3OL2B

Receptor-ligand structure of human semaphorin 4d with plexin b1.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
511
structure length
496
Chain Sequence
LPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSAHGEVLFAAFSSAAPPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSPEQWLWSFQPELGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Semaphorin-4D
publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 496
sequence length 511
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3ol2B01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ol2B02
4O3UB 4FA5D 1GXRA 2P9SC 1OLZA 3RMZD 2H47A 2AGXA 4A0AB 4FAND 4JSVC 4ZN4A 5KDOB 4QT8A 5AMSA 4IA9A 5CXCA 4CC9A 1MG3A 2Z2PA 3EI1A 4H5IA 4G56B 3EI3A 4FB1D 4E5ZA 2VDQB 5FKSA 2PM9B 4ES0A 3JB9L 4K3JB 4Z7NB 3IIYA 4J79A 5CXBB 2EBSA 3MZKA 5K19A 5HDBB 1JMZB 2OIZA 2H13A 3NVQA 5HE1B 3IIWA 3ZE1B 5EALA 2VDLB 3BG0A 5IJ8E 3UR4A 3T3MB 2GNQA 1RI6A 4A7JA 4O3TB 5C2WB 2P9LC 4MK0B 2GC7A 2IUQA 5HQGA 2MTAH 3JROA 2XYIA 4GGAA 2XL3A 4A0AA 5TDHB 4LG9A 2CE8A 4A2MA 3UVKA 3I7PA 5FKRA 5IC7A 3NIFB 3ZE0B 5K1CC 4PBZA 2H9NA 3DM0A 2PM9A 3IJ1A 5H1MA 4O45A 3SWSD 3NVXA 5FLXg 4CZYA 2I0TA 4YVDA 3OKWA 2XL2A 1L0QA 5CXBA 3SBQA 4A11B 4ERYA 1SQJA 3I7LA 4QL1A 3SBPA 2B5MA 4GZ8A 4U1EI 4WK4B 1JOFA 3C99A 4AOWA 1GG2B 3V7DB 2HKMA 4JSPC 4X61B 2P9NC 5FKQA 4GM8A 4ZOXA 3P4FA 2CO0A 4PSXB 4J8BA 4FA1D 2OVPB 5HE3B 4LG8A 3RLMD 5AJAA 5H14A 3CFVA 5IGQA 3W15A 3L4OD 4FWWA 3UVNA 2VDPB 4CZVA 3C75H 3F3FA 3OKYA 4WJKB 3J80g 4E54B 2HESX 1R5MA 4N14A 2J55H 2OVRB 2G9AA 4J0WA 1ERJA 3VI3B 4ESGA 4FA4D 4CY3A 2OVQB 5EM2B 4XYIA 4UM9D 3UVMA 4X60B 4L9OA 4CI2A 4J78A 3SJLD 2VC2B 2VDOB 4XYHA 5E6RB 1XHMA 1PBYB 2HKRA 4Z7OB 4PXWA 4X3EA 4JD2C 3EI4B 2O9KA 3OW8A 2P26A 1N6EA 4GMBA 1YUKA 4GGDA 2VDRB 5AFU3 2H6NA 3SCYA 3C9CA 1SQ9A 2UZXB 2VDKB 3RSEC 2H9LA 4E54A 2OK4A 3VA6A 1U4CA 4BL0A 2AGYA 5IGOA 4D0KA 1SSLA 4J77A 2CN3A 1TYQC 1GP2B 5GXIA 2YNOA 3EU7A 4JSXC 3B7FA 5EM2A 3OKTA 2BBKH 2B5LA 1MDAH 2CE9A 4A2LA 5IJ7E 5EMLB 4A0BB 4GM3A 2I3SA 5CYKB 3K26A 2AGLA 3RN1D 3EWEA 3MKSB 2W18A 1S4UX 5I5MA 2B5NA 2H6QA 3FGBA 2H6KA 3UVLA 4ZOVA 4GQ1A 3DXKC 3I2NA 2PBIB 4OWRA 1JJUB 3AFCA 3DSMA 1A0RB 3AL9A 4UM8B 2CN2A 4H5JA 4KFMB 4I79A 4CI1A 4GQ2P 5I5JA 3PE7A 2I0SA 3I7HA 3MXXA 3MKQA 4A08B 5FKTA 4FAVD 2AGWA 3ZE2B 2HJ4A 3FCUB 4O1QD 1B9YA 4O9DA 2I3TA 3I7NA 2YNPA 3VGZA 5CYKA 4PNKB 3RRMC 4PSWB 2P9KC 3MZLA 4GM9A 2UZYB 3IKOA 4ZOZA 3EG6A 4CZXA 2YMUA 2QXVA 3L4MD 3I7OA 2P9PC 3KRWB 4LGNA 2Q7QA 1XKSA 3ZDYB 3ZDXB 1OMWB 3V5WB 5FXYA 4BH6A 2BCJB 2HXCA 3GREA 1Q47A 3OL2B 4J87A 2CO0C 4A08A 2YNNA 4A11A 4AEZA 4ERZA 2HYEA 2XU7A 5TF2A 2YB8B 4QQEA 5GXHA 3I8EA 2IURA 1SHYB 1PI6A 4CY1A 1NR0A 5I5IA 3RFHA 2CNXA 5EMJB 2J56H 5FQDA 4A09B 3RN0D 4R7AB 1B9XA 3V9FA 1K32A 1VYHC 2AH0A 3K27A 2IAAA 3KRXB 4CI8A 4FA9D 2IUVA 3A0FA 3CIKB 5GSAA 3VI4B 3HFQA 4WK0B 4L3GD 3PVUB 2OJYA 2IWFA 4EWRA 3GFCA 3ULEC 3FM0A 4HDJA 4UM9B 3DWLC 3EI2B 3DXMC 5EMMB 5SXMA 2P9UC 2I0RA 2YBAA 5IT9g 3PSLA 3JAMg 2QC5A 4J8GA 4J82A 4CY2A 4D6VA 2PM6B 2H9MA 3ZDZB 2AH1A 5HYNB 4J73A 2Z2NA 3SMRA 4K3ID 3NIGB 3UKRC 5GMKn 4A09A 3EI4A 3SHFA 4OZUA 4Z8LA 3N0DA 3RFGA 2AGZA 1TBGA 3VH0A 5EARA 4J86A 2P28A 1QNIA 4IMMA 2VDMB 3PVWB 1GOTB 3SLED 2AQ5A 3PXSD 4JXMA 4QRJA 3ORVD 2J57G 3U4YA 3E0CA 1N6DA 3T3PB 3EI2A 2B4EA 4FHLA 4PBYA 2HJBA 3ZWLB 1PEVA 5A2Qg 5H17A 5JWZA 1YFQA 4WK2B 1XIPA 3F3GA 4NSXA 5E6SB 3BWSA 3I7KA 5TEFA 4A0BA 2H14A 1NEXB 4J0XA 2PM7B 5TEEA 5E6UB 3JRPA 3OKYB 1K8KC 4Z7QB 3MMYA 2G99A 5C2VB 4ZOYA 3JZHA 3AL8B 4JT6C 3NVNA 3AH8B 4TZ4A 1MG2A 2H9PA 3UVOA 3CFSB 4Y7RA 1FWXA 5EAMA 3EMHA 2IWKA 3SXTD 2IUPA 2OK6A 3PSCB 3JZGA 4JT5C 4PC0A 3J81g 1JMXB 2Z2OA 4ERQA 4Y5RD 2H3XA 2H68A 3BG1A 4JSNC 2GC4A 3ODTA 1N6FA 3PXTD 4GQBB 1U8CB 2TRCB 4U7AA 3SVWD 3FRXA 4X63B 4J84A 1P22A 5B4WA 5C9ZB 3JZNA 5CXCB 3EI1B 2VDNB 4J81A 4L1QD 3EI3B 5EMKB 3C5MA 4E5ZB 4GGCA 4CY5A 3AL8A 3JPXA 3IJCA 4CI3A 5HE0B 3SFZA 5FA5B 5THAA 3NIDB 3N0EA 3UKUC 4BUJC 2P9IC 3I89A 3I8CA 4L3HD 4UI9R 3F3PA 3IJ0A 5EAPA 5HE2B 4XEIC 1TYEB 1U2VC 1PGUA 3OTTA 3PXWD 3OL2A 3SBRA 3SN6B
