4J81A

Crystal structure of beta'-cop/insig-1 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
total genus 90
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j81A01
4N14A 5CYKB 4GM3A 3VA6A 3EI1B 3SLED 2IUVA 2I0TA 4BH6A 3CFVA 2PBIB 3AL8A 2YB8B 4FA9D 1JMXB 2TRCB 1B9YA 1NEXB 4ZOYA 2H9PA 3OTTA 1GOTB 2IUQA 4O3TB 4A0AB 3JPXA 2B5MA 2HKMA 4KFMB 1PBYB 4PBZA 5FLXg 3JB9L 3SHFA 2HJ4A 1N6EA 3JZGA 4H5IA 1ERJA 4J86A 2Z2NA 5EAPA 5HE0B 3JZNA 4ZOXA 3SBRA 2AGYA 4GZ8A 4AOWA 1SQJA 2J55H 3L4OD 3A0FA 5HYNB 1P22A 4J77A 3C99A 4X63B 5FKTA 3SBPA 3DXKC 4PXWA 3UVNA 3MZLA 3SBQA 3ULEC 5C9ZB 4ES0A 3RFGA 1PEVA 3RN1D 4J82A 4JSNC 3I7OA 4GGDA 4XEIC 2OVPB 4A0AA 3I7LA 5B4WA 2BBKH 5EMMB 1TYQC 5I5JA 1S4UX 3IKOA 3SMRA 4CC9A 3EI3B 3DM0A 4GM8A 3K26A 4J87A 4CZVA 3SN6B 4A0BB 2CNXA 3I89A 2G9AA 3V5WB 3AH8B 2IUPA 4L1QD 5GMKn 4JD2C 2P9UC 5K1CC 1U2VC 2O9KA 4IMMA 2H13A 4J84A 3J80g 4J8BA 4BL0A 4J73A 2Z2PA 3MKSB 2XYIA 3MZKA 2H9MA 3BWSA 4Y7RA 4FHLA 4IA9A 3SJLD 1JMZB 2YNNA 4QRJA 4FAVD 2PM6B 3OL2A 3PVUB 5FKQA 4CY5A 4JSVC 5EMLB 2EBSA 1YFQA 3UVMA 3JAMg 3W15A 5H14A 3BG1A 5GXHA 1QNIA 1SHYB 2BCJB 3NVQA 2YMUA 4A11A 2AGXA 2CO0A 5THAA 2H6KA 4LG8A 4D0KA 3PSLA 4PBYA 2UZXB 2IWFA 5EM2B 4I79A 1PGUA 4QQEA 4U7AA 5I5MA 5EMKB 3UKUC 4X60B 5IGOA 5FKSA 3BG0A 5SXMA 4ERQA 2AQ5A 2P9NC 4PSXB 4LGNA 3OW8A 5FQDA 2P9LC 5HE3B 5FKRA 1GP2B 3UVKA 5IJ8E 2YNPA 3C9CA 4PSWB 5TEEA 3I7HA 1Q47A 3UR4A 2P9IC 5JWZA 1XIPA 4FWWA 4YVDA 5CXBA 3OKTA 4JXMA 2CE8A 4CY3A 4JSPC 4A0BA 3JZHA 1MG2A 4O1QD 4JSXC 4BUJC 3CIKB 3EMHA 2IAAA 3UKRC 3ZWLB 2PM7B 2W18A 3AL8B 3E0CA 4J79A 2OK4A 4OZUA 1N6FA 3NVXA 3SCYA 3EWEA 5KDOB 3B7FA 2XL2A 3VH0A 3MMYA 2P9PC 3I7PA 5IT9g 2H14A 5TDHB 1MDAH 4J0XA 2HESX 3F3PA 4K3ID 3VGZA 2UZYB 3EI2A 2P9SC 4GQ2P 2I3SA 2HXCA 4E5ZB 4X61B 4QT8A 3RSEC 3PXTD 3PVWB 3EG6A 3L4MD 3MKQA 4ESGA 4ZN4A 4FA5D 2HJBA 3HFQA 4GQ1A 4EWRA 5AFU3 5CXCA 4U1EI 5GXIA 4H5JA 4CI8A 3OKYA 2H3XA 2G99A 4D6VA 3SFZA 1SQ9A 4FA4D 4LG9A 5EM2A 2XU7A 3I7KA 5FA5B 1N6DA 3OKWA 4GGCA 5CYKA 3DXMC 2QXVA 2HYEA 3EI4A 3RN0D 2CE9A 3EI2B 3DWLC 4TZ4A 2IURA 3KRXB 1GXRA 3OKYB 4L9OA 1U4CA 2IWKA 1R5MA 3I2NA 1PI6A 4CZYA 3OL2B 3C75H 1JJUB 3MXXA 4A09A 2H47A 3PE7A 3RRMC 3IJCA 4FB1D 3J81g 2OIZA 3FGBA 3IJ1A 3F3FA 4GQBB 2Q7QA 3P4FA 4GGAA 2CN3A 3F3GA 2CN2A 4CI3A 3N0DA 4A2MA 2MTAH 4GMBA 2AH0A 5EARA 3GFCA 4NSXA 2PM9A 5C2WB 3AL9A 3PSCB 4A08A 1TBGA 5FXYA 3SWSD 2AGZA 4MK0B 5CXBB 3UVOA 1RI6A 4J78A 3CFSB 5HE2B 3V7DB 5IGQA 2GC4A 3IIWA 4FAND 4E5ZA 3JROA 4ERZA 4E54B 4UI9R 3V9FA 4CY1A 3KRWB 1NR0A 2I0RA 4G56B 3RMZD 2H6QA 5CXCB 4O3UB 2P9KC 2GNQA 3SXTD 3ORVD 2H9LA 3ODTA 2H9NA 5C2VB 2HKRA 2B5NA 4ZOVA 1FWXA 2YBAA 2OVRB 3RLMD 4A7JA 1B9XA 4J8GA 4A08B 5TF2A 2AH1A 2J56H 4O9DA 2I0SA 4L3GD 4FA1D 3N0EA 1XHMA 1L0QA 3I7NA 5TEFA 4GM9A 2B4EA 2I3TA 2OK6A 3FRXA 3PXWD 1MG3A 5AMSA 2J57G 4Y5RD 2AGWA 3FM0A 3RFHA 2H68A 2OJYA 3NVNA 5EMJB 1K32A 3UVLA 4HDJA 2GC7A 3EI1A 4JT6C 4PNKB 1XKSA 4R7AB 3GREA 4X3EA 4AEZA 3I8CA 5K19A 4CY2A 4CI1A 3AFCA 2B5LA 3I8EA 4ERYA 1K8KC 1OMWB 5H17A 5IC7A 4E54A 4CZXA 5GSAA 3EI3A 4A09B 1VYHC 4XYHA 4OWRA 5I5IA 3K27A 4K3JB 3EI4B 5HQGA 3U4YA 5IJ7E 5A2Qg 2OVQB 4JT5C 1OLZA 4PC0A 4ZOZA 2QC5A 3IJ0A 4J81A 1GG2B 2H6NA 3DSMA 2CO0C 3C5MA 3PXSD 1A0RB 4O45A 3IIYA 4XYIA 2AGLA 5AJAA 5HE1B 4CI2A 5H1MA 2Z2OA 3JRPA 4A11B 4Z8LA 2PM9B 3SVWD 2XL3A 4QL1A 4L3HD 4J0WA 5EAMA 3EU7A 2YNOA 5EALA 1JOFA 4A2LA
