 4YVDA 1S4UX 2CE9A 5CYKA 5TEFA 3I89A 4ESGA 1JMXB 4XYHA 1SQ9A 3SCYA 4A09A 2HXCA 2H9PA 2YNPA 4Z8LA 3UR4A 4JT6C 4X3EA 4CY1A 2BCJB 3OKYB 3SXTD 3PSCB 3E0CA 3EI3B 3HFQA 1OLZA 3BG0A 2IUPA 2CNXA 4X61B 4J86A 2Z2PA 4A0BA 3CIKB 1A0RB 3K27A 4AEZA 3OL2A 1RI6A 3ULEC 3I2NA 5FXYA 3DSMA 1GOTB 4J0WA 2H3XA 4MK0B 3DWLC 4CZYA 1MG3A 4J82A 4ES0A 3I7KA 3L4MD 2P9LC 2I0SA 3MXXA 1JOFA 3BWSA 4IMMA 5EAMA 5EMMB 3PXTD 5CXCB 2AGZA 4GM3A 3EMHA 4IA9A 4A11A 4A08A 4O1QD 5SXMA 5K19A 3F3PA 3A0FA 5IJ7E 3I7PA 2H6KA 4GQ1A 5AJAA 1SQJA 4BH6A 4GGAA 3SWSD 4GGDA 1GXRA 4A0AA 3B7FA 5EMLB 4FA5D 3VH0A 2G99A 3I7LA 4O9DA 5THAA 4J84A 2QXVA 2UZYB 2XU7A 3SFZA 3J81g 4OZUA 5TF2A 2AGXA 2OIZA 3FM0A 3BG1A 2PBIB 3SJLD 5IT9g 3N0EA 3RFGA 3SVWD 2GC7A 5FKQA 3EWEA 5KDOB 4ZOXA 2QC5A 2P9SC 5IJ8E 3FGBA 3PSLA 3JROA 3V7DB 4E54B 5CXBA 2B5LA 5JWZA 4JD2C 3JPXA 3EI2B 2HKMA 5C2VB 5GXIA 4NSXA 4CZXA 2IWFA 3IIWA 2OJYA 3FRXA 4UI9R 2GC4A 4D6VA 3C99A 4A0BB 5GSAA 3RSEC 4OWRA 3OL2B 3SMRA 4PSXB 4XYIA 4CI3A 1YFQA 3IJ1A 4J81A 3UVMA 4U1EI 5HE0B 3JAMg 5H14A 3PVWB 3RFHA 4FHLA 4J8GA 4E54A 2TRCB 4H5JA 4JSVC 5FKRA 2Z2NA 4ERYA 2Z2OA 4PC0A 1NEXB 5IGOA 5HE3B 2BBKH 4GQBB 3EI2A 3OTTA 4A11B 4A08B 3UVNA 1VYHC 4FA1D 2MTAH 3PE7A 3SBQA 4K3ID 4JSPC 3MMYA 2YNOA 4ERQA 2H9LA 2HYEA 4A2LA 4J77A 3EU7A 5GMKn 5FLXg 2YMUA 4U7AA 4A0AB 1MDAH 4A2MA 3EI4B 2AH1A 4LG8A 3AL9A 4PBZA 2P9IC 1FWXA 5FKSA 3EI1B 4CI1A 5B4WA 1PEVA 3AH8B 2IURA 4J78A 3SBRA 2OK6A 4CY5A 1Q47A 4QRJA 2XYIA 1R5MA 2IWKA 1B9YA 4L3GD 3IJ0A 2PM9A 3ORVD 4ZN4A 2J57G 2W18A 2CN2A 2I0TA 3U4YA 5CXBB 2H68A 4FA9D 2Q7QA 3NVQA 3EI4A 5EALA 5C9ZB 3GREA 4GMBA 3EI1A 4CZVA 3I8CA 4FAND 3JRPA 3MZKA 4QQEA 4JSXC 1PGUA 2B5MA 5HE1B 2OVQB 3JB9L 4GQ2P 2H14A 1XIPA 3ZWLB 3V9FA 2YB8B 4BUJC 3SN6B 4CI2A 3I7NA 3DXKC 3VA6A 1ERJA 1NR0A 2O9KA 4ERZA 2IAAA 2H47A 4L1QD 2XL3A 3SLED 4D0KA 1N6FA 2G9AA 3I7HA 4TZ4A 2CN3A 2P9UC 1N6EA 1GP2B 1PI6A 2H9MA 3RMZD 2AGYA 3RN1D 2CE8A 3GFCA 4HDJA 1QNIA 5H1MA 3KRWB 4LGNA 2IUQA 2J56H 4L3HD 2XL2A 3C9CA 2AGLA 4L9OA 2YBAA 1JMZB 4J8BA 5FQDA 4J73A 3I8EA 3UKRC 4X63B 4O3TB 1K8KC 3JZNA 3PXSD 5EARA 1JJUB 5FA5B 3C75H 4O45A 4O3UB 4R7AB 4J79A 5EAPA 3AL8B 2P9PC 5A2Qg 2OVPB 2GNQA 2PM7B 2H6NA 2HKRA 3RLMD 1GG2B 5I5JA 3RN0D 5H17A 2PM9B 3IJCA 1L0QA 4QL1A 2P9NC 2AGWA 3SHFA 3F3FA 2H13A 4GGCA 4Y7RA 4Y5RD 3KRXB 3DXMC 2I3SA 4E5ZB 3OKWA 5HQGA 4G56B 3SBPA 4J87A 4N14A 3C5MA 5TEEA 4FB1D 3AL8A 4PNKB 3JZGA 3CFSB 1MG2A 4EWRA 4PSWB 3UVKA 2B4EA 3MKSB 5EMJB 3OW8A 4LG9A 1P22A 1B9XA 2IUVA 2UZXB 3K26A 4BL0A 5EM2B 2HJ4A 4JT5C 3EG6A 3RRMC 5AMSA 4I79A 3OKYA 4CY2A 5AFU3 2EBSA 3EI3A 1U4CA 4GZ8A 5IGQA 4ZOVA 5IC7A 4E5ZA 5GXHA 4J0XA 1TYQC 1XKSA 4PBYA 1U2VC 3OKTA 3W15A 3CFVA 4K3JB 5EMKB 4KFMB 4ZOYA 5C2WB 3MZLA 2CO0A 4JXMA 5FKTA 5I5IA 5I5MA 1K32A 3IIYA 4GM9A 3MKQA 3ODTA 4CY3A 2I0RA 3UVOA 3J80g 3L4OD 5HE2B 4FAVD 5EM2A 1XHMA 2CO0C 3DM0A 3VGZA 2HJBA 3IKOA 2HESX 5CXCA 2PM6B 4QT8A 1OMWB 2B5NA 3F3GA 3P4FA 1PBYB 4H5IA 5K1CC 3NVNA 3UKUC 2P9KC 3NVXA 4JSNC 2AH0A 5CYKB 3V5WB 4AOWA 4XEIC 4CC9A 4A7JA 4FWWA 2YNNA 4PXWA 4A09B 2H6QA 1N6DA 4CI8A 4GM8A 2OK4A 3N0DA 3I7OA 5TDHB 3PXWD
chains in the Genus database with same CATH superfamily
