4J81A

Crystal structure of beta'-cop/insig-1 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 90
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j81A01
3ORVD 1U4CA 1GG2B 2AGLA 3UKRC 3B7FA 1K32A 3OKWA 2AGZA 2I0TA 5HE3B 3JRPA 5TDHB 2XL2A 3MMYA 2IURA 3FGBA 1N6FA 5EMMB 3JAMg 3C75H 4H5JA 4QQEA 3HFQA 3OW8A 3SWSD 2TRCB 4U7AA 2H9LA 3C99A 1TBGA 2Q7QA 2H6KA 2PBIB 3IJCA 1P22A 2W18A 3SMRA 4OZUA 3I7LA 3SVWD 2H6QA 1B9YA 3BWSA 1OMWB 5FLXg 4PBZA 4D6VA 4H5IA 5EM2A 1JMXB 2P9PC 4YVDA 3J80g 3V7DB 4A11A 5K1CC 1OLZA 3F3PA 4CI8A 2IWKA 3BG0A 3OKTA 4G56B 5I5IA 4Y5RD 4A0AB 3OL2A 3I8EA 2IUPA 3VA6A 4J0WA 2AGXA 4HDJA 4GMBA 4BUJC 3JB9L 4ZOZA 2H9PA 2IUQA 4CY5A 3J81g 1K8KC 2QC5A 5H1MA 2I3SA 3FM0A 5HQGA 2P9IC 4GZ8A 3C5MA 1A0RB 3JZNA 4Z8LA 3PXTD 2UZYB 5I5MA 4KFMB 2CO0A 2AQ5A 4J0XA 3MXXA 3F3GA 3NVNA 3KRWB 3DXKC 3IKOA 3MZKA 3OKYB 5K19A 3ZWLB 3GREA 2GNQA 1MG3A 5CXBA 3EI1B 1XKSA 4FA9D 3CIKB 4D0KA 2AH1A 3DWLC 4LG8A 1JOFA 1VYHC 3I7NA 4FA4D 4QT8A 4AEZA 2GC4A 3EI4A 4O3TB 4J8GA 3FRXA 4GGAA 1TYQC 2G9AA 4GM3A 4X61B 1XIPA 4IA9A 1MG2A 1QNIA 4X60B 4J84A 1GOTB 2O9KA 3BG1A 4J79A 2PM9A 1ERJA 2IAAA 3SLED 3MZLA 4J77A 3AL9A 3C9CA 2XL3A 5CYKB 3W15A 3PVWB 3PXSD 2H9MA 4A09B 1YFQA 4GQ2P 4A0BA 3N0DA 2OVPB 5FKRA 4JSXC 1Q47A 5IJ7E 3JZHA 4PSXB 5JWZA 1RI6A 3UVKA 4FWWA 4JSPC 1GXRA 3PSLA 4JXMA 3CFSB 4BH6A 3SJLD 4A11B 3AL8A 5EAPA 3JZGA 2HESX 3DSMA 2AGWA 3DXMC 4O45A 3OL2B 2I0RA 2OK4A 4CI1A 3NVXA 2HKMA 4FHLA 2BCJB 2YB8B 2OIZA 3VH0A 4CZVA 2PM7B 3NVQA 4O9DA 4K3ID 1N6EA 3I7KA 5GSAA 3ODTA 5AMSA 4E5ZA 1JJUB 2XU7A 3RRMC 4JT5C 3KRXB 2HJ4A 4PSWB 3MKQA 2HKRA 2XYIA 4LGNA 3RFHA 4GQ1A 4FAVD 2UZXB 4L3HD 2YMUA 1PGUA 4K3JB 5H14A 4EWRA 5IC7A 1JMZB 5CXBB 3PVUB 2H13A 2CN2A 2P9UC 5KDOB 4CZXA 3SBPA 4J87A 4LG9A 4CZYA 2HXCA 2Z2OA 3IJ1A 4ZN4A 5GXHA 4I79A 5IGOA 4Y7RA 3EI3B 2OK6A 2CE8A 3RN0D 5AFU3 5HE1B 4A08B 2H6NA 2J56H 3F3FA 2AH0A 2BBKH 4E54A 4CI2A 3I7PA 2YNOA 1N6DA 3OTTA 3AFCA 5THAA 2PM6B 4GGDA 5GXIA 1SQJA 3I7OA 3PSCB 3CFVA 3L4MD 4ERYA 5CXCB 5A2Qg 4NSXA 2YNNA 4CC9A 3IIWA 4J73A 4TZ4A 4GQBB 4A0BB 1B9XA 1PI6A 4OWRA 4FB1D 4A0AA 3U4YA 1PEVA 3ULEC 3JROA 3AL8B 4BL0A 4X3EA 2B4EA 3SBQA 3SCYA 3L4OD 4XYHA 4GGCA 5TEEA 4JD2C 2I3TA 3EI2A 4ZOVA 3AH8B 4O1QD 3IIYA 4QRJA 2CE9A 4FA5D 4IMMA 4CY3A 5EMLB 3SHFA 3OKYA 4U1EI 4XEIC 2MTAH 5FA5B 5AJAA 3E0CA 2H9NA 5TF2A 3SN6B 3MKSB 4PNKB 3EI1A 5IT9g 5EAMA 3A0FA 2YBAA 3PXWD 5FKTA 5EM2B 5EMKB 4CI3A 3RSEC 4FAND 5C2WB 5B4WA 2AGYA 1MDAH 2H47A 5GMKn 3P4FA 5IJ8E 2H14A 4N14A 1S4UX 1NR0A 2OJYA 3RLMD 2I0SA 3JPXA 4J86A 4E54B 2B5LA 5FXYA 5CYKA 2J55H 1L0QA 4A09A 3I2NA 2EBSA 4J82A 1PBYB 4JT6C 4A2MA 5HE0B 3I7HA 1R5MA 4QL1A 2CO0C 3EWEA 5EARA 3IJ0A 4R7AB 3RFGA 3EMHA 3SFZA 3VGZA 2HYEA 5EALA 3EI4B 2P9SC 5FQDA 4J81A 2B5MA 2IUVA 5I5JA 1GP2B 1SQ9A 4CY2A 1FWXA 3N0EA 4GM8A 5C2VB 2P9NC 2PM9B 3GFCA 2CN3A 2Z2PA 4L3GD 2P9LC 3UR4A 4PC0A 2H68A 4PBYA 2P9KC 2J57G 3EI2B 3K27A 4XYIA 4L9OA 3I89A 4L1QD 4ESGA 3PE7A 3I8CA 4A2LA 3UKUC 2QXVA 3EU7A 3UVMA 4FA1D 2Z2NA 4ES0A 4MK0B 3V5WB 5EMJB 5FKQA 1XHMA 4ZOXA 4UI9R 4X63B 5TEFA 3RN1D 2G99A 4ERZA 3UVLA 3EG6A 3SXTD 5HE2B 4JSNC 3EI3A 4AOWA 4GM9A 3UVNA 4A08A 4O3UB 2OVQB 3DM0A 2B5NA 2CNXA 2GC7A 5FKSA 3V9FA 4A7JA 3UVOA 3K26A 4ZOYA 2IWFA 3RMZD 4J8BA 2YNPA 5HYNB 2H3XA 4JSVC 5H17A 4E5ZB 4CY1A 1U2VC 5C9ZB 1SHYB 5CXCA 2HJBA 2OVRB 4PXWA 4ERQA 3SBRA 5SXMA 1NEXB 5IGQA 4J78A