chains in the Genus database with same CATH superfamily
4N14A 3NIDA 4BCBA 2BKLA 5CYKB 4GM3A 3VA6A 3EI1B 3SLED 2IUVA 2I0TA 4BH6A 4NBMA 3CFVA 2PBIB 3AL8A 2YB8B 4FA9D 1JMXB 2TRCB 1B9YA 1NEXB 4ZOYA 2H9PA 3OTTA 1GOTB 2IUQA 4O3TB 5M5VA 4A0AB 3JPXA 2B5MA 2HKMA 4KFMB 1PBYB 4PBZA 5FLXg 3ZDYA 3JB9L 3SHFA 2HJ4A 2QZPA 1N6EA 3JZGA 4H5IA 5M5SA 4JHPC 1O6GA 3IURA 1ERJA 4J86A 2Z2NA 5EAPA 5HE0B 2WQ8A 3JZNA 4ZOXA 3SBRA 2AGYA 4GZ8A 4AOWA 1H2XA 1SQJA 2J55H 3L4OD 4NC4A 2VZ1A 4BP9A 3A0FA 3V4PA 5HYNB 1P22A 4J77A 3C99A 4X63B 5FKTA 4WJKA 3SBPA 3DXKC 4PXWA 1A12A 1U8CA 3UVNA 3MZLA 5E6UA 3SBQA 3ULEC 5C9ZB 4ES0A 3RFGA 4BCDA 1PEVA 3RN1D 4J82A 3O4HA 4JSNC 1M1XA 3I7OA 4GGDA 4XEIC 4D9SA 2OVPB 4A0AA 3I7LA 5B4WA 2BBKH 5EMMB 1TYQC 4G55A 5I5JA 1S4UX 3IKOA 3SMRA 4CC9A 4MMXA 3EI3B 3DM0A 1UTCA 3K26A 4GM8A 4J87A 4CZVA 3SN6B 3V4VA 1E8NA 5FFOA 4A0BB 1GOHA 2HU7A 1UOQA 2CNXA 3I89A 2G9AA 3V5WB 3AH8B 2IUPA 4L1QD 5GMKn 4IRZA 4JD2C 3O4IA 2P9UC 5K1CC 3GC3B 1U2VC 2O9KA 3IUNA 4IMMA 2H13A 4J84A 4G1MA 3J80g 4J8BA 5FFGA 4BL0A 4J73A 2Z2PA 3MKSB 2XYIA 4MMYA 3MZKA 4Z7QA 2H9MA 3BWSA 3IUQA 4FHLA 4IA9A 4Y7RA 3K6SA 3SJLD 3MUNA 1JMZB 2YNNA 4NAAA 4JHNA 4QRJA 4FAVD 4AMZA 2PM6B 3OL2A 3PVUB 5FKQA 4CY5A 4JSVC 5C86A 5EMLB 2EBSA 1YFQA 3QHYB 3UVMA 3JAMg 3W15A 5H14A 4BCCA 3IJEA 3BG1A 5M61A 5GXHA 1QNIA 1SHYB 2BCJB 4DNVA 3NVQA 2YMUA 4A11A 1O6FA 2JKXA 2AGXA 2CO0A 5THAA 2H6KA 4LG8A 4D0KA 3PSLA 4PBYA 2UZXB 3FCUA 2IWFA 2EICA 5EM2B 4UM9A 2VDRA 4I79A 1PGUA 4QQEA 4U7AA 5I5MA 5EMKB 3UKUC 3K72A 4X60B 5IGOA 5FKSA 3BG0A 5SXMA 4ERQA 2AQ5A 2P9NC 4PSXB 4LGNA 3OW8A 5FQDA 4NENA 2P9LC 5C92A 1E5TA 5HE3B 5FKRA 4AMYA 1GP2B 3UVKA 4QAMA 5IJ8E 2YNPA 3C9CA 4PSWB 5TEEA 3I7HA 1Q47A 5M5UA 3UR4A 2VDMA 2P9IC 5JWZA 1XIPA 1I2MB 4FWWA 4YVDA 5CXBA 3OKTA 4JXMA 1VZ3A 2CE8A 4CY3A 1H2ZA 4JSPC 3JZHA 2EIBA 4A0BA 1MG2A 4O1QD 4JSXC 4BUJC 3CIKB 3EMHA 2IAAA 3UKRC 2VDNA 3ZWLB 2PM7B 2W18A 3AL8B 3E0CA 4J79A 2OK4A 4OZUA 1VZ2A 1N6FA 3NVXA 3SCYA 4AX4A 3EWEA 5KDOB 3B7FA 2XL2A 3VH0A 3MMYA 2P9PC 5M5TA 3I7PA 1VE7A 5IT9g 2H14A 5TDHB 3IUMA 2HU5A 1MDAH 4J0XA 2HESX 3F3PA 4K3ID 3VGZA 2UZYB 1L5GA 3T3PA 2P9SC 3EI2A 2VDOA 4GQ2P 3ZDXA 2I3SA 3VI4A 2HXCA 4E5ZB 4X61B 4QT8A 3RSEC 1K3IA 1GOGA 4RE5A 3PXTD 3PVWB 4BP8A 3EG6A 3L4MD 3KCIA 3MKQA 5E6RA 4ESGA 4ZN4A 4FA5D 2HJBA 3HFQA 4GQ1A 4EWRA 5AFU3 2VZ3A 5CXCA 4U1EI 2HU8A 3T3MA 5GXIA 3IVMA 4H5JA 4CI8A 3OKYA 4L1MA 2H3XA 2G99A 4D6VA 3SFZA 1SQ9A 4FA4D 4LG9A 5EM2A 2XU7A 3I7KA 5FA5B 1N6DA 3OKWA 4GGCA 5CYKA 1GOFA 3DXMC 2QXVA 2HYEA 3EI4A 4DNUA 3EQ8A 3RN0D 3ZE0A 2CE9A 3EI2B 3DWLC 4TZ4A 2IURA 3KRXB 1GXRA 3OKYB 5HDBA 4L9OA 1U4CA 2IWKA 2VDLA 1R5MA 3I2NA 1PI6A 4CZYA 3OL2B 3C75H 1JJUB 3MXXA 4A09A 2H47A 3PE7A 3RRMC 3IJCA 1JV2A 4FB1D 4Z7NA 3J81g 2OIZA 3FGBA 3IJ1A 3F3FA 4GQBB 2Q7QA 3P4FA 4GGAA 2CN3A 3F3GA 2CN2A 3IUJA 4CI3A 3MVDK 3N0DA 4A2MA 2MTAH 2VDPA 4GMBA 3ZE1A 2AH0A 5EARA 3GFCA 4Z7OA 4NSXA 2PM9A 3K71A 5C2WB 1C9IA 3AL9A 4DNWA 3PSCB 4A08A 1TBGA 1H2WA 3FCSA 5FXYA 3SWSD 2AGZA 4MK0B 5CXBB 3UVOA 1RI6A 4J78A 3CFSB 2VDQA 5HE2B 3V7DB 1UOPA 1C9LA 5IGQA 1QFSA 2GC4A 3IIWA 4FAND 4E5ZA 4O02A 3JROA 4ERZA 4E54B 4UI9R 3V9FA 4CY1A 3KRWB 1NR0A 4RE6A 2I0RA 4G56B 3RMZD 1YR2A 4WK0A 2H6QA 3DDUA 5CXCB 4O3UB 2P9KC 2GNQA 3SXTD 3QI0A 2QR5A 3ORVD 2H9LA 1JTDB 2XZGA 3ODTA 2H9NA 5C2VB 4AN1A 2HKRA 2B5NA 3O4GA 2EIEA 4ZOVA 3GD1I 1FWXA 1VE6A 2YBAA 2OVRB 3RLMD 4A7JA 1B9XA 