1M1XA 3AFCA 1BPOA 2VDKA 1SHYB 4WJKA 1E5TA 2H9NA 4FA4D 2OVRB 2I3TA 1UTCA 1GOGA 1TBGA 5HYNB 2J55H 3UVLA 5M5RA 4AMZA 2AQ5A 4X60B 1T2XA 4ZOZA 3ZE0A 3JZHA 3PVUB 4MMYA 4YVDA 3IUNA 1A12A 1S4UX 2CE9A 5CYKA 3VI3A 5TEFA 3I89A 4ESGA 1JMXB 2XZGA 4XYHA 1SQ9A 3FCSA 3SCYA 4A09A 3IJEA 1GOFA 4AX4A 2HXCA 2H9PA 2YNPA 1QFSA 3ZDXA 4Z8LA 3UR4A 4JT6C 4X3EA 4G55A 4CY1A 2BCJB 3OKYB 3SXTD 3PSCB 1L5GA 3E0CA 3EI3B 3GD1I 3HFQA 3IURA 1OLZA 3ZDZA 3BG0A 4BP8A 2IUPA 2CNXA 4X61B 4J86A 1UOOA 1U8CA 5E6SA 2Z2PA 4A0BA 3CIKB 1A0RB 3K27A 3NIFA 3K6SA 4AEZA 3OL2A 1RI6A 3ULEC 3I2NA 5FXYA 3DSMA 2HU5A 1GOTB 4J0WA 2H3XA 4MK0B 3O4IA 2VC2A 3DWLC 4CZYA 1H2XA 1MG3A 4J82A 4ES0A 3I7KA 3L4MD 2P9LC 3GC3B 2I0SA 3MXXA 1JOFA 3BWSA 4IMMA 5EAMA 5EMMB 3PXTD 5CXCB 2AGZA 4GM3A 1H2ZA 3EMHA 4IA9A 4A11A 4DNVA 4A08A 2VDRA 4O1QD 5E6RA 5SXMA 5K19A 3F3PA 3A0FA 5IJ7E 3I7PA 2H6KA 4GQ1A 5AJAA 1SQJA 4BH6A 4GGAA 3SWSD 4GGDA 1GXRA 1C9LA 4JHNA 4MMZA 4A0AA 3B7FA 1E8NA 5EMLB 4FA5D 3VH0A 2G99A 1I2MB 3I7LA 4O9DA 5THAA 4J84A 2QXVA 2UZYB 2XU7A 3SFZA 3J81g 3EQ8A 4OZUA 5TF2A 4Z7QA 3MUNA 2AGXA 2OIZA 3IULA 3FM0A 3BG1A 2QZPA 2PBIB 3SJLD 5IT9g 1K3IA 3N0EA 5M61A 3RFGA 3SVWD 3O4HA 2GC7A 5FKQA 3EWEA 5KDOB 4ZOXA 2QC5A 2P9SC 3QHYB 5IJ8E 3FGBA 3PSLA 3JROA 3V7DB 4E54B 5CXBA 3O4JA 2B5LA 3IVMA 5JWZA 4JD2C 5HDBA 2EICA 3JPXA 3EI2B 2HKMA 5C2VB 1VZ2A 5GXIA 5M5SA 4NSXA 4CZXA 2IWFA 3IUJA 4WK2A 4DNUA 3IIWA 1GOHA 2OJYA 3FRXA 4UI9R 2GC4A 4D6VA 3C99A 4A0BB 5GSAA 3RSEC 3DDUA 4OWRA 3OL2B 5M5TA 3SMRA 4PSXB 4XYIA 4CI3A 1YFQA 3IJ1A 4J81A 3UVMA 1C9IA 4U1EI 5HE0B 3JAMg 5H14A 3PVWB 3RFHA 2VZ1A 4FHLA 4J8GA 2TRCB 4E54A 3V4PA 4H5JA 4UM9A 4JSVC 5FKRA 2Z2NA 4ERYA 4NC4A 2Z2OA 4PC0A 1NEXB 3K72A 5IGOA 5HE3B 2BBKH 4GQBB 4Z7NA 3EI2A 3OTTA 3ZE1A 4A11B 4A08B 3UVNA 1VYHC 4FA1D 2MTAH 3PE7A 3SBQA 4K3ID 4JSPC 4NBMA 3MMYA 2YNOA 4ERQA 2H9LA 2HYEA 3EQ7A 4A2LA 3ZDYA 4J77A 3EU7A 5GMKn 5FLXg 2YMUA 4U7AA 4QAMA 4A0AB 1MDAH 4A2MA 3EI4B 2AH1A 4LG8A 3AL9A 4BP9A 5M5UA 4PBZA 2P9IC 1FWXA 5FKSA 3EI1B 4L1MA 4CI1A 5B4WA 1PEVA 3AH8B 4RE6A 2IURA 4J78A 3SBRA 4O02A 2OK6A 4CY5A 1Q47A 2WQ8A 4QRJA 2XYIA 1R5MA 2IWKA 1B9YA 4L3GD 3IJ0A 2PM9A 3ORVD 3K71A 3MUOA 4ZN4A 2J57G 2W18A 5FFOA 1UOQA 4BCDA 2CN2A 2I0TA 3U4YA 5CXBB 2H68A 2VDNA 4FA9D 2Q7QA 3NVQA 3EI4A 1QFMA 5EALA 5C9ZB 3GREA 4GMBA 2VDPA 4WK4A 3EI1A 4CZVA 3I8CA 4FAND 3JRPA 2HU8A 3MZKA 4QQEA 4JSXC 1PGUA 2B5MA 5HE1B 2OVQB 3JB9L 2H14A 4GQ2P 1XIPA 3ZWLB 3V9FA 2YB8B 4BUJC 3SN6B 4D9SA 4CI2A 3I7NA 3DXKC 3VA6A 1ERJA 1NR0A 2O9KA 4AN0A 4ERZA 2IAAA 2HU7A 2H47A 2VDLA 5E6UA 4L1QD 2XL3A 3SLED 4D0KA 1N6FA 2G9AA 3I7HA 4MMXA 4TZ4A 2CN3A 2P9UC 1N6EA 1GP2B 1PI6A 3ZE2A 2H9MA 3RMZD 2EIBA 2AGYA 3RN1D 2CE8A 3GFCA 1O6GA 4HDJA 1QNIA 5H1MA 3VI4A 4G1MA 4RE5A 3KRWB 4LGNA 2IUQA 2J56H 4IRZA 4L3HD 2XL2A 3C9CA 2AGLA 4L9OA 1TYEA 1JMZB 2YBAA 4J8BA 5FQDA 4J73A 3I8EA 3KCIA 3UKRC 4X63B 2BKLA 4O3TB 1K8KC 3JZNA 4AMYA 3PXSD 5EARA 1JJUB 5FA5B 3C75H 4O45A 4O3UB 4R7AB 4J79A 5EAPA 3AL8B 2P9PC 1UOPA 5A2Qg 2OVPB 2GNQA 2PM7B 3IUMA 2EIEA 2H6NA 2HKRA 3RLMD 2XDWA 3T3PA 1GG2B 5I5JA 3RN0D 1VE7A 5H17A 3EQ9A 2PM9B 3IJCA 3IUQA 1L0QA 4QL1A 1VE6A 2P9NC 2AGWA 3SHFA 3F3FA 2H13A 4GGCA 4NENA 4WK0A 4Y7RA 4Y5RD 3KRXB 3DXMC 3T3MA 2I3SA 2XE4A 4E5ZB 3OKWA 5HQGA 4G56B 3SBPA 4J87A 4N14A 3C5MA 5TEEA 4FB1D 3AL8A 4PNKB 3JZGA 2EIDA 3CFSB 1MG2A 5C92A 4EWRA 5M5VA 4PSWB 4G1EA 1YR2A 3UVKA 2B4EA 3MKSB 5EMJB 3OW8A 3O4GA 4LG9A 2VZ3A 5C86A 1P22A 1O6FA 1B9XA 3MVDK 2IUVA 2UZXB 3K26A 4BL0A 5EM2B 2HJ4A 4JT5C 3EG6A 3RRMC 3NIGA 5AMSA 3OF7A 4I79A 3OKYA 4BCCA 