3OL2B

Receptor-ligand structure of human semaphorin 4d with plexin b1.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
511
structure length
496
Chain Sequence
LPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSAHGEVLFAAFSSAAPPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSPEQWLWSFQPELGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Semaphorin-4D
total genus 118
structure length 496
sequence length 511
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3ol2B01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ol2B02
4I79A 3GREA 4E5ZB 5FKQA 4JSVC 1MG2A 3UKUC 5E6UB 3OTTA 3C99A 2I0SA 3IJ0A 4GGAA 2HKMA 3I8EA 2J56H 3AL8A 2GNQA 5EM2B 3I2NA 2VDKB 2HKRA 2IWFA 2P9LC 4JSPC 3IJ1A 4CC9A 2XU7A 4IMMA 1RI6A 4UM9B 5FQDA 3SN6B 4X3EA 2CO0C 2VDNB 4XYHA 2XL3A 4ERYA 3UVMA 3C5MA 4J78A 4IA9A 2H68A 5HE0B 2I0RA 3I7OA 4PC0A 3DXKC 4QRJA 3EI3A 1VYHC 2B5NA 3NIDB 5FKTA 2YNNA 3ODTA 3PVUB 2B4EA 5IGQA 3PSLA 3SBQA 3F3FA 4FAVD 3VA6A 5EAMA 2H13A 3CFVA 2VDRB 4A2MA 4X61B 3JZGA 1U4CA 4FA5D 2AGYA 4J73A 4GGCA 4L3HD 3P4FA 5HE1B 2P9IC 3JZHA 4CI8A 1U8CB 3GFCA 4O3UB 4ERZA 4LG9A 4J0XA 1NR0A 4PBYA 3EI3B 3B7FA 4BUJC 2VDQB 4J8GA 1TYEB 3OL2A 1OMWB 2P26A 2VDLB 3L4OD 3N0EA 5AFU3 1QNIA 5EAPA 3FCUB 2HJ4A 5FXYA 2W18A 2P9SC 3ZDXB 4PSXB 2P9UC 3UVOA 2J57G 3RFHA 2H9LA 2QXVA 5CXCB 4BL0A 3EI2A 5C9ZB 4Z7QB 4UM9D 1K32A 3DSMA 4CZXA 2YB8B 2PM9B 2UZYB 1OLZA 3BG0A 3RN0D 4OZUA 3ZE2B 5TDHB 2P9KC 3RFGA 4X60B 3V7DB 3I7NA 5K1CC 2XYIA 4O3TB 2H47A 3E0CA 4E54B 2GC7A 1JJUB 2H9MA 2J55H 2OK4A 2CN3A 3AH8B 4GZ8A 5JWZA 5H14A 4J8BA 4AOWA 1P22A 3FRXA 5CXBA 1JMXB 4O1QD 2HXCA 4J86A 4OWRA 1N6FA 4WJKB 3BG1A 3K26A 3MKQA 5E6SB 2CE8A 5HE3B 4XYIA 1TBGA 3MZKA 2OVQB 2B5LA 4A0AB 3ULEC 4WK0B 2QC5A 4GM3A 1L0QA 2H9NA 1N6EA 5SXMA 5IT9g 1YUKA 5K19A 3MMYA 3T3PB 4FA4D 4CZYA 1Q47A 2AH0A 3I89A 4PBZA 5H1MA 1ERJA 2GC4A 1U2VC 4QL1A 1MDAH 1SHYB 2OVPB 3VI3B 4LG8A 3A0FA 4GMBA 4JSXC 1FWXA 4UI9R 2H9PA 3I8CA 5TEFA 3AFCA 4GQBB 3SLED 4FA1D 3EI1A 3IIYA 5AMSA 4MK0B 3F3PA 4CY5A 3I7PA 1NEXB 3OKYB 5IJ8E 4A0BA 3OKWA 3DXMC 1GXRA 3NVXA 4H5JA 2YNPA 5HE2B 2G9AA 4FWWA 3RLMD 4Y5RD 4GQ1A 2CE9A 4ERQA 4CI1A 2AQ5A 3RSEC 1GG2B 5FKSA 3UKRC 3EU7A 3J80g 5EMJB 3EI1B 3AL8B 4FHLA 5KDOB 3JROA 4U7AA 4J81A 4A0AA 4EWRA 3ZE0B 5I5MA 1SQ9A 2YBAA 3NVNA 3JPXA 2P9PC 3VH0A 4ZOVA 5TF2A 3IIWA 3OKYA 4A11A 2Z2OA 2PM7B 5FLXg 2O9KA 4JSNC 4JT6C 1JOFA 4JXMA 2VDPB 4WK4B 5CYKA 3VGZA 2CO0A 3L4MD 4TZ4A 4WK2B 1YFQA 5CYKB 5THAA 2YNOA 5EMKB 5HQGA 2HJBA 3ZDYB 3UVLA 3SMRA 4CY1A 1MG3A 5IGOA 2IUPA 3I7KA 2Z2PA 5FA5B 1XKSA 3C75H 4ZOYA 3PXSD 4HDJA 3W15A 5I5IA 1B9XA 3SHFA 2Z2NA 4K3JB 4A09B 3UVNA 4NSXA 4J82A 3FM0A 5EARA 3V9FA 4A2LA 3EG6A 3ZWLB 3NIGB 3DWLC 3V5WB 4U1EI 2BCJB 4Z7NB 1XHMA 2AGWA 3MXXA 4ZOXA 2AGLA 3RMZD 2XL2A 3KRWB 3I7HA 4A09A 1A0RB 3CIKB 4CZVA 2BBKH 4CY2A 3PVWB 4K3ID 5IJ7E 4FB1D 2IWKA 4ZN4A 4J79A 3OKTA 5I5JA 3PXTD 4E5ZA 1S4UX 1PI6A 2IUQA 4A08A 1XIPA 4J87A 3ZE1B 2I3TA 5HYNB 1K8KC 2TRCB 2PM9A 2PBIB 1B9YA 3BWSA 4Z8LA 3SVWD 4H5IA 3HFQA 2IUVA 4ZOZA 4O9DA 3JB9L 2MTAH 3U4YA 5EM2A 4D0KA 3SBPA 2OK6A 4Z7OB 5B4WA 1TYQC 4CY3A 4E54A 2IAAA 4J77A 1SQJA 4GM9A 2HYEA 3UR4A 2B5MA 5A2Qg 3NVQA 3FGBA 3SXTD 4PSWB 4D6VA 4FA9D 3OW8A 4JT5C 1R5MA 3MKSB 4X63B 4BH6A 4QT8A 4O45A 5EMMB 3IJCA 4CI3A 4YVDA 1GOTB 2H14A 3JAMg 5H17A 5GMKn 4L9OA 1GP2B 3UVKA 3EWEA 2OVRB 3SBRA 3IKOA 1N6DA 4GQ2P 3SWSD 3PSCB 5C2VB 4R7AB 4CI2A 4J0WA 4GGDA 3EI4A 2AH1A 4GM8A 4A0BB 3PE7A 5GSAA 3EI4B 5GXHA 5E6RB 3RN1D 2UZXB 2P28A 2AGZA 1SSLA 4LGNA 3I7LA 3CFSB 2CN2A 2OIZA 3ORVD 2VDOB 5TEEA 2VC2B 5C2WB 3SCYA 2YMUA 3EMHA 2I0TA 2EBSA 4UM8B 4JD2C 4KFMB 3OL2B 4J84A 3NIFB 2H6NA 3MZLA 4PXWA 5CXBB 4N14A 3N0DA 4Y7RA 2H6QA 2HESX 5GXIA 3K27A 4A7JA 1PGUA 1JMZB 4G56B 2H6KA 4ES0A 3DM0A 5IC7A 5AJAA 5FKRA 3J81g 3JZNA 3F3GA 3KRXB 2AGXA 2G99A 4QQEA 2H3XA 4ESGA 3PXWD 3SFZA 2I3SA 4L1QD 3T3MB 2P9NC 2VDMB 5HDBB 3RRMC 2PM6B 3SJLD 2OJYA 3C9CA 3VI4B 3ZDZB 2Q7QA 3EI2B 1PEVA 4AEZA 4L3GD 5CXCA 1PBYB 5EALA 2CNXA 3JRPA 4A11B 5EMLB 4PNKB 4XEIC 2IURA 3AL9A 4FAND 4A08B
