3OL2B

Receptor-ligand structure of human semaphorin 4d with plexin b1.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
511
structure length
496
Chain Sequence
LPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSAHGEVLFAAFSSAAPPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSPEQWLWSFQPELGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Semaphorin-4D
publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 118
structure length 496
sequence length 511
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3ol2B01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ol2B02
3EI3A 3ZDXB 3EI4A 4ZN4A 4PNKB 2P9KC 4ESGA 4PBZA 1PGUA 5AFU3 4IA9A 5FA5B 5SXMA 2Q7QA 4BH6A 3OL2B 4G56B 4FAVD 5H1MA 4ZOVA 2YNNA 3EI2A 4UM8B 2OVRB 2AGLA 4L3GD 3EI1A 4CZYA 4ZOZA 5JWZA 4D6VA 3B7FA 3K26A 1MG3A 1YUKA 2CN3A 1OMWB 4GQ1A 5FXYA 5E6UB 2P28A 3T3MB 3ZE1B 4X3EA 2UZYB 3VA6A 3SCYA 3JROA 3EU7A 2AGXA 4PSWB 2GNQA 4LGNA 4WK4B 5I5JA 3NIFB 4J77A 1SHYB 4FA5D 4WK0B 4MK0B 5IGQA 5KDOB 2AH1A 2H9NA 5AJAA 4IMMA 2HJBA 4ZOYA 3UVKA 3CFVA 4BL0A 1FWXA 2HKRA 5IC7A 5E6RB 4GM3A 3JRPA 2P9SC 3ZWLB 3RLMD 5TF2A 1P22A 1XIPA 2PM6B 3CFSB 3ORVD 4JSXC 2CO0C 4Z7NB 2PM7B 2H6QA 2VDNB 3OL2A 2OJYA 2HXCA 4ERYA 3FM0A 1B9XA 5A2Qg 5I5IA 3SJLD 5FLXg 2OVPB 1MDAH 5CXCB 4A11A 3OKTA 5FKRA 4H5IA 3IJ1A 2VC2B 1TBGA 4E54B 4R7AB 3AFCA 1MG2A 4QQEA 3ZE2B 2PBIB 4A08A 3EI1B 1N6FA 3IKOA 2I3TA 3E0CA 3SBQA 2OK6A 4Z8LA 2CE9A 2IWKA 3SWSD 3ZDZB 3P4FA 1ERJA 5TEFA 4GGAA 3OKYB 4J86A 3V9FA 2J56H 2B5NA 3SVWD 3JZGA 3MKQA 3VI4B 1XKSA 2CO0A 3C75H 4JXMA 5EALA 3MXXA 3J81g 3NVQA 3AH8B 2IUPA 3C9CA 5IT9g 4A0AB 3ZDYB 5H17A 4CI8A 3AL8A 3KRXB 3PXTD 4CZXA 4XYHA 4XYIA 1GP2B 3GREA 2IAAA 2XL3A 3RN1D 2H14A 5EM2B 2QC5A 2B5MA 5EMKB 2B5LA 4AOWA 4FA1D 5CXCA 2H9LA 2I0RA 4JD2C 3UVOA 4L9OA 2P9UC 5GSAA 4E54A 5HYNB 3F3PA 1SQJA 3CIKB 5TDHB 4H5JA 3K27A 4ZOXA 3OKWA 2MTAH 2OK4A 1RI6A 5K19A 3NVXA 3I8CA 3JZHA 1K8KC 2VDPB 4JT6C 3JPXA 3UKUC 1GXRA 1JOFA 4PXWA 4A11B 5EMJB 2QXVA 4Y7RA 2W18A 2AQ5A 3OKYA 4NSXA 1PEVA 4QL1A 2XU7A 1OLZA 3OTTA 4A08B 4CY1A 2YB8B 4O3TB 4CI3A 1YFQA 2GC7A 3SFZA 3EG6A 4GM9A 1U4CA 2P9IC 1N6EA 4X61B 2IURA 3W15A 4O45A 4L3HD 4FA9D 1K32A 1QNIA 2BBKH 3MMYA 3I7OA 4A2MA 4A0AA 5C9ZB 3A0FA 3I7PA 4PSXB 2H3XA 5HE1B 3BG1A 3I7KA 4J0XA 4EWRA 2PM9B 2VDRB 5AMSA 4GMBA 4CZVA 3U4YA 4J87A 2HYEA 2HESX 3DM0A 3SBRA 5EM2A 3AL8B 1VYHC 1N6DA 3UVLA 3PVUB 3ULEC 4ERQA 3MKSB 4J0WA 4OWRA 5H14A 3MZKA 1JMXB 3MZLA 4L1QD 2O9KA 4A7JA 4ES0A 4AEZA 3PSCB 3ODTA 4QRJA 3JZNA 1GOTB 2YNOA 3IIYA 4J8BA 3SBPA 3UR4A 4PC0A 2P9NC 3N0DA 4O3UB 3I7NA 5HE3B 3GFCA 4FB1D 3V5WB 5CYKB 4CY3A 2VDQB 4J8GA 4JSNC 4JT5C 1B9YA 3UVNA 4K3ID 5I5MA 4N14A 3PSLA 3VH0A 3IJ0A 3RN0D 1XHMA 4CI1A 1PI6A 4XEIC 4GQBB 4PBYA 2PM9A 1SQ9A 2P26A 1S4UX 2H68A 4BUJC 2CN2A 2VDOB 1JJUB 1U8CB 2UZXB 3VI3B 5FKSA 3KRWB 3DSMA 5CXBB 4OZUA 4FAND 2I3SA 2H9MA 3BWSA 3PXSD 5EMLB 4LG8A 4D0KA 2XYIA 2P9PC 4YVDA 2EBSA 1R5MA 2G99A 4JSVC 4E5ZB 3PE7A 4UM9B 4I79A 2AH0A 5CYKA 2J55H 3T3PB 2P9LC 3F3GA 2H9PA 3DXMC 3L4OD 5EAMA 4CY5A 2VDKB 5E6SB 3J80g 2IWFA 2AGZA 3SN6B 4KFMB 5FQDA 2HJ4A 5FKQA 5EMMB 4HDJA 2Z2PA 3JAMg 5C2VB 5IJ7E 2Z2OA 3UKRC 3NVNA 4QT8A 4Z7OB 5HDBB 4UI9R 4J81A 2G9AA 2CNXA 5HE2B 4Y5RD 2H6NA 5HQGA 5IJ8E 2B4EA 3C5MA 4WK2B 3C99A 1TYEB 3NIGB 2TRCB 5CXBA 4J84A 3V7DB 5IGOA 3FCUB 2H6KA 2BCJB 4CI2A 4U7AA 3SMRA 3FGBA 3N0EA 3RFHA 4GZ8A 4CC9A 4K3JB 3EWEA 1U2VC 3F3FA 5HE0B 3HFQA 3I7LA 3L4MD 4A09B 5GXIA 4J78A 2OVQB 2IUQA 1PBYB 4U1EI 5EAPA 1NEXB 3BG0A 3DXKC 4E5ZA 4J73A 4FHLA 4A09A 2IUVA 3I7HA 4GM8A 4A0BB 5GMKn 2I0TA 4LG9A 4X60B 4UM9D 3RFGA 2YMUA 4JSPC 4GGCA 4FWWA 4TZ4A 2GC4A 1JMZB 4ERZA 3NIDB 3AL9A 2H47A 3EI3B 3SXTD 3EI4B 3EMHA 3I89A 5GXHA 5TEEA 3VGZA 1Q47A 3RMZD 3PXWD 1L0QA 2YBAA 2J57G 3RRMC 5B4WA 3PVWB 3SHFA 2YNPA 5K1CC 3IIWA 4X63B 4J82A 2HKMA 3EI2B 2AGYA 2VDMB 1GG2B 4CY2A 1SSLA 2I0SA 2CE8A 1NR0A 3I2NA 4Z7QB 3IJCA 3UVMA 5EARA 3JB9L 4FA4D 2AGWA 4A0BA 2OIZA 2XL2A 4J79A 3RSEC 2Z2NA 4WJKB 3FRXA 4A2LA 2VDLB 3DWLC 3I8EA 3SLED 1TYQC 1A0RB 5THAA 4GGDA 2H13A 4GQ2P 5C2WB 4O9DA 3ZE0B 5FKTA 3OW8A 4O1QD