4CY2A 5AFU3 2EBSA 4DNWA 3EI3A 1U4CA 1JTDB 4GZ8A 5IGQA 4ZOVA 5IC7A 4E5ZA 5GXHA 4J0XA 1TYQC 1XKSA 4O2WA 4PBYA 1U2VC 3OKTA 3W15A 3CFVA 4K3JB 5EMKB 1VZ3A 4KFMB 4ZOYA 5C2WB 3MZLA 2CO0A 4JXMA 5FKTA 5I5IA 5I5MA 1K32A 3IIYA 4GM9A 3MKQA 2VDQA 4UM8A 3ODTA 4CY3A 2I0RA 3UVOA 3J80g 3L4OD 5HE2B 5FFGA 4FAVD 5EM2A 1XHMA 2CO0C 3DM0A 3VGZA 2HJBA 4Z7OA 3NIDA 1E8MA 3IKOA 3QI0A 2HESX 5CXCA 2PM6B 4QT8A 1OMWB 2B5NA 2VDMA 3F3GA 3P4FA 1PBYB 4H5IA 5K1CC 3NVNA 3UKUC 2QR5A 2P9KC 3NVXA 4JSNC 2AH0A 5CYKB 3V5WB 4AOWA 4XEIC 1JV2A 4BCBA 4JHPC 4CC9A 4A7JA 4FWWA 1H2YA 2YNNA 4NAAA 4PXWA 4A09B 3FCUA 2H6QA 1N6DA 4AN1A 4CI8A 4GM8A 2JKXA 2OK4A 1H2WA 3N0DA 2VDOA 3I7OA 3V4VA 5TDHB 3PXWD
chains in the Genus database with same CATH topology
3AFCA 1SHYB 2H9NA 4FA4D 2OVRB 2I3TA 1TBGA 5HYNB 2J55H 3UVLA 2AQ5A 4X60B 4ZOZA 3JZHA 3PVUB 4YVDA 1S4UX 2CE9A 5CYKA 5TEFA 3I89A 4ESGA 1JMXB 4XYHA 1SQ9A 3SCYA 4A09A 2HXCA 2H9PA 2YNPA 4Z8LA 3UR4A 4JT6C 4X3EA 4CY1A 2BCJB 3OKYB 3SXTD 3PSCB 3E0CA 3EI3B 3HFQA 1OLZA 3BG0A 2IUPA 2CNXA 4X61B 4J86A 2Z2PA 4A0BA 3CIKB 1A0RB 3K27A 4AEZA 3OL2A 1RI6A 3ULEC 3I2NA 5FXYA 3DSMA 1GOTB 4J0WA 2H3XA 4MK0B 3DWLC 4CZYA 1MG3A 4J82A 4ES0A 3I7KA 3L4MD 2P9LC 2I0SA 3MXXA 1JOFA 3BWSA 4IMMA 5EAMA 5EMMB 3PXTD 5CXCB 2AGZA 4GM3A 3EMHA 4IA9A 4A11A 4A08A 4O1QD 5SXMA 5K19A 3F3PA 3A0FA 5IJ7E 3I7PA 2H6KA 4GQ1A 5AJAA 1SQJA 4BH6A 4GGAA 3SWSD 4GGDA 1GXRA 4A0AA 3B7FA 5EMLB 4FA5D 3VH0A 2G99A 3I7LA 4O9DA 5THAA 4J84A 2QXVA 2UZYB 2XU7A 3SFZA 3J81g 4OZUA 5TF2A 2AGXA 2OIZA 3FM0A 3BG1A 2PBIB 3SJLD 5IT9g 3N0EA 3RFGA 3SVWD 2GC7A 5FKQA 3EWEA 5KDOB 4ZOXA 2QC5A 2P9SC 5IJ8E 3FGBA 3PSLA 3JROA 3V7DB 4E54B 5CXBA 2B5LA 5JWZA 4JD2C 3JPXA 3EI2B 2HKMA 5C2VB 5GXIA 4NSXA 4CZXA 2IWFA 3IIWA 2OJYA 3FRXA 4UI9R 2GC4A 4D6VA 3C99A 4A0BB 5GSAA 3RSEC 4OWRA 3OL2B 3SMRA 4PSXB 4XYIA 4CI3A 1YFQA 3IJ1A 4J81A 3UVMA 4U1EI 5HE0B 3JAMg 5H14A 3PVWB 3RFHA 4FHLA 4J8GA 4E54A 2TRCB 4H5JA 4JSVC 5FKRA 2Z2NA 4ERYA 2Z2OA 4PC0A 1NEXB 5IGOA 5HE3B 2BBKH 4GQBB 3EI2A 3OTTA 4A11B 4A08B 3UVNA 1VYHC 4FA1D 2MTAH 3PE7A 3SBQA 4K3ID 4JSPC 3MMYA 2YNOA 4ERQA 2H9LA 2HYEA 4A2LA 4J77A 3EU7A 5GMKn 5FLXg 2YMUA 4U7AA 4A0AB 1MDAH 4A2MA 3EI4B 2AH1A 4LG8A 3AL9A 4PBZA 2P9IC 1FWXA 5FKSA 3EI1B 4CI1A 5B4WA 1PEVA 3AH8B 2IURA 4J78A 3SBRA 2OK6A 4CY5A 1Q47A 4QRJA 2XYIA 1R5MA 2IWKA 1B9YA 4L3GD 3IJ0A 2PM9A 3ORVD 4ZN4A 2J57G 2W18A 2CN2A 2I0TA 3U4YA 5CXBB 2H68A 4FA9D 2Q7QA 3NVQA 3EI4A 5EALA 5C9ZB 3GREA 4GMBA 3EI1A 4CZVA 3I8CA 4FAND 3JRPA 3MZKA 4QQEA 4JSXC 1PGUA 2B5MA 5HE1B 2OVQB 3JB9L 4GQ2P 2H14A 1XIPA 3ZWLB 3V9FA 2YB8B 4BUJC 3SN6B 4CI2A 3I7NA 3DXKC 3VA6A 1ERJA 1NR0A 2O9KA 4ERZA 2IAAA 2H47A 4L1QD 2XL3A 3SLED 4D0KA 1N6FA 2G9AA 3I7HA 4TZ4A 2CN3A 2P9UC 1N6EA 1GP2B 1PI6A 2H9MA 3RMZD 2AGYA 3RN1D 2CE8A 3GFCA 4HDJA 1QNIA 5H1MA 3KRWB 4LGNA 2IUQA 2J56H 4L3HD 2XL2A 3C9CA 2AGLA 4L9OA 2YBAA 1JMZB 4J8BA 5FQDA 4J73A 3I8EA 3UKRC 4X63B 4O3TB 1K8KC 3JZNA 3PXSD 5EARA 1JJUB 5FA5B 3C75H 4O45A 4O3UB 4R7AB 4J79A 5EAPA 3AL8B 2P9PC 5A2Qg 2OVPB 2GNQA 2PM7B 2H6NA 2HKRA 3RLMD 1GG2B 5I5JA 3RN0D 5H17A 2PM9B 3IJCA 1L0QA 4QL1A 2P9NC 2AGWA 3SHFA 3F3FA 2H13A 4GGCA 4Y7RA 4Y5RD 3KRXB 3DXMC 2I3SA 4E5ZB 3OKWA 5HQGA 4G56B 3SBPA 4J87A 4N14A 3C5MA 5TEEA 4FB1D 3AL8A 4PNKB 3JZGA 3CFSB 1MG2A 4EWRA 4PSWB 3UVKA 2B4EA 3MKSB 5EMJB 3OW8A 4LG9A 1P22A 1B9XA 2IUVA 2UZXB 3K26A 4BL0A 