chains in the Genus database with same CATH superfamily
4O3UB 4FA5D 1GXRA 2P9SC 1OLZA 3RMZD 2H47A 2AGXA 4A0AB 4FAND 4JSVC 4ZN4A 5KDOB 4QT8A 3MUNA 5AMSA 4IA9A 2QR5A 3FCSA 3IUNA 5CXCA 1MG3A 4CC9A 4NENA 2Z2PA 3EI1A 4H5IA 4G56B 3EI3A 1JTDB 4FB1D 4E5ZA 2VDQB 5FKSA 2PM9B 4ES0A 3JB9L 4K3JB 4Z7NB 3IIYA 4J79A 4AMYA 5CXBB 2EBSA 3EQ9A 1VE6A 3MZKA 5K19A 5HDBB 4MMXA 1O6FA 2VZ3A 1JMZB 2OIZA 2H13A 3NVQA 5HE1B 3IIWA 3ZE1B 1E8MA 5EALA 1TYEA 2VDLB 1E8NA 3BG0A 5IJ8E 3QI0A 3UR4A 3T3MB 2GNQA 1RI6A 4A7JA 4O3TB 5C2WB 2P9LC 4MK0B 2GC7A 2IUQA 5HQGA 1H2XA 3JROA 2MTAH 2XYIA 4GGAA 2XL3A 4A0AA 5TDHB 1K3IA 4LG9A 1GOHA 1I2MB 2CE8A 4A2MA 3UVKA 3I7PA 5FKRA 5IC7A 3NIFB 3ZE0B 5K1CC 4PBZA 2VDQA 2H9NA 3DM0A 2PM9A 3IJ1A 5H1MA 4O45A 3SWSD 3NVXA 5FLXg 4Z7NA 4CZYA 2I0TA 4YVDA 3OKWA 2XL2A 1L0QA 5CXBA 3QHYB 3SBQA 3MUOA 4A11B 5HDBA 1SQJA 4ERYA 3I7LA 5FFGA 4QL1A 3SBPA 2B5MA 4GZ8A 4U1EI 4WK4B 1JOFA 3ZE1A 3C99A 4AOWA 1GG2B 2VDLA 2HKMA 4JSPC 4X61B 2P9NC 3V7DB 5FKQA 4GM8A 4ZOXA 3P4FA 2CO0A 4PSXB 4J8BA 4FA1D 2OVPB 5HE3B 3T3MA 4LG8A 4WK2A 3RLMD 5AJAA 2XDWA 5H14A 3CFVA 5IGQA 3IVMA 3W15A 3L4OD 4FWWA 4O2WA 5E6UA 3NIFA 3UVNA 2VDPB 4CZVA 3C75H 3F3FA 3OKYA 3ZE0A 3V4VA 4WJKB 1UOQA 3J80g 4E54B 2HESX 3IURA 1R5MA 4N14A 2J55H 2OVRB 2G9AA 4J0WA 4RE6A 2QZPA 1ERJA 3VI3B 4ESGA 4FA4D 4CY3A 4MMYA 1VZ2A 2OVQB 5EM2B 4XYIA 4UM9D 3UVMA 1E5TA 4X60B 4L9OA 4CI2A 4J78A 3SJLD 2VC2B 4WK4A 4XYHA 2VDOB 5E6RB 4RE5A 1A12A 1XHMA 1PBYB 2HKRA 4QAMA 4Z7OB 4PXWA 4X3EA 4JD2C 3EI4B 2O9KA 3IJEA 3OW8A 2P26A 1N6EA 1YR2A 4GMBA 1YUKA 3EQ8A 3IUJA 4GGDA 2VDRB 5AFU3 1U8CA 2H6NA 3SCYA 3C9CA 1SQ9A 2UZXB 2VDKB 3RSEC 4WJKA 2VDNA 2H9LA 4E54A 2OK4A 3VA6A 5M61A 1U4CA 4BL0A 2AGYA 2HU7A 5IGOA 4D0KA 3IULA 4MMZA 1SSLA 4JHPC 4J77A 2CN3A 1TYQC 1GP2B 2XE4A 3VI3A 2YNOA 1VZ3A 3EU7A 3NIDA 3B7FA 4JSXC 5EM2A 3MVDK 3OKTA 2BBKH 2B5LA 1MDAH 2CE9A 2VDOA 5E6RA 4A2LA 5IJ7E 5EMLB 4A0BB 4Z7OA 4GM3A 2I3SA 3O4JA 5CYKB 3K26A 4NAAA 2AGLA 3RN1D 3EWEA 3MKSB 4BP8A 4BCCA 2W18A 1S4UX 5I5MA 2B5NA 2H6QA 5M5RA 3FGBA 2H6KA 3UVLA 4ZOVA 2VDRA 4GQ1A 3DXKC 3I2NA 3KCIA 2PBIB 4OWRA 1JJUB 3AFCA 3DSMA 1QFSA 3K71A 4NC4A 2VDKA 1A0RB 3AL9A 4UM8B 2CN2A 4H5JA 5M5UA 4G55A 4KFMB 4I79A 4CI1A 4BCDA 1H2WA 4GQ2P 5I5JA 3PE7A 2I0SA 3I7HA 3MXXA 3MKQA 4A08B 5FKTA 3IUMA 1GOGA 4FAVD 2AGWA 3ZE2B 2WQ8A 2HJ4A 3FCUB 4AN1A 4O1QD 1B9YA 4O9DA 2EICA 2I3TA 3I7NA 2YNPA 3VGZA 5CYKA 4PNKB 3RRMC 3OF7A 4PSWB 2P9KC 3MZLA 4GM9A 2EIBA 2UZYB 3IKOA 4ZOZA 3EG6A 4CZXA 2YMUA 3V4PA 2QXVA 3L4MD 4DNUA 3I7OA 2JKXA 1C9IA 2P9PC 2BKLA 3KRWB 4LGNA 2Q7QA 1XKSA 3ZDYB 3ZDXB 3GC3B 1OMWB 4UM8A 3GD1I 3V5WB 5FXYA 3O4HA 4BH6A 2BCJB 2HXCA 3GREA 1Q47A 3OL2B 4J87A 2CO0C 4A08A 2JWGA 5M5VA 2YNNA 4A11A 4AEZA 4ERZA 2HYEA 2XU7A 2EIEA 5TF2A 2YB8B 3ZE2A 3FCUA 4QQEA 1T2XA 3I8EA 5GXHA 2HU8A 4AN0A 2IURA 4IRZA 1SHYB 1PI6A 4CY1A 1NR0A 5I5IA 1BPOA 3RFHA 2CNXA 5EMJB 2J56H 5FQDA 1VE7A 4A09B 3RN0D 4R7AB 5M5TA 1B9XA 3V9FA 1K32A 1VYHC 2AH0A 3K27A 2IAAA 5GXIA 3KRXB 4CI8A 4FA9D 2IUVA 3A0FA 3CIKB 5GSAA 3DDUA 3VI4B 3HFQA 4WK0B 4L3GD 3PVUB 2OJYA 2IWFA 3ZDYA 4EWRA 2VDPA 3GFCA 3ZDXA 3ULEC 3FM0A 4HDJA 4UM9B 3DWLC 3EI2B 3DXMC 5EMMB 5SXMA 2P9UC 2I0RA 2YBAA 5IT9g 3PSLA 3JAMg 2QC5A 4J8GA 4DNVA 4J82A 4CY2A 4D6VA 2PM6B 2H9MA 3ZDZB 2AH1A 5HYNB 2VC2A 4J73A 2Z2NA 3O4GA 3O4IA 3SMRA 4K3ID 3NIGB 3UKRC 5GMKn 5M5SA 