4J8GA 4A08B 5TF2A 2AH1A 1UOOA 2J56H 4O9DA 1TYEA 2I0SA 4L3GD 4FA1D 3N0EA 1XHMA 1L0QA 3I7NA 5TEFA 3ZE2A 2B4EA 2I3TA 3PXWD 2OK6A 3FRXA 4GM9A 1MG3A 5AMSA 2J57G 4Y5RD 2AGWA 3VI3A 3FM0A 3OF7A 3RFHA 2H68A 2OJYA 3NVNA 5EMJB 1T2XA 4UM8A 1K32A 3UVLA 4HDJA 3EQ7A 2GC7A 3EI1A 4JT6C 4PNKB 1XKSA 4R7AB 3GREA 2XDWA 4X3EA 4AEZA 3I8CA 5K19A 4CY2A 1E8MA 4CI1A 3AFCA 2B5LA 3I8EA 5M5RA 4ERYA 3MUOA 4AN0A 2VC2A 1BPOA 1K8KC 1OMWB 5H17A 5IC7A 4E54A 2EIDA 4CZXA 5GSAA 3EI3A 4A09B 1VYHC 2XE4A 4XYHA 4OWRA 5I5IA 3K27A 3NIGA 4K3JB 3EI4B 5HQGA 3U4YA 5IJ7E 5A2Qg 2OVQB 4JT5C 1OLZA 4PC0A 4ZOZA 2QC5A 4WK4A 3IJ0A 4J81A 1GG2B 2H6NA 3DSMA 2CO0C 3C5MA 3IULA 3PXSD 1A0RB 4O45A 3ZDZA 3IIYA 4O2WA 4WK2A 4XYIA 2AGLA 5AJAA 5HE1B 4G1EA 1QFMA 4CI2A 5H1MA 2Z2OA 3JRPA 4A11B 5E6SA 4Z8LA 3NIFA 2PM9B 3O4JA 4MMZA 2XL3A 3SVWD 3EQ9A 4QL1A 4L3HD 4J0WA 5EAMA 3EU7A 1H2YA 2YNOA 5EALA 2VDKA 1JOFA 4A2LA
chains in the Genus database with same CATH topology
4N14A 5CYKB 4GM3A 3VA6A 3EI1B 3SLED 2IUVA 2I0TA 4BH6A 3CFVA 2PBIB 3AL8A 2YB8B 4FA9D 1JMXB 2TRCB 1B9YA 1NEXB 4ZOYA 2H9PA 3OTTA 1GOTB 2IUQA 4O3TB 4A0AB 3JPXA 2B5MA 2HKMA 4KFMB 1PBYB 4PBZA 5FLXg 3JB9L 3SHFA 2HJ4A 1N6EA 3JZGA 4H5IA 1ERJA 4J86A 2Z2NA 5EAPA 5HE0B 3JZNA 4ZOXA 3SBRA 2AGYA 4GZ8A 4AOWA 1SQJA 2J55H 3L4OD 3A0FA 5HYNB 1P22A 4J77A 3C99A 4X63B 5FKTA 3SBPA 3DXKC 4PXWA 3UVNA 3MZLA 3SBQA 3ULEC 5C9ZB 4ES0A 3RFGA 1PEVA 3RN1D 4J82A 4JSNC 3I7OA 4GGDA 4XEIC 2OVPB 4A0AA 3I7LA 5B4WA 2BBKH 5EMMB 1TYQC 5I5JA 1S4UX 3IKOA 3SMRA 4CC9A 3EI3B 3DM0A 4GM8A 3K26A 4J87A 4CZVA 3SN6B 4A0BB 2CNXA 3I89A 2G9AA 3V5WB 3AH8B 2IUPA 4L1QD 5GMKn 4JD2C 2P9UC 5K1CC 1U2VC 2O9KA 4IMMA 2H13A 4J84A 3J80g 4J8BA 4BL0A 4J73A 2Z2PA 3MKSB 2XYIA 3MZKA 2H9MA 3BWSA 4Y7RA 4FHLA 4IA9A 3SJLD 1JMZB 2YNNA 4QRJA 4FAVD 2PM6B 3OL2A 3PVUB 5FKQA 4CY5A 4JSVC 5EMLB 2EBSA 1YFQA 3UVMA 3JAMg 3W15A 5H14A 3BG1A 5GXHA 1QNIA 1SHYB 2BCJB 3NVQA 2YMUA 4A11A 2AGXA 2CO0A 5THAA 2H6KA 4LG8A 4D0KA 3PSLA 4PBYA 2UZXB 2IWFA 5EM2B 4I79A 1PGUA 4QQEA 4U7AA 5I5MA 5EMKB 3UKUC 4X60B 5IGOA 5FKSA 3BG0A 5SXMA 4ERQA 2AQ5A 2P9NC 4PSXB 4LGNA 3OW8A 5FQDA 2P9LC 5HE3B 5FKRA 1GP2B 3UVKA 5IJ8E 2YNPA 3C9CA 4PSWB 5TEEA 3I7HA 1Q47A 3UR4A 2P9IC 5JWZA 1XIPA 4FWWA 4YVDA 5CXBA 3OKTA 4JXMA 2CE8A 4CY3A 4JSPC 4A0BA 3JZHA 1MG2A 4O1QD 4JSXC 4BUJC 3CIKB 3EMHA 2IAAA 3UKRC 3ZWLB 2PM7B 2W18A 3AL8B 3E0CA 4J79A 2OK4A 4OZUA 1N6FA 3NVXA 3SCYA 3EWEA 5KDOB 3B7FA 2XL2A 3VH0A 3MMYA 2P9PC 3I7PA 5IT9g 2H14A 5TDHB 1MDAH 4J0XA 2HESX 3F3PA 4K3ID 3VGZA 2UZYB 3EI2A 2P9SC 4GQ2P 2I3SA 2HXCA 4E5ZB 4X61B 4QT8A 3RSEC 3PXTD 3PVWB 3EG6A 3L4MD 3MKQA 4ESGA 4ZN4A 4FA5D 2HJBA 3HFQA 4GQ1A 4EWRA 5AFU3 5CXCA 4U1EI 5GXIA 4H5JA 4CI8A 3OKYA 2H3XA 2G99A 4D6VA 3SFZA 1SQ9A 4FA4D 4LG9A 5EM2A 2XU7A 3I7KA 5FA5B 1N6DA 3OKWA 4GGCA 5CYKA 3DXMC 2QXVA 2HYEA 3EI4A 3RN0D 2CE9A 3EI2B 3DWLC 4TZ4A 2IURA 3KRXB 1GXRA 3OKYB 4L9OA 1U4CA 2IWKA 1R5MA 3I2NA 1PI6A 4CZYA 3OL2B 3C75H 1JJUB 3MXXA 4A09A 2H47A 3PE7A 3RRMC 3IJCA 4FB1D 3J81g 2OIZA 3FGBA 3IJ1A 3F3FA 4GQBB 2Q7QA 3P4FA 4GGAA 2CN3A 3F3GA 2CN2A 4CI3A 3N0DA 4A2MA 2MTAH 4GMBA 2AH0A 5EARA 3GFCA 4NSXA 2PM9A 5C2WB 3AL9A 3PSCB 4A08A 1TBGA 5FXYA 3SWSD 2AGZA 4MK0B 5CXBB 3UVOA 1RI6A 4J78A 3CFSB 5HE2B 3V7DB 5IGQA 2GC4A 3IIWA 4FAND 4E5ZA 3JROA 4ERZA 4E54B 4UI9R 3V9FA 4CY1A 3KRWB 1NR0A 2I0RA 4G56B 3RMZD 2H6QA 5CXCB 4O3UB 2P9KC 2GNQA 3SXTD 3ORVD 2H9LA 3ODTA 