3OL2B

Receptor-ligand structure of human semaphorin 4d with plexin b1.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
511
structure length
496
Chain Sequence
b'LPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSAHGEVLFAAFSSAAPPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSPEQWLWSFQPELGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Semaphorin-4D
publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 118
structure length 496
sequence length 511
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3ol2B01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ol2B02
4FAVD 2PM9B 3AL8B 3JRPA 2CO0C 1PI6A 4FHLA 4PC0A 5TEFA 4WJKB 3DSMA 4J84A 4ZN4A 1SQ9A 1JMZB 2CO0A 2AGWA 5TF2A 4OZUA 3JZNA 2YNOA 5CYKA 2B4EA 5HYNB 4X3EA 3UVKA 3DM0A 3I2NA 1SHYB 3F3FA 3K27A 4O45A 3RFHA 5CYKB 3NIFB 3PE7A 2OVPB 3JZHA 4UM9B 1GG2B 4JSVC 5GXIA 4AOWA 1JJUB 4CZVA 3PVWB 2Q7QA 4BL0A 4D0KA 2I3SA 3HFQA 4KFMB 5I5MA 4Z8LA 5FKQA 4J87A 1R5MA 3I7LA 3W15A 4ZOZA 4ZOVA 1NEXB 2HJ4A 5E6SB 4QL1A 5EALA 4ES0A 1JMXB 3SFZA 3OKYA 5H17A 2UZXB 3ZWLB 4FA4D 1TYQC 3SBPA 3OKYB 4J78A 3PXSD 4CZYA 5I5IA 2CN2A 2I0SA 3VI3B 3F3GA 4CY1A 4UI9R 3L4OD 4H5IA 3ZE2B 4PXWA 4J82A 2P9IC 4LGNA 1YFQA 3CFSB 4UM8B 3RN0D 4CY5A 3PSLA 4J81A 1PGUA 4A0AA 5K19A 2H6KA 3EI3A 2P9LC 3C9CA 2OK6A 5B4WA 5AMSA 2H6NA 4JT6C 3SBQA 4A0AB 1JOFA 2GNQA 3PXTD 4Z7NB 4D6VA 2YBAA 3AL9A 3EI3B 2YNNA 4J8GA 3I7NA 5TDHB 2BBKH 3NVQA 4O3UB 2CE9A 3P4FA 5EARA 3ULEC 4CY2A 4GQBB 2G99A 5EM2A 4LG8A 4A08A 3CFVA 2P9PC 3A0FA 4X60B 3MMYA 5EM2B 3DWLC 4IA9A 1GXRA 3KRXB 2VDOB 2P9SC 3E0CA 4FA1D 1K8KC 4K3ID 4PSWB 3UKUC 1XHMA 3IJ0A 2VDRB 4J73A 2XYIA 4X63B 2P26A 4WK4B 3JB9L 5GXHA 3I7KA 3AFCA 3MXXA 3V7DB 3VGZA 2OK4A 3CIKB 5IJ7E 4J86A 2AGZA 2I0RA 2P9UC 2H47A 4XEIC 3I7OA 1MG2A 3MZKA 4QRJA 5E6UB 3KRWB 2OVRB 4FWWA 3I8CA 3UR4A 2CE8A 1OLZA 2EBSA 4MK0B 2HKMA 3IIYA 5HQGA 4PNKB 4CI1A 5EMKB 3B7FA 2CN3A 3OL2A 4J8BA 3EI4A 3FM0A 3SMRA 2VDLB 4GQ1A 2H3XA 2P9KC 2AGXA 4GM8A 2O9KA 2IUPA 3OL2B 3VI4B 3EI4B 2XU7A 3MZLA 5SXMA 4EWRA 1B9YA 3UVOA 4XYHA 2J57G 2AGYA 2UZYB 2CNXA 5H14A 4J79A 3ZE0B 3DXKC 5HE3B 3SVWD 5FQDA 3ODTA 1K32A 3C75H 4XYIA 3T3PB 4CI3A 4E5ZA 3NVXA 2HESX 4I79A 3ZDXB 3RFGA 3RMZD 4ERZA 4E5ZB 4ESGA 1TBGA 4GZ8A 4A7JA 3K26A 5AFU3 5EAPA 2QXVA 3BWSA 1OMWB 2GC7A 3SXTD 1L0QA 3IJ1A 5THAA 2H14A 1N6EA 1VYHC 2BCJB 2PM7B 3EI2A 3UVNA 3FCUB 2AGLA 4J77A 1A0RB 4J0WA 4G56B 2YNPA 4LG9A 4N14A 5TEEA 4GMBA 3EI2B 4WK2B 2Z2OA 4GM9A 5C9ZB 1GOTB 4ERQA 2PBIB 2VC2B 3I8EA 1PEVA 1U4CA 4U1EI 1N6DA 3SLED 3EWEA 2H9LA 1SQJA 3JZGA 5FKSA 4U7AA 5FXYA 4HDJA 2VDPB 3I89A 3OTTA 2VDMB 5C2WB 3GFCA 3RSEC 3EG6A 5H1MA 1RI6A 2P28A 3NIDB 4GGAA 5IGOA 2J55H 2OJYA 3J80g 4Y7RA 2H9NA 4NSXA 4CY3A 4O1QD 4IMMA 4A08B 4GM3A 3IIWA 3ZDYB 2I3TA 2XL3A 3PXWD 3RN1D 5IJ8E 3SBRA 5JWZA 4ZOYA 3JPXA 3EI1A 2HKRA 3U4YA 3BG1A 3JAMg 2Z2NA 2Z2PA 3GREA 4K3JB 5EAMA 3EI1B 4A09A 2QC5A 4E54A 5KDOB 5CXCA 3SWSD 2B5NA 2P9NC 4O3TB 2HYEA 4A09B 1N6FA 3UKRC 5IT9g 4E54B 4TZ4A 4JSNC 5CXCB 4A2MA 3MKQA 2AQ5A 1YUKA 1QNIA 4Z7QB 4L3GD 3VA6A 5EMJB 3C99A 2VDKB 5GMKn 3OW8A 3VH0A 2PM6B 5FLXg 2OVQB 3FRXA 2B5LA 2H6QA 3T3MB 3MKSB 4A2LA 5C2VB 5HE0B 4GGCA 3L4MD 3EU7A 4L3HD 3FGBA 4CC9A 3I7HA 3IJCA 4FA5D 1U8CB 4PSXB 3RRMC 1MG3A 3RLMD 1ERJA 3V5WB 3PVUB 4L9OA 4QT8A 3F3PA 3UVLA 2H13A 5FA5B 4Z7OB 4FA9D 3NVNA 3ZE1B 2VDQB 4CZXA 1U2VC 5I5JA 2YB8B 4PBYA 3NIGB 3OKWA 4WK0B 1Q47A 2B5MA 2G9AA 3J81g 3SJLD 4QQEA 2YMUA 4OWRA 5E6RB 5EMMB 4H5JA 4CI2A 3C5MA 4O9DA 4BH6A 3ZDZB 2GC4A 3UVMA 2IUVA 4A0BA 2AH1A 3SCYA 4JD2C 2VDNB 2H9MA 5HE1B 2OIZA 1GP2B 3PSCB 2HXCA 4CI8A 4X61B 4JT5C 4A0BB 1XKSA 1SSLA 2H68A 2IAAA 4R7AB 3SN6B 4GQ2P 2J56H 5EMLB 5HDBB 4UM9D 3AH8B 3V9FA 1XIPA 5AJAA 4Y5RD 5CXBA 4AEZA 3OKTA 1MDAH 4ERYA 5IC7A 4JXMA 5FKRA 4L1QD 1S4UX 5CXBB 3N0EA 4JSPC 2IWKA 2IURA 1B9XA 5K1CC 5IGQA 4PBZA 1NR0A 1TYEB 3IKOA 3JROA 4BUJC 5A2Qg 4JSXC 3SHFA 3DXMC 4GGDA 2AH0A 2W18A 3ORVD 1FWXA 4FAND 2H9PA 1PBYB 4A11B 2MTAH 2TRCB 3EMHA 2HJBA 2XL2A 4J0XA 4ZOXA 4FB1D 3N0DA 2I0TA 4A11A 5GSAA 2IWFA 3BG0A 5FKTA 1P22A 2PM9A 4YVDA 3AL8A 3I7PA 5HE2B 2IUQA