4A09A 3EI4A 1UOPA 4L1MA 3SHFA 4OZUA 4Z8LA 3K72A 3N0DA 3RFGA 4AX4A 2AGZA 1TBGA 3VH0A 5EARA 4J86A 2P28A 1QNIA 4IMMA 1O6GA 2VDMB 3VI4A 4WK0A 3PVWB 1GOTB 1M1XA 3SLED 2AQ5A 3PXSD 4JXMA 4QRJA 4UM9A 3ORVD 2J57G 3U4YA 3E0CA 1N6DA 3T3PB 4G1MA 3EI2A 1H2YA 2B4EA 3K6SA 4FHLA 2JWHA 1GOFA 4PBYA 2HJBA 2XZGA 3ZWLB 1PEVA 5A2Qg 5H17A 5JWZA 1YFQA 4WK2B 1XIPA 3F3GA 1H2ZA 4NSXA 3ZDZA 5E6SB 3BWSA 3I7KA 4D9SA 4BCBA 5TEFA 4A0BA 2H14A 1NEXB 4J0XA 2PM7B 5TEEA 3NIGA 2EIDA 4BP9A 5E6UB 3JRPA 3OKYB 1K8KC 4Z7QB 3MMYA 2G99A 5C2VB 4ZOYA 3JZHA 2HU5A 3AL8B 2VDMA 4JT6C 3NVNA 3AH8B 5FFOA 4TZ4A 1MG2A 2H9PA 3UVOA 3CFSB 4Y7RA 1FWXA 5EAMA 3EMHA 4DNWA 2IWKA 3SXTD 2IUPA 2OK6A 3T3PA 3PSCB 3JZGA 1UOOA 4JT5C 4PC0A 3J81g 1JMXB 2Z2OA 4ERQA 4Y5RD 2H3XA 2H68A 3BG1A 4JSNC 4O02A 2GC4A 5E6SA 3ODTA 1N6FA 3PXTD 4NBMA 4GQBB 1U8CB 2TRCB 3IUQA 4U7AA 3SVWD 3FRXA 4X63B 4J84A 1P22A 1QFMA 5B4WA 5C9ZB 4Z7QA 3JZNA 5CXCB 4AMZA 3EI1B 4G1EA 2VDNB 4J81A 4L1QD 3EI3B 5EMKB 3C5MA 5C86A 4E5ZB 4GGCA 4CY5A 3AL8A 3JPXA 3IJCA 3EQ7A 4CI3A 5HE0B 1UTCA 3SFZA 5FA5B 5THAA 3NIDB 1L5GA 2VZ1A 3N0EA 3UKUC 5C92A 4BUJC 1C9LA 2P9IC 4JHNA 3I89A 3I8CA 4L3HD 4UI9R 3F3PA 3IJ0A 5EAPA 5HE2B 4XEIC 1TYEB 1U2VC 1PGUA 3OTTA 3PXWD 1JV2A 3OL2A 3SBRA 3SN6B
chains in the Genus database with same CATH topology
4O3UB 4FA5D 1GXRA 2P9SC 1OLZA 3RMZD 2H47A 2AGXA 4A0AB 4FAND 4JSVC 4ZN4A 5KDOB 4QT8A 5AMSA 4IA9A 5CXCA 4CC9A 1MG3A 2Z2PA 3EI1A 4H5IA 4G56B 3EI3A 4FB1D 4E5ZA 2VDQB 5FKSA 2PM9B 4ES0A 3JB9L 4K3JB 4Z7NB 3IIYA 4J79A 5CXBB 2EBSA 3MZKA 5K19A 5HDBB 1JMZB 2OIZA 2H13A 3NVQA 5HE1B 3IIWA 3ZE1B 5EALA 2VDLB 3BG0A 5IJ8E 3UR4A 3T3MB 2GNQA 1RI6A 4A7JA 4O3TB 5C2WB 2P9LC 4MK0B 2GC7A 2IUQA 5HQGA 2MTAH 3JROA 2XYIA 4GGAA 2XL3A 4A0AA 5TDHB 4LG9A 2CE8A 4A2MA 3UVKA 3I7PA 5FKRA 5IC7A 3NIFB 3ZE0B 5K1CC 4PBZA 2H9NA 3DM0A 2PM9A 3IJ1A 5H1MA 4O45A 3SWSD 3NVXA 5FLXg 4CZYA 2I0TA 4YVDA 3OKWA 2XL2A 1L0QA 5CXBA 3SBQA 4A11B 4ERYA 1SQJA 3I7LA 4QL1A 3SBPA 2B5MA 4GZ8A 4U1EI 4WK4B 1JOFA 3C99A 4AOWA 1GG2B 3V7DB 2HKMA 4JSPC 4X61B 2P9NC 5FKQA 4GM8A 4ZOXA 3P4FA 2CO0A 4PSXB 4J8BA 4FA1D 2OVPB 5HE3B 4LG8A 3RLMD 5AJAA 5H14A 3CFVA 5IGQA 3W15A 3L4OD 4FWWA 3UVNA 2VDPB 4CZVA 3C75H 3F3FA 3OKYA 4WJKB 3J80g 4E54B 2HESX 1R5MA 4N14A 2J55H 2OVRB 2G9AA 4J0WA 1ERJA 3VI3B 4ESGA 4FA4D 4CY3A 2OVQB 5EM2B 4XYIA 4UM9D 3UVMA 4X60B 4L9OA 4CI2A 4J78A 3SJLD 2VC2B 2VDOB 4XYHA 5E6RB 1XHMA 1PBYB 2HKRA 4Z7OB 4PXWA 4X3EA 4JD2C 3EI4B 2O9KA 3OW8A 2P26A 1N6EA 4GMBA 1YUKA 4GGDA 2VDRB 5AFU3 2H6NA 3SCYA 3C9CA 1SQ9A 2UZXB 2VDKB 3RSEC 2H9LA 4E54A 2OK4A 3VA6A 1U4CA 4BL0A 2AGYA 5IGOA 4D0KA 1SSLA 4J77A 2CN3A 1TYQC 1GP2B 5GXIA 2YNOA 3EU7A 4JSXC 3B7FA 5EM2A 3OKTA 2BBKH 2B5LA 1MDAH 2CE9A 4A2LA 5IJ7E 5EMLB 4A0BB 4GM3A 2I3SA 5CYKB 3K26A 2AGLA 3RN1D 3EWEA 3MKSB 2W18A 1S4UX 5I5MA 2B5NA 2H6QA 3FGBA 2H6KA 3UVLA 4ZOVA 4GQ1A 3DXKC 3I2NA 2PBIB 4OWRA 1JJUB 3AFCA 3DSMA 1A0RB 3AL9A 4UM8B 2CN2A 4H5JA 4KFMB 4I79A 4CI1A 4GQ2P 5I5JA 3PE7A 2I0SA 3I7HA 3MXXA 3MKQA 4A08B 5FKTA 4FAVD 2AGWA 3ZE2B 2HJ4A 3FCUB 4O1QD 1B9YA 4O9DA 2I3TA 3I7NA 2YNPA 3VGZA 5CYKA 4PNKB 3RRMC 4PSWB 2P9KC 3MZLA 4GM9A 2UZYB 3IKOA 4ZOZA 3EG6A 4CZXA 2YMUA 2QXVA 3L4MD 3I7OA 2P9PC 3KRWB 4LGNA 2Q7QA 1XKSA 3ZDYB 3ZDXB 1OMWB 3V5WB 5FXYA 4BH6A 2BCJB 2HXCA 3GREA 1Q47A 3OL2B 4J87A 2CO0C 4A08A 2JWGA 2YNNA 4A11A 4AEZA 4ERZA 2HYEA 2XU7A 5TF2A 2YB8B 4QQEA 5GXHA 3I8EA 2IURA 1SHYB 1PI6A 4CY1A 1NR0A 5I5IA 3RFHA 2CNXA 5EMJB 2J56H 5FQDA 4A09B 3RN0D 4R7AB 1B9XA 3V9FA 1K32A 1VYHC 2AH0A 3K27A 2IAAA 3KRXB 4CI8A 4FA9D 2IUVA 3A0FA 3CIKB 5GSAA 3VI4B 3HFQA 4WK0B 4L3GD 3PVUB 2OJYA 2IWFA 4EWRA 3GFCA 3ULEC 3FM0A 4HDJA 4UM9B 3DWLC 3EI2B 3DXMC 5EMMB 5SXMA 2P9UC 2I0RA 2YBAA 5IT9g 3PSLA 