chains in the Genus database with same CATH superfamily
4I79A 2HU8A 3GREA 4E5ZB 3GC3B 5FKQA 4JSVC 1MG2A 3V4VA 3UKUC 5E6UB 3OTTA 3C99A 2I0SA 3IJ0A 2VC2A 4GGAA 2HKMA 3I8EA 2J56H 3AL8A 2GNQA 3IULA 5EM2B 1O6FA 3I2NA 2VDKB 2HKRA 2IWFA 4D9SA 2P9LC 4JSPC 3IJ1A 4QAMA 4CC9A 2XU7A 4IMMA 4WK0A 1RI6A 2QZPA 4UM9B 5FQDA 3SN6B 4X3EA 2CO0C 2VDNB 4DNVA 3IUNA 4XYHA 2XL3A 4ERYA 5M5TA 3KCIA 3UVMA 3C5MA 4J78A 4AMZA 4IA9A 2H68A 3NIGA 5HE0B 2I0RA 3I7OA 4PC0A 3DXKC 4QRJA 3IURA 3ZDYA 3EI3A 1VYHC 2B5NA 3NIDB 5FKTA 4NBMA 2YNNA 3ODTA 3PVUB 2B4EA 1H2XA 5IGQA 3PSLA 3SBQA 3VI4A 3F3FA 4FAVD 3VA6A 5EAMA 2H13A 3CFVA 2VDRB 1M1XA 4A2MA 4X61B 3JZGA 1U4CA 4FA5D 2AGYA 4J73A 3V4PA 4GGCA 4L3HD 3P4FA 5HE1B 2P9IC 1UTCA 3JZHA 4CI8A 4JHNA 1U8CB 3GFCA 4O3UB 4ERZA 4RE5A 3QHYB 5C92A 4LG9A 4J0XA 1NR0A 4MMXA 4PBYA 2HU7A 3EI3B 3B7FA 4BUJC 4BCDA 5M5RA 2VDQB 3OF7A 4J8GA 4NC4A 1TYEB 3OL2A 1OMWB 2P26A 2VDLB 3O4HA 3L4OD 3T3MA 3N0EA 5AFU3 1QNIA 5EAPA 3FCUB 4UM8A 2HJ4A 5FXYA 2W18A 2P9SC 1E8MA 4PSXB 3ZDXB 1TYEA 2P9UC 1K3IA 3UVOA 2J57G 3RFHA 2H9LA 3QI0A 2QXVA 5CXCB 4BL0A 3EI2A 5C9ZB 4Z7QB 2VDPA 4UM9D 1K32A 3DSMA 4CZXA 2YB8B 2PM9B 2UZYB 1OLZA 3BG0A 3RN0D 4OZUA 3MUOA 3ZE2B 3IUJA 5TDHB 2P9KC 4RE6A 3RFGA 4X60B 3V7DB 3I7NA 3ZE2A 5K1CC 2XYIA 4O3TB 2H47A 3E0CA 4E54B 2VDNA 2GC7A 1JJUB 2H9MA 3MVDK 2J55H 2OK4A 2CN3A 3AH8B 4GZ8A 5JWZA 5H14A 1GOHA 4J8BA 3ZDZA 4AOWA 1P22A 1UOPA 3FRXA 5CXBA 1JMXB 4O1QD 2HXCA 4J86A 4OWRA 2WQ8A 3ZE1A 3DDUA 1N6FA 4WJKB 2EIEA 3BG1A 4BCCA 3K26A 3MKQA 5E6SB 2XDWA 2CE8A 1QFSA 1I2MB 5HE3B 2VDOA 4XYIA 1TBGA 3MZKA 2OVQB 2B5LA 4A0AB 3ULEC 4WK0B 2QC5A 4GM3A 1L0QA 2H9NA 4Z7OA 2VDKA 1N6EA 4G55A 5SXMA 5IT9g 1YUKA 5K19A 2HU5A 3MMYA 3T3PB 4FA4D 4CZYA 1Q47A 5M5UA 2AH0A 3I89A 3O4GA 4PBZA 1ERJA 5H1MA 2GC4A 1U2VC 4QL1A 4DNWA 1MDAH 1SHYB 2OVPB 3VI3B 4LG8A 3A0FA 4GMBA 5FFGA 4AN0A 4JSXC 3ZE0A 1FWXA 2QR5A 4UI9R 2H9PA 3I8CA 5TEFA 3AFCA 4GQBB 3SLED 4FA1D 3EI1A 3IIYA 5AMSA 4BCBA 1L5GA 1O6GA 4MK0B 3F3PA 1C9IA 4CY5A 3I7PA 1NEXB 3OKYB 5FFOA 5IJ8E 3OKWA 4A0BA 3DXMC 1GXRA 1GOFA 3NVXA 4H5JA 2YNPA 5HE2B 4UM9A 2G9AA 3IVMA 4FWWA 3RLMD 1VZ3A 4Y5RD 4GQ1A 2CE9A 4ERQA 4CI1A 2AQ5A 3T3PA 4WK2A 3RSEC 2JKXA 1GG2B 5FKSA 3UKRC 3EU7A 3J80g 4WK4A 5EMJB 3EI1B 3AL8B 4FHLA 4G1EA 5KDOB 4IRZA 2VZ3A 3JROA 4U7AA 4J81A 4A0AA 5E6UA 4EWRA 3ZE0B 3FCUA 1SQ9A 5I5MA 2YBAA 3NVNA 3NIFA 3JPXA 2P9PC 2EICA 3VH0A 4ZOVA 5TF2A 3IIWA 3OKYA 4BP8A 4A11A 2Z2OA 2PM7B 4NENA 5FLXg 2O9KA 4JSNC 4JT6C 1JOFA 4JXMA 2VDPB 4WK4B 5CYKA 3VGZA 2CO0A 3L4MD 5M5SA 4TZ4A 4WK2B 1U8CA 1YFQA 5CYKB 5THAA 2YNOA 5EMKB 5HQGA 2VDMA 2HJBA 3ZDYB 2BKLA 3UVLA 3SMRA 4CY1A 4Z7NA 1MG3A 5IGOA 2IUPA 3I7KA 2Z2PA 2VDLA 5FA5B 1A12A 1XKSA 3C75H 4ZOYA 3PXSD 4HDJA 3EQ9A 3W15A 5I5IA 1B9XA 1JTDB 4DNUA 3SHFA 3GD1I 1C9LA 2Z2NA 4K3JB 4A09B 3UVNA 4NSXA 4J82A 4O02A 3K6SA 1GOGA 3FM0A 1VE6A 5EARA 3V9FA 4A2LA 3EG6A 1UOOA 3ZWLB 4AX4A 1QFMA 3NIGB 3DWLC 5E6SA 2EIBA 4U1EI 3V5WB 2BCJB 4Z7NB 1XHMA 2AGWA 3MXXA 4ZOXA 2AGLA 3RMZD 2XL2A 4G1MA 1E5TA 3KRWB 3I7HA 4A09A 1YR2A 1A0RB 3CIKB 4CZVA 2BBKH 1H2WA 4CY2A 3PVWB 4K3ID 5IJ7E 4MMYA 4FB1D 2IWKA 4ZN4A 4J79A 3OKTA 5I5JA 1H2YA 3PXTD 4E5ZA 1S4UX 1PI6A 3VI3A 2IUQA 4WJKA 4A08A 1XIPA 4J87A 3ZE1B 2I3TA 1BPOA 5HYNB 1K8KC 2TRCB 3EQ7A 2PM9A 2PBIB 1B9YA 3BWSA 4Z8LA 3SVWD 3IUQA 4H5IA 3HFQA 2IUVA 2EIDA 3FCSA 4O9DA 4ZOZA 2MTAH 3U4YA 