chains in the Genus database with same CATH superfamily
4FAVD 3MUNA 2PM9B 4NBMA 3AL8B 3JRPA 5M61A 2CO0C 1PI6A 4FHLA 4PC0A 5TEFA 3O4JA 4WJKB 3O4GA 3DSMA 1VZ3A 4J84A 4MMZA 4ZN4A 1SQ9A 1JMZB 2CO0A 2AGWA 5TF2A 4OZUA 3JZNA 2YNOA 5CYKA 2B4EA 3NIFA 5HYNB 4X3EA 3UVKA 3DM0A 3EQ8A 3I2NA 3KCIA 1SHYB 5M5SA 3F3FA 3K27A 4UM9A 4O45A 3RFHA 5CYKB 3NIFB 3PE7A 2OVPB 3JZHA 4UM9B 1GG2B 4JSVC 5GXIA 4AOWA 1JJUB 4CZVA 3PVWB 2Q7QA 4BL0A 4D0KA 2I3SA 3IVMA 1O6FA 3HFQA 2EIBA 4KFMB 5I5MA 4Z8LA 5E6SA 5FKQA 4J87A 1R5MA 3I7LA 3W15A 4ZOZA 4ZOVA 1VE6A 1NEXB 2HJ4A 3IUQA 5E6SB 4QL1A 5EALA 4ES0A 1JMXB 3SFZA 3OKYA 5H17A 2UZXB 3ZWLB 4FA4D 1TYQC 3VI3A 3SBPA 3OKYB 4J78A 3PXSD 4CZYA 3ZE2A 5I5IA 2VZ1A 2CN2A 2I0SA 3VI3B 3F3GA 4CY1A 4UI9R 1E8NA 3L4OD 4UM8A 4H5IA 1UTCA 3ZE2B 3FCSA 2HU8A 4PXWA 4J82A 2P9IC 4LGNA 1YFQA 3CFSB 4G55A 3RN0D 4UM8B 4CY5A 3IUNA 3PSLA 4J81A 3O4IA 1PGUA 4A0AA 4Z7NA 2H6KA 5K19A 1C9IA 1L5GA 3EI3A 2P9LC 3C9CA 2OK6A 5B4WA 5AMSA 2H6NA 4JT6C 3SBQA 4A0AB 1JOFA 2GNQA 3PXTD 4Z7NB 3EQ7A 2YBAA 3AL9A 3EI3B 4D6VA 2YNNA 4J8GA 1QFMA 3I7NA 5TDHB 2BBKH 3NVQA 4O3UB 2CE9A 3P4FA 5EARA 3ULEC 4CY2A 4GQBB 2G99A 5EM2A 4LG8A 4A08A 3CFVA 2P9PC 3A0FA 2VDOA 4X60B 3MMYA 4BCCA 4DNWA 5EM2B 2JWGA 3DWLC 4IA9A 1GXRA 3KRXB 5TEEA 2VDOB 2P9SC 2VDRA 3O4HA 3GD1I 3E0CA 4FA1D 1K8KC 4K3ID 4WK4A 4QAMA 3IUJA 4PSWB 3UKUC 1XHMA 3IJ0A 2VDRB 4J73A 4DNVA 2XYIA 4X63B 2P26A 4WK4B 3JB9L 5GXHA 3K6SA 3I7KA 3AFCA 3MXXA 3V7DB 3VGZA 2OK4A 3CIKB 5IJ7E 4J86A 5E6UA 2AGZA 2I0RA 2P9UC 2H47A 4XEIC 3I7OA 1MG2A 3MZKA 4QRJA 5E6UB 3GC3B 3KRWB 2OVRB 4FWWA 3I8CA 4G1MA 3UR4A 1YR2A 2CE8A 4JHPC 1OLZA 2EBSA 4MK0B 2HKMA 3IIYA 5HQGA 3T3MA 2VDLA 4PNKB 4NENA 4CI1A 3MUOA 5EMKB 3B7FA 2CN3A 3OL2A 4J8BA 3VI4A 3EI4A 3FM0A 2EICA 3SMRA 4GQ1A 2VDLB 2H3XA 2P9KC 2AGXA 3OF7A 4GM8A 1GOHA 2O9KA 2IUPA 2VZ3A 4RE6A 3OL2B 4BCBA 3VI4B 3EI4B 2XU7A 3MZLA 5SXMA 3ZE0A 5M5TA 3IURA 4EWRA 1B9YA 3UVOA 4XYHA 2J57G 2AGYA 4L1MA 2UZYB 2CNXA 5H14A 4J79A 3ZE0B 3DXKC 5HE3B 3SVWD 3T3PA 1H2WA 5FQDA 3ODTA 3ZDXA 1K32A 3C75H 4XYIA 3T3PB 4CI3A 4E5ZA 1A12A 3NVXA 2HESX 4I79A 3ZDXB 3RFGA 3RMZD 4ERZA 4E5ZB 4ESGA 1TBGA 4GZ8A 5FFOA 4A7JA 3K26A 5AFU3 5EAPA 1T2XA 3FCUA 2QXVA 4MMXA 3BWSA 1OMWB 3EQ9A 2GC7A 3SXTD 1L0QA 3IJ1A 5C92A 1JV2A 2H14A 5THAA 1N6EA 1VYHC 2BCJB 2PM7B 3EI2A 4WK2A 3UVNA 3FCUB 1E5TA 2AGLA 4J77A 1A0RB 4J0WA 4G56B 2YNPA 2XE4A 3IJEA 4LG9A 4N14A 4O02A 2VC2A 5M5RA 4GMBA 3EI2B 4WK2B 2Z2OA 2BKLA 1QFSA 4GM9A 5C9ZB 1GOTB 4ERQA 2PBIB 2VDPA 1GOGA 2VC2B 3I8EA 1PEVA 1K3IA 1U4CA 1N6DA 2VDMA 4U1EI 3SLED 4D9SA 3EWEA 2H9LA 2JKXA 1SQJA 3JZGA 5FKSA 4U7AA 5FXYA 4HDJA 2VDPB 3NIDA 3I89A 3OTTA 2VDMB 5C2WB 3GFCA 3RSEC 3EG6A 5H1MA 3ZDYA 1RI6A 2HU7A 2P28A 3NIDB 4GGAA 5IGOA 2J55H 2OJYA 3J80g 4BP9A 4Y7RA 2H9NA 4NSXA 4CY3A 4O1QD 4IMMA 4A08B 4GM3A 3IIWA 3ZDYB 3DDUA 3V4PA 5M5UA 2I3TA 2XL3A 3PXWD 3RN1D 5IJ8E 3SBRA 5JWZA 1M1XA 4ZOYA 3JPXA 3EI1A 2HKRA 4IRZA 3U4YA 3BG1A 4JHNA 3JAMg 2Z2NA 2Z2PA 3GREA 4K3JB 5EAMA 3EI1B 4A09A 2QC5A 4E54A 4AMZA 5KDOB 5CXCA 4RE5A 1H2YA 3SWSD 1H2XA 2B5NA 2P9NC 4O3TB 2HYEA 4A09B 1N6FA 3UKRC 4Z7QA 5IT9g 4E54B 4TZ4A 4JSNC 2VDKA 4MMYA 5CXCB 4A2MA 3MKQA 2AQ5A 1YUKA 1QNIA 4Z7QB 4L3GD 3VA6A 5EMJB 3C99A 2VDKB 5GMKn 4NAAA 3OW8A 3VH0A 2QZPA 2PM6B 5FLXg 2OVQB 3FRXA 2B5LA 2H6QA 3T3MB 3MKSB 1U8CA 3V4VA 3K71A 