chains in the Genus database with same CATH superfamily
2HU5A 3EI3A 3ZDXB 3EI4A 4ZN4A 4PNKB 2P9KC 4ESGA 1A12A 1H2ZA 4PBZA 1PGUA 5AFU3 3EQ8A 4IA9A 5FA5B 5SXMA 3MUOA 2Q7QA 4BH6A 1O6FA 3OL2B 4G56B 4FAVD 5H1MA 1VZ3A 4ZOVA 2YNNA 3EI2A 4UM8B 2OVRB 2AGLA 4L3GD 1BPOA 3EI1A 3KCIA 4CZYA 4ZOZA 5JWZA 4D6VA 3B7FA 3K26A 2VDMA 1MG3A 5FFGA 1YUKA 2CN3A 1OMWB 4GQ1A 5FXYA 5E6UB 2P28A 3T3MB 3ZE1B 1GOFA 3V4VA 4X3EA 2UZYB 3VA6A 3SCYA 3JROA 3EU7A 4Z7QA 2AGXA 4PSWB 2GNQA 3IUJA 4LGNA 5I5JA 4WK4B 3NIFB 4J77A 1SHYB 4FA5D 4WK0B 2QZPA 2JKXA 3QHYB 4MK0B 4WJKA 5IGQA 2VDLA 5KDOB 2AH1A 2H9NA 5AJAA 4IMMA 2HJBA 4ZOYA 3UVKA 3ZE0A 3CFVA 4BL0A 1FWXA 2HKRA 5IC7A 5E6RB 4GM3A 3JRPA 2P9SC 3ZWLB 3RLMD 5TF2A 1P22A 1QFMA 1XIPA 2PM6B 3CFSB 3ORVD 4JSXC 3O4JA 2CO0C 4Z7NB 2PM7B 1E5TA 2H6QA 2VDNB 3OL2A 2OJYA 2HXCA 4ERYA 3FM0A 1B9XA 4MMYA 5A2Qg 4UM8A 5I5IA 3SJLD 5FLXg 2OVPB 1MDAH 5CXCB 4A11A 3OKTA 5FKRA 4H5IA 3IJ1A 4D9SA 2VC2B 5E6UA 3T3MA 3K71A 1TBGA 3ZE1A 4E54B 4R7AB 3AFCA 4O2WA 1MG2A 4QQEA 3ZE2B 2PBIB 4A08A 3EI1B 1N6FA 3IKOA 2I3TA 1C9LA 3E0CA 3SBQA 2OK6A 4BCCA 4Z8LA 1QFSA 2CE9A 2IWKA 4WK4A 3NIFA 3SWSD 5M5RA 3P4FA 5M5VA 3ZDZB 1ERJA 2EIBA 5TEFA 4GGAA 4WK0A 3OKYB 2HU8A 4J86A 5M5TA 3V9FA 2J56H 5M5SA 2B5NA 3SVWD 3JZGA 3MKQA 3VI4B 1XKSA 2CO0A 3C75H 4JXMA 5EALA 1UOPA 3MXXA 3J81g 1E8MA 3NVQA 5E6RA 3AH8B 2IUPA 3C9CA 5IT9g 4A0AB 3ZDYB 5H17A 4CI8A 3AL8A 3KRXB 4AMYA 3PXTD 5C86A 4CZXA 4XYHA 4XYIA 1GP2B 2VDNA 3GREA 3K72A 2IAAA 2XL3A 3RN1D 2H14A 5EM2B 2QC5A 2B5MA 2EIDA 5EMKB 2B5LA 1GOHA 4AX4A 4AOWA 4FA1D 5CXCA 2H9LA 2I0RA 4JD2C 3UVOA 2VC2A 4L9OA 2P9UC 4AMZA 5GSAA 2JWGA 4E54A 5HYNB 3F3PA 1SQJA 3CIKB 5TDHB 4H5JA 3K27A 4ZOXA 3OKWA 2MTAH 3ZE2A 2OK4A 1RI6A 4BCDA 5K19A 3NVXA 3I8CA 3JZHA 1K8KC 2VDPB 4JT6C 3JPXA 3UKUC 1GXRA 1JOFA 4PXWA 4A11B 5EMJB 3ZDZA 2QXVA 4Y7RA 2W18A 2AQ5A 3OKYA 4NSXA 1PEVA 4QL1A 2XU7A 1OLZA 3OTTA 4DNVA 4A08B 4CY1A 2YB8B 4O3TB 3VI4A 4CI3A 1YFQA 2GC7A 3SFZA 3K6SA 3EG6A 4GM9A 1U4CA 2P9IC 4RE5A 1N6EA 4X61B 2IURA 1UOOA 3IURA 3W15A 3QI0A 2HU7A 4L3HD 4O45A 4FA9D 1K32A 1QNIA 2BBKH 2VDOA 3I7OA 3MMYA 3ZDYA 4A2MA 4A0AA 5C9ZB 3A0FA 1C9IA 3I7PA 4PSXB 2H3XA 5HE1B 3BG1A 3I7KA 4J0XA 4EWRA 2PM9B 2EIEA 2VDRB 5AMSA 4GMBA 4CZVA 3U4YA 4J87A 1VE6A 2HYEA 2HESX 3DM0A 4NBMA 3SBRA 5EM2A 3AL8B 1VYHC 4L1MA 1N6DA 3UVLA 3IVMA 3PVUB 3ULEC 1YR2A 4RE6A 4ERQA 3MKSB 4J0WA 4OWRA 5H14A 3MZKA 1JMXB 3MZLA 1L5GA 4L1QD 2O9KA 4UM9A 4A7JA 4ES0A 4AEZA 3PSCB 3ODTA 4O02A 2VDPA 4QRJA 3JZNA 1GOTB 2YNOA 3IIYA 4J8BA 2VDKA 3SBPA 3UR4A 4PC0A 2P9NC 4BCBA 3N0DA 4O3UB 3I7NA 5HE3B 3GFCA 2WQ8A 4MMZA 4FB1D 3V5WB 5CYKB 4G55A 4CY3A 2VDQB 4J8GA 2QR5A 3IULA 4JSNC 2XDWA 1B9YA 4JT5C 3UVNA 4K3ID 1E8NA 5I5MA 4N14A 3PSLA 3VH0A 3IJ0A 3RN0D 2VZ3A 1XHMA 4DNWA 4CI1A 1H2WA 1PI6A 3NIGA 4XEIC 4GQBB 4PBYA 2PM9A 1SQ9A 3GC3B 2P26A 2VDRA 1S4UX 1UTCA 2H68A 3IUNA 4BUJC 4AN0A 2CN2A 2VDOB 3MVDK 4JHPC 1JJUB 2XZGA 2EICA 2UZXB 5FFOA 1U8CB 3VI3B 5FKSA 3KRWB 3DSMA 5CXBB 4OZUA 4FAND 2I3SA 3GD1I 3IUMA 2H9MA 3BWSA 3PXSD 2VZ1A 5EMLB 4LG8A 4D0KA 4MMXA 2XYIA 2P9PC 4YVDA 2EBSA 1R5MA 2G99A 4JSVC 4E5ZB 4JHNA 3PE7A 4UM9B 5M5UA 3NIDA 4I79A 2AH0A 5CYKA 5C92A 2J55H 3T3PB 2P9LC 3F3GA 2H9PA 2VDQA 3DXMC 3L4OD 5EAMA 4CY5A 2VDKB 3J80g 5E6SB 2IWFA 2AGZA 3IUQA 2BKLA 3SN6B 4KFMB 5FQDA 2HJ4A 4AN1A 5FKQA 5EMMB 4HDJA 