5EM2B 2HJ4A 4JT5C 3EG6A 3RRMC 5AMSA 4I79A 3OKYA 4CY2A 5AFU3 2EBSA 3EI3A 1U4CA 4GZ8A 5IGQA 4ZOVA 5IC7A 4E5ZA 5GXHA 4J0XA 1TYQC 1XKSA 4PBYA 1U2VC 3OKTA 3W15A 3CFVA 4K3JB 5EMKB 4KFMB 4ZOYA 5C2WB 3MZLA 2CO0A 4JXMA 5FKTA 5I5IA 5I5MA 1K32A 3IIYA 4GM9A 3MKQA 3ODTA 4CY3A 2I0RA 3UVOA 3J80g 3L4OD 5HE2B 4FAVD 5EM2A 1XHMA 2CO0C 3DM0A 3VGZA 2HJBA 3IKOA 2HESX 5CXCA 2PM6B 4QT8A 1OMWB 2B5NA 3F3GA 3P4FA 1PBYB 4H5IA 5K1CC 3NVNA 3UKUC 2P9KC 3NVXA 4JSNC 2AH0A 5CYKB 3V5WB 4AOWA 4XEIC 4CC9A 4A7JA 4FWWA 2YNNA 4PXWA 4A09B 2H6QA 1N6DA 4CI8A 4GM8A 2OK4A 3N0DA 3I7OA 5TDHB 3PXWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFC A;  1SHY B;  2H9N A;  4FA4 D;  2OVR B;  2I3T A;  1TBG A;  5HYN B;  2J55 H;  3UVL A;  2AQ5 A;  4X60 B;  4ZOZ A;  3JZH A;  3PVU B;  4YVD A;  1S4U X;  2CE9 A;  5CYK A;  5TEF A;  3I89 A;  4ESG A;  1JMX B;  4XYH A;  1SQ9 A;  3SCY A;  4A09 A;  2HXC A;  2H9P A;  2YNP A;  4Z8L A;  3UR4 A;  4JT6 C;  4X3E A;  4CY1 A;  2BCJ B;  3OKY B;  3SXT D;  3PSC B;  3E0C A;  3EI3 B;  3HFQ A;  1OLZ A;  3BG0 A;  2IUP A;  2CNX A;  4X61 B;  4J86 A;  2Z2P A;  4A0B A;  3CIK B;  1A0R B;  3K27 A;  4AEZ A;  3OL2 A;  1RI6 A;  3ULE C;  3I2N A;  5FXY A;  3DSM A;  1GOT B;  4J0W A;  2H3X A;  4MK0 B;  3DWL C;  4CZY A;  1MG3 A;  4J82 A;  4ES0 A;  3I7K A;  3L4M D;  2P9L C;  2I0S A;  3MXX A;  1JOF A;  3BWS A;  4IMM A;  5EAM A;  5EMM B;  3PXT D;  5CXC B;  2AGZ A;  4GM3 A;  3EMH A;  4IA9 A;  4A11 A;  4A08 A;  4O1Q D;  5SXM A;  5K19 A;  3F3P A;  3A0F A;  5IJ7 E;  3I7P A;  2H6K A;  4GQ1 A;  5AJA A;  1SQJ A;  4BH6 A;  4GGA A;  3SWS D;  4GGD A;  1GXR A;  4A0A A;  3B7F A;  5EML B;  4FA5 D;  3VH0 A;  2G99 A;  3I7L A;  4O9D A;  5THA A;  4J84 A;  2QXV A;  2UZY B;  2XU7 A;  3SFZ A;  3J81 g;  4OZU A;  5TF2 A;  2AGX A;  2OIZ A;  3FM0 A;  3BG1 A;  2PBI B;  3SJL D;  5IT9 g;  3N0E A;  3RFG A;  3SVW D;  2GC7 A;  5FKQ A;  3EWE A;  5KDO B;  4ZOX A;  2QC5 A;  2P9S C;  5IJ8 E;  3FGB A;  3PSL A;  3JRO A;  3V7D B;  4E54 B;  5CXB A;  2B5L A;  5JWZ A;  4JD2 C;  3JPX A;  3EI2 B;  2HKM A;  5C2V B;  5GXI A;  4NSX A;  4CZX A;  2IWF A;  3IIW A;  2OJY A;  3FRX A;  4UI9 R;  2GC4 A;  4D6V A;  3C99 A;  4A0B B;  5GSA A;  3RSE C;  4OWR A;  3OL2 B;  3SMR A;  4PSX B;  4XYI A;  4CI3 A;  1YFQ A;  3IJ1 A;  4J81 A;  3UVM A;  4U1E I;  5HE0 B;  3JAM g;  5H14 A;  3PVW B;  3RFH A;  4FHL A;  4J8G A;  4E54 A;  2TRC B;  4H5J A;  4JSV C;  5FKR A;  2Z2N A;  4ERY A;  2Z2O A;  4PC0 A;  1NEX B;  5IGO A;  5HE3 B;  2BBK H;  4GQB B;  3EI2 A;  3OTT A;  4A11 B;  4A08 B;  3UVN A;  1VYH C;  4FA1 D;  2MTA H;  3PE7 A;  3SBQ A;  4K3I D;  4JSP C;  3MMY A;  2YNO A;  4ERQ A;  2H9L A;  2HYE A;  4A2L A;  4J77 A;  3EU7 A;  5GMK n;  5FLX g;  2YMU A;  4U7A A;  4A0A B;  1MDA H;  4A2M A;  3EI4 B;  2AH1 A;  4LG8 A;  3AL9 A;  4PBZ A;  2P9I C;  1FWX A;  5FKS A;  3EI1 B;  4CI1 A;  5B4W A;  1PEV A;  3AH8 B;  2IUR A;  4J78 A;  3SBR A;  2OK6 A;  4CY5 A;  1Q47 A;  4QRJ A;  2XYI A;  1R5M A;  2IWK A;  1B9Y A;  4L3G D;  3IJ0 A;  2PM9 A;  3ORV D;  4ZN4 A;  2J57 G;  2W18 A;  2CN2 A;  2I0T A;  3U4Y A;  5CXB B;  2H68 A;  4FA9 D;  2Q7Q A;  3NVQ A;  3EI4 A;  5EAL A;  5C9Z B;  3GRE A;  4GMB A;  3EI1 A;  4CZV A;  3I8C A;  4FAN D;  3JRP A;  3MZK A;  4QQE A;  4JSX C;  1PGU A;  2B5M A;  5HE1 B;  2OVQ B;  3JB9 L;  4GQ2 P;  2H14 