2H9NA 5C2VB 2HKRA 2B5NA 4ZOVA 1FWXA 2YBAA 2OVRB 3RLMD 4A7JA 1B9XA 4J8GA 4A08B 5TF2A 2AH1A 2J56H 4O9DA 2I0SA 4L3GD 4FA1D 3N0EA 1XHMA 1L0QA 3I7NA 5TEFA 4GM9A 2B4EA 2I3TA 2OK6A 3FRXA 3PXWD 1MG3A 5AMSA 2J57G 4Y5RD 2AGWA 3FM0A 3RFHA 2H68A 2OJYA 3NVNA 5EMJB 1K32A 3UVLA 4HDJA 2GC7A 3EI1A 4JT6C 4PNKB 1XKSA 4R7AB 3GREA 4X3EA 4AEZA 3I8CA 5K19A 4CY2A 4CI1A 3AFCA 2B5LA 3I8EA 4ERYA 1K8KC 1OMWB 5H17A 5IC7A 4E54A 4CZXA 5GSAA 3EI3A 4A09B 1VYHC 4XYHA 4OWRA 5I5IA 3K27A 4K3JB 3EI4B 5HQGA 3U4YA 5IJ7E 5A2Qg 2OVQB 4JT5C 1OLZA 4PC0A 4ZOZA 2QC5A 3IJ0A 4J81A 1GG2B 2H6NA 3DSMA 2CO0C 3C5MA 3PXSD 1A0RB 4O45A 3IIYA 4XYIA 2AGLA 5AJAA 5HE1B 4CI2A 5H1MA 2Z2OA 3JRPA 4A11B 4Z8LA 2PM9B 3SVWD 2XL3A 4QL1A 4L3HD 4J0WA 5EAMA 3EU7A 2YNOA 5EALA 1JOFA 4A2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N14 A;  5CYK B;  4GM3 A;  3VA6 A;  3EI1 B;  3SLE D;  2IUV A;  2I0T A;  4BH6 A;  3CFV A;  2PBI B;  3AL8 A;  2YB8 B;  4FA9 D;  1JMX B;  2TRC B;  1B9Y A;  1NEX B;  4ZOY A;  2H9P A;  3OTT A;  1GOT B;  2IUQ A;  4O3T B;  4A0A B;  3JPX A;  2B5M A;  2HKM A;  4KFM B;  1PBY B;  4PBZ A;  5FLX g;  3JB9 L;  3SHF A;  2HJ4 A;  1N6E A;  3JZG A;  4H5I A;  1ERJ A;  4J86 A;  2Z2N A;  5EAP A;  5HE0 B;  3JZN A;  4ZOX A;  3SBR A;  2AGY A;  4GZ8 A;  4AOW A;  1SQJ A;  2J55 H;  3L4O D;  3A0F A;  5HYN B;  1P22 A;  4J77 A;  3C99 A;  4X63 B;  5FKT A;  3SBP A;  3DXK C;  4PXW A;  3UVN A;  3MZL A;  3SBQ A;  3ULE C;  5C9Z B;  4ES0 A;  3RFG A;  1PEV A;  3RN1 D;  4J82 A;  4JSN C;  3I7O A;  4GGD A;  4XEI C;  2OVP B;  4A0A A;  3I7L A;  5B4W A;  2BBK H;  5EMM B;  1TYQ C;  5I5J A;  1S4U X;  3IKO A;  3SMR A;  4CC9 A;  3EI3 B;  3DM0 A;  4GM8 A;  3K26 A;  4J87 A;  4CZV A;  3SN6 B;  4A0B B;  2CNX A;  3I89 A;  2G9A A;  3V5W B;  3AH8 B;  2IUP A;  4L1Q D;  5GMK n;  4JD2 C;  2P9U C;  5K1C C;  1U2V C;  2O9K A;  4IMM A;  2H13 A;  4J84 A;  3J80 g;  4J8B A;  4BL0 A;  4J73 A;  2Z2P A;  3MKS B;  2XYI A;  3MZK A;  2H9M A;  3BWS A;  4Y7R A;  4FHL A;  4IA9 A;  3SJL D;  1JMZ B;  2YNN A;  4QRJ A;  4FAV D;  2PM6 B;  3OL2 A;  3PVU B;  5FKQ A;  4CY5 A;  4JSV C;  5EML B;  2EBS A;  1YFQ A;  3UVM A;  3JAM g;  3W15 A;  5H14 A;  3BG1 A;  5GXH A;  1QNI A;  1SHY B;  2BCJ B;  3NVQ A;  2YMU A;  4A11 A;  2AGX A;  2CO0 A;  5THA A;  2H6K A;  4LG8 A;  4D0K A;  3PSL A;  4PBY A;  2UZX B;  2IWF A;  5EM2 B;  4I79 A;  1PGU A;  4QQE A;  4U7A A;  5I5M A;  5EMK B;  3UKU C;  4X60 B;  5IGO A;  5FKS A;  3BG0 A;  5SXM A;  4ERQ A;  2AQ5 A;  2P9N C;  4PSX B;  4LGN A;  3OW8 A;  5FQD A;  2P9L C;  5HE3 B;  5FKR A;  1GP2 B;  3UVK A;  5IJ8 E;  2YNP A;  3C9C A;  4PSW B;  5TEE A;  3I7H A;  1Q47 A;  3UR4 A;  2P9I C;  5JWZ A;  1XIP A;  4FWW A;  4YVD A;  5CXB A;  3OKT A;  4JXM A;  2CE8 A;  4CY3 A;  4JSP C;  4A0B A;  3JZH A;  1MG2 A;  4O1Q D;  4JSX C;  4BUJ C;  3CIK B;  3EMH A;  2IAA A;  3UKR C;  3ZWL B;  2PM7 B;  2W18 A;  3AL8 B;  3E0C A;  4J79 A;  2OK4 A;  4OZU A;  1N6F A;  3NVX A;  3SCY A;  3EWE A;  5KDO B;  3B7F A;  2XL2 A;  3VH0 A;  3MMY A;  2P9P C;  3I7P A;  5IT9 g;  2H14 A;  5TDH B;  1MDA H;  4J0X A;  2HES X;  3F3P A;  4K3I D;  3VGZ A;  2UZY B;  3EI2 A;  2P9S C;  4GQ2 P;  2I3S A;  2HXC A;  4E5Z B;  4X61 B;  4QT8 A;  3RSE C;  3PXT D;  3PVW B;  3EG6 A;  3L4M D;  3MKQ A;  4ESG A;  4ZN4 A;  4FA5 D;  2HJB A;  3HFQ A;  4GQ1 A;  4EWR A;  5AFU 3;  5CXC A;  4U1E I;  