3QHYB 4A2LA 5C2VB 1C9LA 5HE0B 4GGCA 3L4MD 1VZ2A 3EU7A 4L3HD 4BP8A 3FGBA 4AN0A 4CC9A 3I7HA 3IJCA 4FA5D 1U8CB 4PSXB 4Z7OA 3RRMC 4G1EA 3ZE1A 1MG3A 1I2MB 2VDQA 3RLMD 1ERJA 2EIEA 3PVUB 3V5WB 1UOOA 4L9OA 4QT8A 3F3PA 3NIGA 3UVLA 2H13A 5FA5B 5M5VA 4FA9D 4WK0A 3NVNA 4Z7OB 3ZE1B 2VDQB 4CZXA 1U2VC 5I5JA 2YB8B 4PBYA 3NIGB 3OKWA 5E6RA 4WK0B 1Q47A 2B5MA 2G9AA 1VE7A 3J81g 4NC4A 3SJLD 4QQEA 2YMUA 4OWRA 1BPOA 5E6RB 5EMMB 4H5JA 4CI2A 3ZDZA 3C5MA 4O9DA 5FFGA 4BH6A 2QR5A 3ZDZB 2GC4A 3UVMA 1E8MA 2VDNA 4DNUA 2IUVA 4A0BA 2AH1A 3SCYA 4JD2C 2VDNB 2H9MA 5HE1B 2OIZA 1GP2B 3PSCB 2HXCA 4CI8A 4X61B 4JT5C 5HDBA 4A0BB 1XKSA 1SSLA 2H68A 2IAAA 4R7AB 3SN6B 4GQ2P 2J56H 4AN1A 5EMLB 5HDBB 4UM9D 3AH8B 3V9FA 1XIPA 3QI0A 5AJAA 1UOPA 1UOQA 4Y5RD 5CXBA 4AEZA 3OKTA 1MDAH 1H2ZA 5IC7A 4ERYA 4JXMA 5FKRA 4L1QD 4AMYA 1S4UX 5CXBB 3N0EA 1TYEA 4JSPC 2IWKA 5C86A 2IURA 1B9XA 5K1CC 5IGQA 1O6GA 2EIDA 3MVDK 4PBZA 1NR0A 1TYEB 3IKOA 4O2WA 3JROA 4BUJC 5A2Qg 4JSXC 3SHFA 3DXMC 2HU5A 1GOFA 2XDWA 4GGDA 2AH0A 3IUMA 2W18A 2WQ8A 3ORVD 1FWXA 4FAND 2XZGA 2H9PA 1PBYB 4A11B 2MTAH 2TRCB 3EMHA 2HJBA 2XL2A 4J0XA 4ZOXA 3K72A 4FB1D 3N0DA 2I0TA 4A11A 1JTDB 2JWHA 5GSAA 2IWFA 3BG0A 5FKTA 1P22A 2PM9A 4YVDA 3AL8A 3I7PA 4BCDA 4AX4A 3IULA 5HE2B 2IUQA 4WJKA
chains in the Genus database with same CATH topology
4FAVD 2PM9B 3AL8B 3JRPA 2CO0C 1PI6A 4FHLA 4PC0A 5TEFA 4WJKB 3DSMA 4J84A 4ZN4A 1SQ9A 1JMZB 2CO0A 2AGWA 5TF2A 4OZUA 3JZNA 2YNOA 5CYKA 2B4EA 5HYNB 4X3EA 3UVKA 3DM0A 3I2NA 1SHYB 3F3FA 3K27A 4O45A 3RFHA 5CYKB 3NIFB 3PE7A 2OVPB 3JZHA 4UM9B 1GG2B 4JSVC 5GXIA 4AOWA 1JJUB 4CZVA 3PVWB 2Q7QA 4BL0A 4D0KA 2I3SA 3HFQA 4KFMB 5I5MA 4Z8LA 5FKQA 4J87A 1R5MA 3I7LA 3W15A 4ZOZA 4ZOVA 1NEXB 2HJ4A 5E6SB 4QL1A 5EALA 4ES0A 1JMXB 3SFZA 3OKYA 5H17A 2UZXB 3ZWLB 4FA4D 1TYQC 3SBPA 3OKYB 4J78A 3PXSD 4CZYA 5I5IA 2CN2A 2I0SA 3VI3B 3F3GA 4CY1A 4UI9R 3L4OD 4H5IA 3ZE2B 4PXWA 4J82A 2P9IC 4LGNA 1YFQA 3CFSB 4UM8B 3RN0D 4CY5A 3PSLA 4J81A 1PGUA 4A0AA 5K19A 2H6KA 3EI3A 2P9LC 3C9CA 2OK6A 5B4WA 5AMSA 2H6NA 4JT6C 3SBQA 4A0AB 1JOFA 2GNQA 3PXTD 4Z7NB 4D6VA 2YBAA 3AL9A 3EI3B 2YNNA 4J8GA 3I7NA 5TDHB 2BBKH 3NVQA 4O3UB 2CE9A 3P4FA 5EARA 3ULEC 4CY2A 4GQBB 2G99A 5EM2A 4LG8A 4A08A 3CFVA 2P9PC 3A0FA 4X60B 3MMYA 5EM2B 2JWGA 3DWLC 4IA9A 1GXRA 3KRXB 2VDOB 2P9SC 3E0CA 4FA1D 1K8KC 4K3ID 4PSWB 3UKUC 1XHMA 3IJ0A 2VDRB 4J73A 2XYIA 4X63B 2P26A 4WK4B 3JB9L 5GXHA 3I7KA 3AFCA 3MXXA 3V7DB 3VGZA 2OK4A 3CIKB 5IJ7E 4J86A 2AGZA 2I0RA 2P9UC 2H47A 4XEIC 3I7OA 1MG2A 3MZKA 4QRJA 5E6UB 3KRWB 2OVRB 4FWWA 3I8CA 3UR4A 2CE8A 1OLZA 2EBSA 4MK0B 2HKMA 3IIYA 5HQGA 4PNKB 4CI1A 5EMKB 3B7FA 2CN3A 3OL2A 4J8BA 3EI4A 3FM0A 3SMRA 2VDLB 4GQ1A 2H3XA 2P9KC 2AGXA 4GM8A 2O9KA 2IUPA 3OL2B 3VI4B 3EI4B 2XU7A 3MZLA 5SXMA 4EWRA 1B9YA 3UVOA 4XYHA 2J57G 2AGYA 2UZYB 2CNXA 5H14A 4J79A 3ZE0B 3DXKC 5HE3B 3SVWD 5FQDA 3ODTA 1K32A 3C75H 4XYIA 3T3PB 4CI3A 4E5ZA 3NVXA 2HESX 4I79A 3ZDXB 3RFGA 3RMZD 4ERZA 4E5ZB 4ESGA 1TBGA 4GZ8A 4A7JA 3K26A 5AFU3 5EAPA 2QXVA 3BWSA 1OMWB 2GC7A 3SXTD 1L0QA 3IJ1A 5THAA 2H14A 1N6EA 1VYHC 2BCJB 2PM7B 3EI2A 3UVNA 3FCUB 2AGLA 4J77A 1A0RB 4J0WA 4G56B 2YNPA 4LG9A 4N14A 5TEEA 4GMBA 3EI2B 4WK2B 2Z2OA 4GM9A 5C9ZB 1GOTB 4ERQA 2PBIB 2VC2B 3I8EA 1PEVA 1U4CA 4U1EI 1N6DA 3SLED 3EWEA 2H9LA 1SQJA 3JZGA 5FKSA 4U7AA 5FXYA 4HDJA 2VDPB 3I89A 3OTTA 2VDMB 5C2WB 3GFCA 3RSEC 3EG6A 5H1MA 1RI6A 2P28A 3NIDB 4GGAA 5IGOA 2J55H 2OJYA 3J80g 4Y7RA 2H9NA 4NSXA 4CY3A 4O1QD 4IMMA 4A08B 4GM3A 3IIWA 3ZDYB 2I3TA 2XL3A 3PXWD 3RN1D 5IJ8E 3SBRA 5JWZA 4ZOYA 3JPXA 3EI1A 2HKRA 3U4YA 3BG1A 3JAMg 2Z2NA 2Z2PA 3GREA 4K3JB 5EAMA 3EI1B 4A09A 2QC5A 4E54A 5KDOB 5CXCA 3SWSD 2B5NA 2P9NC 4O3TB 2HYEA 4A09B 1N6FA 3UKRC 5IT9g 4E54B 4TZ4A 