A;  1XIP A;  3ZWL B;  3V9F A;  2YB8 B;  4BUJ C;  3SN6 B;  4CI2 A;  3I7N A;  3DXK C;  3VA6 A;  1ERJ A;  1NR0 A;  2O9K A;  4ERZ A;  2IAA A;  2H47 A;  4L1Q D;  2XL3 A;  3SLE D;  4D0K A;  1N6F A;  2G9A A;  3I7H A;  4TZ4 A;  2CN3 A;  2P9U C;  1N6E A;  1GP2 B;  1PI6 A;  2H9M A;  3RMZ D;  2AGY A;  3RN1 D;  2CE8 A;  3GFC A;  4HDJ A;  1QNI A;  5H1M A;  3KRW B;  4LGN A;  2IUQ A;  2J56 H;  4L3H D;  2XL2 A;  3C9C A;  2AGL A;  4L9O A;  2YBA A;  1JMZ B;  4J8B A;  5FQD A;  4J73 A;  3I8E A;  3UKR C;  4X63 B;  4O3T B;  1K8K C;  3JZN A;  3PXS D;  5EAR A;  1JJU B;  5FA5 B;  3C75 H;  4O45 A;  4O3U B;  4R7A B;  4J79 A;  5EAP A;  3AL8 B;  2P9P C;  5A2Q g;  2OVP B;  2GNQ A;  2PM7 B;  2H6N A;  2HKR A;  3RLM D;  1GG2 B;  5I5J A;  3RN0 D;  5H17 A;  2PM9 B;  3IJC A;  1L0Q A;  4QL1 A;  2P9N C;  2AGW A;  3SHF A;  3F3F A;  2H13 A;  4GGC A;  4Y7R A;  4Y5R D;  3KRX B;  3DXM C;  2I3S A;  4E5Z B;  3OKW A;  5HQG A;  4G56 B;  3SBP A;  4J87 A;  4N14 A;  3C5M A;  5TEE A;  4FB1 D;  3AL8 A;  4PNK B;  3JZG A;  3CFS B;  1MG2 A;  4EWR A;  4PSW B;  3UVK A;  2B4E A;  3MKS B;  5EMJ B;  3OW8 A;  4LG9 A;  1P22 A;  1B9X A;  2IUV A;  2UZX B;  3K26 A;  4BL0 A;  5EM2 B;  2HJ4 A;  4JT5 C;  3EG6 A;  3RRM C;  5AMS A;  4I79 A;  3OKY A;  4CY2 A;  5AFU 3;  2EBS A;  3EI3 A;  1U4C A;  4GZ8 A;  5IGQ A;  4ZOV A;  5IC7 A;  4E5Z A;  5GXH A;  4J0X A;  1TYQ C;  1XKS A;  4PBY A;  1U2V C;  3OKT A;  3W15 A;  3CFV A;  4K3J B;  5EMK B;  4KFM B;  4ZOY A;  5C2W B;  3MZL A;  2CO0 A;  4JXM A;  5FKT A;  5I5I A;  5I5M A;  1K32 A;  3IIY A;  4GM9 A;  3MKQ A;  3ODT A;  4CY3 A;  2I0R A;  3UVO A;  3J80 g;  3L4O D;  5HE2 B;  4FAV D;  5EM2 A;  1XHM A;  2CO0 C;  3DM0 A;  3VGZ A;  2HJB A;  3IKO A;  2HES X;  5CXC A;  2PM6 B;  4QT8 A;  1OMW B;  2B5N A;  3F3G A;  3P4F A;  1PBY B;  4H5I A;  5K1C C;  3NVN A;  3UKU C;  2P9K C;  3NVX A;  4JSN C;  2AH0 A;  5CYK B;  3V5W B;  4AOW A;  4XEI C;  4CC9 A;  4A7J A;  4FWW A;  2YNN A;  4PXW A;  4A09 B;  2H6Q A;  1N6D A;  4CI8 A;  4GM8 A;  2OK4 A;  3N0D A;  3I7O A;  5TDH B;  3PXW D; 
#chains in the Genus database with same CATH topology
 1M1X A;  3AFC A;  1BPO A;  2VDK A;  1SHY B;  4WJK A;  1E5T A;  2H9N A;  4FA4 D;  2OVR B;  2I3T A;  1UTC A;  1GOG A;  1TBG A;  5HYN B;  2J55 H;  3UVL A;  5M5R A;  4AMZ A;  2AQ5 A;  4X60 B;  1T2X A;  4ZOZ A;  3ZE0 A;  3JZH A;  3PVU B;  4MMY A;  4YVD A;  3IUN A;  1A12 A;  1S4U X;  2CE9 A;  5CYK A;  3VI3 A;  5TEF A;  3I89 A;  4ESG A;  1JMX B;  2XZG A;  4XYH A;  1SQ9 A;  3FCS A;  3SCY A;  4A09 A;  3IJE A;  1GOF A;  4AX4 A;  2HXC A;  2H9P A;  2YNP A;  1QFS A;  3ZDX A;  4Z8L A;  3UR4 A;  4JT6 C;  4X3E A;  4G55 A;  4CY1 A;  2BCJ B;  3OKY B;  3SXT D;  3PSC B;  1L5G A;  3E0C A;  3EI3 B;  3GD1 I;  3HFQ A;  3IUR A;  1OLZ A;  3ZDZ A;  3BG0 A;  4BP8 A;  2IUP A;  2CNX A;  4X61 B;  4J86 A;  1UOO A;  1U8C A;  5E6S A;  2Z2P A;  4A0B A;  3CIK B;  1A0R B;  3K27 A;  3NIF A;  3K6S A;  4AEZ A;  3OL2 A;  1RI6 A;  3ULE C;  3I2N A;  5FXY A;  3DSM A;  2HU5 A;  1GOT B;  4J0W A;  2H3X A;  4MK0 B;  3O4I A;  2VC2 A;  3DWL C;  4CZY A;  1H2X A;  1MG3 A;  4J82 A;  4ES0 A;  3I7K A;  3L4M D;  2P9L C;  3GC3 B;  2I0S A;  3MXX A;  1JOF A;  3BWS A;  4IMM A;  5EAM A;  5EMM B;  3PXT D;  5CXC B;  2AGZ A;  4GM3 A;  1H2Z A;  3EMH A;  4IA9 A;  4A11 A;  4DNV A;  