5GXI A;  4H5J A;  4CI8 A;  3OKY A;  2H3X A;  2G99 A;  4D6V A;  3SFZ A;  1SQ9 A;  4FA4 D;  4LG9 A;  5EM2 A;  2XU7 A;  3I7K A;  5FA5 B;  1N6D A;  3OKW A;  4GGC A;  5CYK A;  3DXM C;  2QXV A;  2HYE A;  3EI4 A;  3RN0 D;  2CE9 A;  3EI2 B;  3DWL C;  4TZ4 A;  2IUR A;  3KRX B;  1GXR A;  3OKY B;  4L9O A;  1U4C A;  2IWK A;  1R5M A;  3I2N A;  1PI6 A;  4CZY A;  3OL2 B;  3C75 H;  1JJU B;  3MXX A;  4A09 A;  2H47 A;  3PE7 A;  3RRM C;  3IJC A;  4FB1 D;  3J81 g;  2OIZ A;  3FGB A;  3IJ1 A;  3F3F A;  4GQB B;  2Q7Q A;  3P4F A;  4GGA A;  2CN3 A;  3F3G A;  2CN2 A;  4CI3 A;  3N0D A;  4A2M A;  2MTA H;  4GMB A;  2AH0 A;  5EAR A;  3GFC A;  4NSX A;  2PM9 A;  5C2W B;  3AL9 A;  3PSC B;  4A08 A;  1TBG A;  5FXY A;  3SWS D;  2AGZ A;  4MK0 B;  5CXB B;  3UVO A;  1RI6 A;  4J78 A;  3CFS B;  5HE2 B;  3V7D B;  5IGQ A;  2GC4 A;  3IIW A;  4FAN D;  4E5Z A;  3JRO A;  4ERZ A;  4E54 B;  4UI9 R;  3V9F A;  4CY1 A;  3KRW B;  1NR0 A;  2I0R A;  4G56 B;  3RMZ D;  2H6Q A;  5CXC B;  4O3U B;  2P9K C;  2GNQ A;  3SXT D;  3ORV D;  2H9L A;  3ODT A;  2H9N A;  5C2V B;  2HKR A;  2B5N A;  4ZOV A;  1FWX A;  2YBA A;  2OVR B;  3RLM D;  4A7J A;  1B9X A;  4J8G A;  4A08 B;  5TF2 A;  2AH1 A;  2J56 H;  4O9D A;  2I0S A;  4L3G D;  4FA1 D;  3N0E A;  1XHM A;  1L0Q A;  3I7N A;  5TEF A;  4GM9 A;  2B4E A;  2I3T A;  2OK6 A;  3FRX A;  3PXW D;  1MG3 A;  5AMS A;  2J57 G;  4Y5R D;  2AGW A;  3FM0 A;  3RFH A;  2H68 A;  2OJY A;  3NVN A;  5EMJ B;  1K32 A;  3UVL A;  4HDJ A;  2GC7 A;  3EI1 A;  4JT6 C;  4PNK B;  1XKS A;  4R7A B;  3GRE A;  4X3E A;  4AEZ A;  3I8C A;  5K19 A;  4CY2 A;  4CI1 A;  3AFC A;  2B5L A;  3I8E A;  4ERY A;  1K8K C;  1OMW B;  5H17 A;  5IC7 A;  4E54 A;  4CZX A;  5GSA A;  3EI3 A;  4A09 B;  1VYH C;  4XYH A;  4OWR A;  5I5I A;  3K27 A;  4K3J B;  3EI4 B;  5HQG A;  3U4Y A;  5IJ7 E;  5A2Q g;  2OVQ B;  4JT5 C;  1OLZ A;  4PC0 A;  4ZOZ A;  2QC5 A;  3IJ0 A;  4J81 A;  1GG2 B;  2H6N A;  3DSM A;  2CO0 C;  3C5M A;  3PXS D;  1A0R B;  4O45 A;  3IIY A;  4XYI A;  2AGL A;  5AJA A;  5HE1 B;  4CI2 A;  5H1M A;  2Z2O A;  3JRP A;  4A11 B;  4Z8L A;  2PM9 B;  3SVW D;  2XL3 A;  4QL1 A;  4L3H D;  4J0W A;  5EAM A;  3EU7 A;  2YNO A;  5EAL A;  1JOF A;  4A2L A; 
#chains in the Genus database with same CATH topology
 4N14 A;  3NID A;  4BCB A;  2BKL A;  5CYK B;  4GM3 A;  3VA6 A;  3EI1 B;  3SLE D;  2IUV A;  2I0T A;  4BH6 A;  4NBM A;  3CFV A;  2PBI B;  3AL8 A;  2YB8 B;  4FA9 D;  1JMX B;  2TRC B;  1B9Y A;  1NEX B;  4ZOY A;  2H9P A;  3OTT A;  1GOT B;  2IUQ A;  4O3T B;  5M5V A;  4A0A B;  3JPX A;  2B5M A;  2HKM A;  4KFM B;  1PBY B;  4PBZ A;  5FLX g;  3ZDY A;  3JB9 L;  3SHF A;  2HJ4 A;  2QZP A;  1N6E A;  3JZG A;  4H5I A;  5M5S A;  4JHP C;  1O6G A;  3IUR A;  1ERJ A;  4J86 A;  2Z2N A;  5EAP A;  5HE0 B;  2WQ8 A;  3JZN A;  4ZOX A;  3SBR A;  2AGY A;  4GZ8 A;  4AOW A;  1H2X A;  1SQJ A;  2J55 H;  3L4O D;  4NC4 A;  2VZ1 A;  4BP9 A;  3A0F A;  3V4P A;  5HYN B;  1P22 A;  4J77 A;  3C99 A;  4X63 B;  5FKT A;  4WJK A;  3SBP A;  3DXK C;  4PXW A;  1A12 A;  1U8C A;  3UVN A;  3MZL A;  5E6U A;  3SBQ A;  3ULE C;  5C9Z B;  4ES0 A;  3RFG A;  4BCD A;  1PEV A;  3RN1 D;  4J82 A;  3O4H A;  4JSN C;  1M1X A;  3I7O A;  4GGD A;  4XEI C;  4D9S A;  2OVP B;  4A0A A;  3I7L A;  5B4W A;  2BBK H;  5EMM B;  1TYQ C;  4G55 A;  5I5J A;  1S4U X;  3IKO A;  3SMR A;  4CC9 A;  4MMX A;  