2Z2PA 1T2XA 3JAMg 5C2VB 3IJEA 5IJ7E 2Z2OA 3UKRC 3NVNA 4QAMA 4QT8A 4Z7OB 3O4GA 1H2YA 5HDBB 4DNUA 1JV2A 4UI9R 4J81A 2G9AA 2CNXA 5HE2B 4Y5RD 2H6NA 5HQGA 5IJ8E 3EQ7A 4BP8A 1VE7A 2B4EA 3C5MA 1U8CA 3VI3A 4WK2B 3C99A 1TYEB 3NIGB 2TRCB 3MUNA 5CXBA 4J84A 1M1XA 3V7DB 4NC4A 5IGOA 3FCUB 2H6KA 2BCJB 4NAAA 2JWHA 4CI2A 4U7AA 3SMRA 3FGBA 1H2XA 3N0EA 3DDUA 4GZ8A 3RFHA 4K3JB 3EWEA 4CC9A 1U2VC 3F3FA 5HE0B 3HFQA 3I7LA 3L4MD 4A09B 3O4IA 5GXIA 4J78A 2OVQB 2IUQA 4G1EA 1PBYB 4U1EI 5EAPA 1NEXB 3BG0A 3DXKC 4E5ZA 3O4HA 4J73A 4FHLA 4A09A 3FCSA 2IUVA 3I7HA 4GM8A 4A0BB 5GMKn 2I0TA 4LG9A 3T3PA 3ZDXA 4X60B 5E6SA 4UM9D 1K3IA 3RFGA 2YMUA 4JSPC 4GGCA 4FWWA 4TZ4A 2GC4A 1JMZB 2XE4A 4ERZA 3NIDB 3AL9A 1I2MB 2H47A 3EI3B 3SXTD 3EI4B 3EMHA 3I89A 4Z7OA 5GXHA 5TEEA 1UOQA 3VGZA 1Q47A 5HDBA 3RMZD 3PXWD 1GOGA 1L0QA 2YBAA 2J57G 3RRMC 5B4WA 3PVWB 5M61A 3SHFA 2YNPA 5K1CC 3IIWA 4X63B 4WK2A 4J82A 2HKMA 1TYEA 3EI2B 3FCUA 3OF7A 4BP9A 2AGYA 2VDMB 1GG2B 4CY2A 1SSLA 2I0SA 2CE8A 1NR0A 4G1MA 3I2NA 4Z7QB 3EQ9A 4IRZA 3IJCA 1VZ2A 3UVMA 5EARA 3JB9L 1JTDB 4FA4D 2AGWA 1O6GA 2OIZA 4A0BA 2XL2A 4NENA 4J79A 3RSEC 2Z2NA 4WJKB 3FRXA 4A2LA 2VDLB 3DWLC 3I8EA 3SLED 1TYQC 3V4PA 1A0RB 5THAA 4GGDA 2H13A 4GQ2P 5C2WB 4O9DA 3ZE0B 5FKTA 4Z7NA 3OW8A 4O1QD
chains in the Genus database with same CATH topology
3EI3A 3ZDXB 3EI4A 4ZN4A 4PNKB 2P9KC 4ESGA 4PBZA 1PGUA 5AFU3 4IA9A 5FA5B 5SXMA 2Q7QA 4BH6A 3OL2B 4G56B 4FAVD 5H1MA 4ZOVA 2YNNA 3EI2A 4UM8B 2OVRB 2AGLA 4L3GD 3EI1A 4CZYA 4ZOZA 5JWZA 4D6VA 3B7FA 3K26A 1MG3A 1YUKA 2CN3A 1OMWB 4GQ1A 5FXYA 5E6UB 2P28A 3T3MB 3ZE1B 4X3EA 2UZYB 3VA6A 3SCYA 3JROA 3EU7A 2AGXA 4PSWB 2GNQA 4LGNA 4WK4B 5I5JA 3NIFB 4J77A 1SHYB 4FA5D 4WK0B 4MK0B 5IGQA 5KDOB 2AH1A 2H9NA 5AJAA 4IMMA 2HJBA 4ZOYA 3UVKA 3CFVA 4BL0A 1FWXA 2HKRA 5IC7A 5E6RB 4GM3A 3JRPA 2P9SC 3ZWLB 3RLMD 5TF2A 1P22A 1XIPA 2PM6B 3CFSB 3ORVD 4JSXC 2CO0C 4Z7NB 2PM7B 2H6QA 2VDNB 3OL2A 2OJYA 2HXCA 4ERYA 3FM0A 1B9XA 5A2Qg 5I5IA 3SJLD 5FLXg 2OVPB 1MDAH 5CXCB 4A11A 3OKTA 5FKRA 4H5IA 3IJ1A 2VC2B 1TBGA 4E54B 4R7AB 3AFCA 1MG2A 4QQEA 3ZE2B 2PBIB 4A08A 3EI1B 1N6FA 3IKOA 2I3TA 3E0CA 3SBQA 2OK6A 4Z8LA 2CE9A 2IWKA 3SWSD 3ZDZB 3P4FA 1ERJA 5TEFA 4GGAA 3OKYB 4J86A 3V9FA 2J56H 2B5NA 3SVWD 3JZGA 3MKQA 3VI4B 1XKSA 2CO0A 3C75H 4JXMA 5EALA 3MXXA 3J81g 3NVQA 3AH8B 2IUPA 3C9CA 5IT9g 4A0AB 3ZDYB 5H17A 4CI8A 3AL8A 3KRXB 3PXTD 4CZXA 4XYHA 4XYIA 1GP2B 3GREA 2IAAA 2XL3A 3RN1D 2H14A 5EM2B 2QC5A 2B5MA 5EMKB 2B5LA 4AOWA 4FA1D 5CXCA 2H9LA 2I0RA 4JD2C 3UVOA 4L9OA 2P9UC 5GSAA 2JWGA 4E54A 5HYNB 3F3PA 1SQJA 3CIKB 5TDHB 4H5JA 3K27A 4ZOXA 3OKWA 2MTAH 2OK4A 1RI6A 5K19A 3NVXA 3I8CA 3JZHA 1K8KC 2VDPB 4JT6C 3JPXA 3UKUC 1GXRA 1JOFA 4PXWA 4A11B 5EMJB 2QXVA 4Y7RA 2W18A 2AQ5A 3OKYA 4NSXA 1PEVA 4QL1A 2XU7A 1OLZA 3OTTA 4A08B 4CY1A 2YB8B 4O3TB 4CI3A 1YFQA 2GC7A 3SFZA 3EG6A 4GM9A 1U4CA 2P9IC 1N6EA 4X61B 2IURA 3W15A 4O45A 4L3HD 4FA9D 1K32A 1QNIA 2BBKH 3MMYA 3I7OA 4A2MA 4A0AA 5C9ZB 3A0FA 3I7PA 4PSXB 2H3XA 5HE1B 3BG1A 3I7KA 4J0XA 4EWRA 2PM9B 2VDRB 5AMSA 4GMBA 4CZVA 3U4YA 4J87A 2HYEA 2HESX 3DM0A 3SBRA 5EM2A 3AL8B 1VYHC 1N6DA 3UVLA 3PVUB 3ULEC 4ERQA 3MKSB 4J0WA 4OWRA 5H14A 3MZKA 1JMXB 3MZLA 4L1QD 2O9KA 4A7JA 4ES0A 4AEZA 3PSCB 3ODTA 4QRJA 3JZNA 1GOTB 2YNOA 3IIYA 4J8BA 3SBPA 3UR4A 4PC0A 2P9NC 3N0DA 4O3UB 3I7NA 5HE3B 3GFCA 4FB1D 3V5WB 5CYKB 4CY3A 2VDQB 4J8GA 4JSNC 4JT5C 1B9YA 3UVNA 4K3ID 5I5MA 4N14A 3PSLA 3VH0A 3IJ0A 3RN0D 1XHMA 4CI1A 1PI6A 4XEIC 4GQBB 4PBYA 2PM9A 1SQ9A 2P26A 1S4UX 2H68A 4BUJC 2CN2A 2VDOB 1JJUB 1U8CB 2UZXB 3VI3B 5FKSA 3KRWB 3DSMA 5CXBB 4OZUA 4FAND 2I3SA 2H9MA 3BWSA 3PXSD 5EMLB 4LG8A 4D0KA 2XYIA 2P9PC 4YVDA 2EBSA 1R5MA 2G99A 4JSVC 4E5ZB 3PE7A 4UM9B 4I79A 2AH0A 5CYKA 