3JB9L 5EM2A 4D0KA 3SBPA 2OK6A 4Z7OB 5B4WA 2JWHA 2VZ1A 4NAAA 1TYQC 4CY3A 4E54A 2IAAA 3K72A 1SQJA 4GM9A 4J77A 3UR4A 2HYEA 2B5MA 5A2Qg 3NVQA 3FGBA 3SXTD 4PSWB 4D6VA 4O2WA 4FA9D 3OW8A 1VZ2A 4JT5C 1E8NA 2XZGA 1R5MA 3MKSB 4X63B 3O4IA 4BH6A 4QT8A 5M5VA 4O45A 5EMMB 3IJCA 3MUNA 4CI3A 4YVDA 1GOTB 2H14A 3JAMg 3EQ8A 5H17A 5GMKn 4L9OA 1GP2B 3UVKA 3EWEA 1VE7A 2OVRB 3SBRA 3IKOA 1N6DA 4GQ2P 3SWSD 3IUMA 3PSCB 5C2VB 4R7AB 4CI2A 4BP9A 4J0WA 4GGDA 3EI4A 2AH1A 4MMZA 5M61A 5C86A 2VDRA 4GM8A 3K71A 4A0BB 3PE7A 5GSAA 3EI4B 5GXHA 5E6RB 3RN1D 2UZXB 2P28A 2AGZA 3O4JA 1SSLA 4LGNA 3I7LA 3CFSB 3IJEA 2CN2A 3NIDA 4JHPC 2OIZA 3ORVD 2VDOB 2JWGA 5TEEA 1H2ZA 2VC2B 4L1MA 5C2WB 3SCYA 2YMUA 3EMHA 2I0TA 3ZDXA 2EBSA 4UM8B 2XE4A 4JD2C 4KFMB 3OL2B 4AN1A 4J84A 3NIFB 2H6NA 3MZLA 4PXWA 5CXBB 4N14A 3N0DA 4Y7RA 2H6QA 2HESX 4AMYA 5GXIA 3K27A 4A7JA 1PGUA 1JMZB 1T2XA 4G56B 2H6KA 4ES0A 4Z7QA 1JV2A 3DM0A 5IC7A 5AJAA 1UOQA 5FKRA 3J81g 3JZNA 3F3GA 3KRXB 2AGXA 2G99A 4QQEA 2H3XA 4ESGA 5HDBA 3PXWD 3SFZA 2I3SA 4L1QD 3T3MB 2P9NC 2VDMB 5HDBB 3RRMC 2PM6B 3SJLD 2OJYA 3C9CA 3VI4B 2VDQA 3ZDZB 2Q7QA 3EI2B 1PEVA 4AEZA 4L3GD 5CXCA 1PBYB 5EALA 2CNXA 3JRPA 4A11B 5EMLB 4PNKB 4XEIC 2IURA 5E6RA 3AL9A 4FAND 4A08B
chains in the Genus database with same CATH topology
4I79A 3GREA 4E5ZB 5FKQA 4JSVC 1MG2A 3UKUC 5E6UB 3OTTA 3C99A 2I0SA 3IJ0A 4GGAA 2HKMA 3I8EA 2J56H 3AL8A 2GNQA 5EM2B 3I2NA 2VDKB 2HKRA 2IWFA 2P9LC 4JSPC 3IJ1A 4CC9A 2XU7A 4IMMA 1RI6A 4UM9B 5FQDA 3SN6B 4X3EA 2CO0C 2VDNB 4XYHA 2XL3A 4ERYA 3UVMA 3C5MA 4J78A 4IA9A 2H68A 5HE0B 2I0RA 3I7OA 4PC0A 3DXKC 4QRJA 3EI3A 1VYHC 2B5NA 3NIDB 5FKTA 2YNNA 3ODTA 3PVUB 2B4EA 5IGQA 3PSLA 3SBQA 3F3FA 4FAVD 3VA6A 5EAMA 2H13A 3CFVA 2VDRB 4A2MA 4X61B 3JZGA 1U4CA 4FA5D 2AGYA 4J73A 4GGCA 4L3HD 3P4FA 5HE1B 2P9IC 3JZHA 4CI8A 1U8CB 3GFCA 4O3UB 4ERZA 4LG9A 4J0XA 1NR0A 4PBYA 3EI3B 3B7FA 4BUJC 2VDQB 4J8GA 1TYEB 3OL2A 1OMWB 2P26A 2VDLB 3L4OD 3N0EA 5AFU3 1QNIA 5EAPA 3FCUB 2HJ4A 5FXYA 2W18A 2P9SC 3ZDXB 4PSXB 2P9UC 3UVOA 2J57G 3RFHA 2H9LA 2QXVA 5CXCB 4BL0A 3EI2A 5C9ZB 4Z7QB 4UM9D 1K32A 3DSMA 4CZXA 2YB8B 2PM9B 2UZYB 1OLZA 3BG0A 3RN0D 4OZUA 3ZE2B 5TDHB 2P9KC 3RFGA 4X60B 3V7DB 3I7NA 5K1CC 2XYIA 4O3TB 2H47A 3E0CA 4E54B 2GC7A 1JJUB 2H9MA 2J55H 2OK4A 2CN3A 3AH8B 4GZ8A 5JWZA 5H14A 4J8BA 4AOWA 1P22A 3FRXA 5CXBA 1JMXB 4O1QD 2HXCA 4J86A 4OWRA 1N6FA 4WJKB 3BG1A 3K26A 3MKQA 5E6SB 2CE8A 5HE3B 4XYIA 1TBGA 3MZKA 2OVQB 2B5LA 4A0AB 3ULEC 4WK0B 2QC5A 4GM3A 1L0QA 2H9NA 1N6EA 5SXMA 5IT9g 1YUKA 5K19A 3MMYA 3T3PB 4FA4D 4CZYA 1Q47A 2AH0A 3I89A 4PBZA 5H1MA 1ERJA 2GC4A 1U2VC 4QL1A 1MDAH 1SHYB 2OVPB 3VI3B 4LG8A 3A0FA 4GMBA 4JSXC 1FWXA 4UI9R 2H9PA 3I8CA 5TEFA 3AFCA 4GQBB 3SLED 4FA1D 3EI1A 3IIYA 5AMSA 4MK0B 3F3PA 4CY5A 3I7PA 1NEXB 3OKYB 5IJ8E 4A0BA 3OKWA 3DXMC 1GXRA 3NVXA 4H5JA 2YNPA 5HE2B 2G9AA 4FWWA 3RLMD 4Y5RD 4GQ1A 2CE9A 4ERQA 4CI1A 2AQ5A 3RSEC 1GG2B 5FKSA 3UKRC 3EU7A 3J80g 5EMJB 3EI1B 3AL8B 4FHLA 5KDOB 3JROA 4U7AA 4J81A 4A0AA 4EWRA 3ZE0B 5I5MA 1SQ9A 2YBAA 3NVNA 3JPXA 2P9PC 3VH0A 4ZOVA 5TF2A 3IIWA 3OKYA 4A11A 2Z2OA 2PM7B 5FLXg 2O9KA 4JSNC 4JT6C 1JOFA 4JXMA 2VDPB 4WK4B 5CYKA 3VGZA 2CO0A 3L4MD 4TZ4A 4WK2B 1YFQA 5CYKB 5THAA 2YNOA 5EMKB 5HQGA 2HJBA 3ZDYB 3UVLA 3SMRA 4CY1A 1MG3A 5IGOA 2IUPA 3I7KA 2Z2PA 5FA5B 1XKSA 3C75H 4ZOYA 3PXSD 4HDJA 3W15A 5I5IA 1B9XA 3SHFA 2Z2NA 4K3JB 4A09B 3UVNA 4NSXA 4J82A 3FM0A 5EARA 3V9FA 4A2LA 3EG6A 3ZWLB 3NIGB 3DWLC 3V5WB 4U1EI 2BCJB 4Z7NB 1XHMA 2AGWA 3MXXA 4ZOXA 2AGLA 3RMZD 2XL2A 3KRWB 3I7HA 4A09A 1A0RB 3CIKB 4CZVA 2BBKH 4CY2A 3PVWB 4K3ID 5IJ7E 4FB1D 2IWKA 4ZN4A 4J79A 3OKTA 5I5JA 3PXTD 4E5ZA 1S4UX 1PI6A 2IUQA 4A08A 1XIPA 4J87A 3ZE1B 2I3TA 5HYNB 1K8KC 2TRCB 2PM9A 2PBIB 