4A08 A;  2VDR A;  4O1Q D;  5E6R A;  5SXM A;  5K19 A;  3F3P A;  3A0F A;  5IJ7 E;  3I7P A;  2H6K A;  4GQ1 A;  5AJA A;  1SQJ A;  4BH6 A;  4GGA A;  3SWS D;  4GGD A;  1GXR A;  1C9L A;  4JHN A;  4MMZ A;  4A0A A;  3B7F A;  1E8N A;  5EML B;  4FA5 D;  3VH0 A;  2G99 A;  1I2M B;  3I7L A;  4O9D A;  5THA A;  4J84 A;  2QXV A;  2UZY B;  2XU7 A;  3SFZ A;  3J81 g;  3EQ8 A;  4OZU A;  5TF2 A;  4Z7Q A;  3MUN A;  2AGX A;  2OIZ A;  3IUL A;  3FM0 A;  3BG1 A;  2QZP A;  2PBI B;  3SJL D;  5IT9 g;  1K3I A;  3N0E A;  5M61 A;  3RFG A;  3SVW D;  3O4H A;  2GC7 A;  5FKQ A;  3EWE A;  5KDO B;  4ZOX A;  2QC5 A;  2P9S C;  3QHY B;  5IJ8 E;  3FGB A;  3PSL A;  3JRO A;  3V7D B;  4E54 B;  5CXB A;  3O4J A;  2B5L A;  3IVM A;  5JWZ A;  4JD2 C;  5HDB A;  2EIC A;  3JPX A;  3EI2 B;  2HKM A;  5C2V B;  1VZ2 A;  5GXI A;  5M5S A;  4NSX A;  4CZX A;  2IWF A;  3IUJ A;  4WK2 A;  4DNU A;  3IIW A;  1GOH A;  2OJY A;  3FRX A;  4UI9 R;  2GC4 A;  4D6V A;  3C99 A;  4A0B B;  5GSA A;  3RSE C;  3DDU A;  4OWR A;  3OL2 B;  5M5T A;  3SMR A;  4PSX B;  4XYI A;  4CI3 A;  1YFQ A;  3IJ1 A;  4J81 A;  3UVM A;  1C9I A;  4U1E I;  5HE0 B;  3JAM g;  5H14 A;  3PVW B;  3RFH A;  2VZ1 A;  4FHL A;  4J8G A;  2TRC B;  4E54 A;  3V4P A;  4H5J A;  4UM9 A;  4JSV C;  5FKR A;  2Z2N A;  4ERY A;  4NC4 A;  2Z2O A;  4PC0 A;  1NEX B;  3K72 A;  5IGO A;  5HE3 B;  2BBK H;  4GQB B;  4Z7N A;  3EI2 A;  3OTT A;  3ZE1 A;  4A11 B;  4A08 B;  3UVN A;  1VYH C;  4FA1 D;  2MTA H;  3PE7 A;  3SBQ A;  4K3I D;  4JSP C;  4NBM A;  3MMY A;  2YNO A;  4ERQ A;  2H9L A;  2HYE A;  3EQ7 A;  4A2L A;  3ZDY A;  4J77 A;  3EU7 A;  5GMK n;  5FLX g;  2YMU A;  4U7A A;  4QAM A;  4A0A B;  1MDA H;  4A2M A;  3EI4 B;  2AH1 A;  4LG8 A;  3AL9 A;  4BP9 A;  5M5U A;  4PBZ A;  2P9I C;  1FWX A;  5FKS A;  3EI1 B;  4L1M A;  4CI1 A;  5B4W A;  1PEV A;  3AH8 B;  4RE6 A;  2IUR A;  4J78 A;  3SBR A;  4O02 A;  2OK6 A;  4CY5 A;  1Q47 A;  2WQ8 A;  4QRJ A;  2XYI A;  1R5M A;  2IWK A;  1B9Y A;  4L3G D;  3IJ0 A;  2PM9 A;  3ORV D;  3K71 A;  3MUO A;  4ZN4 A;  2J57 G;  2W18 A;  5FFO A;  1UOQ A;  4BCD A;  2CN2 A;  2I0T A;  3U4Y A;  5CXB B;  2H68 A;  2VDN A;  4FA9 D;  2Q7Q A;  3NVQ A;  3EI4 A;  1QFM A;  5EAL A;  5C9Z B;  3GRE A;  4GMB A;  2VDP A;  4WK4 A;  3EI1 A;  4CZV A;  3I8C A;  4FAN D;  3JRP A;  2HU8 A;  3MZK A;  4QQE A;  4JSX C;  1PGU A;  2B5M A;  5HE1 B;  2OVQ B;  3JB9 L;  2H14 A;  4GQ2 P;  1XIP A;  3ZWL B;  3V9F A;  2YB8 B;  4BUJ C;  3SN6 B;  4D9S A;  4CI2 A;  3I7N A;  3DXK C;  3VA6 A;  1ERJ A;  1NR0 A;  2O9K A;  4AN0 A;  4ERZ A;  2IAA A;  2HU7 A;  2H47 A;  2VDL A;  5E6U A;  4L1Q D;  2XL3 A;  3SLE D;  4D0K A;  1N6F A;  2G9A A;  3I7H A;  4MMX A;  4TZ4 A;  2CN3 A;  2P9U C;  1N6E A;  1GP2 B;  1PI6 A;  3ZE2 A;  2H9M A;  3RMZ D;  2EIB A;  2AGY A;  3RN1 D;  2CE8 A;  3GFC A;  1O6G A;  4HDJ A;  1QNI A;  5H1M A;  3VI4 A;  4G1M A;  4RE5 A;  3KRW B;  4LGN A;  2IUQ A;  2J56 H;  4IRZ A;  4L3H D;  2XL2 A;  3C9C A;  2AGL A;  4L9O A;  1TYE A;  1JMZ B;  2YBA A;  4J8B A;  5FQD A;  4J73 A;  3I8E A;  3KCI A;  3UKR C;  4X63 B;  2BKL A;  4O3T B;  1K8K C;  3JZN A;  4AMY A;  3PXS D;  5EAR A;  1JJU B;  5FA5 B;  3C75 H;  4O45 A;  4O3U B;  4R7A B;  4J79 A;  5EAP A;  3AL8 B;  2P9P C;  1UOP A;  5A2Q g;  2OVP B;  2GNQ A;  2PM7 B;  3IUM A;  2EIE A;  2H6N A;  2HKR A;  3RLM D;  