2J55H 3T3PB 2P9LC 3F3GA 2H9PA 3DXMC 3L4OD 5EAMA 4CY5A 2VDKB 5E6SB 3J80g 2IWFA 2AGZA 3SN6B 4KFMB 5FQDA 2HJ4A 5FKQA 5EMMB 4HDJA 2Z2PA 3JAMg 5C2VB 5IJ7E 2Z2OA 3UKRC 3NVNA 4QT8A 4Z7OB 5HDBB 4UI9R 4J81A 2G9AA 2CNXA 5HE2B 4Y5RD 2H6NA 5HQGA 5IJ8E 2B4EA 3C5MA 4WK2B 3C99A 1TYEB 3NIGB 2TRCB 5CXBA 4J84A 3V7DB 5IGOA 3FCUB 2H6KA 2BCJB 2JWHA 4CI2A 4U7AA 3SMRA 3FGBA 3N0EA 3RFHA 4GZ8A 4CC9A 4K3JB 3EWEA 1U2VC 3F3FA 5HE0B 3HFQA 3I7LA 3L4MD 4A09B 5GXIA 4J78A 2OVQB 2IUQA 1PBYB 4U1EI 5EAPA 1NEXB 3BG0A 3DXKC 4E5ZA 4J73A 4FHLA 4A09A 2IUVA 3I7HA 4GM8A 4A0BB 5GMKn 2I0TA 4LG9A 4X60B 4UM9D 3RFGA 2YMUA 4JSPC 4GGCA 4FWWA 4TZ4A 2GC4A 1JMZB 4ERZA 3NIDB 3AL9A 2H47A 3EI3B 3SXTD 3EI4B 3EMHA 3I89A 5GXHA 5TEEA 3VGZA 1Q47A 3RMZD 3PXWD 1L0QA 2YBAA 2J57G 3RRMC 5B4WA 3PVWB 3SHFA 2YNPA 5K1CC 3IIWA 4X63B 4J82A 2HKMA 3EI2B 2AGYA 2VDMB 1GG2B 4CY2A 1SSLA 2I0SA 2CE8A 1NR0A 3I2NA 4Z7QB 3IJCA 3UVMA 5EARA 3JB9L 4FA4D 2AGWA 4A0BA 2OIZA 2XL2A 4J79A 3RSEC 2Z2NA 4WJKB 3FRXA 4A2LA 2VDLB 3DWLC 3I8EA 3SLED 1TYQC 1A0RB 5THAA 4GGDA 2H13A 4GQ2P 5C2WB 4O9DA 3ZE0B 5FKTA 3OW8A 4O1QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI3 A;  3ZDX B;  3EI4 A;  4ZN4 A;  4PNK B;  2P9K C;  4ESG A;  4PBZ A;  1PGU A;  5AFU 3;  4IA9 A;  5FA5 B;  5SXM A;  2Q7Q A;  4BH6 A;  3OL2 B;  4G56 B;  4FAV D;  5H1M A;  4ZOV A;  2YNN A;  3EI2 A;  4UM8 B;  2OVR B;  2AGL A;  4L3G D;  3EI1 A;  4CZY A;  4ZOZ A;  5JWZ A;  4D6V A;  3B7F A;  3K26 A;  1MG3 A;  1YUK A;  2CN3 A;  1OMW B;  4GQ1 A;  5FXY A;  5E6U B;  2P28 A;  3T3M B;  3ZE1 B;  4X3E A;  2UZY B;  3VA6 A;  3SCY A;  3JRO A;  3EU7 A;  2AGX A;  4PSW B;  2GNQ A;  4LGN A;  4WK4 B;  5I5J A;  3NIF B;  4J77 A;  1SHY B;  4FA5 D;  4WK0 B;  4MK0 B;  5IGQ A;  5KDO B;  2AH1 A;  2H9N A;  5AJA A;  4IMM A;  2HJB A;  4ZOY A;  3UVK A;  3CFV A;  4BL0 A;  1FWX A;  2HKR A;  5IC7 A;  5E6R B;  4GM3 A;  3JRP A;  2P9S C;  3ZWL B;  3RLM D;  5TF2 A;  1P22 A;  1XIP A;  2PM6 B;  3CFS B;  3ORV D;  4JSX C;  2CO0 C;  4Z7N B;  2PM7 B;  2H6Q A;  2VDN B;  3OL2 A;  2OJY A;  2HXC A;  4ERY A;  3FM0 A;  1B9X A;  5A2Q g;  5I5I A;  3SJL D;  5FLX g;  2OVP B;  1MDA H;  5CXC B;  4A11 A;  3OKT A;  5FKR A;  4H5I A;  3IJ1 A;  2VC2 B;  1TBG A;  4E54 B;  4R7A B;  3AFC A;  1MG2 A;  4QQE A;  3ZE2 B;  2PBI B;  4A08 A;  3EI1 B;  1N6F A;  3IKO A;  2I3T A;  3E0C A;  3SBQ A;  2OK6 A;  4Z8L A;  2CE9 A;  2IWK A;  3SWS D;  3ZDZ B;  3P4F A;  1ERJ A;  5TEF A;  4GGA A;  3OKY B;  4J86 A;  3V9F A;  2J56 H;  2B5N A;  3SVW D;  3JZG A;  3MKQ A;  3VI4 B;  1XKS A;  2CO0 A;  3C75 H;  4JXM A;  5EAL A;  3MXX A;  3J81 g;  3NVQ A;  3AH8 B;  2IUP A;  3C9C A;  5IT9 g;  4A0A B;  3ZDY B;  5H17 A;  4CI8 A;  3AL8 A;  3KRX B;  3PXT D;  4CZX A;  4XYH A;  4XYI A;  1GP2 B;  3GRE A;  2IAA A;  2XL3 A;  3RN1 D;  2H14 A;  5EM2 B;  2QC5 A;  2B5M A;  5EMK B;  2B5L A;  4AOW A;  4FA1 D;  5CXC A;  2H9L A;  2I0R A;  4JD2 C;  3UVO A;  4L9O A;  2P9U C;  5GSA A;  4E54 A;  5HYN B;  3F3P A;  1SQJ A;  3CIK B;  5TDH B;  4H5J A;  3K27 A;  4ZOX A;  3OKW A;  2MTA H;  2OK4 A;  1RI6 A;  5K19 A;  3NVX A;  3I8C A;  3JZH A;  1K8K C;  2VDP B;  4JT6 C;  3JPX A;  3UKU C;  1GXR A;  1JOF A;  4PXW A;  4A11 B;  5EMJ B;  2QXV A;  4Y7R A;  2W18 A;  2AQ5 A;  3OKY A;  4NSX A;  1PEV A;  4QL1 A;  2XU7 A;  1OLZ A;  3OTT A;  4A08 B;  4CY1 A;  2YB8 B;  4O3T B;  4CI3 A;  1YFQ A;  2GC7 A;  3SFZ A;  3EG6 A;  4GM9 A;  1U4C A;  2P9I C;  1N6E A;  4X61 B;  2IUR A;  3W15 A;  4O45 A;  4L3H D;  4FA9 D;  1K32 A;  1QNI A;  2BBK H;  3MMY A;  3I7O A;  4A2M A;  4A0A A;  5C9Z B;  3A0F A;  3I7P A;  4PSX B;  2H3X A;  5HE1 B;  3BG1 A;  3I7K A;  4J0X A;  4EWR A;  2PM9 B;  2VDR B;  5AMS A;  4GMB A;  