chains in the Genus database with same CATH superfamily
3ORVD 4BCCA 1U4CA 1GG2B 2AGLA 3UKRC 1K3IA 3B7FA 1K32A 2VZ3A 3OKWA 2AGZA 1UTCA 2I0TA 5HE3B 3JRPA 1L5GA 5TDHB 2XL2A 3MMYA 1JV2A 2IURA 3FGBA 1N6FA 5EMMB 3JAMg 3C75H 4H5JA 4QQEA 3HFQA 3OW8A 4O2WA 5HDBA 3SWSD 2TRCB 3EQ8A 3QI0A 4U7AA 4NAAA 2H9LA 3C99A 1TBGA 4L1MA 2Q7QA 2H6KA 2PBIB 3IJCA 1P22A 2W18A 3SMRA 4AMZA 4OZUA 3I7LA 4MMZA 4JHNA 3SVWD 2H6QA 1B9YA 3BWSA 1OMWB 4Z7OA 4PBZA 4BP8A 5FLXg 4D6VA 4H5IA 5EM2A 1JMXB 1C9IA 2P9PC 4YVDA 3MUOA 3IUMA 4WK4A 3V7DB 3J80g 4A11A 5K1CC 1OLZA 3F3PA 4CI8A 2IWKA 3BG0A 3OKTA 4G56B 5I5IA 4NC4A 3QHYB 4Y5RD 4A0AB 3VI3A 3OL2A 3I8EA 2IUPA 3VA6A 4J0WA 2AGXA 4HDJA 4GMBA 4BUJC 5M5TA 3O4IA 3JB9L 4ZOZA 2H9PA 1GOFA 2IUQA 4CY5A 3J81g 1K8KC 2QC5A 5H1MA 2I3SA 3FM0A 5HQGA 2P9IC 4GZ8A 3C5MA 1A0RB 3JZNA 4Z8LA 1H2XA 3PXTD 2UZYB 3IUJA 5I5MA 4KFMB 2CO0A 4NENA 2AQ5A 4J0XA 3MXXA 3F3GA 1M1XA 3NVNA 3KRWB 3DXKC 3IKOA 3MZKA 3OKYB 1H2WA 5K19A 3ZWLB 3GREA 1O6GA 2GNQA 1MG3A 5CXBA 3EI1B 1XKSA 4FA9D 3CIKB 4D0KA 2JKXA 2AH1A 3DWLC 3NIDA 4AN1A 4LG8A 1JOFA 2VDRA 1VYHC 5C92A 3I7NA 4FA4D 3ZDXA 5M5RA 3IJEA 4QT8A 4AEZA 2GC4A 3EI4A 4O3TB 4J8GA 3FRXA 4GGAA 1TYQC 2G9AA 4GM3A 4X61B 1XIPA 4IA9A 1MG2A 1QNIA 1UOQA 4X60B 4J84A 3K6SA 1GOTB 3MVDK 1C9LA 2O9KA 3BG1A 4J79A 2PM9A 2VDQA 3IURA 4AX4A 1ERJA 2IAAA 3SLED 3MZLA 4J77A 3AL9A 3C9CA 3ZDZA 3O4GA 4NBMA 1VE6A 2XL3A 5CYKB 1YR2A 3W15A 3PVWB 3PXSD 2H9MA 4A09B 1YFQA 4GQ2P 4A0BA 3N0DA 2OVPB 5FKRA 4JSXC 1Q47A 5IJ7E 5M61A 1GOHA 3JZHA 1JTDB 4PSXB 5JWZA 1RI6A 3UVKA 4FWWA 4JSPC 1GXRA 3PSLA 4JXMA 3CFSB 4BH6A 3SJLD 4A11B 3AL8A 5EAPA 3JZGA 2HESX 4G1MA 2QZPA 2AGWA 3DSMA 3DXMC 3KCIA 4O45A 3OL2B 2I0RA 2OK4A 3ZDYA 4CI1A 1O6FA 2HU8A 4Z7QA 3NVXA 3K72A 2HKMA 4FHLA 2BCJB 2YB8B 2OIZA 3VH0A 4CZVA 5M5SA 2PM7B 1QFMA 3NVQA 4O9DA 4RE5A 4K3ID 1GOGA 1N6EA 3I7KA 5FFGA 5GSAA 3ODTA 5AMSA 4D9SA 4E5ZA 1JJUB 2XU7A 3RRMC 4JT5C 3KRXB 2HJ4A 4PSWB 3MKQA 2HKRA 2XYIA 4LGNA 3RFHA 3FCUA 4GQ1A 4FAVD 2UZXB 2EIEA 2VZ1A 4L3HD 3NIGA 2YMUA 1PGUA 4K3JB 5H14A 4EWRA 5IC7A 1JMZB 5CXBB 3PVUB 2H13A 2CN2A 2P9UC 1I2MB 4CZXA 5KDOB 3SBPA 4J87A 3IULA 1VE7A 4LG9A 2HXCA 4CZYA 1H2YA 2Z2OA 3GC3B 3IJ1A 3EQ7A 4ZN4A 2HU5A 5GXHA 4I79A 5IGOA 4UM8A 4Y7RA 3EI3B 2OK6A 2CE8A 3RN0D 5AFU3 5HE1B 4A08B 2H6NA 2J56H 4O02A 3F3FA 1VZ3A 2AH0A 2BBKH 4E54A 4CI2A 3I7PA 2YNOA 1N6DA 3OTTA 3AFCA 5THAA 2VDLA 3IVMA 2PM6B 4GGDA 5GXIA 1SQJA 3I7OA 3PSCB 4G1EA 3CFVA 3ZE1A 3L4MD 4ERYA 5CXCB 5A2Qg 4NSXA 4AMYA 2YNNA 4CC9A 3IIWA 4J73A 4TZ4A 4GQBB 4BCBA 4A0BB 1B9XA 1PI6A 4OWRA 4FB1D 4A0AA 4JHPC 3U4YA 1PEVA 2VDMA 3T3MA 3GD1I 4WK2A 3ULEC 1E8MA 3JROA 3AL8B 4BL0A 4X3EA 2VDOA 2B4EA 3SBQA 1BPOA 3SCYA 3L4OD 4XYHA 4GGCA 5TEEA 4JD2C 4MMXA 1VZ2A 2I3TA 3EI2A 4ZOVA 3AH8B 4O1QD 4Z7NA 3IIYA 4QRJA 2HU7A 2CE9A 4FA5D 4IMMA 3DDUA 4CY3A 1E5TA 3OF7A 5EMLB 3SHFA 3OKYA 4U1EI 4XEIC 2MTAH 5FA5B 5AJAA 3E0CA 2H9NA 5TF2A 3T3PA 3SN6B 3MKSB 4PNKB 2XZGA 3EI1A 5IT9g 5EAMA 3A0FA 2YBAA 3PXWD 5FKTA 5EM2B 5EMKB 4CI3A 3RSEC 4FAND 4QAMA 5C2WB 1UOOA 5B4WA 1MDAH 2AGYA 2H47A 5GMKn 2BKLA 3P4FA 5IJ8E 2EIDA 2H14A 4N14A 1S4UX 1NR0A 1T2XA 2VC2A 2OJYA 2EICA 3ZE0A 1QFSA 4AN0A 3RLMD 2I0SA 3JPXA 4J86A 4E54B 2B5LA 5FXYA 5CYKA 4RE6A 2J55H 1L0QA 4IRZA 4A09A 2VDKA 2XE4A 3I2NA 2EBSA 2VDPA 4J82A 1PBYB 4JT6C 3IUQA 4A2MA 5HE0B 3I7HA 1R5MA 4QL1A 2CO0C 3EWEA 5C86A 5EARA 3O4JA 3IJ0A 3V4PA 4R7AB 4WK0A 3RFGA 3EMHA 3SFZA 