3EI3 B;  3DM0 A;  1UTC A;  3K26 A;  4GM8 A;  4J87 A;  4CZV A;  3SN6 B;  3V4V A;  1E8N A;  5FFO A;  4A0B B;  1GOH A;  2HU7 A;  1UOQ A;  2CNX A;  3I89 A;  2G9A A;  3V5W B;  3AH8 B;  2IUP A;  4L1Q D;  5GMK n;  4IRZ A;  4JD2 C;  3O4I A;  2P9U C;  5K1C C;  3GC3 B;  1U2V C;  2O9K A;  3IUN A;  4IMM A;  2H13 A;  4J84 A;  4G1M A;  3J80 g;  4J8B A;  5FFG A;  4BL0 A;  4J73 A;  2Z2P A;  3MKS B;  2XYI A;  4MMY A;  3MZK A;  4Z7Q A;  2H9M A;  3BWS A;  3IUQ A;  4FHL A;  4IA9 A;  4Y7R A;  3K6S A;  3SJL D;  3MUN A;  1JMZ B;  2YNN A;  4NAA A;  4JHN A;  4QRJ A;  4FAV D;  4AMZ A;  2PM6 B;  3OL2 A;  3PVU B;  5FKQ A;  4CY5 A;  4JSV C;  5C86 A;  5EML B;  2EBS A;  1YFQ A;  3QHY B;  3UVM A;  3JAM g;  3W15 A;  5H14 A;  4BCC A;  3IJE A;  3BG1 A;  5M61 A;  5GXH A;  1QNI A;  1SHY B;  2BCJ B;  4DNV A;  3NVQ A;  2YMU A;  4A11 A;  1O6F A;  2JKX A;  2AGX A;  2CO0 A;  5THA A;  2H6K A;  4LG8 A;  4D0K A;  3PSL A;  4PBY A;  2UZX B;  3FCU A;  2IWF A;  2EIC A;  5EM2 B;  4UM9 A;  2VDR A;  4I79 A;  1PGU A;  4QQE A;  4U7A A;  5I5M A;  5EMK B;  3UKU C;  3K72 A;  4X60 B;  5IGO A;  5FKS A;  3BG0 A;  5SXM A;  4ERQ A;  2AQ5 A;  2P9N C;  4PSX B;  4LGN A;  3OW8 A;  5FQD A;  4NEN A;  2P9L C;  5C92 A;  1E5T A;  5HE3 B;  5FKR A;  4AMY A;  1GP2 B;  3UVK A;  4QAM A;  5IJ8 E;  2YNP A;  3C9C A;  4PSW B;  5TEE A;  3I7H A;  1Q47 A;  5M5U A;  3UR4 A;  2VDM A;  2P9I C;  5JWZ A;  1XIP A;  1I2M B;  4FWW A;  4YVD A;  5CXB A;  3OKT A;  4JXM A;  1VZ3 A;  2CE8 A;  4CY3 A;  1H2Z A;  4JSP C;  3JZH A;  2EIB A;  4A0B A;  1MG2 A;  4O1Q D;  4JSX C;  4BUJ C;  3CIK B;  3EMH A;  2IAA A;  3UKR C;  2VDN A;  3ZWL B;  2PM7 B;  2W18 A;  3AL8 B;  3E0C A;  4J79 A;  2OK4 A;  4OZU A;  1VZ2 A;  1N6F A;  3NVX A;  3SCY A;  4AX4 A;  3EWE A;  5KDO B;  3B7F A;  2XL2 A;  3VH0 A;  3MMY A;  2P9P C;  5M5T A;  3I7P A;  1VE7 A;  5IT9 g;  2H14 A;  5TDH B;  3IUM A;  2HU5 A;  1MDA H;  4J0X A;  2HES X;  3F3P A;  4K3I D;  3VGZ A;  2UZY B;  1L5G A;  3T3P A;  2P9S C;  3EI2 A;  2VDO A;  4GQ2 P;  3ZDX A;  2I3S A;  3VI4 A;  2HXC A;  4E5Z B;  4X61 B;  4QT8 A;  3RSE C;  1K3I A;  1GOG A;  4RE5 A;  3PXT D;  3PVW B;  4BP8 A;  3EG6 A;  3L4M D;  3KCI A;  3MKQ A;  5E6R A;  4ESG A;  4ZN4 A;  4FA5 D;  2HJB A;  3HFQ A;  4GQ1 A;  4EWR A;  5AFU 3;  2VZ3 A;  5CXC A;  4U1E I;  2HU8 A;  3T3M A;  5GXI A;  3IVM A;  4H5J A;  4CI8 A;  3OKY A;  4L1M A;  2H3X A;  2G99 A;  4D6V A;  3SFZ A;  1SQ9 A;  4FA4 D;  4LG9 A;  5EM2 A;  2XU7 A;  3I7K A;  5FA5 B;  1N6D A;  3OKW A;  4GGC A;  5CYK A;  1GOF A;  3DXM C;  2QXV A;  2HYE A;  3EI4 A;  4DNU A;  3EQ8 A;  3RN0 D;  3ZE0 A;  2CE9 A;  3EI2 B;  3DWL C;  4TZ4 A;  2IUR A;  3KRX B;  1GXR A;  3OKY B;  5HDB A;  4L9O A;  1U4C A;  2IWK A;  2VDL A;  1R5M A;  3I2N A;  1PI6 A;  4CZY A;  3OL2 B;  3C75 H;  1JJU B;  3MXX A;  4A09 A;  2H47 A;  3PE7 A;  3RRM C;  3IJC A;  1JV2 A;  4FB1 D;  4Z7N A;  3J81 g;  2OIZ A;  3FGB A;  3IJ1 A;  3F3F A;  4GQB B;  2Q7Q A;  3P4F A;  4GGA A;  2CN3 A;  3F3G A;  2CN2 A;  3IUJ A;  4CI3 A;  3MVD K;  3N0D A;  4A2M A;  2MTA H;  2VDP A;  4GMB A;  3ZE1 A;  2AH0 A;  5EAR A;  3GFC A;  4Z7O A;  4NSX A;  2PM9 A;  3K71 A;  5C2W B;  1C9I A;  3AL9 A;  4DNW A;  3PSC B;  4A08 A;  1TBG A;  1H2W A;  3FCS A;  5FXY A;  3SWS D;  2AGZ A;  4MK0 B;  5CXB B;  3UVO A;  1RI6 A;  4J78 A;  3CFS B;  2VDQ A;  5HE2 B;  3V7D B;  