4CZV A;  3U4Y A;  4J87 A;  2HYE A;  2HES X;  3DM0 A;  3SBR A;  5EM2 A;  3AL8 B;  1VYH C;  1N6D A;  3UVL A;  3PVU B;  3ULE C;  4ERQ A;  3MKS B;  4J0W A;  4OWR A;  5H14 A;  3MZK A;  1JMX B;  3MZL A;  4L1Q D;  2O9K A;  4A7J A;  4ES0 A;  4AEZ A;  3PSC B;  3ODT A;  4QRJ A;  3JZN A;  1GOT B;  2YNO A;  3IIY A;  4J8B A;  3SBP A;  3UR4 A;  4PC0 A;  2P9N C;  3N0D A;  4O3U B;  3I7N A;  5HE3 B;  3GFC A;  4FB1 D;  3V5W B;  5CYK B;  4CY3 A;  2VDQ B;  4J8G A;  4JSN C;  4JT5 C;  1B9Y A;  3UVN A;  4K3I D;  5I5M A;  4N14 A;  3PSL A;  3VH0 A;  3IJ0 A;  3RN0 D;  1XHM A;  4CI1 A;  1PI6 A;  4XEI C;  4GQB B;  4PBY A;  2PM9 A;  1SQ9 A;  2P26 A;  1S4U X;  2H68 A;  4BUJ C;  2CN2 A;  2VDO B;  1JJU B;  1U8C B;  2UZX B;  3VI3 B;  5FKS A;  3KRW B;  3DSM A;  5CXB B;  4OZU A;  4FAN D;  2I3S A;  2H9M A;  3BWS A;  3PXS D;  5EML B;  4LG8 A;  4D0K A;  2XYI A;  2P9P C;  4YVD A;  2EBS A;  1R5M A;  2G99 A;  4JSV C;  4E5Z B;  3PE7 A;  4UM9 B;  4I79 A;  2AH0 A;  5CYK A;  2J55 H;  3T3P B;  2P9L C;  3F3G A;  2H9P A;  3DXM C;  3L4O D;  5EAM A;  4CY5 A;  2VDK B;  5E6S B;  3J80 g;  2IWF A;  2AGZ A;  3SN6 B;  4KFM B;  5FQD A;  2HJ4 A;  5FKQ A;  5EMM B;  4HDJ A;  2Z2P A;  3JAM g;  5C2V B;  5IJ7 E;  2Z2O A;  3UKR C;  3NVN A;  4QT8 A;  4Z7O B;  5HDB B;  4UI9 R;  4J81 A;  2G9A A;  2CNX A;  5HE2 B;  4Y5R D;  2H6N A;  5HQG A;  5IJ8 E;  2B4E A;  3C5M A;  4WK2 B;  3C99 A;  1TYE B;  3NIG B;  2TRC B;  5CXB A;  4J84 A;  3V7D B;  5IGO A;  3FCU B;  2H6K A;  2BCJ B;  4CI2 A;  4U7A A;  3SMR A;  3FGB A;  3N0E A;  3RFH A;  4GZ8 A;  4CC9 A;  4K3J B;  3EWE A;  1U2V C;  3F3F A;  5HE0 B;  3HFQ A;  3I7L A;  3L4M D;  4A09 B;  5GXI A;  4J78 A;  2OVQ B;  2IUQ A;  1PBY B;  4U1E I;  5EAP A;  1NEX B;  3BG0 A;  3DXK C;  4E5Z A;  4J73 A;  4FHL A;  4A09 A;  2IUV A;  3I7H A;  4GM8 A;  4A0B B;  5GMK n;  2I0T A;  4LG9 A;  4X60 B;  4UM9 D;  3RFG A;  2YMU A;  4JSP C;  4GGC A;  4FWW A;  4TZ4 A;  2GC4 A;  1JMZ B;  4ERZ A;  3NID B;  3AL9 A;  2H47 A;  3EI3 B;  3SXT D;  3EI4 B;  3EMH A;  3I89 A;  5GXH A;  5TEE A;  3VGZ A;  1Q47 A;  3RMZ D;  3PXW D;  1L0Q A;  2YBA A;  2J57 G;  3RRM C;  5B4W A;  3PVW B;  3SHF A;  2YNP A;  5K1C C;  3IIW A;  4X63 B;  4J82 A;  2HKM A;  3EI2 B;  2AGY A;  2VDM B;  1GG2 B;  4CY2 A;  1SSL A;  2I0S A;  2CE8 A;  1NR0 A;  3I2N A;  4Z7Q B;  3IJC A;  3UVM A;  5EAR A;  3JB9 L;  4FA4 D;  2AGW A;  4A0B A;  2OIZ A;  2XL2 A;  4J79 A;  3RSE C;  2Z2N A;  4WJK B;  3FRX A;  4A2L A;  2VDL B;  3DWL C;  3I8E A;  3SLE D;  1TYQ C;  1A0R B;  5THA A;  4GGD A;  2H13 A;  4GQ2 P;  5C2W B;  4O9D A;  3ZE0 B;  5FKT A;  3OW8 A;  4O1Q D; 
#chains in the Genus database with same CATH topology
 2HU5 A;  3EI3 A;  3ZDX B;  3EI4 A;  4ZN4 A;  4PNK B;  2P9K C;  4ESG A;  1A12 A;  1H2Z A;  4PBZ A;  1PGU A;  5AFU 3;  3EQ8 A;  4IA9 A;  5FA5 B;  5SXM A;  3MUO A;  2Q7Q A;  4BH6 A;  1O6F A;  3OL2 B;  4G56 B;  4FAV D;  5H1M A;  1VZ3 A;  4ZOV A;  2YNN A;  3EI2 A;  4UM8 B;  2OVR B;  2AGL A;  4L3G D;  1BPO A;  3EI1 A;  3KCI A;  4CZY A;  4ZOZ A;  5JWZ A;  4D6V A;  3B7F A;  3K26 A;  2VDM A;  1MG3 A;  5FFG A;  1YUK A;  2CN3 A;  1OMW B;  4GQ1 A;  5FXY A;  5E6U B;  2P28 A;  3T3M B;  3ZE1 B;  1GOF A;  3V4V A;  4X3E A;  2UZY B;  3VA6 A;  3SCY A;  3JRO A;  3EU7 A;  4Z7Q A;  2AGX A;  4PSW B;  2GNQ A;  3IUJ A;  4LGN A;  5I5J A;  4WK4 B;  3NIF B;  4J77 A;  1SHY B;  4FA5 D;  4WK0 B;  2QZP A;  2JKX A;  3QHY B;  4MK0 B;  4WJK A;  5IGQ A;  2VDL A;  5KDO B;  2AH1 A;  2H9N A;  5AJA A;  4IMM A;  2HJB A;  4ZOY A;  3UVK A;  3ZE0 A;  3CFV A;  4BL0 A;  1FWX A;  2HKR A;  5IC7 A;  5E6R B;  4GM3 A;  3JRP A;  2P9S C;  3ZWL B;  3RLM D;  5TF2 A;  1P22 A;  1QFM