3JAMg 2QC5A 4J8GA 4J82A 4CY2A 4D6VA 2PM6B 2H9MA 3ZDZB 2AH1A 5HYNB 4J73A 2Z2NA 3SMRA 4K3ID 3NIGB 3UKRC 5GMKn 4A09A 3EI4A 3SHFA 4OZUA 4Z8LA 3N0DA 3RFGA 2AGZA 1TBGA 3VH0A 5EARA 4J86A 2P28A 1QNIA 4IMMA 2VDMB 3PVWB 1GOTB 3SLED 2AQ5A 3PXSD 4JXMA 4QRJA 3ORVD 2J57G 3U4YA 3E0CA 1N6DA 3T3PB 3EI2A 2B4EA 4FHLA 2JWHA 4PBYA 2HJBA 3ZWLB 1PEVA 5A2Qg 5H17A 5JWZA 1YFQA 4WK2B 1XIPA 3F3GA 4NSXA 5E6SB 3BWSA 3I7KA 5TEFA 4A0BA 2H14A 1NEXB 4J0XA 2PM7B 5TEEA 5E6UB 3JRPA 3OKYB 1K8KC 4Z7QB 3MMYA 2G99A 5C2VB 4ZOYA 3JZHA 3AL8B 4JT6C 3NVNA 3AH8B 4TZ4A 1MG2A 2H9PA 3UVOA 3CFSB 4Y7RA 1FWXA 5EAMA 3EMHA 2IWKA 3SXTD 2IUPA 2OK6A 3PSCB 3JZGA 4JT5C 4PC0A 3J81g 1JMXB 2Z2OA 4ERQA 4Y5RD 2H3XA 2H68A 3BG1A 4JSNC 2GC4A 3ODTA 1N6FA 3PXTD 4GQBB 1U8CB 2TRCB 4U7AA 3SVWD 3FRXA 4X63B 4J84A 1P22A 5B4WA 5C9ZB 3JZNA 5CXCB 3EI1B 2VDNB 4J81A 4L1QD 3EI3B 5EMKB 3C5MA 4E5ZB 4GGCA 4CY5A 3AL8A 3JPXA 3IJCA 4CI3A 5HE0B 3SFZA 5FA5B 5THAA 3NIDB 3N0EA 3UKUC 4BUJC 2P9IC 3I89A 3I8CA 4L3HD 4UI9R 3F3PA 3IJ0A 5EAPA 5HE2B 4XEIC 1TYEB 1U2VC 1PGUA 3OTTA 3PXWD 3OL2A 3SBRA 3SN6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3U B;  4FA5 D;  1GXR A;  2P9S C;  1OLZ A;  3RMZ D;  2H47 A;  2AGX A;  4A0A B;  4FAN D;  4JSV C;  4ZN4 A;  5KDO B;  4QT8 A;  5AMS A;  4IA9 A;  5CXC A;  4CC9 A;  1MG3 A;  2Z2P A;  3EI1 A;  4H5I A;  4G56 B;  3EI3 A;  4FB1 D;  4E5Z A;  2VDQ B;  5FKS A;  2PM9 B;  4ES0 A;  3JB9 L;  4K3J B;  4Z7N B;  3IIY A;  4J79 A;  5CXB B;  2EBS A;  3MZK A;  5K19 A;  5HDB B;  1JMZ B;  2OIZ A;  2H13 A;  3NVQ A;  5HE1 B;  3IIW A;  3ZE1 B;  5EAL A;  2VDL B;  3BG0 A;  5IJ8 E;  3UR4 A;  3T3M B;  2GNQ A;  1RI6 A;  4A7J A;  4O3T B;  5C2W B;  2P9L C;  4MK0 B;  2GC7 A;  2IUQ A;  5HQG A;  2MTA H;  3JRO A;  2XYI A;  4GGA A;  2XL3 A;  4A0A A;  5TDH B;  4LG9 A;  2CE8 A;  4A2M A;  3UVK A;  3I7P A;  5FKR A;  5IC7 A;  3NIF B;  3ZE0 B;  5K1C C;  4PBZ A;  2H9N A;  3DM0 A;  2PM9 A;  3IJ1 A;  5H1M A;  4O45 A;  3SWS D;  3NVX A;  5FLX g;  4CZY A;  2I0T A;  4YVD A;  3OKW A;  2XL2 A;  1L0Q A;  5CXB A;  3SBQ A;  4A11 B;  4ERY A;  1SQJ A;  3I7L A;  4QL1 A;  3SBP A;  2B5M A;  4GZ8 A;  4U1E I;  4WK4 B;  1JOF A;  3C99 A;  4AOW A;  1GG2 B;  3V7D B;  2HKM A;  4JSP C;  4X61 B;  2P9N C;  5FKQ A;  4GM8 A;  4ZOX A;  3P4F A;  2CO0 A;  4PSX B;  4J8B A;  4FA1 D;  2OVP B;  5HE3 B;  4LG8 A;  3RLM D;  5AJA A;  5H14 A;  3CFV A;  5IGQ A;  3W15 A;  3L4O D;  4FWW A;  3UVN A;  2VDP B;  4CZV A;  3C75 H;  3F3F A;  3OKY A;  4WJK B;  3J80 g;  4E54 B;  2HES X;  1R5M A;  4N14 A;  2J55 H;  2OVR B;  2G9A A;  4J0W A;  1ERJ A;  3VI3 B;  4ESG A;  4FA4 D;  4CY3 A;  2OVQ B;  5EM2 B;  4XYI A;  4UM9 D;  3UVM A;  4X60 B;  4L9O A;  4CI2 A;  4J78 A;  3SJL D;  2VC2 B;  2VDO B;  4XYH A;  5E6R B;  1XHM A;  1PBY B;  2HKR A;  4Z7O B;  4PXW A;  4X3E A;  4JD2 C;  3EI4 B;  2O9K A;  3OW8 A;  2P26 A;  1N6E A;  4GMB A;  1YUK A;  4GGD A;  2VDR B;  5AFU 3;  2H6N A;  3SCY A;  3C9C A;  1SQ9 A;  2UZX B;  2VDK B;  3RSE C;  2H9L A;  4E54 A;  2OK4 A;  3VA6 A;  1U4C A;  4BL0 A;  2AGY A;  5IGO A;  4D0K A;  1SSL A;  4J77 A;  2CN3 A;  1TYQ C;  1GP2 B;  5GXI A;  2YNO A;  3EU7 A;  4JSX C;  3B7F A;  5EM2 A;  3OKT A;  2BBK H;  2B5L A;  1MDA H;  2CE9 A;  4A2L A;  5IJ7 E;  5EML B;  4A0B B;  4GM3 A;  2I3S A;  5CYK B;  3K26 A;  2AGL A;  3RN1 D;  3EWE A;  3MKS B;  2W18 A;  1S4U X;  5I5M A;  2B5N A;  2H6Q A;  3FGB A;  2H6K A;  3UVL A;  4ZOV A;  4GQ1 A;  3DXK C;  3I2N A;  2PBI B;  4OWR A;  1JJU B;  3AFC A;  3DSM A;  1A0R B;  3AL9 A;  4UM8 B;  2CN2 A;  4H5J A;  4KFM B;  4I79 A;  4CI1 A;  4GQ2 P;  5I5J A;  3PE7 A;  2I0S A;  3I7H A;  3MXX A;  3MKQ A;  4A08 B;  5FKT A;  4FAV D;  2AGW A;  