1B9YA 3BWSA 4Z8LA 3SVWD 4H5IA 3HFQA 2IUVA 4ZOZA 4O9DA 3JB9L 2MTAH 3U4YA 5EM2A 4D0KA 3SBPA 2OK6A 4Z7OB 5B4WA 2JWHA 1TYQC 4CY3A 4E54A 2IAAA 4J77A 1SQJA 4GM9A 2HYEA 3UR4A 2B5MA 5A2Qg 3NVQA 3FGBA 3SXTD 4PSWB 4D6VA 4FA9D 3OW8A 4JT5C 1R5MA 3MKSB 4X63B 4BH6A 4QT8A 4O45A 5EMMB 3IJCA 4CI3A 4YVDA 1GOTB 2H14A 3JAMg 5H17A 5GMKn 4L9OA 1GP2B 3UVKA 3EWEA 2OVRB 3SBRA 3IKOA 1N6DA 4GQ2P 3SWSD 3PSCB 5C2VB 4R7AB 4CI2A 4J0WA 4GGDA 3EI4A 2AH1A 4GM8A 4A0BB 3PE7A 5GSAA 3EI4B 5GXHA 5E6RB 3RN1D 2UZXB 2P28A 2AGZA 1SSLA 4LGNA 3I7LA 3CFSB 2CN2A 2OIZA 3ORVD 2VDOB 2JWGA 5TEEA 2VC2B 5C2WB 3SCYA 2YMUA 3EMHA 2I0TA 2EBSA 4UM8B 4JD2C 4KFMB 3OL2B 4J84A 3NIFB 2H6NA 3MZLA 4PXWA 5CXBB 4N14A 3N0DA 4Y7RA 2H6QA 2HESX 5GXIA 3K27A 4A7JA 1PGUA 1JMZB 4G56B 2H6KA 4ES0A 3DM0A 5IC7A 5AJAA 5FKRA 3J81g 3JZNA 3F3GA 3KRXB 2AGXA 2G99A 4QQEA 2H3XA 4ESGA 3PXWD 3SFZA 2I3SA 4L1QD 3T3MB 2P9NC 2VDMB 5HDBB 3RRMC 2PM6B 3SJLD 2OJYA 3C9CA 3VI4B 3ZDZB 2Q7QA 3EI2B 1PEVA 4AEZA 4L3GD 5CXCA 1PBYB 5EALA 2CNXA 3JRPA 4A11B 5EMLB 4PNKB 4XEIC 2IURA 3AL9A 4FAND 4A08B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I79 A;  3GRE A;  4E5Z B;  5FKQ A;  4JSV C;  1MG2 A;  3UKU C;  5E6U B;  3OTT A;  3C99 A;  2I0S A;  3IJ0 A;  4GGA A;  2HKM A;  3I8E A;  2J56 H;  3AL8 A;  2GNQ A;  5EM2 B;  3I2N A;  2VDK B;  2HKR A;  2IWF A;  2P9L C;  4JSP C;  3IJ1 A;  4CC9 A;  2XU7 A;  4IMM A;  1RI6 A;  4UM9 B;  5FQD A;  3SN6 B;  4X3E A;  2CO0 C;  2VDN B;  4XYH A;  2XL3 A;  4ERY A;  3UVM A;  3C5M A;  4J78 A;  4IA9 A;  2H68 A;  5HE0 B;  2I0R A;  3I7O A;  4PC0 A;  3DXK C;  4QRJ A;  3EI3 A;  1VYH C;  2B5N A;  3NID B;  5FKT A;  2YNN A;  3ODT A;  3PVU B;  2B4E A;  5IGQ A;  3PSL A;  3SBQ A;  3F3F A;  4FAV D;  3VA6 A;  5EAM A;  2H13 A;  3CFV A;  2VDR B;  4A2M A;  4X61 B;  3JZG A;  1U4C A;  4FA5 D;  2AGY A;  4J73 A;  4GGC A;  4L3H D;  3P4F A;  5HE1 B;  2P9I C;  3JZH A;  4CI8 A;  1U8C B;  3GFC A;  4O3U B;  4ERZ A;  4LG9 A;  4J0X A;  1NR0 A;  4PBY A;  3EI3 B;  3B7F A;  4BUJ C;  2VDQ B;  4J8G A;  1TYE B;  3OL2 A;  1OMW B;  2P26 A;  2VDL B;  3L4O D;  3N0E A;  5AFU 3;  1QNI A;  5EAP A;  3FCU B;  2HJ4 A;  5FXY A;  2W18 A;  2P9S C;  3ZDX B;  4PSX B;  2P9U C;  3UVO A;  2J57 G;  3RFH A;  2H9L A;  2QXV A;  5CXC B;  4BL0 A;  3EI2 A;  5C9Z B;  4Z7Q B;  4UM9 D;  1K32 A;  3DSM A;  4CZX A;  2YB8 B;  2PM9 B;  2UZY B;  1OLZ A;  3BG0 A;  3RN0 D;  4OZU A;  3ZE2 B;  5TDH B;  2P9K C;  3RFG A;  4X60 B;  3V7D B;  3I7N A;  5K1C C;  2XYI A;  4O3T B;  2H47 A;  3E0C A;  4E54 B;  2GC7 A;  1JJU B;  2H9M A;  2J55 H;  2OK4 A;  2CN3 A;  3AH8 B;  4GZ8 A;  5JWZ A;  5H14 A;  4J8B A;  4AOW A;  1P22 A;  3FRX A;  5CXB A;  1JMX B;  4O1Q D;  2HXC A;  4J86 A;  4OWR A;  1N6F A;  4WJK B;  3BG1 A;  3K26 A;  3MKQ A;  5E6S B;  2CE8 A;  5HE3 B;  4XYI A;  1TBG A;  3MZK A;  2OVQ B;  2B5L A;  4A0A B;  3ULE C;  4WK0 B;  2QC5 A;  4GM3 A;  1L0Q A;  2H9N A;  1N6E A;  5SXM A;  5IT9 g;  1YUK A;  5K19 A;  3MMY A;  3T3P B;  4FA4 D;  4CZY A;  1Q47 A;  2AH0 A;  3I89 A;  4PBZ A;  5H1M A;  1ERJ A;  2GC4 A;  1U2V C;  4QL1 A;  1MDA H;  1SHY B;  2OVP B;  3VI3 B;  4LG8 A;  3A0F A;  4GMB A;  4JSX C;  1FWX A;  4UI9 R;  2H9P A;  3I8C A;  5TEF A;  3AFC A;  4GQB B;  3SLE D;  4FA1 D;  3EI1 A;  3IIY A;  5AMS A;  4MK0 B;  3F3P A;  4CY5 A;  3I7P A;  1NEX B;  3OKY B;  5IJ8 E;  4A0B A;  3OKW A;  3DXM C;  1GXR A;  3NVX A;  4H5J A;  2YNP A;  5HE2 B;  2G9A A;  4FWW A;  3RLM D;  4Y5R D;  4GQ1 A;  2CE9 A;  4ERQ A;  4CI1 A;  2AQ5 A;  3RSE C;  1GG2 B;  5FKS A;  3UKR C;  3EU7 A;  3J80 g;  5EMJ B;  3EI1 B;  3AL8 B;  4FHL A;  5KDO B;  3JRO A;  4U7A A;  4J81 A;  4A0A A;  4EWR A;  3ZE0 B;  5I5M A;  1SQ9 A;  2YBA