1UOP A;  1C9L A;  5IGQ A;  1QFS A;  2GC4 A;  3IIW A;  4FAN D;  4E5Z A;  4O02 A;  3JRO A;  4ERZ A;  4E54 B;  4UI9 R;  3V9F A;  4CY1 A;  3KRW B;  1NR0 A;  4RE6 A;  2I0R A;  4G56 B;  3RMZ D;  1YR2 A;  4WK0 A;  2H6Q A;  3DDU A;  5CXC B;  4O3U B;  2P9K C;  2GNQ A;  3SXT D;  3QI0 A;  2QR5 A;  3ORV D;  2H9L A;  1JTD B;  2XZG A;  3ODT A;  2H9N A;  5C2V B;  4AN1 A;  2HKR A;  2B5N A;  3O4G A;  2EIE A;  4ZOV A;  3GD1 I;  1FWX A;  1VE6 A;  2YBA A;  2OVR B;  3RLM D;  4A7J A;  1B9X A;  4J8G A;  4A08 B;  5TF2 A;  2AH1 A;  1UOO A;  2J56 H;  4O9D A;  1TYE A;  2I0S A;  4L3G D;  4FA1 D;  3N0E A;  1XHM A;  1L0Q A;  3I7N A;  5TEF A;  3ZE2 A;  2B4E A;  2I3T A;  3PXW D;  2OK6 A;  3FRX A;  4GM9 A;  1MG3 A;  5AMS A;  2J57 G;  4Y5R D;  2AGW A;  3VI3 A;  3FM0 A;  3OF7 A;  3RFH A;  2H68 A;  2OJY A;  3NVN A;  5EMJ B;  1T2X A;  4UM8 A;  1K32 A;  3UVL A;  4HDJ A;  3EQ7 A;  2GC7 A;  3EI1 A;  4JT6 C;  4PNK B;  1XKS A;  4R7A B;  3GRE A;  2XDW A;  4X3E A;  4AEZ A;  3I8C A;  5K19 A;  4CY2 A;  1E8M A;  4CI1 A;  3AFC A;  2B5L A;  3I8E A;  5M5R A;  4ERY A;  3MUO A;  4AN0 A;  2VC2 A;  1BPO A;  1K8K C;  1OMW B;  5H17 A;  5IC7 A;  4E54 A;  2EID A;  4CZX A;  5GSA A;  3EI3 A;  4A09 B;  1VYH C;  2XE4 A;  4XYH A;  4OWR A;  5I5I A;  3K27 A;  3NIG A;  4K3J B;  3EI4 B;  5HQG A;  3U4Y A;  5IJ7 E;  5A2Q g;  2OVQ B;  4JT5 C;  1OLZ A;  4PC0 A;  4ZOZ A;  2QC5 A;  4WK4 A;  3IJ0 A;  4J81 A;  1GG2 B;  2H6N A;  3DSM A;  2CO0 C;  3C5M A;  3IUL A;  3PXS D;  1A0R B;  4O45 A;  3ZDZ A;  3IIY A;  4O2W A;  4WK2 A;  4XYI A;  2AGL A;  5AJA A;  5HE1 B;  4G1E A;  1QFM A;  4CI2 A;  5H1M A;  2Z2O A;  3JRP A;  4A11 B;  5E6S A;  4Z8L A;  3NIF A;  2PM9 B;  3O4J A;  4MMZ A;  2XL3 A;  3SVW D;  3EQ9 A;  4QL1 A;  4L3H D;  4J0W A;  5EAM A;  3EU7 A;  1H2Y A;  2YNO A;  5EAL A;  2VDK A;  1JOF A;  4A2L A; 
#chains in the Genus database with same CATH homology
 4N14 A;  5CYK B;  4GM3 A;  3VA6 A;  3EI1 B;  3SLE D;  2IUV A;  2I0T A;  4BH6 A;  3CFV A;  2PBI B;  3AL8 A;  2YB8 B;  4FA9 D;  1JMX B;  2TRC B;  1B9Y A;  1NEX B;  4ZOY A;  2H9P A;  3OTT A;  1GOT B;  2IUQ A;  4O3T B;  4A0A B;  3JPX A;  2B5M A;  2HKM A;  4KFM B;  1PBY B;  4PBZ A;  5FLX g;  3JB9 L;  3SHF A;  2HJ4 A;  1N6E A;  3JZG A;  4H5I A;  1ERJ A;  4J86 A;  2Z2N A;  5EAP A;  5HE0 B;  3JZN A;  4ZOX A;  3SBR A;  2AGY A;  4GZ8 A;  4AOW A;  1SQJ A;  2J55 H;  3L4O D;  3A0F A;  5HYN B;  1P22 A;  4J77 A;  3C99 A;  4X63 B;  5FKT A;  3SBP A;  3DXK C;  4PXW A;  3UVN A;  3MZL A;  3SBQ A;  3ULE C;  5C9Z B;  4ES0 A;  3RFG A;  1PEV A;  3RN1 D;  4J82 A;  4JSN C;  3I7O A;  4GGD A;  4XEI C;  2OVP B;  4A0A A;  3I7L A;  5B4W A;  2BBK H;  5EMM B;  1TYQ C;  5I5J A;  1S4U X;  3IKO A;  3SMR A;  4CC9 A;  3EI3 B;  3DM0 A;  4GM8 A;  3K26 A;  4J87 A;  4CZV A;  3SN6 B;  4A0B B;  2CNX A;  3I89 A;  2G9A A;  3V5W B;  3AH8 B;  2IUP A;  4L1Q D;  5GMK n;  4JD2 C;  2P9U C;  5K1C C;  1U2V C;  2O9K A;  4IMM A;  2H13 A;  4J84 A;  3J80 g;  4J8B A;  4BL0 A;  4J73 A;  2Z2P A;  3MKS B;  2XYI A;  3MZK A;  2H9M A;  3BWS A;  4Y7R A;  4FHL A;  4IA9 A;  3SJL D;  1JMZ B;  2YNN A;  4QRJ A;  4FAV D;  2PM6 B;  3OL2 A;  3PVU B;  5FKQ A;  4CY5 A;  4JSV C;  5EML B;  2EBS A;  1YFQ A;  3UVM A;  3JAM g;  3W15 A;  5H14 A;  3BG1 A;  5GXH A;  1QNI A;  1SHY B;  2BCJ B;  3NVQ A;  2YMU A;  4A11 A;  2AGX A;  2CO0 