A;  1XIP A;  2PM6 B;  3CFS B;  3ORV D;  4JSX C;  3O4J A;  2CO0 C;  4Z7N B;  2PM7 B;  1E5T A;  2H6Q A;  2VDN B;  3OL2 A;  2OJY A;  2HXC A;  4ERY A;  3FM0 A;  1B9X A;  4MMY A;  5A2Q g;  4UM8 A;  5I5I A;  3SJL D;  5FLX g;  2OVP B;  1MDA H;  5CXC B;  4A11 A;  3OKT A;  5FKR A;  4H5I A;  3IJ1 A;  4D9S A;  2VC2 B;  5E6U A;  3T3M A;  3K71 A;  1TBG A;  3ZE1 A;  4E54 B;  4R7A B;  3AFC A;  4O2W A;  1MG2 A;  4QQE A;  3ZE2 B;  2PBI B;  4A08 A;  3EI1 B;  1N6F A;  3IKO A;  2I3T A;  1C9L A;  3E0C A;  3SBQ A;  2OK6 A;  4BCC A;  4Z8L A;  1QFS A;  2CE9 A;  2IWK A;  4WK4 A;  3NIF A;  3SWS D;  5M5R A;  3P4F A;  5M5V A;  3ZDZ B;  1ERJ A;  2EIB A;  5TEF A;  4GGA A;  4WK0 A;  3OKY B;  2HU8 A;  4J86 A;  5M5T A;  3V9F A;  2J56 H;  5M5S A;  2B5N A;  3SVW D;  3JZG A;  3MKQ A;  3VI4 B;  1XKS A;  2CO0 A;  3C75 H;  4JXM A;  5EAL A;  1UOP A;  3MXX A;  3J81 g;  1E8M A;  3NVQ A;  5E6R A;  3AH8 B;  2IUP A;  3C9C A;  5IT9 g;  4A0A B;  3ZDY B;  5H17 A;  4CI8 A;  3AL8 A;  3KRX B;  4AMY A;  3PXT D;  5C86 A;  4CZX A;  4XYH A;  4XYI A;  1GP2 B;  2VDN A;  3GRE A;  3K72 A;  2IAA A;  2XL3 A;  3RN1 D;  2H14 A;  5EM2 B;  2QC5 A;  2B5M A;  2EID A;  5EMK B;  2B5L A;  1GOH A;  4AX4 A;  4AOW A;  4FA1 D;  5CXC A;  2H9L A;  2I0R A;  4JD2 C;  3UVO A;  2VC2 A;  4L9O A;  2P9U C;  4AMZ A;  5GSA A;  2JWG A;  4E54 A;  5HYN B;  3F3P A;  1SQJ A;  3CIK B;  5TDH B;  4H5J A;  3K27 A;  4ZOX A;  3OKW A;  2MTA H;  3ZE2 A;  2OK4 A;  1RI6 A;  4BCD A;  5K19 A;  3NVX A;  3I8C A;  3JZH A;  1K8K C;  2VDP B;  4JT6 C;  3JPX A;  3UKU C;  1GXR A;  1JOF A;  4PXW A;  4A11 B;  5EMJ B;  3ZDZ A;  2QXV A;  4Y7R A;  2W18 A;  2AQ5 A;  3OKY A;  4NSX A;  1PEV A;  4QL1 A;  2XU7 A;  1OLZ A;  3OTT A;  4DNV A;  4A08 B;  4CY1 A;  2YB8 B;  4O3T B;  3VI4 A;  4CI3 A;  1YFQ A;  2GC7 A;  3SFZ A;  3K6S A;  3EG6 A;  4GM9 A;  1U4C A;  2P9I C;  4RE5 A;  1N6E A;  4X61 B;  2IUR A;  1UOO A;  3IUR A;  3W15 A;  3QI0 A;  2HU7 A;  4L3H D;  4O45 A;  4FA9 D;  1K32 A;  1QNI A;  2BBK H;  2VDO A;  3I7O A;  3MMY A;  3ZDY A;  4A2M A;  4A0A A;  5C9Z B;  3A0F A;  1C9I A;  3I7P A;  4PSX B;  2H3X A;  5HE1 B;  3BG1 A;  3I7K A;  4J0X A;  4EWR A;  2PM9 B;  2EIE A;  2VDR B;  5AMS A;  4GMB A;  4CZV A;  3U4Y A;  4J87 A;  1VE6 A;  2HYE A;  2HES X;  3DM0 A;  4NBM A;  3SBR A;  5EM2 A;  3AL8 B;  1VYH C;  4L1M A;  1N6D A;  3UVL A;  3IVM A;  3PVU B;  3ULE C;  1YR2 A;  4RE6 A;  4ERQ A;  3MKS B;  4J0W A;  4OWR A;  5H14 A;  3MZK A;  1JMX B;  3MZL A;  1L5G A;  4L1Q D;  2O9K A;  4UM9 A;  4A7J A;  4ES0 A;  4AEZ A;  3PSC B;  3ODT A;  4O02 A;  2VDP A;  4QRJ A;  3JZN A;  1GOT B;  2YNO A;  3IIY A;  4J8B A;  2VDK A;  3SBP A;  3UR4 A;  4PC0 A;  2P9N C;  4BCB A;  3N0D A;  4O3U B;  3I7N A;  5HE3 B;  3GFC A;  2WQ8 A;  4MMZ A;  4FB1 D;  3V5W B;  5CYK B;  4G55 A;  4CY3 A;  2VDQ B;  4J8G A;  2QR5 A;  3IUL A;  4JSN C;  2XDW A;  1B9Y A;  4JT5 C;  3UVN A;  4K3I D;  1E8N A;  5I5M A;  4N14 A;  3PSL A;  3VH0 A;  3IJ0 A;  3RN0 D;  2VZ3 A;  1XHM A;  4DNW A;  4CI1 A;  1H2W A;  1PI6 A;  3NIG A;  4XEI C;  4GQB B;  4PBY A;  2PM9 A;  1SQ9 A;  3GC3 B;  2P26 A;  2VDR A;  1S4U X;  1UTC A;  2H68 A;  3IUN A;  4BUJ C;  4AN0 A;  2CN2 A;  2VDO B;  3MVD K;  4JHP C;  1JJU B;  2XZG A;  2EIC A;  2UZX B;  5FFO A;  1U8C B;  3VI3 B;  5FKS A;  3KRW B;  3DSM A;  5CXB B;  4OZU A;  4FAN D;  2I3S A;  3GD1 I;  3IUM A;  2H9M A;  3BWS A;  3PXS D;  2VZ1 A;  5EML B;  4LG8 A;  4D0K A;  4MMX A;  2XYI A;  2P9P C;  4YVD A;  2EBS A;  1R5M A;  2G99 A;  4JSV C;  4E5Z B;  4JHN A;  3PE7 A;  4UM9 B;  5M5U A;  3NID A;  4I79 A;  2AH0 A;  5CYK A;  5C92 A;  2J55 H;  3T3P B;  2P9L C;  3F3G A;  2H9P A;  2VDQ A;  3DXM