A;  3NVN A;  3JPX A;  2P9P C;  3VH0 A;  4ZOV A;  5TF2 A;  3IIW A;  3OKY A;  4A11 A;  2Z2O A;  2PM7 B;  5FLX g;  2O9K A;  4JSN C;  4JT6 C;  1JOF A;  4JXM A;  2VDP B;  4WK4 B;  5CYK A;  3VGZ A;  2CO0 A;  3L4M D;  4TZ4 A;  4WK2 B;  1YFQ A;  5CYK B;  5THA A;  2YNO A;  5EMK B;  5HQG A;  2HJB A;  3ZDY B;  3UVL A;  3SMR A;  4CY1 A;  1MG3 A;  5IGO A;  2IUP A;  3I7K A;  2Z2P A;  5FA5 B;  1XKS A;  3C75 H;  4ZOY A;  3PXS D;  4HDJ A;  3W15 A;  5I5I A;  1B9X A;  3SHF A;  2Z2N A;  4K3J B;  4A09 B;  3UVN A;  4NSX A;  4J82 A;  3FM0 A;  5EAR A;  3V9F A;  4A2L A;  3EG6 A;  3ZWL B;  3NIG B;  3DWL C;  3V5W B;  4U1E I;  2BCJ B;  4Z7N B;  1XHM A;  2AGW A;  3MXX A;  4ZOX A;  2AGL A;  3RMZ D;  2XL2 A;  3KRW B;  3I7H A;  4A09 A;  1A0R B;  3CIK B;  4CZV A;  2BBK H;  4CY2 A;  3PVW B;  4K3I D;  5IJ7 E;  4FB1 D;  2IWK A;  4ZN4 A;  4J79 A;  3OKT A;  5I5J A;  3PXT D;  4E5Z A;  1S4U X;  1PI6 A;  2IUQ A;  4A08 A;  1XIP A;  4J87 A;  3ZE1 B;  2I3T A;  5HYN B;  1K8K C;  2TRC B;  2PM9 A;  2PBI B;  1B9Y A;  3BWS A;  4Z8L A;  3SVW D;  4H5I A;  3HFQ A;  2IUV A;  4ZOZ A;  4O9D A;  3JB9 L;  2MTA H;  3U4Y A;  5EM2 A;  4D0K A;  3SBP A;  2OK6 A;  4Z7O B;  5B4W A;  1TYQ C;  4CY3 A;  4E54 A;  2IAA A;  4J77 A;  1SQJ A;  4GM9 A;  2HYE A;  3UR4 A;  2B5M A;  5A2Q g;  3NVQ A;  3FGB A;  3SXT D;  4PSW B;  4D6V A;  4FA9 D;  3OW8 A;  4JT5 C;  1R5M A;  3MKS B;  4X63 B;  4BH6 A;  4QT8 A;  4O45 A;  5EMM B;  3IJC A;  4CI3 A;  4YVD A;  1GOT B;  2H14 A;  3JAM g;  5H17 A;  5GMK n;  4L9O A;  1GP2 B;  3UVK A;  3EWE A;  2OVR B;  3SBR A;  3IKO A;  1N6D A;  4GQ2 P;  3SWS D;  3PSC B;  5C2V B;  4R7A B;  4CI2 A;  4J0W A;  4GGD A;  3EI4 A;  2AH1 A;  4GM8 A;  4A0B B;  3PE7 A;  5GSA A;  3EI4 B;  5GXH A;  5E6R B;  3RN1 D;  2UZX B;  2P28 A;  2AGZ A;  1SSL A;  4LGN A;  3I7L A;  3CFS B;  2CN2 A;  2OIZ A;  3ORV D;  2VDO B;  5TEE A;  2VC2 B;  5C2W B;  3SCY A;  2YMU A;  3EMH A;  2I0T A;  2EBS A;  4UM8 B;  4JD2 C;  4KFM B;  3OL2 B;  4J84 A;  3NIF B;  2H6N A;  3MZL A;  4PXW A;  5CXB B;  4N14 A;  3N0D A;  4Y7R A;  2H6Q A;  2HES X;  5GXI A;  3K27 A;  4A7J A;  1PGU A;  1JMZ B;  4G56 B;  2H6K A;  4ES0 A;  3DM0 A;  5IC7 A;  5AJA A;  5FKR A;  3J81 g;  3JZN A;  3F3G A;  3KRX B;  2AGX A;  2G99 A;  4QQE A;  2H3X A;  4ESG A;  3PXW D;  3SFZ A;  2I3S A;  4L1Q D;  3T3M B;  2P9N C;  2VDM B;  5HDB B;  3RRM C;  2PM6 B;  3SJL D;  2OJY A;  3C9C A;  3VI4 B;  3ZDZ B;  2Q7Q A;  3EI2 B;  1PEV A;  4AEZ A;  4L3G D;  5CXC A;  1PBY B;  5EAL A;  2CNX A;  3JRP A;  4A11 B;  5EML B;  4PNK B;  4XEI C;  2IUR A;  3AL9 A;  4FAN D;  4A08 B; 
#chains in the Genus database with same CATH topology
 4I79 A;  2HU8 A;  3GRE A;  4E5Z B;  3GC3 B;  5FKQ A;  4JSV C;  1MG2 A;  3V4V A;  3UKU C;  5E6U B;  3OTT A;  3C99 A;  2I0S A;  3IJ0 A;  2VC2 A;  4GGA A;  2HKM A;  3I8E A;  2J56 H;  3AL8 A;  2GNQ A;  3IUL A;  5EM2 B;  1O6F A;  3I2N A;  2VDK B;  2HKR A;  2IWF A;  4D9S A;  2P9L C;  4JSP C;  3IJ1 A;  4QAM A;  4CC9 A;  2XU7 A;  4IMM A;  4WK0 A;  1RI6 A;  2QZP A;  4UM9 B;  5FQD A;  3SN6 B;  4X3E A;  2CO0 C;  2VDN B;  4DNV A;  3IUN A;  4XYH A;  2XL3 A;  4ERY A;  5M5T A;  3KCI A;  3UVM A;  3C5M A;  4J78 A;  4AMZ A;  4IA9 A;  2H68 A;  3NIG A;  5HE0 B;  2I0R A;  3I7O A;  4PC0 A;  3DXK C;  4QRJ A;  3IUR A;  3ZDY A;  3EI3 A;  1VYH C;  2B5N A;  3NID B;  5FKT A;  4NBM A;  2YNN A;  3ODT A;  3PVU B;  2B4E A;  1H2X A;  5IGQ A;  3PSL A;  3SBQ A;  3VI4 A;  3F3F A;  4FAV D;  3VA6 A;  5EAM A;  2H13 A;  3CFV A;  2VDR B;  1M1X A;  4A2M A;  4X61 B;  3JZG A;  1U4C A;  4FA5 D;  2AGY A;  4J73 A;  3V4P A;  4GGC A;  4L3H D;  3P4F A;  5HE1 B;  2P9I C;  1UTC A;  3JZH A;  