3VGZA 2WQ8A 2HYEA 5EALA 3EI4B 3IUNA 4BCDA 2P9SC 5FQDA 4J81A 2B5MA 2IUVA 5I5JA 4UM9A 1GP2B 1SQ9A 4CY2A 1FWXA 4BP9A 4DNUA 3N0EA 4GM8A 5C2VB 2P9NC 2PM9B 3GFCA 3V4VA 2CN3A 4DNVA 2Z2PA 5M5VA 3O4HA 4L3GD 3NIFA 2P9LC 3UR4A 3MUNA 4PC0A 1TYEA 2H68A 4PBYA 2P9KC 2J57G 3EI2B 3K27A 3VI4A 4XYIA 4L9OA 3I89A 4L1QD 4ESGA 3EQ9A 3I8CA 3PE7A 4A2LA 3ZE2A 3UKUC 2QXVA 3EU7A 1U8CA 3UVMA 4FA1D 2Z2NA 1E8NA 4ES0A 4MK0B 3V5WB 5E6UA 5EMJB 5FKQA 1XHMA 4ZOXA 4DNWA 4UI9R 4X63B 5TEFA 1UOPA 3RN1D 2VDNA 5FFOA 2G99A 4ERZA 3UVLA 3EG6A 3SXTD 2QR5A 5HE2B 4JSNC 2XDWA 3EI3A 5E6RA 4AOWA 4GM9A 3FCSA 3UVNA 4A08A 4O3UB 2OVQB 3DM0A 2B5NA 2CNXA 2GC7A 4WJKA 4MMYA 5FKSA 3V9FA 4A7JA 3UVOA 3K26A 5M5UA 4ZOYA 2IWFA 3RMZD 1H2ZA 4J8BA 2YNPA 5HYNB 2H3XA 4JSVC 5H17A 4E5ZB 4CY1A 1U2VC 5C9ZB 3K71A 1SHYB 5CXCA 5E6SA 2HJBA 2OVRB 4PXWA 4ERQA 3SBRA 5SXMA 1NEXB 5IGQA 4J78A 2EIBA 1A12A 4G55A
chains in the Genus database with same CATH topology
3ORVD 1U4CA 1GG2B 2AGLA 3UKRC 3B7FA 1K32A 3OKWA 2AGZA 2I0TA 5HE3B 3JRPA 5TDHB 2XL2A 3MMYA 2IURA 3FGBA 1N6FA 5EMMB 3JAMg 3C75H 4H5JA 4QQEA 3HFQA 3OW8A 3SWSD 2TRCB 4U7AA 2H9LA 3C99A 1TBGA 2Q7QA 2H6KA 2PBIB 3IJCA 1P22A 2W18A 3SMRA 4OZUA 3I7LA 3SVWD 2H6QA 1B9YA 3BWSA 1OMWB 5FLXg 4PBZA 4D6VA 4H5IA 5EM2A 1JMXB 2P9PC 4YVDA 3J80g 3V7DB 4A11A 5K1CC 1OLZA 3F3PA 4CI8A 2IWKA 3BG0A 3OKTA 4G56B 5I5IA 4Y5RD 4A0AB 3OL2A 3I8EA 2IUPA 3VA6A 4J0WA 2AGXA 4HDJA 4GMBA 4BUJC 3JB9L 4ZOZA 2H9PA 2IUQA 4CY5A 3J81g 1K8KC 2QC5A 5H1MA 2I3SA 3FM0A 5HQGA 2P9IC 4GZ8A 3C5MA 1A0RB 3JZNA 4Z8LA 3PXTD 2UZYB 5I5MA 4KFMB 2CO0A 2AQ5A 4J0XA 3MXXA 3F3GA 3NVNA 3KRWB 3DXKC 3IKOA 3MZKA 3OKYB 5K19A 3ZWLB 3GREA 2GNQA 1MG3A 5CXBA 3EI1B 1XKSA 4FA9D 3CIKB 4D0KA 2AH1A 3DWLC 4LG8A 1JOFA 1VYHC 3I7NA 4FA4D 4QT8A 4AEZA 2GC4A 3EI4A 4O3TB 4J8GA 3FRXA 4GGAA 1TYQC 2G9AA 4GM3A 4X61B 1XIPA 4IA9A 1MG2A 1QNIA 4X60B 4J84A 1GOTB 2O9KA 3BG1A 4J79A 2PM9A 1ERJA 2IAAA 3SLED 3MZLA 4J77A 3AL9A 3C9CA 2XL3A 5CYKB 3W15A 3PVWB 3PXSD 2H9MA 4A09B 1YFQA 4GQ2P 4A0BA 3N0DA 2OVPB 5FKRA 4JSXC 1Q47A 5IJ7E 3JZHA 4PSXB 5JWZA 1RI6A 3UVKA 4FWWA 4JSPC 1GXRA 3PSLA 4JXMA 3CFSB 4BH6A 3SJLD 4A11B 3AL8A 5EAPA 3JZGA 2HESX 3DSMA 2AGWA 3DXMC 4O45A 3OL2B 2I0RA 2OK4A 4CI1A 3NVXA 2HKMA 4FHLA 2BCJB 2YB8B 2OIZA 3VH0A 4CZVA 2PM7B 3NVQA 4O9DA 4K3ID 1N6EA 3I7KA 5GSAA 3ODTA 5AMSA 4E5ZA 1JJUB 2XU7A 3RRMC 4JT5C 3KRXB 2HJ4A 4PSWB 3MKQA 2HKRA 2XYIA 4LGNA 3RFHA 4GQ1A 4FAVD 2UZXB 4L3HD 2YMUA 1PGUA 4K3JB 5H14A 4EWRA 5IC7A 1JMZB 5CXBB 3PVUB 2H13A 2CN2A 2P9UC 5KDOB 4CZXA 3SBPA 4J87A 4LG9A 4CZYA 2HXCA 2Z2OA 3IJ1A 4ZN4A 5GXHA 4I79A 5IGOA 4Y7RA 3EI3B 2OK6A 2CE8A 3RN0D 5AFU3 5HE1B 4A08B 2H6NA 2J56H 3F3FA 2AH0A 2BBKH 4E54A 4CI2A 3I7PA 2YNOA 1N6DA 3OTTA 3AFCA 5THAA 2PM6B 4GGDA 5GXIA 1SQJA 3I7OA 3PSCB 3CFVA 3L4MD 4ERYA 5CXCB 5A2Qg 4NSXA 2YNNA 4CC9A 3IIWA 4J73A 4TZ4A 4GQBB 4A0BB 1B9XA 1PI6A 4OWRA 4FB1D 4A0AA 3U4YA 1PEVA 3ULEC 3JROA 3AL8B 4BL0A 4X3EA 2B4EA 3SBQA 3SCYA 3L4OD 4XYHA 4GGCA 5TEEA 4JD2C 2I3TA 3EI2A 4ZOVA 3AH8B 4O1QD 3IIYA 4QRJA 2CE9A 4FA5D 4IMMA 4CY3A 5EMLB 3SHFA 3OKYA 4U1EI 4XEIC 2MTAH 5FA5B 5AJAA 3E0CA 2H9NA 5TF2A 3SN6B 3MKSB 4PNKB 3EI1A 5IT9g 5EAMA 3A0FA 2YBAA 3PXWD 5FKTA 5EM2B 5EMKB 4CI3A 3RSEC 4FAND 5C2WB 5B4WA 2AGYA 1MDAH 2H47A 5GMKn 3P4FA 5IJ8E 2H14A 4N14A 1S4UX 1NR0A 2OJYA 3RLMD 2I0SA 3JPXA 4J86A 4E54B 2B5LA 5FXYA 5CYKA 2J55H 1L0QA 4A09A 3I2NA 2EBSA 4J82A 