3ZE2 B;  2HJ4 A;  3FCU B;  4O1Q D;  1B9Y A;  4O9D A;  2I3T A;  3I7N A;  2YNP A;  3VGZ A;  5CYK A;  4PNK B;  3RRM C;  4PSW B;  2P9K C;  3MZL A;  4GM9 A;  2UZY B;  3IKO A;  4ZOZ A;  3EG6 A;  4CZX A;  2YMU A;  2QXV A;  3L4M D;  3I7O A;  2P9P C;  3KRW B;  4LGN A;  2Q7Q A;  1XKS A;  3ZDY B;  3ZDX B;  1OMW B;  3V5W B;  5FXY A;  4BH6 A;  2BCJ B;  2HXC A;  3GRE A;  1Q47 A;  3OL2 B;  4J87 A;  2CO0 C;  4A08 A;  2YNN A;  4A11 A;  4AEZ A;  4ERZ A;  2HYE A;  2XU7 A;  5TF2 A;  2YB8 B;  4QQE A;  5GXH A;  3I8E A;  2IUR A;  1SHY B;  1PI6 A;  4CY1 A;  1NR0 A;  5I5I A;  3RFH A;  2CNX A;  5EMJ B;  2J56 H;  5FQD A;  4A09 B;  3RN0 D;  4R7A B;  1B9X A;  3V9F A;  1K32 A;  1VYH C;  2AH0 A;  3K27 A;  2IAA A;  3KRX B;  4CI8 A;  4FA9 D;  2IUV A;  3A0F A;  3CIK B;  5GSA A;  3VI4 B;  3HFQ A;  4WK0 B;  4L3G D;  3PVU B;  2OJY A;  2IWF A;  4EWR A;  3GFC A;  3ULE C;  3FM0 A;  4HDJ A;  4UM9 B;  3DWL C;  3EI2 B;  3DXM C;  5EMM B;  5SXM A;  2P9U C;  2I0R A;  2YBA A;  5IT9 g;  3PSL A;  3JAM g;  2QC5 A;  4J8G A;  4J82 A;  4CY2 A;  4D6V A;  2PM6 B;  2H9M A;  3ZDZ B;  2AH1 A;  5HYN B;  4J73 A;  2Z2N A;  3SMR A;  4K3I D;  3NIG B;  3UKR C;  5GMK n;  4A09 A;  3EI4 A;  3SHF A;  4OZU A;  4Z8L A;  3N0D A;  3RFG A;  2AGZ A;  1TBG A;  3VH0 A;  5EAR A;  4J86 A;  2P28 A;  1QNI A;  4IMM A;  2VDM B;  3PVW B;  1GOT B;  3SLE D;  2AQ5 A;  3PXS D;  4JXM A;  4QRJ A;  3ORV D;  2J57 G;  3U4Y A;  3E0C A;  1N6D A;  3T3P B;  3EI2 A;  2B4E A;  4FHL A;  4PBY A;  2HJB A;  3ZWL B;  1PEV A;  5A2Q g;  5H17 A;  5JWZ A;  1YFQ A;  4WK2 B;  1XIP A;  3F3G A;  4NSX A;  5E6S B;  3BWS A;  3I7K A;  5TEF A;  4A0B A;  2H14 A;  1NEX B;  4J0X A;  2PM7 B;  5TEE A;  5E6U B;  3JRP A;  3OKY B;  1K8K C;  4Z7Q B;  3MMY A;  2G99 A;  5C2V B;  4ZOY A;  3JZH A;  3AL8 B;  4JT6 C;  3NVN A;  3AH8 B;  4TZ4 A;  1MG2 A;  2H9P A;  3UVO A;  3CFS B;  4Y7R A;  1FWX A;  5EAM A;  3EMH A;  2IWK A;  3SXT D;  2IUP A;  2OK6 A;  3PSC B;  3JZG A;  4JT5 C;  4PC0 A;  3J81 g;  1JMX B;  2Z2O A;  4ERQ A;  4Y5R D;  2H3X A;  2H68 A;  3BG1 A;  4JSN C;  2GC4 A;  3ODT A;  1N6F A;  3PXT D;  4GQB B;  1U8C B;  2TRC B;  4U7A A;  3SVW D;  3FRX A;  4X63 B;  4J84 A;  1P22 A;  5B4W A;  5C9Z B;  3JZN A;  5CXC B;  3EI1 B;  2VDN B;  4J81 A;  4L1Q D;  3EI3 B;  5EMK B;  3C5M A;  4E5Z B;  4GGC A;  4CY5 A;  3AL8 A;  3JPX A;  3IJC A;  4CI3 A;  5HE0 B;  3SFZ A;  5FA5 B;  5THA A;  3NID B;  3N0E A;  3UKU C;  4BUJ C;  2P9I C;  3I89 A;  3I8C A;  4L3H D;  4UI9 R;  3F3P A;  3IJ0 A;  5EAP A;  5HE2 B;  4XEI C;  1TYE B;  1U2V C;  1PGU A;  3OTT A;  3PXW D;  3OL2 A;  3SBR A;  3SN6 B; 
#chains in the Genus database with same CATH topology
 4O3U B;  4FA5 D;  1GXR A;  2P9S C;  1OLZ A;  3RMZ D;  2H47 A;  2AGX A;  4A0A B;  4FAN D;  4JSV C;  4ZN4 A;  5KDO B;  4QT8 A;  3MUN A;  5AMS A;  4IA9 A;  2QR5 A;  3FCS A;  3IUN A;  5CXC A;  1MG3 A;  4CC9 A;  4NEN A;  2Z2P A;  3EI1 A;  4H5I A;  4G56 B;  3EI3 A;  1JTD B;  4FB1 D;  4E5Z A;  2VDQ B;  5FKS A;  2PM9 B;  4ES0 A;  3JB9 L;  4K3J B;  4Z7N B;  3IIY A;  4J79 A;  4AMY A;  5CXB B;  2EBS A;  3EQ9 A;  1VE6 A;  3MZK A;  5K19 A;  5HDB B;  4MMX A;  1O6F A;  2VZ3 A;  1JMZ B;  2OIZ A;  2H13 A;  3NVQ A;  5HE1 B;  3IIW A;  3ZE1 B;  1E8M A;  5EAL A;  1TYE A;  2VDL B;  1E8N A;  3BG0 A;  5IJ8 E;  3QI0 A;  3UR4 A;  3T3M B;  2GNQ A;  1RI6 A;  4A7J A;  4O3T B;  5C2W B;  2P9L C;  4MK0 B;  2GC7 A;  2IUQ A;  5HQG A;  1H2X A;  3JRO A;  2MTA H;  2XYI A;  4GGA A;  2XL3 A;  4A0A A;  5TDH B;  1K3I A;  4LG9 A;  1GOH A;  1I2M B;  2CE8 A;  4A2M A;  3UVK A;  3I7P A;  5FKR A;  5IC7 A;  3NIF B;  3ZE0 B;  5K1C C;  4PBZ A;  2VDQ A;  2H9N A;  3DM0 A;  2PM9 A;  