4JSNC 5CXCB 4A2MA 3MKQA 2AQ5A 1YUKA 1QNIA 4Z7QB 4L3GD 3VA6A 5EMJB 3C99A 2VDKB 5GMKn 3OW8A 3VH0A 2PM6B 5FLXg 2OVQB 3FRXA 2B5LA 2H6QA 3T3MB 3MKSB 4A2LA 5C2VB 5HE0B 4GGCA 3L4MD 3EU7A 4L3HD 3FGBA 4CC9A 3I7HA 3IJCA 4FA5D 1U8CB 4PSXB 3RRMC 1MG3A 3RLMD 1ERJA 3V5WB 3PVUB 4L9OA 4QT8A 3F3PA 3UVLA 2H13A 5FA5B 4Z7OB 4FA9D 3NVNA 3ZE1B 2VDQB 4CZXA 1U2VC 5I5JA 2YB8B 4PBYA 3NIGB 3OKWA 4WK0B 1Q47A 2B5MA 2G9AA 3J81g 3SJLD 4QQEA 2YMUA 4OWRA 5E6RB 5EMMB 4H5JA 4CI2A 3C5MA 4O9DA 4BH6A 3ZDZB 2GC4A 3UVMA 2IUVA 4A0BA 2AH1A 3SCYA 4JD2C 2VDNB 2H9MA 5HE1B 2OIZA 1GP2B 3PSCB 2HXCA 4CI8A 4X61B 4JT5C 4A0BB 1XKSA 1SSLA 2H68A 2IAAA 4R7AB 3SN6B 4GQ2P 2J56H 5EMLB 5HDBB 4UM9D 3AH8B 3V9FA 1XIPA 5AJAA 4Y5RD 5CXBA 4AEZA 3OKTA 1MDAH 4ERYA 5IC7A 4JXMA 5FKRA 4L1QD 1S4UX 5CXBB 3N0EA 4JSPC 2IWKA 2IURA 1B9XA 5K1CC 5IGQA 4PBZA 1NR0A 1TYEB 3IKOA 3JROA 4BUJC 5A2Qg 4JSXC 3SHFA 3DXMC 4GGDA 2AH0A 2W18A 3ORVD 1FWXA 4FAND 2H9PA 1PBYB 4A11B 2MTAH 2TRCB 3EMHA 2HJBA 2XL2A 4J0XA 4ZOXA 4FB1D 3N0DA 2I0TA 4A11A 2JWHA 5GSAA 2IWFA 3BG0A 5FKTA 1P22A 2PM9A 4YVDA 3AL8A 3I7PA 5HE2B 2IUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAV D;  2PM9 B;  3AL8 B;  3JRP A;  2CO0 C;  1PI6 A;  4FHL A;  4PC0 A;  5TEF A;  4WJK B;  3DSM A;  4J84 A;  4ZN4 A;  1SQ9 A;  1JMZ B;  2CO0 A;  2AGW A;  5TF2 A;  4OZU A;  3JZN A;  2YNO A;  5CYK A;  2B4E A;  5HYN B;  4X3E A;  3UVK A;  3DM0 A;  3I2N A;  1SHY B;  3F3F A;  3K27 A;  4O45 A;  3RFH A;  5CYK B;  3NIF B;  3PE7 A;  2OVP B;  3JZH A;  4UM9 B;  1GG2 B;  4JSV C;  5GXI A;  4AOW A;  1JJU B;  4CZV A;  3PVW B;  2Q7Q A;  4BL0 A;  4D0K A;  2I3S A;  3HFQ A;  4KFM B;  5I5M A;  4Z8L A;  5FKQ A;  4J87 A;  1R5M A;  3I7L A;  3W15 A;  4ZOZ A;  4ZOV A;  1NEX B;  2HJ4 A;  5E6S B;  4QL1 A;  5EAL A;  4ES0 A;  1JMX B;  3SFZ A;  3OKY A;  5H17 A;  2UZX B;  3ZWL B;  4FA4 D;  1TYQ C;  3SBP A;  3OKY B;  4J78 A;  3PXS D;  4CZY A;  5I5I A;  2CN2 A;  2I0S A;  3VI3 B;  3F3G A;  4CY1 A;  4UI9 R;  3L4O D;  4H5I A;  3ZE2 B;  4PXW A;  4J82 A;  2P9I C;  4LGN A;  1YFQ A;  3CFS B;  4UM8 B;  3RN0 D;  4CY5 A;  3PSL A;  4J81 A;  1PGU A;  4A0A A;  5K19 A;  2H6K A;  3EI3 A;  2P9L C;  3C9C A;  2OK6 A;  5B4W A;  5AMS A;  2H6N A;  4JT6 C;  3SBQ A;  4A0A B;  1JOF A;  2GNQ A;  3PXT D;  4Z7N B;  4D6V A;  2YBA A;  3AL9 A;  3EI3 B;  2YNN A;  4J8G A;  3I7N A;  5TDH B;  2BBK H;  3NVQ A;  4O3U B;  2CE9 A;  3P4F A;  5EAR A;  3ULE C;  4CY2 A;  4GQB B;  2G99 A;  5EM2 A;  4LG8 A;  4A08 A;  3CFV A;  2P9P C;  3A0F A;  4X60 B;  3MMY A;  5EM2 B;  3DWL C;  4IA9 A;  1GXR A;  3KRX B;  2VDO B;  2P9S C;  3E0C A;  4FA1 D;  1K8K C;  4K3I D;  4PSW B;  3UKU C;  1XHM A;  3IJ0 A;  2VDR B;  4J73 A;  2XYI A;  4X63 B;  2P26 A;  4WK4 B;  3JB9 L;  5GXH A;  3I7K A;  3AFC A;  3MXX A;  3V7D B;  3VGZ A;  2OK4 A;  3CIK B;  5IJ7 E;  4J86 A;  2AGZ A;  2I0R A;  2P9U C;  2H47 A;  4XEI C;  3I7O A;  1MG2 A;  3MZK A;  4QRJ A;  5E6U B;  3KRW B;  2OVR B;  4FWW A;  3I8C A;  3UR4 A;  2CE8 A;  1OLZ A;  2EBS A;  4MK0 B;  2HKM A;  3IIY A;  5HQG A;  4PNK B;  4CI1 A;  5EMK B;  3B7F A;  2CN3 A;  3OL2 A;  4J8B A;  3EI4 A;  3FM0 A;  3SMR A;  2VDL B;  4GQ1 A;  2H3X A;  2P9K C;  2AGX A;  4GM8 A;  2O9K A;  2IUP A;  3OL2 B;  3VI4 B;  3EI4 B;  2XU7 A;  3MZL A;  5SXM A;  4EWR A;  1B9Y A;  3UVO A;  4XYH A;  2J57 G;  2AGY A;  2UZY B;  2CNX A;  5H14 A;  4J79 A;  3ZE0 B;  3DXK C;  5HE3 B;  3SVW D;  5FQD A;  3ODT A;  1K32 A;  3C75 H;  4XYI A;  3T3P B;  4CI3 A;  4E5Z A;  3NVX A;  2HES X;  4I79 A;  3ZDX B;  3RFG A;  3RMZ D;  4ERZ A;  4E5Z B;  4ESG A;  1TBG A;  4GZ8 A;  4A7J A;  3K26 A;  5AFU 3;  5EAP A;  2QXV A;  3BWS A;  1OMW B;  2GC7 A;  3SXT D;  1L0Q A;  3IJ1 A;  