1PBYB 4JT6C 4A2MA 5HE0B 3I7HA 1R5MA 4QL1A 2CO0C 3EWEA 5EARA 3IJ0A 4R7AB 3RFGA 3EMHA 3SFZA 3VGZA 2HYEA 5EALA 3EI4B 2P9SC 5FQDA 4J81A 2B5MA 2IUVA 5I5JA 1GP2B 1SQ9A 4CY2A 1FWXA 3N0EA 4GM8A 5C2VB 2P9NC 2PM9B 3GFCA 2CN3A 2Z2PA 4L3GD 2P9LC 3UR4A 4PC0A 2H68A 4PBYA 2P9KC 2J57G 3EI2B 3K27A 4XYIA 4L9OA 3I89A 4L1QD 4ESGA 3PE7A 3I8CA 4A2LA 3UKUC 2QXVA 3EU7A 3UVMA 4FA1D 2Z2NA 4ES0A 4MK0B 3V5WB 5EMJB 5FKQA 1XHMA 4ZOXA 4UI9R 4X63B 5TEFA 3RN1D 2G99A 4ERZA 3UVLA 3EG6A 3SXTD 5HE2B 4JSNC 3EI3A 4AOWA 4GM9A 3UVNA 4A08A 4O3UB 2OVQB 3DM0A 2B5NA 2CNXA 2GC7A 5FKSA 3V9FA 4A7JA 3UVOA 3K26A 4ZOYA 2IWFA 3RMZD 4J8BA 2YNPA 5HYNB 2H3XA 4JSVC 5H17A 4E5ZB 4CY1A 1U2VC 5C9ZB 1SHYB 5CXCA 2HJBA 2OVRB 4PXWA 4ERQA 3SBRA 5SXMA 1NEXB 5IGQA 4J78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ORV D;  1U4C A;  1GG2 B;  2AGL A;  3UKR C;  3B7F A;  1K32 A;  3OKW A;  2AGZ A;  2I0T A;  5HE3 B;  3JRP A;  5TDH B;  2XL2 A;  3MMY A;  2IUR A;  3FGB A;  1N6F A;  5EMM B;  3JAM g;  3C75 H;  4H5J A;  4QQE A;  3HFQ A;  3OW8 A;  3SWS D;  2TRC B;  4U7A A;  2H9L A;  3C99 A;  1TBG A;  2Q7Q A;  2H6K A;  2PBI B;  3IJC A;  1P22 A;  2W18 A;  3SMR A;  4OZU A;  3I7L A;  3SVW D;  2H6Q A;  1B9Y A;  3BWS A;  1OMW B;  5FLX g;  4PBZ A;  4D6V A;  4H5I A;  5EM2 A;  1JMX B;  2P9P C;  4YVD A;  3J80 g;  3V7D B;  4A11 A;  5K1C C;  1OLZ A;  3F3P A;  4CI8 A;  2IWK A;  3BG0 A;  3OKT A;  4G56 B;  5I5I A;  4Y5R D;  4A0A B;  3OL2 A;  3I8E A;  2IUP A;  3VA6 A;  4J0W A;  2AGX A;  4HDJ A;  4GMB A;  4BUJ C;  3JB9 L;  4ZOZ A;  2H9P A;  2IUQ A;  4CY5 A;  3J81 g;  1K8K C;  2QC5 A;  5H1M A;  2I3S A;  3FM0 A;  5HQG A;  2P9I C;  4GZ8 A;  3C5M A;  1A0R B;  3JZN A;  4Z8L A;  3PXT D;  2UZY B;  5I5M A;  4KFM B;  2CO0 A;  2AQ5 A;  4J0X A;  3MXX A;  3F3G A;  3NVN A;  3KRW B;  3DXK C;  3IKO A;  3MZK A;  3OKY B;  5K19 A;  3ZWL B;  3GRE A;  2GNQ A;  1MG3 A;  5CXB A;  3EI1 B;  1XKS A;  4FA9 D;  3CIK B;  4D0K A;  2AH1 A;  3DWL C;  4LG8 A;  1JOF A;  1VYH C;  3I7N A;  4FA4 D;  4QT8 A;  4AEZ A;  2GC4 A;  3EI4 A;  4O3T B;  4J8G A;  3FRX A;  4GGA A;  1TYQ C;  2G9A A;  4GM3 A;  4X61 B;  1XIP A;  4IA9 A;  1MG2 A;  1QNI A;  4X60 B;  4J84 A;  1GOT B;  2O9K A;  3BG1 A;  4J79 A;  2PM9 A;  1ERJ A;  2IAA A;  3SLE D;  3MZL A;  4J77 A;  3AL9 A;  3C9C A;  2XL3 A;  5CYK B;  3W15 A;  3PVW B;  3PXS D;  2H9M A;  4A09 B;  1YFQ A;  4GQ2 P;  4A0B A;  3N0D A;  2OVP B;  5FKR A;  4JSX C;  1Q47 A;  5IJ7 E;  3JZH A;  4PSX B;  5JWZ A;  1RI6 A;  3UVK A;  4FWW A;  4JSP C;  1GXR A;  3PSL A;  4JXM A;  3CFS B;  4BH6 A;  3SJL D;  4A11 B;  3AL8 A;  5EAP A;  3JZG A;  2HES X;  3DSM A;  2AGW A;  3DXM C;  4O45 A;  3OL2 B;  2I0R A;  2OK4 A;  4CI1 A;  3NVX A;  2HKM A;  4FHL A;  2BCJ B;  2YB8 B;  2OIZ A;  3VH0 A;  4CZV A;  2PM7 B;  3NVQ A;  4O9D A;  4K3I D;  1N6E A;  3I7K A;  5GSA A;  3ODT A;  5AMS A;  4E5Z A;  1JJU B;  2XU7 A;  3RRM C;  4JT5 C;  3KRX B;  2HJ4 A;  4PSW B;  3MKQ A;  2HKR A;  2XYI A;  4LGN A;  3RFH A;  4GQ1 A;  4FAV D;  2UZX B;  4L3H D;  2YMU A;  1PGU A;  4K3J B;  5H14 A;  4EWR A;  5IC7 A;  1JMZ B;  5CXB B;  3PVU B;  2H13 A;  2CN2 A;  2P9U C;  5KDO B;  4CZX A;  3SBP A;  4J87 A;  4LG9 A;  4CZY A;  2HXC A;  2Z2O A;  3IJ1 A;  4ZN4 A;  5GXH A;  4I79 A;  5IGO A;  4Y7R A;  3EI3 B;  2OK6 A;  2CE8 A;  3RN0 D;  5AFU 3;  5HE1 B;  4A08 B;  2H6N A;  2J56 H;  3F3F