2XDW A;  3T3P A;  1GG2 B;  5I5J A;  3RN0 D;  1VE7 A;  5H17 A;  3EQ9 A;  2PM9 B;  3IJC A;  3IUQ A;  1L0Q A;  4QL1 A;  1VE6 A;  2P9N C;  2AGW A;  3SHF A;  3F3F A;  2H13 A;  4GGC A;  4NEN A;  4WK0 A;  4Y7R A;  4Y5R D;  3KRX B;  3DXM C;  3T3M A;  2I3S A;  2XE4 A;  4E5Z B;  3OKW A;  5HQG A;  4G56 B;  3SBP A;  4J87 A;  4N14 A;  3C5M A;  5TEE A;  4FB1 D;  3AL8 A;  4PNK B;  3JZG A;  2EID A;  3CFS B;  1MG2 A;  5C92 A;  4EWR A;  5M5V A;  4PSW B;  4G1E A;  1YR2 A;  3UVK A;  2B4E A;  3MKS B;  5EMJ B;  3OW8 A;  3O4G A;  4LG9 A;  2VZ3 A;  5C86 A;  1P22 A;  1O6F A;  1B9X A;  3MVD K;  2IUV A;  2UZX B;  3K26 A;  4BL0 A;  5EM2 B;  2HJ4 A;  4JT5 C;  3EG6 A;  3RRM C;  3NIG A;  5AMS A;  3OF7 A;  4I79 A;  3OKY A;  4BCC A;  4CY2 A;  5AFU 3;  2EBS A;  4DNW A;  3EI3 A;  1U4C A;  1JTD B;  4GZ8 A;  5IGQ A;  4ZOV A;  5IC7 A;  4E5Z A;  5GXH A;  4J0X A;  1TYQ C;  1XKS A;  4O2W A;  4PBY A;  1U2V C;  3OKT A;  3W15 A;  3CFV A;  4K3J B;  5EMK B;  1VZ3 A;  4KFM B;  4ZOY A;  5C2W B;  3MZL A;  2CO0 A;  4JXM A;  5FKT A;  5I5I A;  5I5M A;  1K32 A;  3IIY A;  4GM9 A;  3MKQ A;  2VDQ A;  4UM8 A;  3ODT A;  4CY3 A;  2I0R A;  3UVO A;  3J80 g;  3L4O D;  5HE2 B;  5FFG A;  4FAV D;  5EM2 A;  1XHM A;  2CO0 C;  3DM0 A;  3VGZ A;  2HJB A;  4Z7O A;  3NID A;  1E8M A;  3IKO A;  3QI0 A;  2HES X;  5CXC A;  2PM6 B;  4QT8 A;  1OMW B;  2B5N A;  2VDM A;  3F3G A;  3P4F A;  1PBY B;  4H5I A;  5K1C C;  3NVN A;  3UKU C;  2QR5 A;  2P9K C;  3NVX A;  4JSN C;  2AH0 A;  5CYK B;  3V5W B;  4AOW A;  4XEI C;  1JV2 A;  4BCB A;  4JHP C;  4CC9 A;  4A7J A;  4FWW A;  1H2Y A;  2YNN A;  4NAA A;  4PXW A;  4A09 B;  3FCU A;  2H6Q A;  1N6D A;  4AN1 A;  4CI8 A;  4GM8 A;  2JKX A;  2OK4 A;  1H2W A;  3N0D A;  2VDO A;  3I7O A;  3V4V A;  5TDH B;  3PXW D; 
#chains in the Genus database with same CATH homology
 3AFC A;  1SHY B;  2H9N A;  4FA4 D;  2OVR B;  2I3T A;  1TBG A;  5HYN B;  2J55 H;  3UVL A;  2AQ5 A;  4X60 B;  4ZOZ A;  3JZH A;  3PVU B;  4YVD A;  1S4U X;  2CE9 A;  5CYK A;  5TEF A;  3I89 A;  4ESG A;  1JMX B;  4XYH A;  1SQ9 A;  3SCY A;  4A09 A;  2HXC A;  2H9P A;  2YNP A;  4Z8L A;  3UR4 A;  4JT6 C;  4X3E A;  4CY1 A;  2BCJ B;  3OKY B;  3SXT D;  3PSC B;  3E0C A;  3EI3 B;  3HFQ A;  1OLZ A;  3BG0 A;  2IUP A;  2CNX A;  4X61 B;  4J86 A;  2Z2P A;  4A0B A;  3CIK B;  1A0R B;  3K27 A;  4AEZ A;  3OL2 A;  1RI6 A;  3ULE C;  3I2N A;  5FXY A;  3DSM A;  1GOT B;  4J0W A;  2H3X A;  4MK0 B;  3DWL C;  4CZY A;  1MG3 A;  4J82 A;  4ES0 A;  3I7K A;  3L4M D;  2P9L C;  2I0S A;  3MXX A;  1JOF A;  3BWS A;  4IMM A;  5EAM A;  5EMM B;  3PXT D;  5CXC B;  2AGZ A;  4GM3 A;  3EMH A;  4IA9 A;  4A11 A;  4A08 A;  4O1Q D;  5SXM A;  5K19 A;  3F3P A;  3A0F A;  5IJ7 E;  3I7P A;  2H6K A;  4GQ1 A;  5AJA A;  1SQJ A;  4BH6 A;  4GGA A;  3SWS D;  4GGD A;  1GXR A;  4A0A A;  3B7F A;  5EML B;  4FA5 D;  3VH0 A;  2G99 A;  3I7L A;  4O9D A;  5THA A;  4J84 A;  2QXV A;  2UZY B;  2XU7 A;  3SFZ A;  3J81 g;  4OZU A;  5TF2 A;  2AGX A;  2OIZ A;  3FM0 A;  3BG1 A;  2PBI B;  3SJL D;  5IT9 g;  3N0E A;  3RFG A;  3SVW D;  2GC7 A;  5FKQ A;  3EWE A;  5KDO B;  4ZOX A;  2QC5 A;  2P9S C;  5IJ8 E;  3FGB A;  3PSL A;  3JRO A;  3V7D B;  4E54 B;  5CXB A;  2B5L A;  5JWZ A;  4JD2 C;  3JPX A;  3EI2 B;  2HKM A;  5C2V B;  5GXI A;  4NSX A;  4CZX A;  2IWF A;  3IIW A;  2OJY