3IJ1 A;  5H1M A;  4O45 A;  3SWS D;  3NVX A;  5FLX g;  4Z7N A;  4CZY A;  2I0T A;  4YVD A;  3OKW A;  2XL2 A;  1L0Q A;  5CXB A;  3QHY B;  3SBQ A;  3MUO A;  4A11 B;  5HDB A;  1SQJ A;  4ERY A;  3I7L A;  5FFG A;  4QL1 A;  3SBP A;  2B5M A;  4GZ8 A;  4U1E I;  4WK4 B;  1JOF A;  3ZE1 A;  3C99 A;  4AOW A;  1GG2 B;  2VDL A;  2HKM A;  4JSP C;  4X61 B;  2P9N C;  3V7D B;  5FKQ A;  4GM8 A;  4ZOX A;  3P4F A;  2CO0 A;  4PSX B;  4J8B A;  4FA1 D;  2OVP B;  5HE3 B;  3T3M A;  4LG8 A;  4WK2 A;  3RLM D;  5AJA A;  2XDW A;  5H14 A;  3CFV A;  5IGQ A;  3IVM A;  3W15 A;  3L4O D;  4FWW A;  4O2W A;  5E6U A;  3NIF A;  3UVN A;  2VDP B;  4CZV A;  3C75 H;  3F3F A;  3OKY A;  3ZE0 A;  3V4V A;  4WJK B;  1UOQ A;  3J80 g;  4E54 B;  2HES X;  3IUR A;  1R5M A;  4N14 A;  2J55 H;  2OVR B;  2G9A A;  4J0W A;  4RE6 A;  2QZP A;  1ERJ A;  3VI3 B;  4ESG A;  4FA4 D;  4CY3 A;  4MMY A;  1VZ2 A;  2OVQ B;  5EM2 B;  4XYI A;  4UM9 D;  3UVM A;  1E5T A;  4X60 B;  4L9O A;  4CI2 A;  4J78 A;  3SJL D;  2VC2 B;  4WK4 A;  4XYH A;  2VDO B;  5E6R B;  4RE5 A;  1A12 A;  1XHM A;  1PBY B;  2HKR A;  4QAM A;  4Z7O B;  4PXW A;  4X3E A;  4JD2 C;  3EI4 B;  2O9K A;  3IJE A;  3OW8 A;  2P26 A;  1N6E A;  1YR2 A;  4GMB A;  1YUK A;  3EQ8 A;  3IUJ A;  4GGD A;  2VDR B;  5AFU 3;  1U8C A;  2H6N A;  3SCY A;  3C9C A;  1SQ9 A;  2UZX B;  2VDK B;  3RSE C;  4WJK A;  2VDN A;  2H9L A;  4E54 A;  2OK4 A;  3VA6 A;  5M61 A;  1U4C A;  4BL0 A;  2AGY A;  2HU7 A;  5IGO A;  4D0K A;  3IUL A;  4MMZ A;  1SSL A;  4JHP C;  4J77 A;  2CN3 A;  1TYQ C;  1GP2 B;  2XE4 A;  3VI3 A;  2YNO A;  1VZ3 A;  3EU7 A;  3NID A;  3B7F A;  4JSX C;  5EM2 A;  3MVD K;  3OKT A;  2BBK H;  2B5L A;  1MDA H;  2CE9 A;  2VDO A;  5E6R A;  4A2L A;  5IJ7 E;  5EML B;  4A0B B;  4Z7O A;  4GM3 A;  2I3S A;  3O4J A;  5CYK B;  3K26 A;  4NAA A;  2AGL A;  3RN1 D;  3EWE A;  3MKS B;  4BP8 A;  4BCC A;  2W18 A;  1S4U X;  5I5M A;  2B5N A;  2H6Q A;  5M5R A;  3FGB A;  2H6K A;  3UVL A;  4ZOV A;  2VDR A;  4GQ1 A;  3DXK C;  3I2N A;  3KCI A;  2PBI B;  4OWR A;  1JJU B;  3AFC A;  3DSM A;  1QFS A;  3K71 A;  4NC4 A;  2VDK A;  1A0R B;  3AL9 A;  4UM8 B;  2CN2 A;  4H5J A;  5M5U A;  4G55 A;  4KFM B;  4I79 A;  4CI1 A;  4BCD A;  1H2W A;  4GQ2 P;  5I5J A;  3PE7 A;  2I0S A;  3I7H A;  3MXX A;  3MKQ A;  4A08 B;  5FKT A;  3IUM A;  1GOG A;  4FAV D;  2AGW A;  3ZE2 B;  2WQ8 A;  2HJ4 A;  3FCU B;  4AN1 A;  4O1Q D;  1B9Y A;  4O9D A;  2EIC A;  2I3T A;  3I7N A;  2YNP A;  3VGZ A;  5CYK A;  4PNK B;  3RRM C;  3OF7 A;  4PSW B;  2P9K C;  3MZL A;  4GM9 A;  2EIB A;  2UZY B;  3IKO A;  4ZOZ A;  3EG6 A;  4CZX A;  2YMU A;  3V4P A;  2QXV A;  3L4M D;  4DNU A;  3I7O A;  2JKX A;  1C9I A;  2P9P C;  2BKL A;  3KRW B;  4LGN A;  2Q7Q A;  1XKS A;  3ZDY B;  3ZDX B;  3GC3 B;  1OMW B;  4UM8 A;  3GD1 I;  3V5W B;  5FXY A;  3O4H A;  4BH6 A;  2BCJ B;  2HXC A;  3GRE A;  1Q47 A;  3OL2 B;  4J87 A;  2CO0 C;  4A08 A;  2JWG A;  5M5V A;  2YNN A;  4A11 A;  4AEZ A;  4ERZ A;  2HYE A;  2XU7 A;  2EIE A;  5TF2 A;  2YB8 B;  3ZE2 A;  3FCU A;  4QQE A;  1T2X A;  3I8E A;  5GXH A;  2HU8 A;  4AN0 A;  2IUR A;  4IRZ A;  1SHY B;  1PI6 A;  4CY1 A;  1NR0 A;  5I5I A;  1BPO A;  3RFH A;  2CNX A;  5EMJ B;  2J56 H;  5FQD A;  1VE7 A;  4A09 B;  3RN0 D;  4R7A B;  5M5T A;  1B9X A;  3V9F A;  1K32 A;  1VYH C;  2AH0 A;  3K27 A;  2IAA A;  5GXI A;  3KRX B;  4CI8 A;  4FA9 D;  2IUV A;  3A0F A;  3CIK B;  5GSA A;  3DDU A;  3VI4 B;  3HFQ A;  4WK0 B;  4L3G D;  3PVU B;  2OJY A;  2IWF A;  3ZDY A;  4EWR A;  2VDP A;  3GFC A;  3ZDX A;  3ULE C;  3FM0 A;  4HDJ A;  4UM9 B;  3DWL C;  3EI2 B;  3DXM C;  5EMM B;  5SXM A;  2P9U C;  2I0R A;  2YBA A;  5IT9 g;  3PSL A;  3JAM g;  2QC5 A;  4J8G