C;  3L4O D;  5EAM A;  4CY5 A;  2VDK B;  3J80 g;  5E6S B;  2IWF A;  2AGZ A;  3IUQ A;  2BKL A;  3SN6 B;  4KFM B;  5FQD A;  2HJ4 A;  4AN1 A;  5FKQ A;  5EMM B;  4HDJ A;  2Z2P A;  1T2X A;  3JAM g;  5C2V B;  3IJE A;  5IJ7 E;  2Z2O A;  3UKR C;  3NVN A;  4QAM A;  4QT8 A;  4Z7O B;  3O4G A;  1H2Y A;  5HDB B;  4DNU A;  1JV2 A;  4UI9 R;  4J81 A;  2G9A A;  2CNX A;  5HE2 B;  4Y5R D;  2H6N A;  5HQG A;  5IJ8 E;  3EQ7 A;  4BP8 A;  1VE7 A;  2B4E A;  3C5M A;  1U8C A;  3VI3 A;  4WK2 B;  3C99 A;  1TYE B;  3NIG B;  2TRC B;  3MUN A;  5CXB A;  4J84 A;  1M1X A;  3V7D B;  4NC4 A;  5IGO A;  3FCU B;  2H6K A;  2BCJ B;  4NAA A;  2JWH A;  4CI2 A;  4U7A A;  3SMR A;  3FGB A;  1H2X A;  3N0E A;  3DDU A;  4GZ8 A;  3RFH A;  4K3J B;  3EWE A;  4CC9 A;  1U2V C;  3F3F A;  5HE0 B;  3HFQ A;  3I7L A;  3L4M D;  4A09 B;  3O4I A;  5GXI A;  4J78 A;  2OVQ B;  2IUQ A;  4G1E A;  1PBY B;  4U1E I;  5EAP A;  1NEX B;  3BG0 A;  3DXK C;  4E5Z A;  3O4H A;  4J73 A;  4FHL A;  4A09 A;  3FCS A;  2IUV A;  3I7H A;  4GM8 A;  4A0B B;  5GMK n;  2I0T A;  4LG9 A;  3T3P A;  3ZDX A;  4X60 B;  5E6S A;  4UM9 D;  1K3I A;  3RFG A;  2YMU A;  4JSP C;  4GGC A;  4FWW A;  4TZ4 A;  2GC4 A;  1JMZ B;  2XE4 A;  4ERZ A;  3NID B;  3AL9 A;  1I2M B;  2H47 A;  3EI3 B;  3SXT D;  3EI4 B;  3EMH A;  3I89 A;  4Z7O A;  5GXH A;  5TEE A;  1UOQ A;  3VGZ A;  1Q47 A;  5HDB A;  3RMZ D;  3PXW D;  1GOG A;  1L0Q A;  2YBA A;  2J57 G;  3RRM C;  5B4W A;  3PVW B;  5M61 A;  3SHF A;  2YNP A;  5K1C C;  3IIW A;  4X63 B;  4WK2 A;  4J82 A;  2HKM A;  1TYE A;  3EI2 B;  3FCU A;  3OF7 A;  4BP9 A;  2AGY A;  2VDM B;  1GG2 B;  4CY2 A;  1SSL A;  2I0S A;  2CE8 A;  1NR0 A;  4G1M A;  3I2N A;  4Z7Q B;  3EQ9 A;  4IRZ A;  3IJC A;  1VZ2 A;  3UVM A;  5EAR A;  3JB9 L;  1JTD B;  4FA4 D;  2AGW A;  1O6G A;  2OIZ A;  4A0B A;  2XL2 A;  4NEN A;  4J79 A;  3RSE C;  2Z2N A;  4WJK B;  3FRX A;  4A2L A;  2VDL B;  3DWL C;  3I8E A;  3SLE D;  1TYQ C;  3V4P A;  1A0R B;  5THA A;  4GGD A;  2H13 A;  4GQ2 P;  5C2W B;  4O9D A;  3ZE0 B;  5FKT A;  4Z7N A;  3OW8 A;  4O1Q D; 
#chains in the Genus database with same CATH homology
 3EI3 A;  3ZDX B;  3EI4 A;  4ZN4 A;  4PNK B;  2P9K C;  4ESG A;  4PBZ A;  1PGU A;  5AFU 3;  4IA9 A;  5FA5 B;  5SXM A;  2Q7Q A;  4BH6 A;  3OL2 B;  4G56 B;  4FAV D;  5H1M A;  4ZOV A;  2YNN A;  3EI2 A;  4UM8 B;  2OVR B;  2AGL A;  4L3G D;  3EI1 A;  4CZY A;  4ZOZ A;  5JWZ A;  4D6V A;  3B7F A;  3K26 A;  1MG3 A;  1YUK A;  2CN3 A;  1OMW B;  4GQ1 A;  5FXY A;  5E6U B;  2P28 A;  3T3M B;  3ZE1 B;  4X3E A;  2UZY B;  3VA6 A;  3SCY A;  3JRO A;  3EU7 A;  2AGX A;  4PSW B;  2GNQ A;  4LGN A;  4WK4 B;  5I5J A;  3NIF B;  4J77 A;  1SHY B;  4FA5 D;  4WK0 B;  4MK0 B;  5IGQ A;  5KDO B;  2AH1 A;  2H9N A;  5AJA A;  4IMM A;  2HJB A;  4ZOY A;  3UVK A;  3CFV A;  4BL0 A;  1FWX A;  2HKR A;  5IC7 A;  5E6R B;  4GM3 A;  3JRP A;  2P9S C;  3ZWL B;  3RLM D;  5TF2 A;  1P22 A;  1XIP A;  2PM6 B;  3CFS B;  3ORV D;  4JSX C;  2CO0 C;  4Z7N B;  2PM7 B;  2H6Q A;  2VDN B;  3OL2 A;  2OJY A;  2HXC A;  4ERY A;  3FM0 A;  1B9X A;  5A2Q g;  5I5I A;  3SJL D;  5FLX g;  2OVP B;  1MDA H;  5CXC B;  4A11 A;  3OKT A;  5FKR A;  4H5I A;  3IJ1 A;  2VC2 B;  1TBG A;  4E54 B;  4R7A B;  3AFC A;  1MG2 A;  4QQE A;  3ZE2 B;  2PBI B;  4A08 A;  3EI1 B;  1N6F A;  3IKO A;  2I3T A;  3E0C A;  3SBQ A;  2OK6 A;  4Z8L A;  2CE9 A;  2IWK A;  3SWS D;  3ZDZ B;  3P4F A;  1ERJ A;  5TEF A;  4GGA A;  3OKY B;  4J86 A;  3V9F A;  2J56 H;  2B5N A;  3SVW D;  3JZG A;  3MKQ A;  3VI4 B;  1XKS A;  2CO0 A;  3C75 H;  4JXM A;  5EAL A;  3MXX A;  3J81 g;  3NVQ A;  3AH8 B;  2IUP A;  3C9C A;  5IT9 g;  4A0A B;  3ZDY B;  5H17 A;  4CI8 A;  3AL8 A;  3KRX B;  