A;  2AH0 A;  2BBK H;  4E54 A;  4CI2 A;  3I7P A;  2YNO A;  1N6D A;  3OTT A;  3AFC A;  5THA A;  2PM6 B;  4GGD A;  5GXI A;  1SQJ A;  3I7O A;  3PSC B;  3CFV A;  3L4M D;  4ERY A;  5CXC B;  5A2Q g;  4NSX A;  2YNN A;  4CC9 A;  3IIW A;  4J73 A;  4TZ4 A;  4GQB B;  4A0B B;  1B9X A;  1PI6 A;  4OWR A;  4FB1 D;  4A0A A;  3U4Y A;  1PEV A;  3ULE C;  3JRO A;  3AL8 B;  4BL0 A;  4X3E A;  2B4E A;  3SBQ A;  3SCY A;  3L4O D;  4XYH A;  4GGC A;  5TEE A;  4JD2 C;  2I3T A;  3EI2 A;  4ZOV A;  3AH8 B;  4O1Q D;  3IIY A;  4QRJ A;  2CE9 A;  4FA5 D;  4IMM A;  4CY3 A;  5EML B;  3SHF A;  3OKY A;  4U1E I;  4XEI C;  2MTA H;  5FA5 B;  5AJA A;  3E0C A;  2H9N A;  5TF2 A;  3SN6 B;  3MKS B;  4PNK B;  3EI1 A;  5IT9 g;  5EAM A;  3A0F A;  2YBA A;  3PXW D;  5FKT A;  5EM2 B;  5EMK B;  4CI3 A;  3RSE C;  4FAN D;  5C2W B;  5B4W A;  2AGY A;  1MDA H;  2H47 A;  5GMK n;  3P4F A;  5IJ8 E;  2H14 A;  4N14 A;  1S4U X;  1NR0 A;  2OJY A;  3RLM D;  2I0S A;  3JPX A;  4J86 A;  4E54 B;  2B5L A;  5FXY A;  5CYK A;  2J55 H;  1L0Q A;  4A09 A;  3I2N A;  2EBS A;  4J82 A;  1PBY B;  4JT6 C;  4A2M A;  5HE0 B;  3I7H A;  1R5M A;  4QL1 A;  2CO0 C;  3EWE A;  5EAR A;  3IJ0 A;  4R7A B;  3RFG A;  3EMH A;  3SFZ A;  3VGZ A;  2HYE A;  5EAL A;  3EI4 B;  2P9S C;  5FQD A;  4J81 A;  2B5M A;  2IUV A;  5I5J A;  1GP2 B;  1SQ9 A;  4CY2 A;  1FWX A;  3N0E A;  4GM8 A;  5C2V B;  2P9N C;  2PM9 B;  3GFC A;  2CN3 A;  2Z2P A;  4L3G D;  2P9L C;  3UR4 A;  4PC0 A;  2H68 A;  4PBY A;  2P9K C;  2J57 G;  3EI2 B;  3K27 A;  4XYI A;  4L9O A;  3I89 A;  4L1Q D;  4ESG A;  3PE7 A;  3I8C A;  4A2L A;  3UKU C;  2QXV A;  3EU7 A;  3UVM A;  4FA1 D;  2Z2N A;  4ES0 A;  4MK0 B;  3V5W B;  5EMJ B;  5FKQ A;  1XHM A;  4ZOX A;  4UI9 R;  4X63 B;  5TEF A;  3RN1 D;  2G99 A;  4ERZ A;  3UVL A;  3EG6 A;  3SXT D;  5HE2 B;  4JSN C;  3EI3 A;  4AOW A;  4GM9 A;  3UVN A;  4A08 A;  4O3U B;  2OVQ B;  3DM0 A;  2B5N A;  2CNX A;  2GC7 A;  5FKS A;  3V9F A;  4A7J A;  3UVO A;  3K26 A;  4ZOY A;  2IWF A;  3RMZ D;  4J8B A;  2YNP A;  5HYN B;  2H3X A;  4JSV C;  5H17 A;  4E5Z B;  4CY1 A;  1U2V C;  5C9Z B;  1SHY B;  5CXC A;  2HJB A;  2OVR B;  4PXW A;  4ERQ A;  3SBR A;  5SXM A;  1NEX B;  5IGQ A;  4J78 A; 
#chains in the Genus database with same CATH topology
 3ORV D;  4BCC A;  1U4C A;  1GG2 B;  2AGL A;  3UKR C;  1K3I A;  3B7F A;  1K32 A;  2VZ3 A;  3OKW A;  2AGZ A;  1UTC A;  2I0T A;  5HE3 B;  3JRP A;  1L5G A;  5TDH B;  2XL2 A;  3MMY A;  1JV2 A;  2IUR A;  3FGB A;  1N6F A;  5EMM B;  3JAM g;  3C75 H;  4H5J A;  4QQE A;  3HFQ A;  3OW8 A;  4O2W A;  5HDB A;  3SWS D;  2TRC B;  3EQ8 A;  3QI0 A;  4U7A A;  4NAA A;  2H9L A;  3C99 A;  1TBG A;  4L1M A;  2Q7Q A;  2H6K A;  2PBI B;  3IJC A;  1P22 A;  2W18 A;  3SMR A;  4AMZ A;  4OZU A;  3I7L A;  4MMZ A;  4JHN A;  3SVW D;  2H6Q A;  1B9Y A;  3BWS A;  1OMW B;  4Z7O A;  4PBZ A;  4BP8 A;  5FLX g;  4D6V A;  4H5I A;  5EM2 A;  1JMX B;  1C9I A;  2P9P C;  4YVD A;  3MUO A;  3IUM A;  4WK4 A;  3V7D B;  3J80 g;  4A11 A;  5K1C C;  1OLZ A;  3F3P A;  4CI8 A;  2IWK A;  3BG0 A;  3OKT A;  4G56 B;  5I5I A;  4NC4 A;  3QHY B;  4Y5R D;  4A0A B;  3VI3 A;  3OL2 A;  3I8E A;  2IUP A;  3VA6 A;  4J0W A;  2AGX A;  4HDJ A;  4GMB A;  4BUJ C;  5M5T A;  3O4I A;  3JB9 L;  4ZOZ A;  2H9P A;  1GOF A;  2IUQ A;  4CY5 A;  3J81 g;  1K8K C;  2QC5 A;  5H1M A;  2I3S A;  3FM0 A;  5HQG A;  2P9I