A;  4DNV A;  4J82 A;  4CY2 A;  4D6V A;  2PM6 B;  2H9M A;  3ZDZ B;  2AH1 A;  5HYN B;  2VC2 A;  4J73 A;  2Z2N A;  3O4G A;  3O4I A;  3SMR A;  4K3I D;  3NIG B;  3UKR C;  5GMK n;  5M5S A;  4A09 A;  3EI4 A;  1UOP A;  4L1M A;  3SHF A;  4OZU A;  4Z8L A;  3K72 A;  3N0D A;  3RFG A;  4AX4 A;  2AGZ A;  1TBG A;  3VH0 A;  5EAR A;  4J86 A;  2P28 A;  1QNI A;  4IMM A;  1O6G A;  2VDM B;  3VI4 A;  4WK0 A;  3PVW B;  1GOT B;  1M1X A;  3SLE D;  2AQ5 A;  3PXS D;  4JXM A;  4QRJ A;  4UM9 A;  3ORV D;  2J57 G;  3U4Y A;  3E0C A;  1N6D A;  3T3P B;  4G1M A;  3EI2 A;  1H2Y A;  2B4E A;  3K6S A;  4FHL A;  2JWH A;  1GOF A;  4PBY A;  2HJB A;  2XZG A;  3ZWL B;  1PEV A;  5A2Q g;  5H17 A;  5JWZ A;  1YFQ A;  4WK2 B;  1XIP A;  3F3G A;  1H2Z A;  4NSX A;  3ZDZ A;  5E6S B;  3BWS A;  3I7K A;  4D9S A;  4BCB A;  5TEF A;  4A0B A;  2H14 A;  1NEX B;  4J0X A;  2PM7 B;  5TEE A;  3NIG A;  2EID A;  4BP9 A;  5E6U B;  3JRP A;  3OKY B;  1K8K C;  4Z7Q B;  3MMY A;  2G99 A;  5C2V B;  4ZOY A;  3JZH A;  2HU5 A;  3AL8 B;  2VDM A;  4JT6 C;  3NVN A;  3AH8 B;  5FFO A;  4TZ4 A;  1MG2 A;  2H9P A;  3UVO A;  3CFS B;  4Y7R A;  1FWX A;  5EAM A;  3EMH A;  4DNW A;  2IWK A;  3SXT D;  2IUP A;  2OK6 A;  3T3P A;  3PSC B;  3JZG A;  1UOO A;  4JT5 C;  4PC0 A;  3J81 g;  1JMX B;  2Z2O A;  4ERQ A;  4Y5R D;  2H3X A;  2H68 A;  3BG1 A;  4JSN C;  4O02 A;  2GC4 A;  5E6S A;  3ODT A;  1N6F A;  3PXT D;  4NBM A;  4GQB B;  1U8C B;  2TRC B;  3IUQ A;  4U7A A;  3SVW D;  3FRX A;  4X63 B;  4J84 A;  1P22 A;  1QFM A;  5B4W A;  5C9Z B;  4Z7Q A;  3JZN A;  5CXC B;  4AMZ A;  3EI1 B;  4G1E A;  2VDN B;  4J81 A;  4L1Q D;  3EI3 B;  5EMK B;  3C5M A;  5C86 A;  4E5Z B;  4GGC A;  4CY5 A;  3AL8 A;  3JPX A;  3IJC A;  3EQ7 A;  4CI3 A;  5HE0 B;  1UTC A;  3SFZ A;  5FA5 B;  5THA A;  3NID B;  1L5G A;  2VZ1 A;  3N0E A;  3UKU C;  5C92 A;  4BUJ C;  1C9L A;  2P9I C;  4JHN A;  3I89 A;  3I8C A;  4L3H D;  4UI9 R;  3F3P A;  3IJ0 A;  5EAP A;  5HE2 B;  4XEI C;  1TYE B;  1U2V C;  1PGU A;  3OTT A;  3PXW D;  1JV2 A;  3OL2 A;  3SBR A;  3SN6 B; 
#chains in the Genus database with same CATH homology
 4O3U B;  4FA5 D;  1GXR A;  2P9S C;  1OLZ A;  3RMZ D;  2H47 A;  2AGX A;  4A0A B;  4FAN D;  4JSV C;  4ZN4 A;  5KDO B;  4QT8 A;  5AMS A;  4IA9 A;  5CXC A;  4CC9 A;  1MG3 A;  2Z2P A;  3EI1 A;  4H5I A;  4G56 B;  3EI3 A;  4FB1 D;  4E5Z A;  2VDQ B;  5FKS A;  2PM9 B;  4ES0 A;  3JB9 L;  4K3J B;  4Z7N B;  3IIY A;  4J79 A;  5CXB B;  2EBS A;  3MZK A;  5K19 A;  5HDB B;  1JMZ B;  2OIZ A;  2H13 A;  3NVQ A;  5HE1 B;  3IIW A;  3ZE1 B;  5EAL A;  2VDL B;  3BG0 A;  5IJ8 E;  3UR4 A;  3T3M B;  2GNQ A;  1RI6 A;  4A7J A;  4O3T B;  5C2W B;  2P9L C;  4MK0 B;  2GC7 A;  2IUQ A;  5HQG A;  2MTA H;  3JRO A;  2XYI A;  4GGA A;  2XL3 A;  4A0A A;  5TDH B;  4LG9 A;  2CE8 A;  4A2M A;  3UVK A;  3I7P A;  5FKR A;  5IC7 A;  3NIF B;  3ZE0 B;  5K1C C;  4PBZ A;  2H9N A;  3DM0 A;  2PM9 A;  3IJ1 A;  5H1M A;  4O45 A;  3SWS D;  3NVX A;  5FLX g;  4CZY A;  2I0T A;  4YVD A;  3OKW A;  2XL2 A;  1L0Q A;  5CXB A;  3SBQ A;  4A11 B;  4ERY A;  1SQJ A;  3I7L A;  4QL1 A;  3SBP A;  2B5M A;  4GZ8 A;  4U1E I;  4WK4 B;  1JOF A;  3C99 A;  4AOW A;  1GG2 B;  3V7D B;  2HKM A;  4JSP C;  4X61 B;  2P9N C;  5FKQ A;  4GM8 A;  4ZOX A;  3P4F A;  2CO0 A;  4PSX B;  4J8B A;  4FA1 D;  2OVP B;  5HE3 B;  4LG8 A;  3RLM D;  5AJA A;  5H14 A;  3CFV A;  5IGQ A;  3W15 A;  3L4O D;  4FWW A;  3UVN A;  2VDP B;  4CZV A;  3C75 H;  3F3F A;  3OKY A;  4WJK B;  3J80 g;  4E54 B;  2HES X;  1R5M A;  4N14 A;  2J55 H;  2OVR B;  2G9A A;  4J0W A;  1ERJ A;  3VI3 B;  4ESG A;  4FA4 D;  4CY3 A;  2OVQ B;  5EM2 B;  4XYI A;  4UM9 D;  3UVM A;  4X60 B;  4L9O A;  4CI2 