A;  3FRX A;  4UI9 R;  2GC4 A;  4D6V A;  3C99 A;  4A0B B;  5GSA A;  3RSE C;  4OWR A;  3OL2 B;  3SMR A;  4PSX B;  4XYI A;  4CI3 A;  1YFQ A;  3IJ1 A;  4J81 A;  3UVM A;  4U1E I;  5HE0 B;  3JAM g;  5H14 A;  3PVW B;  3RFH A;  4FHL A;  4J8G A;  4E54 A;  2TRC B;  4H5J A;  4JSV C;  5FKR A;  2Z2N A;  4ERY A;  2Z2O A;  4PC0 A;  1NEX B;  5IGO A;  5HE3 B;  2BBK H;  4GQB B;  3EI2 A;  3OTT A;  4A11 B;  4A08 B;  3UVN A;  1VYH C;  4FA1 D;  2MTA H;  3PE7 A;  3SBQ A;  4K3I D;  4JSP C;  3MMY A;  2YNO A;  4ERQ A;  2H9L A;  2HYE A;  4A2L A;  4J77 A;  3EU7 A;  5GMK n;  5FLX g;  2YMU A;  4U7A A;  4A0A B;  1MDA H;  4A2M A;  3EI4 B;  2AH1 A;  4LG8 A;  3AL9 A;  4PBZ A;  2P9I C;  1FWX A;  5FKS A;  3EI1 B;  4CI1 A;  5B4W A;  1PEV A;  3AH8 B;  2IUR A;  4J78 A;  3SBR A;  2OK6 A;  4CY5 A;  1Q47 A;  4QRJ A;  2XYI A;  1R5M A;  2IWK A;  1B9Y A;  4L3G D;  3IJ0 A;  2PM9 A;  3ORV D;  4ZN4 A;  2J57 G;  2W18 A;  2CN2 A;  2I0T A;  3U4Y A;  5CXB B;  2H68 A;  4FA9 D;  2Q7Q A;  3NVQ A;  3EI4 A;  5EAL A;  5C9Z B;  3GRE A;  4GMB A;  3EI1 A;  4CZV A;  3I8C A;  4FAN D;  3JRP A;  3MZK A;  4QQE A;  4JSX C;  1PGU A;  2B5M A;  5HE1 B;  2OVQ B;  3JB9 L;  4GQ2 P;  2H14 A;  1XIP A;  3ZWL B;  3V9F A;  2YB8 B;  4BUJ C;  3SN6 B;  4CI2 A;  3I7N A;  3DXK C;  3VA6 A;  1ERJ A;  1NR0 A;  2O9K A;  4ERZ A;  2IAA A;  2H47 A;  4L1Q D;  2XL3 A;  3SLE D;  4D0K A;  1N6F A;  2G9A A;  3I7H A;  4TZ4 A;  2CN3 A;  2P9U C;  1N6E A;  1GP2 B;  1PI6 A;  2H9M A;  3RMZ D;  2AGY A;  3RN1 D;  2CE8 A;  3GFC A;  4HDJ A;  1QNI A;  5H1M A;  3KRW B;  4LGN A;  2IUQ A;  2J56 H;  4L3H D;  2XL2 A;  3C9C A;  2AGL A;  4L9O A;  2YBA A;  1JMZ B;  4J8B A;  5FQD A;  4J73 A;  3I8E A;  3UKR C;  4X63 B;  4O3T B;  1K8K C;  3JZN A;  3PXS D;  5EAR A;  1JJU B;  5FA5 B;  3C75 H;  4O45 A;  4O3U B;  4R7A B;  4J79 A;  5EAP A;  3AL8 B;  2P9P C;  5A2Q g;  2OVP B;  2GNQ A;  2PM7 B;  2H6N A;  2HKR A;  3RLM D;  1GG2 B;  5I5J A;  3RN0 D;  5H17 A;  2PM9 B;  3IJC A;  1L0Q A;  4QL1 A;  2P9N C;  2AGW A;  3SHF A;  3F3F A;  2H13 A;  4GGC A;  4Y7R A;  4Y5R D;  3KRX B;  3DXM C;  2I3S A;  4E5Z B;  3OKW A;  5HQG A;  4G56 B;  3SBP A;  4J87 A;  4N14 A;  3C5M A;  5TEE A;  4FB1 D;  3AL8 A;  4PNK B;  3JZG A;  3CFS B;  1MG2 A;  4EWR A;  4PSW B;  3UVK A;  2B4E A;  3MKS B;  5EMJ B;  3OW8 A;  4LG9 A;  1P22 A;  1B9X A;  2IUV A;  2UZX B;  3K26 A;  4BL0 A;  5EM2 B;  2HJ4 A;  4JT5 C;  3EG6 A;  3RRM C;  5AMS A;  4I79 A;  3OKY A;  4CY2 A;  5AFU 3;  2EBS A;  3EI3 A;  1U4C A;  4GZ8 A;  5IGQ A;  4ZOV A;  5IC7 A;  4E5Z A;  5GXH A;  4J0X A;  1TYQ C;  1XKS A;  4PBY A;  1U2V C;  3OKT A;  3W15 A;  3CFV A;  4K3J B;  5EMK B;  4KFM B;  4ZOY A;  5C2W B;  3MZL A;  2CO0 A;  4JXM A;  5FKT A;  5I5I A;  5I5M A;  1K32 A;  3IIY A;  4GM9 A;  3MKQ A;  3ODT A;  4CY3 A;  2I0R A;  3UVO A;  3J80 g;  3L4O D;  5HE2 B;  4FAV D;  5EM2 A;  1XHM A;  2CO0 C;  3DM0 A;  3VGZ A;  2HJB A;  3IKO A;  2HES X;  5CXC A;  2PM6 B;  4QT8 A;  1OMW B;  2B5N A;  3F3G A;  3P4F A;  1PBY B;  4H5I A;  5K1C C;  3NVN A;  3UKU C;  2P9K C;  3NVX A;  4JSN C;  2AH0 A;  5CYK B;  3V5W B;  4AOW A;  4XEI C;  4CC9 A;  4A7J A;  4FWW A;  2YNN A;  4PXW A;  4A09 B;  2H6Q A;  1N6D A;  4CI8 A;  4GM8 A;  2OK4 A;  3N0D A;  3I7O A;  5TDH B;  3PXW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...