3PXT D;  4CZX A;  4XYH A;  4XYI A;  1GP2 B;  3GRE A;  2IAA A;  2XL3 A;  3RN1 D;  2H14 A;  5EM2 B;  2QC5 A;  2B5M A;  5EMK B;  2B5L A;  4AOW A;  4FA1 D;  5CXC A;  2H9L A;  2I0R A;  4JD2 C;  3UVO A;  4L9O A;  2P9U C;  5GSA A;  2JWG A;  4E54 A;  5HYN B;  3F3P A;  1SQJ A;  3CIK B;  5TDH B;  4H5J A;  3K27 A;  4ZOX A;  3OKW A;  2MTA H;  2OK4 A;  1RI6 A;  5K19 A;  3NVX A;  3I8C A;  3JZH A;  1K8K C;  2VDP B;  4JT6 C;  3JPX A;  3UKU C;  1GXR A;  1JOF A;  4PXW A;  4A11 B;  5EMJ B;  2QXV A;  4Y7R A;  2W18 A;  2AQ5 A;  3OKY A;  4NSX A;  1PEV A;  4QL1 A;  2XU7 A;  1OLZ A;  3OTT A;  4A08 B;  4CY1 A;  2YB8 B;  4O3T B;  4CI3 A;  1YFQ A;  2GC7 A;  3SFZ A;  3EG6 A;  4GM9 A;  1U4C A;  2P9I C;  1N6E A;  4X61 B;  2IUR A;  3W15 A;  4O45 A;  4L3H D;  4FA9 D;  1K32 A;  1QNI A;  2BBK H;  3MMY A;  3I7O A;  4A2M A;  4A0A A;  5C9Z B;  3A0F A;  3I7P A;  4PSX B;  2H3X A;  5HE1 B;  3BG1 A;  3I7K A;  4J0X A;  4EWR A;  2PM9 B;  2VDR B;  5AMS A;  4GMB A;  4CZV A;  3U4Y A;  4J87 A;  2HYE A;  2HES X;  3DM0 A;  3SBR A;  5EM2 A;  3AL8 B;  1VYH C;  1N6D A;  3UVL A;  3PVU B;  3ULE C;  4ERQ A;  3MKS B;  4J0W A;  4OWR A;  5H14 A;  3MZK A;  1JMX B;  3MZL A;  4L1Q D;  2O9K A;  4A7J A;  4ES0 A;  4AEZ A;  3PSC B;  3ODT A;  4QRJ A;  3JZN A;  1GOT B;  2YNO A;  3IIY A;  4J8B A;  3SBP A;  3UR4 A;  4PC0 A;  2P9N C;  3N0D A;  4O3U B;  3I7N A;  5HE3 B;  3GFC A;  4FB1 D;  3V5W B;  5CYK B;  4CY3 A;  2VDQ B;  4J8G A;  4JSN C;  4JT5 C;  1B9Y A;  3UVN A;  4K3I D;  5I5M A;  4N14 A;  3PSL A;  3VH0 A;  3IJ0 A;  3RN0 D;  1XHM A;  4CI1 A;  1PI6 A;  4XEI C;  4GQB B;  4PBY A;  2PM9 A;  1SQ9 A;  2P26 A;  1S4U X;  2H68 A;  4BUJ C;  2CN2 A;  2VDO B;  1JJU B;  1U8C B;  2UZX B;  3VI3 B;  5FKS A;  3KRW B;  3DSM A;  5CXB B;  4OZU A;  4FAN D;  2I3S A;  2H9M A;  3BWS A;  3PXS D;  5EML B;  4LG8 A;  4D0K A;  2XYI A;  2P9P C;  4YVD A;  2EBS A;  1R5M A;  2G99 A;  4JSV C;  4E5Z B;  3PE7 A;  4UM9 B;  4I79 A;  2AH0 A;  5CYK A;  2J55 H;  3T3P B;  2P9L C;  3F3G A;  2H9P A;  3DXM C;  3L4O D;  5EAM A;  4CY5 A;  2VDK B;  5E6S B;  3J80 g;  2IWF A;  2AGZ A;  3SN6 B;  4KFM B;  5FQD A;  2HJ4 A;  5FKQ A;  5EMM B;  4HDJ A;  2Z2P A;  3JAM g;  5C2V B;  5IJ7 E;  2Z2O A;  3UKR C;  3NVN A;  4QT8 A;  4Z7O B;  5HDB B;  4UI9 R;  4J81 A;  2G9A A;  2CNX A;  5HE2 B;  4Y5R D;  2H6N A;  5HQG A;  5IJ8 E;  2B4E A;  3C5M A;  4WK2 B;  3C99 A;  1TYE B;  3NIG B;  2TRC B;  5CXB A;  4J84 A;  3V7D B;  5IGO A;  3FCU B;  2H6K A;  2BCJ B;  2JWH A;  4CI2 A;  4U7A A;  3SMR A;  3FGB A;  3N0E A;  3RFH A;  4GZ8 A;  4CC9 A;  4K3J B;  3EWE A;  1U2V C;  3F3F A;  5HE0 B;  3HFQ A;  3I7L A;  3L4M D;  4A09 B;  5GXI A;  4J78 A;  2OVQ B;  2IUQ A;  1PBY B;  4U1E I;  5EAP A;  1NEX B;  3BG0 A;  3DXK C;  4E5Z A;  4J73 A;  4FHL A;  4A09 A;  2IUV A;  3I7H A;  4GM8 A;  4A0B B;  5GMK n;  2I0T A;  4LG9 A;  4X60 B;  4UM9 D;  3RFG A;  2YMU A;  4JSP C;  4GGC A;  4FWW A;  4TZ4 A;  2GC4 A;  1JMZ B;  4ERZ A;  3NID B;  3AL9 A;  2H47 A;  3EI3 B;  3SXT D;  3EI4 B;  3EMH A;  3I89 A;  5GXH A;  5TEE A;  3VGZ A;  1Q47 A;  3RMZ D;  3PXW D;  1L0Q A;  2YBA A;  2J57 G;  3RRM C;  5B4W A;  3PVW B;  3SHF A;  2YNP A;  5K1C C;  3IIW A;  4X63 B;  4J82 A;  2HKM A;  3EI2 B;  2AGY A;  2VDM B;  1GG2 B;  4CY2 A;  1SSL A;  2I0S A;  2CE8 A;  1NR0 A;  3I2N A;  4Z7Q B;  3IJC A;  3UVM A;  5EAR A;  3JB9 L;  4FA4 D;  2AGW A;  4A0B A;  2OIZ A;  2XL2 A;  4J79 A;  3RSE C;  2Z2N A;  4WJK B;  3FRX A;  4A2L A;  2VDL B;  3DWL C;  3I8E A;  3SLE D;  1TYQ C;  1A0R B;  5THA A;  4GGD A;  2H13 A;  4GQ2 P;  5C2W B;  4O9D A;  3ZE0 B;  5FKT A;  3OW8 A;  4O1Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...