A;  4J78 A;  3SJL D;  2VC2 B;  2VDO B;  4XYH A;  5E6R B;  1XHM A;  1PBY B;  2HKR A;  4Z7O B;  4PXW A;  4X3E A;  4JD2 C;  3EI4 B;  2O9K A;  3OW8 A;  2P26 A;  1N6E A;  4GMB A;  1YUK A;  4GGD A;  2VDR B;  5AFU 3;  2H6N A;  3SCY A;  3C9C A;  1SQ9 A;  2UZX B;  2VDK B;  3RSE C;  2H9L A;  4E54 A;  2OK4 A;  3VA6 A;  1U4C A;  4BL0 A;  2AGY A;  5IGO A;  4D0K A;  1SSL A;  4J77 A;  2CN3 A;  1TYQ C;  1GP2 B;  5GXI A;  2YNO A;  3EU7 A;  4JSX C;  3B7F A;  5EM2 A;  3OKT A;  2BBK H;  2B5L A;  1MDA H;  2CE9 A;  4A2L A;  5IJ7 E;  5EML B;  4A0B B;  4GM3 A;  2I3S A;  5CYK B;  3K26 A;  2AGL A;  3RN1 D;  3EWE A;  3MKS B;  2W18 A;  1S4U X;  5I5M A;  2B5N A;  2H6Q A;  3FGB A;  2H6K A;  3UVL A;  4ZOV A;  4GQ1 A;  3DXK C;  3I2N A;  2PBI B;  4OWR A;  1JJU B;  3AFC A;  3DSM A;  1A0R B;  3AL9 A;  4UM8 B;  2CN2 A;  4H5J A;  4KFM B;  4I79 A;  4CI1 A;  4GQ2 P;  5I5J A;  3PE7 A;  2I0S A;  3I7H A;  3MXX A;  3MKQ A;  4A08 B;  5FKT A;  4FAV D;  2AGW A;  3ZE2 B;  2HJ4 A;  3FCU B;  4O1Q D;  1B9Y A;  4O9D A;  2I3T A;  3I7N A;  2YNP A;  3VGZ A;  5CYK A;  4PNK B;  3RRM C;  4PSW B;  2P9K C;  3MZL A;  4GM9 A;  2UZY B;  3IKO A;  4ZOZ A;  3EG6 A;  4CZX A;  2YMU A;  2QXV A;  3L4M D;  3I7O A;  2P9P C;  3KRW B;  4LGN A;  2Q7Q A;  1XKS A;  3ZDY B;  3ZDX B;  1OMW B;  3V5W B;  5FXY A;  4BH6 A;  2BCJ B;  2HXC A;  3GRE A;  1Q47 A;  3OL2 B;  4J87 A;  2CO0 C;  4A08 A;  2JWG A;  2YNN A;  4A11 A;  4AEZ A;  4ERZ A;  2HYE A;  2XU7 A;  5TF2 A;  2YB8 B;  4QQE A;  5GXH A;  3I8E A;  2IUR A;  1SHY B;  1PI6 A;  4CY1 A;  1NR0 A;  5I5I A;  3RFH A;  2CNX A;  5EMJ B;  2J56 H;  5FQD A;  4A09 B;  3RN0 D;  4R7A B;  1B9X A;  3V9F A;  1K32 A;  1VYH C;  2AH0 A;  3K27 A;  2IAA A;  3KRX B;  4CI8 A;  4FA9 D;  2IUV A;  3A0F A;  3CIK B;  5GSA A;  3VI4 B;  3HFQ A;  4WK0 B;  4L3G D;  3PVU B;  2OJY A;  2IWF A;  4EWR A;  3GFC A;  3ULE C;  3FM0 A;  4HDJ A;  4UM9 B;  3DWL C;  3EI2 B;  3DXM C;  5EMM B;  5SXM A;  2P9U C;  2I0R A;  2YBA A;  5IT9 g;  3PSL A;  3JAM g;  2QC5 A;  4J8G A;  4J82 A;  4CY2 A;  4D6V A;  2PM6 B;  2H9M A;  3ZDZ B;  2AH1 A;  5HYN B;  4J73 A;  2Z2N A;  3SMR A;  4K3I D;  3NIG B;  3UKR C;  5GMK n;  4A09 A;  3EI4 A;  3SHF A;  4OZU A;  4Z8L A;  3N0D A;  3RFG A;  2AGZ A;  1TBG A;  3VH0 A;  5EAR A;  4J86 A;  2P28 A;  1QNI A;  4IMM A;  2VDM B;  3PVW B;  1GOT B;  3SLE D;  2AQ5 A;  3PXS D;  4JXM A;  4QRJ A;  3ORV D;  2J57 G;  3U4Y A;  3E0C A;  1N6D A;  3T3P B;  3EI2 A;  2B4E A;  4FHL A;  2JWH A;  4PBY A;  2HJB A;  3ZWL B;  1PEV A;  5A2Q g;  5H17 A;  5JWZ A;  1YFQ A;  4WK2 B;  1XIP A;  3F3G A;  4NSX A;  5E6S B;  3BWS A;  3I7K A;  5TEF A;  4A0B A;  2H14 A;  1NEX B;  4J0X A;  2PM7 B;  5TEE A;  5E6U B;  3JRP A;  3OKY B;  1K8K C;  4Z7Q B;  3MMY A;  2G99 A;  5C2V B;  4ZOY A;  3JZH A;  3AL8 B;  4JT6 C;  3NVN A;  3AH8 B;  4TZ4 A;  1MG2 A;  2H9P A;  3UVO A;  3CFS B;  4Y7R A;  1FWX A;  5EAM A;  3EMH A;  2IWK A;  3SXT D;  2IUP A;  2OK6 A;  3PSC B;  3JZG A;  4JT5 C;  4PC0 A;  3J81 g;  1JMX B;  2Z2O A;  4ERQ A;  4Y5R D;  2H3X A;  2H68 A;  3BG1 A;  4JSN C;  2GC4 A;  3ODT A;  1N6F A;  3PXT D;  4GQB B;  1U8C B;  2TRC B;  4U7A A;  3SVW D;  3FRX A;  4X63 B;  4J84 A;  1P22 A;  5B4W A;  5C9Z B;  3JZN A;  5CXC B;  3EI1 B;  2VDN B;  4J81 A;  4L1Q D;  3EI3 B;  5EMK B;  3C5M A;  4E5Z B;  4GGC A;  4CY5 A;  3AL8 A;  3JPX A;  3IJC A;  4CI3 A;  5HE0 B;  3SFZ A;  5FA5 B;  5THA A;  3NID B;  3N0E A;  3UKU C;  4BUJ C;  2P9I C;  3I89 A;  3I8C A;  4L3H D;  4UI9 R;  3F3P A;  3IJ0 A;  5EAP A;  5HE2 B;  4XEI C;  1TYE B;  1U2V C;  1PGU A;  3OTT A;  3PXW D;  3OL2 A;  3SBR A;  3SN6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...