5THA A;  2H14 A;  1N6E A;  1VYH C;  2BCJ B;  2PM7 B;  3EI2 A;  3UVN A;  3FCU B;  2AGL A;  4J77 A;  1A0R B;  4J0W A;  4G56 B;  2YNP A;  4LG9 A;  4N14 A;  5TEE A;  4GMB A;  3EI2 B;  4WK2 B;  2Z2O A;  4GM9 A;  5C9Z B;  1GOT B;  4ERQ A;  2PBI B;  2VC2 B;  3I8E A;  1PEV A;  1U4C A;  4U1E I;  1N6D A;  3SLE D;  3EWE A;  2H9L A;  1SQJ A;  3JZG A;  5FKS A;  4U7A A;  5FXY A;  4HDJ A;  2VDP B;  3I89 A;  3OTT A;  2VDM B;  5C2W B;  3GFC A;  3RSE C;  3EG6 A;  5H1M A;  1RI6 A;  2P28 A;  3NID B;  4GGA A;  5IGO A;  2J55 H;  2OJY A;  3J80 g;  4Y7R A;  2H9N A;  4NSX A;  4CY3 A;  4O1Q D;  4IMM A;  4A08 B;  4GM3 A;  3IIW A;  3ZDY B;  2I3T A;  2XL3 A;  3PXW D;  3RN1 D;  5IJ8 E;  3SBR A;  5JWZ A;  4ZOY A;  3JPX A;  3EI1 A;  2HKR A;  3U4Y A;  3BG1 A;  3JAM g;  2Z2N A;  2Z2P A;  3GRE A;  4K3J B;  5EAM A;  3EI1 B;  4A09 A;  2QC5 A;  4E54 A;  5KDO B;  5CXC A;  3SWS D;  2B5N A;  2P9N C;  4O3T B;  2HYE A;  4A09 B;  1N6F A;  3UKR C;  5IT9 g;  4E54 B;  4TZ4 A;  4JSN C;  5CXC B;  4A2M A;  3MKQ A;  2AQ5 A;  1YUK A;  1QNI A;  4Z7Q B;  4L3G D;  3VA6 A;  5EMJ B;  3C99 A;  2VDK B;  5GMK n;  3OW8 A;  3VH0 A;  2PM6 B;  5FLX g;  2OVQ B;  3FRX A;  2B5L A;  2H6Q A;  3T3M B;  3MKS B;  4A2L A;  5C2V B;  5HE0 B;  4GGC A;  3L4M D;  3EU7 A;  4L3H D;  3FGB A;  4CC9 A;  3I7H A;  3IJC A;  4FA5 D;  1U8C B;  4PSX B;  3RRM C;  1MG3 A;  3RLM D;  1ERJ A;  3V5W B;  3PVU B;  4L9O A;  4QT8 A;  3F3P A;  3UVL A;  2H13 A;  5FA5 B;  4Z7O B;  4FA9 D;  3NVN A;  3ZE1 B;  2VDQ B;  4CZX A;  1U2V C;  5I5J A;  2YB8 B;  4PBY A;  3NIG B;  3OKW A;  4WK0 B;  1Q47 A;  2B5M A;  2G9A A;  3J81 g;  3SJL D;  4QQE A;  2YMU A;  4OWR A;  5E6R B;  5EMM B;  4H5J A;  4CI2 A;  3C5M A;  4O9D A;  4BH6 A;  3ZDZ B;  2GC4 A;  3UVM A;  2IUV A;  4A0B A;  2AH1 A;  3SCY A;  4JD2 C;  2VDN B;  2H9M A;  5HE1 B;  2OIZ A;  1GP2 B;  3PSC B;  2HXC A;  4CI8 A;  4X61 B;  4JT5 C;  4A0B B;  1XKS A;  1SSL A;  2H68 A;  2IAA A;  4R7A B;  3SN6 B;  4GQ2 P;  2J56 H;  5EML B;  5HDB B;  4UM9 D;  3AH8 B;  3V9F A;  1XIP A;  5AJA A;  4Y5R D;  5CXB A;  4AEZ A;  3OKT A;  1MDA H;  4ERY A;  5IC7 A;  4JXM A;  5FKR A;  4L1Q D;  1S4U X;  5CXB B;  3N0E A;  4JSP C;  2IWK A;  2IUR A;  1B9X A;  5K1C C;  5IGQ A;  4PBZ A;  1NR0 A;  1TYE B;  3IKO A;  3JRO A;  4BUJ C;  5A2Q g;  4JSX C;  3SHF A;  3DXM C;  4GGD A;  2AH0 A;  2W18 A;  3ORV D;  1FWX A;  4FAN D;  2H9P A;  1PBY B;  4A11 B;  2MTA H;  2TRC B;  3EMH A;  2HJB A;  2XL2 A;  4J0X A;  4ZOX A;  4FB1 D;  3N0D A;  2I0T A;  4A11 A;  5GSA A;  2IWF A;  3BG0 A;  5FKT A;  1P22 A;  2PM9 A;  4YVD A;  3AL8 A;  3I7P A;  5HE2 B;  2IUQ A; 
#chains in the Genus database with same CATH topology
 4FAV D;  3MUN A;  2PM9 B;  4NBM A;  3AL8 B;  3JRP A;  5M61 A;  2CO0 C;  1PI6 A;  4FHL A;  4PC0 A;  5TEF A;  3O4J A;  4WJK B;  3O4G A;  3DSM A;  1VZ3 A;  4J84 A;  4MMZ A;  4ZN4 A;  1SQ9 A;  1JMZ B;  2CO0 A;  2AGW A;  5TF2 A;  4OZU A;  3JZN A;  2YNO A;  5CYK A;  2B4E A;  3NIF A;  5HYN B;  4X3E A;  3UVK A;  3DM0 A;  3EQ8 A;  3I2N A;  3KCI A;  1SHY B;  5M5S A;  3F3F A;  3K27 A;  4UM9 A;  4O45 A;  3RFH A;  5CYK B;  3NIF B;  3PE7 A;  2OVP B;  3JZH A;  4UM9 B;  1GG2 B;  4JSV C;  5GXI A;  4AOW A;  1JJU B;  4CZV A;  3PVW B;  2Q7Q A;  4BL0 A;  4D0K A;  2I3S A;  3IVM A;  1O6F A;  3HFQ A;  2EIB A;  4KFM B;  5I5M A;  4Z8L A;  5E6S A;  5FKQ A;  4J87 A;  1R5M A;  3I7L A;  3W15 A;  4ZOZ A;  4ZOV A;  1VE6 A;  1NEX B;  2HJ4 A;  3IUQ A;  5E6S B;  4QL1 A;  5EAL A;  4ES0 A;  1JMX B;  3SFZ A;  3OKY A;  5H17 A;  2UZX B;  3ZWL B;  4FA4 D;  1TYQ C;  3VI3 A;  3SBP A;  3OKY B;  4J78 A;  3PXS D;  4CZY A;  3ZE2 A;  5I5I A;  2VZ1 A;  2CN2 A;  2I0S A;  