C;  4GZ8 A;  3C5M A;  1A0R B;  3JZN A;  4Z8L A;  1H2X A;  3PXT D;  2UZY B;  3IUJ A;  5I5M A;  4KFM B;  2CO0 A;  4NEN A;  2AQ5 A;  4J0X A;  3MXX A;  3F3G A;  1M1X A;  3NVN A;  3KRW B;  3DXK C;  3IKO A;  3MZK A;  3OKY B;  1H2W A;  5K19 A;  3ZWL B;  3GRE A;  1O6G A;  2GNQ A;  1MG3 A;  5CXB A;  3EI1 B;  1XKS A;  4FA9 D;  3CIK B;  4D0K A;  2JKX A;  2AH1 A;  3DWL C;  3NID A;  4AN1 A;  4LG8 A;  1JOF A;  2VDR A;  1VYH C;  5C92 A;  3I7N A;  4FA4 D;  3ZDX A;  5M5R A;  3IJE A;  4QT8 A;  4AEZ A;  2GC4 A;  3EI4 A;  4O3T B;  4J8G A;  3FRX A;  4GGA A;  1TYQ C;  2G9A A;  4GM3 A;  4X61 B;  1XIP A;  4IA9 A;  1MG2 A;  1QNI A;  1UOQ A;  4X60 B;  4J84 A;  3K6S A;  1GOT B;  3MVD K;  1C9L A;  2O9K A;  3BG1 A;  4J79 A;  2PM9 A;  2VDQ A;  3IUR A;  4AX4 A;  1ERJ A;  2IAA A;  3SLE D;  3MZL A;  4J77 A;  3AL9 A;  3C9C A;  3ZDZ A;  3O4G A;  4NBM A;  1VE6 A;  2XL3 A;  5CYK B;  1YR2 A;  3W15 A;  3PVW B;  3PXS D;  2H9M A;  4A09 B;  1YFQ A;  4GQ2 P;  4A0B A;  3N0D A;  2OVP B;  5FKR A;  4JSX C;  1Q47 A;  5IJ7 E;  5M61 A;  1GOH A;  3JZH A;  1JTD B;  4PSX B;  5JWZ A;  1RI6 A;  3UVK A;  4FWW A;  4JSP C;  1GXR A;  3PSL A;  4JXM A;  3CFS B;  4BH6 A;  3SJL D;  4A11 B;  3AL8 A;  5EAP A;  3JZG A;  2HES X;  4G1M A;  2QZP A;  2AGW A;  3DSM A;  3DXM C;  3KCI A;  4O45 A;  3OL2 B;  2I0R A;  2OK4 A;  3ZDY A;  4CI1 A;  1O6F A;  2HU8 A;  4Z7Q A;  3NVX A;  3K72 A;  2HKM A;  4FHL A;  2BCJ B;  2YB8 B;  2OIZ A;  3VH0 A;  4CZV A;  5M5S A;  2PM7 B;  1QFM A;  3NVQ A;  4O9D A;  4RE5 A;  4K3I D;  1GOG A;  1N6E A;  3I7K A;  5FFG A;  5GSA A;  3ODT A;  5AMS A;  4D9S A;  4E5Z A;  1JJU B;  2XU7 A;  3RRM C;  4JT5 C;  3KRX B;  2HJ4 A;  4PSW B;  3MKQ A;  2HKR A;  2XYI A;  4LGN A;  3RFH A;  3FCU A;  4GQ1 A;  4FAV D;  2UZX B;  2EIE A;  2VZ1 A;  4L3H D;  3NIG A;  2YMU A;  1PGU A;  4K3J B;  5H14 A;  4EWR A;  5IC7 A;  1JMZ B;  5CXB B;  3PVU B;  2H13 A;  2CN2 A;  2P9U C;  1I2M B;  4CZX A;  5KDO B;  3SBP A;  4J87 A;  3IUL A;  1VE7 A;  4LG9 A;  2HXC A;  4CZY A;  1H2Y A;  2Z2O A;  3GC3 B;  3IJ1 A;  3EQ7 A;  4ZN4 A;  2HU5 A;  5GXH A;  4I79 A;  5IGO A;  4UM8 A;  4Y7R A;  3EI3 B;  2OK6 A;  2CE8 A;  3RN0 D;  5AFU 3;  5HE1 B;  4A08 B;  2H6N A;  2J56 H;  4O02 A;  3F3F A;  1VZ3 A;  2AH0 A;  2BBK H;  4E54 A;  4CI2 A;  3I7P A;  2YNO A;  1N6D A;  3OTT A;  3AFC A;  5THA A;  2VDL A;  3IVM A;  2PM6 B;  4GGD A;  5GXI A;  1SQJ A;  3I7O A;  3PSC B;  4G1E A;  3CFV A;  3ZE1 A;  3L4M D;  4ERY A;  5CXC B;  5A2Q g;  4NSX A;  4AMY A;  2YNN A;  4CC9 A;  3IIW A;  4J73 A;  4TZ4 A;  4GQB B;  4BCB A;  4A0B B;  1B9X A;  1PI6 A;  4OWR A;  4FB1 D;  4A0A A;  4JHP C;  3U4Y A;  1PEV A;  2VDM A;  3T3M A;  3GD1 I;  4WK2 A;  3ULE C;  1E8M A;  3JRO A;  3AL8 B;  4BL0 A;  4X3E A;  2VDO A;  2B4E A;  3SBQ A;  1BPO A;  3SCY A;  3L4O D;  4XYH A;  4GGC A;  5TEE A;  4JD2 C;  4MMX A;  1VZ2 A;  2I3T A;  3EI2 A;  4ZOV A;  3AH8 B;  4O1Q D;  4Z7N A;  3IIY A;  4QRJ A;  2HU7 A;  2CE9 A;  4FA5 D;  4IMM A;  3DDU A;  4CY3 A;  1E5T A;  3OF7 A;  5EML B;  3SHF A;  3OKY A;  4U1E I;  4XEI C;  2MTA H;  5FA5 B;  5AJA A;  3E0C A;  2H9N A;  5TF2 A;  3T3P A;  3SN6 B;  3MKS B;  4PNK B;  2XZG A;  3EI1 A;  5IT9 g;  5EAM A;  3A0F A;  2YBA A;  3PXW D;  5FKT A;  5EM2 B;  5EMK B;  4CI3 A;  3RSE C;  4FAN D;  4QAM A;  5C2W B;  1UOO A;  5B4W A;  1MDA H;  2AGY A;  2H47 A;  5GMK n;  2BKL A;  3P4F A;  5IJ8 E;  2EID A;  2H14 A;  4N14 A;  1S4U X;  1NR0 A;  1T2X A;  2VC2 A;  2OJY A;  2EIC A;  3ZE0 A;  1QFS A;  4AN0 A;  3RLM D;  2I0S A;  3JPX A;  4J86 A;  4E54 B;  2B5L A;  5FXY A;  5CYK A;  4RE6 A;  2J55 H;  1L0Q A;  4IRZ A;  4A09 A;  2VDK A;  2XE4 A;  3I2N A;  2EBS A;  2VDP A;  4J82 A;  1PBY B;  4JT6 C;  3IUQ A;  4A2M A;  5HE0 B;  3I7H A;  1R5M A;  4QL1 A;  2CO0 C;  3EWE A;  5C86 A;  5EAR A;  3O4J A;  3IJ0 A;  3V4P A;  4R7A B;  4WK0 A;  3RFG A;  3EMH A;  3SFZ A;  3VGZ A;  2WQ8 A;  2HYE A;  5EAL A;  3EI4 B;  3IUN A;  4BCD A;  2P9S C;  5FQD A;  4J81 A;  2B5M A;  2IUV A;  5I5J A;  4UM9 A;  1GP2 B;  1SQ9 A;  4CY2 A;  1FWX A;  4BP9 A;  4DNU A;  3N0E A;  4GM8 A;  5C2V B;  2P9N C;  2PM9 B;  3GFC A;  3V4V A;  2CN3 A;  4DNV A;  2Z2P A;  5M5V A;  3O4H A;  4L3G D;  3NIF A;  2P9L C;  3UR4 A;  3MUN A;  4PC0 A;  1TYE A;  2H68 A;  4PBY A;  2P9K C;  2J57 G;  3EI2 B;  3K27 A;  3VI4 A;  4XYI A;  4L9O A;  3I89 A;  4L1Q D;  4ESG A;  3EQ9 A;  3I8C A;  3PE7 A;  4A2L A;  3ZE2 A;  3UKU C;  2QXV A;  3EU7 A;  1U8C A;  3UVM A;  4FA1 D;  2Z2N A;  1E8N A;  4ES0 A;  4MK0 B;  3V5W B;  5E6U A;  5EMJ B;  5FKQ A;  1XHM A;  4ZOX A;  4DNW A;  4UI9 R;  4X63 B;  5TEF A;  1UOP A;  3RN1 D;  2VDN A;  5FFO A;  2G99 A;  4ERZ A;  3UVL A;  3EG6 A;  3SXT D;  2QR5 A;  5HE2 B;  4JSN C;  2XDW A;  3EI3 A;  5E6R A;  4AOW A;  4GM9 A;  3FCS A;  3UVN A;  4A08 A;  4O3U B;  2OVQ B;  3DM0 A;  2B5N A;  2CNX A;  2GC7 A;  4WJK A;  4MMY A;  5FKS A;  3V9F A;  4A7J A;  3UVO A;  3K26 A;  5M5U A;  4ZOY A;  2IWF A;  3RMZ D;  1H2Z A;  4J8B A;  2YNP A;  5HYN B;  2H3X A;  4JSV C;  5H17 A;  4E5Z B;  4CY1 A;  1U2V C;  5C9Z B;  3K71 A;  1SHY B;  5CXC A;  5E6S A;  2HJB A;  2OVR B;  4PXW A;  4ERQ A;  3SBR A;  5SXM A;  1NEX B;  5IGQ A;  4J78 A;  2EIB A;  1A12 A;  4G55 A; 
#chains in the Genus database with same CATH homology
 3ORV D;  1U4C A;  1GG2 B;  2AGL A;  3UKR C;  3B7F A;  1K32 A;  3OKW A;  2AGZ A;  2I0T A;  5HE3 B;  3JRP A;  5TDH B;  2XL2 A;  3MMY A;  2IUR A;  3FGB A;  1N6F A;  5EMM B;  3JAM g;  3C75 H;  4H5J A;  4QQE A;  3HFQ A;  3OW8 A;  3SWS D;  2TRC B;  4U7A A;  2H9L A;  3C99 A;  1TBG A;  2Q7Q A;  2H6K A;  2PBI B;  3IJC A;  1P22 A;  2W18 A;  3SMR A;  4OZU A;  3I7L A;  3SVW D;  2H6Q A;  1B9Y A;  3BWS A;  1OMW B;  5FLX g;  4PBZ A;  4D6V A;  4H5I A;  5EM2 A;  1JMX B;  2P9P C;  4YVD A;  3J80 g;  3V7D B;  4A11 A;  5K1C C;  1OLZ A;  3F3P A;  4CI8 A;  2IWK A;  3BG0 A;  3OKT A;  4G56 B;  5I5I A;  4Y5R D;  4A0A B;  3OL2 A;  3I8E A;  2IUP A;  3VA6 A;  4J0W A;  2AGX A;  4HDJ A;  4GMB A;  4BUJ C;  3JB9 L;  4ZOZ A;  2H9P A;  2IUQ A;  4CY5 A;  3J81 g;  1K8K C;  2QC5 A;  5H1M A;  2I3S A;  3FM0 A;  5HQG A;  2P9I C;  4GZ8 A;  3C5M A;  1A0R B;  3JZN A;  4Z8L A;  3PXT D;  2UZY B;  5I5M A;  4KFM B;  2CO0 A;  2AQ5 A;  4J0X A;  3MXX A;  3F3G A;  3NVN A;  3KRW B;  3DXK C;  3IKO A;  3MZK A;  3OKY B;  5K19 A;  3ZWL B;  3GRE A;  2GNQ A;  1MG3 A;  5CXB A;  3EI1 B;  1XKS A;  4FA9 D;  3CIK B;  4D0K A;  2AH1 A;  3DWL C;  4LG8 A;  1JOF A;  1VYH C;  3I7N A;  4FA4 D;  4QT8 A;  4AEZ A;  2GC4 A;  3EI4 A;  4O3T B;  4J8G A;  3FRX A;  4GGA A;  1TYQ C;  2G9A A;  4GM3 A;  4X61 B;  1XIP A;  4IA9 A;  1MG2 A;  1QNI A;  4X60 B;  4J84 A;  1GOT B;  2O9K A;  3BG1 A;  4J79 A;  2PM9 A;  1ERJ A;  2IAA A;  3SLE D;  