A;  5THA A;  2H6K A;  4LG8 A;  4D0K A;  3PSL A;  4PBY A;  2UZX B;  2IWF A;  5EM2 B;  4I79 A;  1PGU A;  4QQE A;  4U7A A;  5I5M A;  5EMK B;  3UKU C;  4X60 B;  5IGO A;  5FKS A;  3BG0 A;  5SXM A;  4ERQ A;  2AQ5 A;  2P9N C;  4PSX B;  4LGN A;  3OW8 A;  5FQD A;  2P9L C;  5HE3 B;  5FKR A;  1GP2 B;  3UVK A;  5IJ8 E;  2YNP A;  3C9C A;  4PSW B;  5TEE A;  3I7H A;  1Q47 A;  3UR4 A;  2P9I C;  5JWZ A;  1XIP A;  4FWW A;  4YVD A;  5CXB A;  3OKT A;  4JXM A;  2CE8 A;  4CY3 A;  4JSP C;  4A0B A;  3JZH A;  1MG2 A;  4O1Q D;  4JSX C;  4BUJ C;  3CIK B;  3EMH A;  2IAA A;  3UKR C;  3ZWL B;  2PM7 B;  2W18 A;  3AL8 B;  3E0C A;  4J79 A;  2OK4 A;  4OZU A;  1N6F A;  3NVX A;  3SCY A;  3EWE A;  5KDO B;  3B7F A;  2XL2 A;  3VH0 A;  3MMY A;  2P9P C;  3I7P A;  5IT9 g;  2H14 A;  5TDH B;  1MDA H;  4J0X A;  2HES X;  3F3P A;  4K3I D;  3VGZ A;  2UZY B;  3EI2 A;  2P9S C;  4GQ2 P;  2I3S A;  2HXC A;  4E5Z B;  4X61 B;  4QT8 A;  3RSE C;  3PXT D;  3PVW B;  3EG6 A;  3L4M D;  3MKQ A;  4ESG A;  4ZN4 A;  4FA5 D;  2HJB A;  3HFQ A;  4GQ1 A;  4EWR A;  5AFU 3;  5CXC A;  4U1E I;  5GXI A;  4H5J A;  4CI8 A;  3OKY A;  2H3X A;  2G99 A;  4D6V A;  3SFZ A;  1SQ9 A;  4FA4 D;  4LG9 A;  5EM2 A;  2XU7 A;  3I7K A;  5FA5 B;  1N6D A;  3OKW A;  4GGC A;  5CYK A;  3DXM C;  2QXV A;  2HYE A;  3EI4 A;  3RN0 D;  2CE9 A;  3EI2 B;  3DWL C;  4TZ4 A;  2IUR A;  3KRX B;  1GXR A;  3OKY B;  4L9O A;  1U4C A;  2IWK A;  1R5M A;  3I2N A;  1PI6 A;  4CZY A;  3OL2 B;  3C75 H;  1JJU B;  3MXX A;  4A09 A;  2H47 A;  3PE7 A;  3RRM C;  3IJC A;  4FB1 D;  3J81 g;  2OIZ A;  3FGB A;  3IJ1 A;  3F3F A;  4GQB B;  2Q7Q A;  3P4F A;  4GGA A;  2CN3 A;  3F3G A;  2CN2 A;  4CI3 A;  3N0D A;  4A2M A;  2MTA H;  4GMB A;  2AH0 A;  5EAR A;  3GFC A;  4NSX A;  2PM9 A;  5C2W B;  3AL9 A;  3PSC B;  4A08 A;  1TBG A;  5FXY A;  3SWS D;  2AGZ A;  4MK0 B;  5CXB B;  3UVO A;  1RI6 A;  4J78 A;  3CFS B;  5HE2 B;  3V7D B;  5IGQ A;  2GC4 A;  3IIW A;  4FAN D;  4E5Z A;  3JRO A;  4ERZ A;  4E54 B;  4UI9 R;  3V9F A;  4CY1 A;  3KRW B;  1NR0 A;  2I0R A;  4G56 B;  3RMZ D;  2H6Q A;  5CXC B;  4O3U B;  2P9K C;  2GNQ A;  3SXT D;  3ORV D;  2H9L A;  3ODT A;  2H9N A;  5C2V B;  2HKR A;  2B5N A;  4ZOV A;  1FWX A;  2YBA A;  2OVR B;  3RLM D;  4A7J A;  1B9X A;  4J8G A;  4A08 B;  5TF2 A;  2AH1 A;  2J56 H;  4O9D A;  2I0S A;  4L3G D;  4FA1 D;  3N0E A;  1XHM A;  1L0Q A;  3I7N A;  5TEF A;  4GM9 A;  2B4E A;  2I3T A;  2OK6 A;  3FRX A;  3PXW D;  1MG3 A;  5AMS A;  2J57 G;  4Y5R D;  2AGW A;  3FM0 A;  3RFH A;  2H68 A;  2OJY A;  3NVN A;  5EMJ B;  1K32 A;  3UVL A;  4HDJ A;  2GC7 A;  3EI1 A;  4JT6 C;  4PNK B;  1XKS A;  4R7A B;  3GRE A;  4X3E A;  4AEZ A;  3I8C A;  5K19 A;  4CY2 A;  4CI1 A;  3AFC A;  2B5L A;  3I8E A;  4ERY A;  1K8K C;  1OMW B;  5H17 A;  5IC7 A;  4E54 A;  4CZX A;  5GSA A;  3EI3 A;  4A09 B;  1VYH C;  4XYH A;  4OWR A;  5I5I A;  3K27 A;  4K3J B;  3EI4 B;  5HQG A;  3U4Y A;  5IJ7 E;  5A2Q g;  2OVQ B;  4JT5 C;  1OLZ A;  4PC0 A;  4ZOZ A;  2QC5 A;  3IJ0 A;  4J81 A;  1GG2 B;  2H6N A;  3DSM A;  2CO0 C;  3C5M A;  3PXS D;  1A0R B;  4O45 A;  3IIY A;  4XYI A;  2AGL A;  5AJA A;  5HE1 B;  4CI2 A;  5H1M A;  2Z2O A;  3JRP A;  4A11 B;  4Z8L A;  2PM9 B;  3SVW D;  2XL3 A;  4QL1 A;  4L3H D;  4J0W A;  5EAM A;  3EU7 A;  2YNO A;  5EAL A;  1JOF A;  4A2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...