4CI8 A;  4JHN A;  1U8C B;  3GFC A;  4O3U B;  4ERZ A;  4RE5 A;  3QHY B;  5C92 A;  4LG9 A;  4J0X A;  1NR0 A;  4MMX A;  4PBY A;  2HU7 A;  3EI3 B;  3B7F A;  4BUJ C;  4BCD A;  5M5R A;  2VDQ B;  3OF7 A;  4J8G A;  4NC4 A;  1TYE B;  3OL2 A;  1OMW B;  2P26 A;  2VDL B;  3O4H A;  3L4O D;  3T3M A;  3N0E A;  5AFU 3;  1QNI A;  5EAP A;  3FCU B;  4UM8 A;  2HJ4 A;  5FXY A;  2W18 A;  2P9S C;  1E8M A;  4PSX B;  3ZDX B;  1TYE A;  2P9U C;  1K3I A;  3UVO A;  2J57 G;  3RFH A;  2H9L A;  3QI0 A;  2QXV A;  5CXC B;  4BL0 A;  3EI2 A;  5C9Z B;  4Z7Q B;  2VDP A;  4UM9 D;  1K32 A;  3DSM A;  4CZX A;  2YB8 B;  2PM9 B;  2UZY B;  1OLZ A;  3BG0 A;  3RN0 D;  4OZU A;  3MUO A;  3ZE2 B;  3IUJ A;  5TDH B;  2P9K C;  4RE6 A;  3RFG A;  4X60 B;  3V7D B;  3I7N A;  3ZE2 A;  5K1C C;  2XYI A;  4O3T B;  2H47 A;  3E0C A;  4E54 B;  2VDN A;  2GC7 A;  1JJU B;  2H9M A;  3MVD K;  2J55 H;  2OK4 A;  2CN3 A;  3AH8 B;  4GZ8 A;  5JWZ A;  5H14 A;  1GOH A;  4J8B A;  3ZDZ A;  4AOW A;  1P22 A;  1UOP A;  3FRX A;  5CXB A;  1JMX B;  4O1Q D;  2HXC A;  4J86 A;  4OWR A;  2WQ8 A;  3ZE1 A;  3DDU A;  1N6F A;  4WJK B;  2EIE A;  3BG1 A;  4BCC A;  3K26 A;  3MKQ A;  5E6S B;  2XDW A;  2CE8 A;  1QFS A;  1I2M B;  5HE3 B;  2VDO A;  4XYI A;  1TBG A;  3MZK A;  2OVQ B;  2B5L A;  4A0A B;  3ULE C;  4WK0 B;  2QC5 A;  4GM3 A;  1L0Q A;  2H9N A;  4Z7O A;  2VDK A;  1N6E A;  4G55 A;  5SXM A;  5IT9 g;  1YUK A;  5K19 A;  2HU5 A;  3MMY A;  3T3P B;  4FA4 D;  4CZY A;  1Q47 A;  5M5U A;  2AH0 A;  3I89 A;  3O4G A;  4PBZ A;  1ERJ A;  5H1M A;  2GC4 A;  1U2V C;  4QL1 A;  4DNW A;  1MDA H;  1SHY B;  2OVP B;  3VI3 B;  4LG8 A;  3A0F A;  4GMB A;  5FFG A;  4AN0 A;  4JSX C;  3ZE0 A;  1FWX A;  2QR5 A;  4UI9 R;  2H9P A;  3I8C A;  5TEF A;  3AFC A;  4GQB B;  3SLE D;  4FA1 D;  3EI1 A;  3IIY A;  5AMS A;  4BCB A;  1L5G A;  1O6G A;  4MK0 B;  3F3P A;  1C9I A;  4CY5 A;  3I7P A;  1NEX B;  3OKY B;  5FFO A;  5IJ8 E;  3OKW A;  4A0B A;  3DXM C;  1GXR A;  1GOF A;  3NVX A;  4H5J A;  2YNP A;  5HE2 B;  4UM9 A;  2G9A A;  3IVM A;  4FWW A;  3RLM D;  1VZ3 A;  4Y5R D;  4GQ1 A;  2CE9 A;  4ERQ A;  4CI1 A;  2AQ5 A;  3T3P A;  4WK2 A;  3RSE C;  2JKX A;  1GG2 B;  5FKS A;  3UKR C;  3EU7 A;  3J80 g;  4WK4 A;  5EMJ B;  3EI1 B;  3AL8 B;  4FHL A;  4G1E A;  5KDO B;  4IRZ A;  2VZ3 A;  3JRO A;  4U7A A;  4J81 A;  4A0A A;  5E6U A;  4EWR A;  3ZE0 B;  3FCU A;  1SQ9 A;  5I5M A;  2YBA A;  3NVN A;  3NIF A;  3JPX A;  2P9P C;  2EIC A;  3VH0 A;  4ZOV A;  5TF2 A;  3IIW A;  3OKY A;  4BP8 A;  4A11 A;  2Z2O A;  2PM7 B;  4NEN A;  5FLX g;  2O9K A;  4JSN C;  4JT6 C;  1JOF A;  4JXM A;  2VDP B;  4WK4 B;  5CYK A;  3VGZ A;  2CO0 A;  3L4M D;  5M5S A;  4TZ4 A;  4WK2 B;  1U8C A;  1YFQ A;  5CYK B;  5THA A;  2YNO A;  5EMK B;  5HQG A;  2VDM A;  2HJB A;  3ZDY B;  2BKL A;  3UVL A;  3SMR A;  4CY1 A;  4Z7N A;  1MG3 A;  5IGO A;  2IUP A;  3I7K A;  2Z2P A;  2VDL A;  5FA5 B;  1A12 A;  1XKS A;  3C75 H;  4ZOY A;  3PXS D;  4HDJ A;  3EQ9 A;  3W15 A;  5I5I A;  1B9X A;  1JTD B;  4DNU A;  3SHF A;  3GD1 I;  1C9L A;  2Z2N A;  4K3J B;  4A09 B;  3UVN A;  4NSX A;  4J82 A;  4O02 A;  3K6S A;  1GOG A;  3FM0 A;  1VE6 A;  5EAR A;  3V9F A;  4A2L A;  3EG6 A;  1UOO A;  3ZWL B;  4AX4 A;  1QFM A;  3NIG B;  3DWL C;  5E6S A;  2EIB A;  4U1E I;  3V5W B;  2BCJ B;  4Z7N B;  1XHM A;  2AGW A;  3MXX A;  4ZOX A;  2AGL A;  3RMZ D;  2XL2 A;  4G1M A;  1E5T A;  3KRW B;  3I7H A;  4A09 A;  1YR2 A;  1A0R B;  3CIK B;  4CZV A;  2BBK H;  1H2W A;  4CY2 A;  3PVW B;  4K3I D;  5IJ7 E;  4MMY A;  4FB1 D;  2IWK A;  4ZN4 A;  4J79 A;  3OKT A;  5I5J A;  1H2Y A;  3PXT D;  4E5Z A;  1S4U X;  1PI6 A;  3VI3 A;  2IUQ A;  4WJK A;  4A08 A;  1XIP A;  4J87 A;  