3VI3 B;  3F3G A;  4CY1 A;  4UI9 R;  1E8N A;  3L4O D;  4UM8 A;  4H5I A;  1UTC A;  3ZE2 B;  3FCS A;  2HU8 A;  4PXW A;  4J82 A;  2P9I C;  4LGN A;  1YFQ A;  3CFS B;  4G55 A;  3RN0 D;  4UM8 B;  4CY5 A;  3IUN A;  3PSL A;  4J81 A;  3O4I A;  1PGU A;  4A0A A;  4Z7N A;  2H6K A;  5K19 A;  1C9I A;  1L5G A;  3EI3 A;  2P9L C;  3C9C A;  2OK6 A;  5B4W A;  5AMS A;  2H6N A;  4JT6 C;  3SBQ A;  4A0A B;  1JOF A;  2GNQ A;  3PXT D;  4Z7N B;  3EQ7 A;  2YBA A;  3AL9 A;  3EI3 B;  4D6V A;  2YNN A;  4J8G A;  1QFM A;  3I7N A;  5TDH B;  2BBK H;  3NVQ A;  4O3U B;  2CE9 A;  3P4F A;  5EAR A;  3ULE C;  4CY2 A;  4GQB B;  2G99 A;  5EM2 A;  4LG8 A;  4A08 A;  3CFV A;  2P9P C;  3A0F A;  2VDO A;  4X60 B;  3MMY A;  4BCC A;  4DNW A;  5EM2 B;  2JWG A;  3DWL C;  4IA9 A;  1GXR A;  3KRX B;  5TEE A;  2VDO B;  2P9S C;  2VDR A;  3O4H A;  3GD1 I;  3E0C A;  4FA1 D;  1K8K C;  4K3I D;  4WK4 A;  4QAM A;  3IUJ A;  4PSW B;  3UKU C;  1XHM A;  3IJ0 A;  2VDR B;  4J73 A;  4DNV A;  2XYI A;  4X63 B;  2P26 A;  4WK4 B;  3JB9 L;  5GXH A;  3K6S A;  3I7K A;  3AFC A;  3MXX A;  3V7D B;  3VGZ A;  2OK4 A;  3CIK B;  5IJ7 E;  4J86 A;  5E6U A;  2AGZ A;  2I0R A;  2P9U C;  2H47 A;  4XEI C;  3I7O A;  1MG2 A;  3MZK A;  4QRJ A;  5E6U B;  3GC3 B;  3KRW B;  2OVR B;  4FWW A;  3I8C A;  4G1M A;  3UR4 A;  1YR2 A;  2CE8 A;  4JHP C;  1OLZ A;  2EBS A;  4MK0 B;  2HKM A;  3IIY A;  5HQG A;  3T3M A;  2VDL A;  4PNK B;  4NEN A;  4CI1 A;  3MUO A;  5EMK B;  3B7F A;  2CN3 A;  3OL2 A;  4J8B A;  3VI4 A;  3EI4 A;  3FM0 A;  2EIC A;  3SMR A;  4GQ1 A;  2VDL B;  2H3X A;  2P9K C;  2AGX A;  3OF7 A;  4GM8 A;  1GOH A;  2O9K A;  2IUP A;  2VZ3 A;  4RE6 A;  3OL2 B;  4BCB A;  3VI4 B;  3EI4 B;  2XU7 A;  3MZL A;  5SXM A;  3ZE0 A;  5M5T A;  3IUR A;  4EWR A;  1B9Y A;  3UVO A;  4XYH A;  2J57 G;  2AGY A;  4L1M A;  2UZY B;  2CNX A;  5H14 A;  4J79 A;  3ZE0 B;  3DXK C;  5HE3 B;  3SVW D;  3T3P A;  1H2W A;  5FQD A;  3ODT A;  3ZDX A;  1K32 A;  3C75 H;  4XYI A;  3T3P B;  4CI3 A;  4E5Z A;  1A12 A;  3NVX A;  2HES X;  4I79 A;  3ZDX B;  3RFG A;  3RMZ D;  4ERZ A;  4E5Z B;  4ESG A;  1TBG A;  4GZ8 A;  5FFO A;  4A7J A;  3K26 A;  5AFU 3;  5EAP A;  1T2X A;  3FCU A;  2QXV A;  4MMX A;  3BWS A;  1OMW B;  3EQ9 A;  2GC7 A;  3SXT D;  1L0Q A;  3IJ1 A;  5C92 A;  1JV2 A;  2H14 A;  5THA A;  1N6E A;  1VYH C;  2BCJ B;  2PM7 B;  3EI2 A;  4WK2 A;  3UVN A;  3FCU B;  1E5T A;  2AGL A;  4J77 A;  1A0R B;  4J0W A;  4G56 B;  2YNP A;  2XE4 A;  3IJE A;  4LG9 A;  4N14 A;  4O02 A;  2VC2 A;  5M5R A;  4GMB A;  3EI2 B;  4WK2 B;  2Z2O A;  2BKL A;  1QFS A;  4GM9 A;  5C9Z B;  1GOT B;  4ERQ A;  2PBI B;  2VDP A;  1GOG A;  2VC2 B;  3I8E A;  1PEV A;  1K3I A;  1U4C A;  1N6D A;  2VDM A;  4U1E I;  3SLE D;  4D9S A;  3EWE A;  2H9L A;  2JKX A;  1SQJ A;  3JZG A;  5FKS A;  4U7A A;  5FXY A;  4HDJ A;  2VDP B;  3NID A;  3I89 A;  3OTT A;  2VDM B;  5C2W B;  3GFC A;  3RSE C;  3EG6 A;  5H1M A;  3ZDY A;  1RI6 A;  2HU7 A;  2P28 A;  3NID B;  4GGA A;  5IGO A;  2J55 H;  2OJY A;  3J80 g;  4BP9 A;  4Y7R A;  2H9N A;  4NSX A;  4CY3 A;  4O1Q D;  4IMM A;  4A08 B;  4GM3 A;  3IIW A;  3ZDY B;  3DDU A;  3V4P A;  5M5U A;  2I3T A;  2XL3 A;  3PXW D;  3RN1 D;  5IJ8 E;  3SBR A;  5JWZ A;  1M1X A;  4ZOY A;  3JPX A;  3EI1 A;  2HKR A;  4IRZ A;  3U4Y A;  3BG1 A;  4JHN A;  3JAM g;  2Z2N A;  2Z2P A;  3GRE A;  4K3J B;  5EAM A;  3EI1 B;  4A09 A;  2QC5 A;  4E54 A;  4AMZ A;  5KDO B;  5CXC A;  4RE5 A;  1H2Y A;  3SWS D;  1H2X A;  2B5N A;  2P9N C;  4O3T B;  2HYE A;  4A09 B;  1N6F A;  3UKR C;  4Z7Q A;  5IT9 g;  4E54 B;  4TZ4 A;  4JSN C;  2VDK A;  4MMY A;  5CXC B;  4A2M A;  3MKQ A;  2AQ5 A;  1YUK A;  1QNI A;  4Z7Q B;  4L3G D;  3VA6 A;  5EMJ B;  3C99 A;  2VDK B;  5GMK n;  4NAA A;  3OW8 A;  3VH0 A;  2QZP A;  2PM6 B;  5FLX g;  2OVQ B;  3FRX A;  2B5L A;  2H6Q A;  3T3M B;  3MKS B;  1U8C A;  3V4V A;  3K71 A;  3QHY B;  4A2L A;  5C2V B;  1C9L A;  5HE0 B;  4GGC A;  3L4M D;  1VZ2 A;  3EU7 A;  4L3H D;  4BP8 A;  3FGB A;  4AN0 A;  4CC9 A;  3I7H A;  3IJC A;  4FA5 D;  1U8C B;  4PSX B;  4Z7O A;  3RRM C;  4G1E A;  3ZE1 A;  1MG3 A;  1I2M B;  2VDQ A;  3RLM D;  1ERJ A;  2EIE A;  3PVU B;  3V5W B;  1UOO A;  4L9O A;  4QT8 A;  3F3P A;  3NIG A;  3UVL A;  2H13 A;  5FA5 B;  5M5V A;  4FA9 D;  4WK0 A;  3NVN A;  4Z7O B;  3ZE1 B;  2VDQ B;  4CZX A;  1U2V C;  5I5J A;  2YB8 B;  4PBY A;  3NIG B;  3OKW A;  5E6R A;  4WK0 B;  1Q47 A;  2B5M A;  2G9A A;  1VE7 A;  3J81 g;  4NC4 A;  3SJL D;  4QQE A;  2YMU A;  4OWR A;  1BPO A;  5E6R B;  5EMM B;  4H5J A;  4CI2 A;  3ZDZ A;  3C5M A;  4O9D A;  5FFG A;  4BH6 A;  2QR5 A;  3ZDZ B;  2GC4 A;  3UVM A;  1E8M A;  2VDN A;  4DNU A;  2IUV A;  4A0B A;  2AH1 A;  3SCY A;  4JD2 C;  2VDN B;  2H9M A;  5HE1 B;  2OIZ A;  1GP2 B;  3PSC B;  2HXC A;  4CI8 A;  4X61 B;  4JT5 C;  5HDB A;  4A0B B;  1XKS A;  1SSL A;  2H68 A;  2IAA A;  4R7A B;  3SN6 B;  4GQ2 P;  2J56 H;  4AN1 A;  5EML B;  5HDB B;  4UM9 D;  3AH8 B;  3V9F A;  1XIP A;  3QI0 A;  5AJA A;  1UOP A;  1UOQ A;  4Y5R D;  5CXB A;  4AEZ A;  3OKT A;  1MDA H;  1H2Z A;  5IC7 A;  4ERY A;  4JXM A;  5FKR A;  4L1Q D;  4AMY A;  1S4U X;  5CXB B;  3N0E A;  1TYE A;  4JSP C;  2IWK A;  5C86 A;  2IUR A;  1B9X A;  5K1C C;  5IGQ A;  1O6G A;  2EID A;  3MVD K;  4PBZ A;  1NR0 A;  1TYE B;  3IKO A;  4O2W A;  3JRO A;  4BUJ C;  5A2Q g;  4JSX C;  3SHF A;  3DXM C;  2HU5 A;  1GOF A;  2XDW A;  4GGD A;  2AH0 A;  3IUM A;  2W18 A;  2WQ8 A;  3ORV D;  1FWX A;  4FAN D;  2XZG A;  2H9P A;  1PBY B;  4A11 B;  2MTA H;  2TRC B;  3EMH A;  2HJB A;  2XL2 A;  4J0X A;  4ZOX A;  3K72 A;  4FB1 D;  3N0D A;  2I0T A;  4A11 A;  1JTD B;  2JWH A;  5GSA A;  2IWF A;  3BG0 A;  5FKT A;  1P22 A;  2PM9 A;  4YVD A;  3AL8 A;  3I7P A;  4BCD A;  4AX4 A;  3IUL A;  5HE2 B;  2IUQ A;  4WJK A; 
#chains in the Genus database with same CATH homology
 4FAV D;  2PM9 B;  3AL8 B;  3JRP A;  2CO0 C;  1PI6 A;  4FHL A;  4PC0 A;  5TEF A;  4WJK B;  3DSM A;  4J84 A;  4ZN4 A;  1SQ9 A;  1JMZ B;  2CO0 A;  2AGW A;  5TF2 A;  4OZU A;  3JZN A;  2YNO A;  5CYK A;  2B4E A;  5HYN B;  4X3E A;  3UVK A;  3DM0 A;  3I2N A;  1SHY B;  3F3F A;  3K27 A;  4O45 A;  3RFH A;  5CYK B;  3NIF B;  3PE7 A;  2OVP B;  3JZH A;  4UM9 B;  1GG2 B;  4JSV C;  5GXI A;  4AOW A;  1JJU B;  4CZV A;  3PVW B;  2Q7Q A;  4BL0 A;  4D0K A;  2I3S A;  3HFQ A;  4KFM B;  5I5M A;  4Z8L A;  5FKQ A;  4J87 A;  1R5M A;  3I7L A;  3W15 A;  4ZOZ A;  4ZOV A;  1NEX B;  2HJ4 A;  5E6S B;  4QL1 A;  5EAL A;  4ES0 A;  1JMX B;  3SFZ A;  3OKY A;  5H17 A;  2UZX B;  3ZWL B;  4FA4 D;  1TYQ C;  3SBP A;  3OKY B;  4J78 A;  3PXS D;  4CZY A;  5I5I A;  2CN2 A;  2I0S A;  3VI3 B;  3F3G A;  4CY1 A;  4UI9 R;  3L4O D;  4H5I A;  3ZE2 B;  4PXW A;  4J82 A;  2P9I C;  4LGN A;  1YFQ A;  3CFS B;  4UM8 B;  3RN0 D;  4CY5 A;  3PSL A;  4J81 A;  1PGU A;  4A0A A;  5K19 A;  2H6K A;  3EI3 A;  2P9L C;  3C9C A;  2OK6 A;  5B4W A;  5AMS A;  2H6N A;  4JT6 C;  3SBQ A;  4A0A B;  1JOF A;  2GNQ A;  3PXT D;  4Z7N B;  4D6V A;  2YBA A;  3AL9 A;  3EI3 B;  2YNN A;  4J8G A;  3I7N A;  5TDH B;  2BBK H;  3NVQ A;  4O3U B;  2CE9 A;  3P4F A;  5EAR A;  3ULE C;  4CY2 A;  4GQB B;  2G99 A;  5EM2 A;  4LG8 A;  4A08 A;  3CFV A;  2P9P C;  3A0F A;  4X60 B;  3MMY A;  5EM2 B;  2JWG A;  3DWL C;  4IA9 A;  1GXR A;  3KRX B;  2VDO B;  2P9S C;  3E0C A;  4FA1 D;  1K8K C;  4K3I D;  4PSW B;  3UKU C;  1XHM A;  3IJ0 A;  2VDR B;  4J73 A;  2XYI A;  