3MZL A;  4J77 A;  3AL9 A;  3C9C A;  2XL3 A;  5CYK B;  3W15 A;  3PVW B;  3PXS D;  2H9M A;  4A09 B;  1YFQ A;  4GQ2 P;  4A0B A;  3N0D A;  2OVP B;  5FKR A;  4JSX C;  1Q47 A;  5IJ7 E;  3JZH A;  4PSX B;  5JWZ A;  1RI6 A;  3UVK A;  4FWW A;  4JSP C;  1GXR A;  3PSL A;  4JXM A;  3CFS B;  4BH6 A;  3SJL D;  4A11 B;  3AL8 A;  5EAP A;  3JZG A;  2HES X;  3DSM A;  2AGW A;  3DXM C;  4O45 A;  3OL2 B;  2I0R A;  2OK4 A;  4CI1 A;  3NVX A;  2HKM A;  4FHL A;  2BCJ B;  2YB8 B;  2OIZ A;  3VH0 A;  4CZV A;  2PM7 B;  3NVQ A;  4O9D A;  4K3I D;  1N6E A;  3I7K A;  5GSA A;  3ODT A;  5AMS A;  4E5Z A;  1JJU B;  2XU7 A;  3RRM C;  4JT5 C;  3KRX B;  2HJ4 A;  4PSW B;  3MKQ A;  2HKR A;  2XYI A;  4LGN A;  3RFH A;  4GQ1 A;  4FAV D;  2UZX B;  4L3H D;  2YMU A;  1PGU A;  4K3J B;  5H14 A;  4EWR A;  5IC7 A;  1JMZ B;  5CXB B;  3PVU B;  2H13 A;  2CN2 A;  2P9U C;  5KDO B;  4CZX A;  3SBP A;  4J87 A;  4LG9 A;  4CZY A;  2HXC A;  2Z2O A;  3IJ1 A;  4ZN4 A;  5GXH A;  4I79 A;  5IGO A;  4Y7R A;  3EI3 B;  2OK6 A;  2CE8 A;  3RN0 D;  5AFU 3;  5HE1 B;  4A08 B;  2H6N A;  2J56 H;  3F3F A;  2AH0 A;  2BBK H;  4E54 A;  4CI2 A;  3I7P A;  2YNO A;  1N6D A;  3OTT A;  3AFC A;  5THA A;  2PM6 B;  4GGD A;  5GXI A;  1SQJ A;  3I7O A;  3PSC B;  3CFV A;  3L4M D;  4ERY A;  5CXC B;  5A2Q g;  4NSX A;  2YNN A;  4CC9 A;  3IIW A;  4J73 A;  4TZ4 A;  4GQB B;  4A0B B;  1B9X A;  1PI6 A;  4OWR A;  4FB1 D;  4A0A A;  3U4Y A;  1PEV A;  3ULE C;  3JRO A;  3AL8 B;  4BL0 A;  4X3E A;  2B4E A;  3SBQ A;  3SCY A;  3L4O D;  4XYH A;  4GGC A;  5TEE A;  4JD2 C;  2I3T A;  3EI2 A;  4ZOV A;  3AH8 B;  4O1Q D;  3IIY A;  4QRJ A;  2CE9 A;  4FA5 D;  4IMM A;  4CY3 A;  5EML B;  3SHF A;  3OKY A;  4U1E I;  4XEI C;  2MTA H;  5FA5 B;  5AJA A;  3E0C A;  2H9N A;  5TF2 A;  3SN6 B;  3MKS B;  4PNK B;  3EI1 A;  5IT9 g;  5EAM A;  3A0F A;  2YBA A;  3PXW D;  5FKT A;  5EM2 B;  5EMK B;  4CI3 A;  3RSE C;  4FAN D;  5C2W B;  5B4W A;  2AGY A;  1MDA H;  2H47 A;  5GMK n;  3P4F A;  5IJ8 E;  2H14 A;  4N14 A;  1S4U X;  1NR0 A;  2OJY A;  3RLM D;  2I0S A;  3JPX A;  4J86 A;  4E54 B;  2B5L A;  5FXY A;  5CYK A;  2J55 H;  1L0Q A;  4A09 A;  3I2N A;  2EBS A;  4J82 A;  1PBY B;  4JT6 C;  4A2M A;  5HE0 B;  3I7H A;  1R5M A;  4QL1 A;  2CO0 C;  3EWE A;  5EAR A;  3IJ0 A;  4R7A B;  3RFG A;  3EMH A;  3SFZ A;  3VGZ A;  2HYE A;  5EAL A;  3EI4 B;  2P9S C;  5FQD A;  4J81 A;  2B5M A;  2IUV A;  5I5J A;  1GP2 B;  1SQ9 A;  4CY2 A;  1FWX A;  3N0E A;  4GM8 A;  5C2V B;  2P9N C;  2PM9 B;  3GFC A;  2CN3 A;  2Z2P A;  4L3G D;  2P9L C;  3UR4 A;  4PC0 A;  2H68 A;  4PBY A;  2P9K C;  2J57 G;  3EI2 B;  3K27 A;  4XYI A;  4L9O A;  3I89 A;  4L1Q D;  4ESG A;  3PE7 A;  3I8C A;  4A2L A;  3UKU C;  2QXV A;  3EU7 A;  3UVM A;  4FA1 D;  2Z2N A;  4ES0 A;  4MK0 B;  3V5W B;  5EMJ B;  5FKQ A;  1XHM A;  4ZOX A;  4UI9 R;  4X63 B;  5TEF A;  3RN1 D;  2G99 A;  4ERZ A;  3UVL A;  3EG6 A;  3SXT D;  5HE2 B;  4JSN C;  3EI3 A;  4AOW A;  4GM9 A;  3UVN A;  4A08 A;  4O3U B;  2OVQ B;  3DM0 A;  2B5N A;  2CNX A;  2GC7 A;  5FKS A;  3V9F A;  4A7J A;  3UVO A;  3K26 A;  4ZOY A;  2IWF A;  3RMZ D;  4J8B A;  2YNP A;  5HYN B;  2H3X A;  4JSV C;  5H17 A;  4E5Z B;  4CY1 A;  1U2V C;  5C9Z B;  1SHY B;  5CXC A;  2HJB A;  2OVR B;  4PXW A;  4ERQ A;  3SBR A;  5SXM A;  1NEX B;  5IGQ A;  4J78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...