3ZE1 B;  2I3T A;  1BPO A;  5HYN B;  1K8K C;  2TRC B;  3EQ7 A;  2PM9 A;  2PBI B;  1B9Y A;  3BWS A;  4Z8L A;  3SVW D;  3IUQ A;  4H5I A;  3HFQ A;  2IUV A;  2EID A;  3FCS A;  4O9D A;  4ZOZ A;  2MTA H;  3U4Y A;  3JB9 L;  5EM2 A;  4D0K A;  3SBP A;  2OK6 A;  4Z7O B;  5B4W A;  2JWH A;  2VZ1 A;  4NAA A;  1TYQ C;  4CY3 A;  4E54 A;  2IAA A;  3K72 A;  1SQJ A;  4GM9 A;  4J77 A;  3UR4 A;  2HYE A;  2B5M A;  5A2Q g;  3NVQ A;  3FGB A;  3SXT D;  4PSW B;  4D6V A;  4O2W A;  4FA9 D;  3OW8 A;  1VZ2 A;  4JT5 C;  1E8N A;  2XZG A;  1R5M A;  3MKS B;  4X63 B;  3O4I A;  4BH6 A;  4QT8 A;  5M5V A;  4O45 A;  5EMM B;  3IJC A;  3MUN A;  4CI3 A;  4YVD A;  1GOT B;  2H14 A;  3JAM g;  3EQ8 A;  5H17 A;  5GMK n;  4L9O A;  1GP2 B;  3UVK A;  3EWE A;  1VE7 A;  2OVR B;  3SBR A;  3IKO A;  1N6D A;  4GQ2 P;  3SWS D;  3IUM A;  3PSC B;  5C2V B;  4R7A B;  4CI2 A;  4BP9 A;  4J0W A;  4GGD A;  3EI4 A;  2AH1 A;  4MMZ A;  5M61 A;  5C86 A;  2VDR A;  4GM8 A;  3K71 A;  4A0B B;  3PE7 A;  5GSA A;  3EI4 B;  5GXH A;  5E6R B;  3RN1 D;  2UZX B;  2P28 A;  2AGZ A;  3O4J A;  1SSL A;  4LGN A;  3I7L A;  3CFS B;  3IJE A;  2CN2 A;  3NID A;  4JHP C;  2OIZ A;  3ORV D;  2VDO B;  2JWG A;  5TEE A;  1H2Z A;  2VC2 B;  4L1M A;  5C2W B;  3SCY A;  2YMU A;  3EMH A;  2I0T A;  3ZDX A;  2EBS A;  4UM8 B;  2XE4 A;  4JD2 C;  4KFM B;  3OL2 B;  4AN1 A;  4J84 A;  3NIF B;  2H6N A;  3MZL A;  4PXW A;  5CXB B;  4N14 A;  3N0D A;  4Y7R A;  2H6Q A;  2HES X;  4AMY A;  5GXI A;  3K27 A;  4A7J A;  1PGU A;  1JMZ B;  1T2X A;  4G56 B;  2H6K A;  4ES0 A;  4Z7Q A;  1JV2 A;  3DM0 A;  5IC7 A;  5AJA A;  1UOQ A;  5FKR A;  3J81 g;  3JZN A;  3F3G A;  3KRX B;  2AGX A;  2G99 A;  4QQE A;  2H3X A;  4ESG A;  5HDB A;  3PXW D;  3SFZ A;  2I3S A;  4L1Q D;  3T3M B;  2P9N C;  2VDM B;  5HDB B;  3RRM C;  2PM6 B;  3SJL D;  2OJY A;  3C9C A;  3VI4 B;  2VDQ A;  3ZDZ B;  2Q7Q A;  3EI2 B;  1PEV A;  4AEZ A;  4L3G D;  5CXC A;  1PBY B;  5EAL A;  2CNX A;  3JRP A;  4A11 B;  5EML B;  4PNK B;  4XEI C;  2IUR A;  5E6R A;  3AL9 A;  4FAN D;  4A08 B; 
#chains in the Genus database with same CATH homology
 4I79 A;  3GRE A;  4E5Z B;  5FKQ A;  4JSV C;  1MG2 A;  3UKU C;  5E6U B;  3OTT A;  3C99 A;  2I0S A;  3IJ0 A;  4GGA A;  2HKM A;  3I8E A;  2J56 H;  3AL8 A;  2GNQ A;  5EM2 B;  3I2N A;  2VDK B;  2HKR A;  2IWF A;  2P9L C;  4JSP C;  3IJ1 A;  4CC9 A;  2XU7 A;  4IMM A;  1RI6 A;  4UM9 B;  5FQD A;  3SN6 B;  4X3E A;  2CO0 C;  2VDN B;  4XYH A;  2XL3 A;  4ERY A;  3UVM A;  3C5M A;  4J78 A;  4IA9 A;  2H68 A;  5HE0 B;  2I0R A;  3I7O A;  4PC0 A;  3DXK C;  4QRJ A;  3EI3 A;  1VYH C;  2B5N A;  3NID B;  5FKT A;  2YNN A;  3ODT A;  3PVU B;  2B4E A;  5IGQ A;  3PSL A;  3SBQ A;  3F3F A;  4FAV D;  3VA6 A;  5EAM A;  2H13 A;  3CFV A;  2VDR B;  4A2M A;  4X61 B;  3JZG A;  1U4C A;  4FA5 D;  2AGY A;  4J73 A;  4GGC A;  4L3H D;  3P4F A;  5HE1 B;  2P9I C;  3JZH A;  4CI8 A;  1U8C B;  3GFC A;  4O3U B;  4ERZ A;  4LG9 A;  4J0X A;  1NR0 A;  4PBY A;  3EI3 B;  3B7F A;  4BUJ C;  2VDQ B;  4J8G A;  1TYE B;  3OL2 A;  1OMW B;  2P26 A;  2VDL B;  3L4O D;  3N0E A;  5AFU 3;  1QNI A;  5EAP A;  3FCU B;  2HJ4 A;  5FXY A;  2W18 A;  2P9S C;  3ZDX B;  4PSX B;  2P9U C;  3UVO A;  2J57 G;  3RFH A;  2H9L A;  2QXV A;  5CXC B;  4BL0 A;  3EI2 A;  5C9Z B;  4Z7Q B;  4UM9 D;  1K32 A;  3DSM A;  4CZX A;  2YB8 B;  2PM9 B;  2UZY B;  1OLZ A;  3BG0 A;  3RN0 D;  4OZU A;  3ZE2 B;  5TDH B;  2P9K C;  3RFG A;  4X60 B;  3V7D B;  3I7N A;  5K1C C;  2XYI A;  4O3T B;  2H47 A;  3E0C A;  4E54 B;  2GC7 A;  1JJU B;  2H9M A;  2J55 H;  2OK4 A;  2CN3 A;  3AH8 B;  4GZ8 A;  5JWZ A;  5H14 A;  4J8B A;  4AOW A;  1P22 A;  3FRX A;  5CXB A;  1JMX B;  4O1Q D;  