4X63 B;  2P26 A;  4WK4 B;  3JB9 L;  5GXH A;  3I7K A;  3AFC A;  3MXX A;  3V7D B;  3VGZ A;  2OK4 A;  3CIK B;  5IJ7 E;  4J86 A;  2AGZ A;  2I0R A;  2P9U C;  2H47 A;  4XEI C;  3I7O A;  1MG2 A;  3MZK A;  4QRJ A;  5E6U B;  3KRW B;  2OVR B;  4FWW A;  3I8C A;  3UR4 A;  2CE8 A;  1OLZ A;  2EBS A;  4MK0 B;  2HKM A;  3IIY A;  5HQG A;  4PNK B;  4CI1 A;  5EMK B;  3B7F A;  2CN3 A;  3OL2 A;  4J8B A;  3EI4 A;  3FM0 A;  3SMR A;  2VDL B;  4GQ1 A;  2H3X A;  2P9K C;  2AGX A;  4GM8 A;  2O9K A;  2IUP A;  3OL2 B;  3VI4 B;  3EI4 B;  2XU7 A;  3MZL A;  5SXM A;  4EWR A;  1B9Y A;  3UVO A;  4XYH A;  2J57 G;  2AGY A;  2UZY B;  2CNX A;  5H14 A;  4J79 A;  3ZE0 B;  3DXK C;  5HE3 B;  3SVW D;  5FQD A;  3ODT A;  1K32 A;  3C75 H;  4XYI A;  3T3P B;  4CI3 A;  4E5Z A;  3NVX A;  2HES X;  4I79 A;  3ZDX B;  3RFG A;  3RMZ D;  4ERZ A;  4E5Z B;  4ESG A;  1TBG A;  4GZ8 A;  4A7J A;  3K26 A;  5AFU 3;  5EAP A;  2QXV A;  3BWS A;  1OMW B;  2GC7 A;  3SXT D;  1L0Q A;  3IJ1 A;  5THA A;  2H14 A;  1N6E A;  1VYH C;  2BCJ B;  2PM7 B;  3EI2 A;  3UVN A;  3FCU B;  2AGL A;  4J77 A;  1A0R B;  4J0W A;  4G56 B;  2YNP A;  4LG9 A;  4N14 A;  5TEE A;  4GMB A;  3EI2 B;  4WK2 B;  2Z2O A;  4GM9 A;  5C9Z B;  1GOT B;  4ERQ A;  2PBI B;  2VC2 B;  3I8E A;  1PEV A;  1U4C A;  4U1E I;  1N6D A;  3SLE D;  3EWE A;  2H9L A;  1SQJ A;  3JZG A;  5FKS A;  4U7A A;  5FXY A;  4HDJ A;  2VDP B;  3I89 A;  3OTT A;  2VDM B;  5C2W B;  3GFC A;  3RSE C;  3EG6 A;  5H1M A;  1RI6 A;  2P28 A;  3NID B;  4GGA A;  5IGO A;  2J55 H;  2OJY A;  3J80 g;  4Y7R A;  2H9N A;  4NSX A;  4CY3 A;  4O1Q D;  4IMM A;  4A08 B;  4GM3 A;  3IIW A;  3ZDY B;  2I3T A;  2XL3 A;  3PXW D;  3RN1 D;  5IJ8 E;  3SBR A;  5JWZ A;  4ZOY A;  3JPX A;  3EI1 A;  2HKR A;  3U4Y A;  3BG1 A;  3JAM g;  2Z2N A;  2Z2P A;  3GRE A;  4K3J B;  5EAM A;  3EI1 B;  4A09 A;  2QC5 A;  4E54 A;  5KDO B;  5CXC A;  3SWS D;  2B5N A;  2P9N C;  4O3T B;  2HYE A;  4A09 B;  1N6F A;  3UKR C;  5IT9 g;  4E54 B;  4TZ4 A;  4JSN C;  5CXC B;  4A2M A;  3MKQ A;  2AQ5 A;  1YUK A;  1QNI A;  4Z7Q B;  4L3G D;  3VA6 A;  5EMJ B;  3C99 A;  2VDK B;  5GMK n;  3OW8 A;  3VH0 A;  2PM6 B;  5FLX g;  2OVQ B;  3FRX A;  2B5L A;  2H6Q A;  3T3M B;  3MKS B;  4A2L A;  5C2V B;  5HE0 B;  4GGC A;  3L4M D;  3EU7 A;  4L3H D;  3FGB A;  4CC9 A;  3I7H A;  3IJC A;  4FA5 D;  1U8C B;  4PSX B;  3RRM C;  1MG3 A;  3RLM D;  1ERJ A;  3V5W B;  3PVU B;  4L9O A;  4QT8 A;  3F3P A;  3UVL A;  2H13 A;  5FA5 B;  4Z7O B;  4FA9 D;  3NVN A;  3ZE1 B;  2VDQ B;  4CZX A;  1U2V C;  5I5J A;  2YB8 B;  4PBY A;  3NIG B;  3OKW A;  4WK0 B;  1Q47 A;  2B5M A;  2G9A A;  3J81 g;  3SJL D;  4QQE A;  2YMU A;  4OWR A;  5E6R B;  5EMM B;  4H5J A;  4CI2 A;  3C5M A;  4O9D A;  4BH6 A;  3ZDZ B;  2GC4 A;  3UVM A;  2IUV A;  4A0B A;  2AH1 A;  3SCY A;  4JD2 C;  2VDN B;  2H9M A;  5HE1 B;  2OIZ A;  1GP2 B;  3PSC B;  2HXC A;  4CI8 A;  4X61 B;  4JT5 C;  4A0B B;  1XKS A;  1SSL A;  2H68 A;  2IAA A;  4R7A B;  3SN6 B;  4GQ2 P;  2J56 H;  5EML B;  5HDB B;  4UM9 D;  3AH8 B;  3V9F A;  1XIP A;  5AJA A;  4Y5R D;  5CXB A;  4AEZ A;  3OKT A;  1MDA H;  4ERY A;  5IC7 A;  4JXM A;  5FKR A;  4L1Q D;  1S4U X;  5CXB B;  3N0E A;  4JSP C;  2IWK A;  2IUR A;  1B9X A;  5K1C C;  5IGQ A;  4PBZ A;  1NR0 A;  1TYE B;  3IKO A;  3JRO A;  4BUJ C;  5A2Q g;  4JSX C;  3SHF A;  3DXM C;  4GGD A;  2AH0 A;  2W18 A;  3ORV D;  1FWX A;  4FAN D;  2H9P A;  1PBY B;  4A11 B;  2MTA H;  2TRC B;  3EMH A;  2HJB A;  2XL2 A;  4J0X A;  4ZOX A;  4FB1 D;  3N0D A;  2I0T A;  4A11 A;  2JWH A;  5GSA A;  2IWF A;  3BG0 A;  5FKT A;  1P22 A;  2PM9 A;  4YVD A;  3AL8 A;  3I7P A;  5HE2 B;  2IUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...