2HXC A;  4J86 A;  4OWR A;  1N6F A;  4WJK B;  3BG1 A;  3K26 A;  3MKQ A;  5E6S B;  2CE8 A;  5HE3 B;  4XYI A;  1TBG A;  3MZK A;  2OVQ B;  2B5L A;  4A0A B;  3ULE C;  4WK0 B;  2QC5 A;  4GM3 A;  1L0Q A;  2H9N A;  1N6E A;  5SXM A;  5IT9 g;  1YUK A;  5K19 A;  3MMY A;  3T3P B;  4FA4 D;  4CZY A;  1Q47 A;  2AH0 A;  3I89 A;  4PBZ A;  5H1M A;  1ERJ A;  2GC4 A;  1U2V C;  4QL1 A;  1MDA H;  1SHY B;  2OVP B;  3VI3 B;  4LG8 A;  3A0F A;  4GMB A;  4JSX C;  1FWX A;  4UI9 R;  2H9P A;  3I8C A;  5TEF A;  3AFC A;  4GQB B;  3SLE D;  4FA1 D;  3EI1 A;  3IIY A;  5AMS A;  4MK0 B;  3F3P A;  4CY5 A;  3I7P A;  1NEX B;  3OKY B;  5IJ8 E;  4A0B A;  3OKW A;  3DXM C;  1GXR A;  3NVX A;  4H5J A;  2YNP A;  5HE2 B;  2G9A A;  4FWW A;  3RLM D;  4Y5R D;  4GQ1 A;  2CE9 A;  4ERQ A;  4CI1 A;  2AQ5 A;  3RSE C;  1GG2 B;  5FKS A;  3UKR C;  3EU7 A;  3J80 g;  5EMJ B;  3EI1 B;  3AL8 B;  4FHL A;  5KDO B;  3JRO A;  4U7A A;  4J81 A;  4A0A A;  4EWR A;  3ZE0 B;  5I5M A;  1SQ9 A;  2YBA A;  3NVN A;  3JPX A;  2P9P C;  3VH0 A;  4ZOV A;  5TF2 A;  3IIW A;  3OKY A;  4A11 A;  2Z2O A;  2PM7 B;  5FLX g;  2O9K A;  4JSN C;  4JT6 C;  1JOF A;  4JXM A;  2VDP B;  4WK4 B;  5CYK A;  3VGZ A;  2CO0 A;  3L4M D;  4TZ4 A;  4WK2 B;  1YFQ A;  5CYK B;  5THA A;  2YNO A;  5EMK B;  5HQG A;  2HJB A;  3ZDY B;  3UVL A;  3SMR A;  4CY1 A;  1MG3 A;  5IGO A;  2IUP A;  3I7K A;  2Z2P A;  5FA5 B;  1XKS A;  3C75 H;  4ZOY A;  3PXS D;  4HDJ A;  3W15 A;  5I5I A;  1B9X A;  3SHF A;  2Z2N A;  4K3J B;  4A09 B;  3UVN A;  4NSX A;  4J82 A;  3FM0 A;  5EAR A;  3V9F A;  4A2L A;  3EG6 A;  3ZWL B;  3NIG B;  3DWL C;  3V5W B;  4U1E I;  2BCJ B;  4Z7N B;  1XHM A;  2AGW A;  3MXX A;  4ZOX A;  2AGL A;  3RMZ D;  2XL2 A;  3KRW B;  3I7H A;  4A09 A;  1A0R B;  3CIK B;  4CZV A;  2BBK H;  4CY2 A;  3PVW B;  4K3I D;  5IJ7 E;  4FB1 D;  2IWK A;  4ZN4 A;  4J79 A;  3OKT A;  5I5J A;  3PXT D;  4E5Z A;  1S4U X;  1PI6 A;  2IUQ A;  4A08 A;  1XIP A;  4J87 A;  3ZE1 B;  2I3T A;  5HYN B;  1K8K C;  2TRC B;  2PM9 A;  2PBI B;  1B9Y A;  3BWS A;  4Z8L A;  3SVW D;  4H5I A;  3HFQ A;  2IUV A;  4ZOZ A;  4O9D A;  3JB9 L;  2MTA H;  3U4Y A;  5EM2 A;  4D0K A;  3SBP A;  2OK6 A;  4Z7O B;  5B4W A;  2JWH A;  1TYQ C;  4CY3 A;  4E54 A;  2IAA A;  4J77 A;  1SQJ A;  4GM9 A;  2HYE A;  3UR4 A;  2B5M A;  5A2Q g;  3NVQ A;  3FGB A;  3SXT D;  4PSW B;  4D6V A;  4FA9 D;  3OW8 A;  4JT5 C;  1R5M A;  3MKS B;  4X63 B;  4BH6 A;  4QT8 A;  4O45 A;  5EMM B;  3IJC A;  4CI3 A;  4YVD A;  1GOT B;  2H14 A;  3JAM g;  5H17 A;  5GMK n;  4L9O A;  1GP2 B;  3UVK A;  3EWE A;  2OVR B;  3SBR A;  3IKO A;  1N6D A;  4GQ2 P;  3SWS D;  3PSC B;  5C2V B;  4R7A B;  4CI2 A;  4J0W A;  4GGD A;  3EI4 A;  2AH1 A;  4GM8 A;  4A0B B;  3PE7 A;  5GSA A;  3EI4 B;  5GXH A;  5E6R B;  3RN1 D;  2UZX B;  2P28 A;  2AGZ A;  1SSL A;  4LGN A;  3I7L A;  3CFS B;  2CN2 A;  2OIZ A;  3ORV D;  2VDO B;  2JWG A;  5TEE A;  2VC2 B;  5C2W B;  3SCY A;  2YMU A;  3EMH A;  2I0T A;  2EBS A;  4UM8 B;  4JD2 C;  4KFM B;  3OL2 B;  4J84 A;  3NIF B;  2H6N A;  3MZL A;  4PXW A;  5CXB B;  4N14 A;  3N0D A;  4Y7R A;  2H6Q A;  2HES X;  5GXI A;  3K27 A;  4A7J A;  1PGU A;  1JMZ B;  4G56 B;  2H6K A;  4ES0 A;  3DM0 A;  5IC7 A;  5AJA A;  5FKR A;  3J81 g;  3JZN A;  3F3G A;  3KRX B;  2AGX A;  2G99 A;  4QQE A;  2H3X A;  4ESG A;  3PXW D;  3SFZ A;  2I3S A;  4L1Q D;  3T3M B;  2P9N C;  2VDM B;  5HDB B;  3RRM C;  2PM6 B;  3SJL D;  2OJY A;  3C9C A;  3VI4 B;  3ZDZ B;  2Q7Q A;  3EI2 B;  1PEV A;  4AEZ A;  4L3G D;  5CXC A;  1PBY B;  5EAL A;  2CNX A;  3JRP A;  4A11 B;  5EML B;  4PNK B;  4XEI C;  2IUR A;  3AL9 A;  4FAN D;  4A08 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...