3OL2B

Receptor-ligand structure of human semaphorin 4d with plexin b1.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
511
structure length
496
Chain Sequence
LPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSAHGEVLFAAFSSAAPPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSPEQWLWSFQPELGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Semaphorin-4D
total genus 118
structure length 496
sequence length 511
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3ol2B01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ol2B02
2I3SA 5FKQA 3VA6A 5IGOA 2QC5A 3FM0A 5HYNB 3UVNA 3W15A 3V5WB 3AL8A 3OL2B 3AL8B 4NSXA 4OWRA 3RN1D 3JAMg 3OTTA 3EMHA 4PBYA 5THAA 2VDRB 5EAMA 4ERYA 3DXKC 3T3PB 2H6NA 3PXSD 4J86A 2VDLB 3I8EA 3V9FA 3N0EA 4AEZA 5AFU3 2IUVA 2YBAA 4FAVD 4UM9B 4J8GA 1P22A 2EBSA 3I8CA 4R7AB 1Q47A 2VDPB 3JZGA 2AGXA 3RN0D 1B9YA 5EM2B 4A2MA 1PI6A 2XL3A 2VDOB 3PSCB 4ZOVA 5H1MA 1PGUA 4GM3A 3UVOA 1JMXB 2Q7QA 5EAPA 5A2Qg 3ODTA 4UI9R 5GXHA 3EI4A 1N6DA 2IWKA 3OW8A 2CE8A 5GSAA 4E54A 3CIKB 1U8CB 4GM8A 3SLED 4YVDA 3PVWB 5FQDA 3EI3B 2GNQA 4ERQA 4GQ2P 4J73A 2QXVA 3SBQA 3IJ1A 4L3HD 5SXMA 3DSMA 3I7OA 5EARA 1A0RB 4A11B 4K3ID 3EWEA 4ZOYA 2CO0A 1OLZA 4A09B 4FA4D 2P26A 5CYKA 3P4FA 2VDKB 5CXCA 5CXCB 4XYHA 2YB8B 4ZOZA 2GC7A 2P9PC 3NIFB 1OMWB 5FKSA 2AGWA 4FB1D 3F3GA 3K27A 4H5JA 2H14A 3MMYA 3I7HA 3V7DB 2HKMA 4CI1A 3J80g 3F3FA 4O45A 1TBGA 1R5MA 2Z2PA 3L4MD 3NVQA 5B4WA 5TEFA 4PXWA 3VI4B 3DM0A 2BCJB 5TDHB 3SJLD 3BG0A 5HQGA 2HJ4A 2P9KC 3ZE0B 1NEXB 1JOFA 5AJAA 4FA9D 3DXMC 4ES0A 2AGYA 4CY1A 2CNXA 4HDJA 4JT5C 3N0DA 5HE2B 1MG2A 4PBZA 5IT9g 2OVPB 2PM6B 2Z2NA 3EI2A 3JRPA 2OIZA 3IJCA 1B9XA 2J56H 2H9NA 4Z7OB 4FA5D 2G9AA 3JZNA 1K8KC 2H68A 3HFQA 4GM9A 3L4OD 4J84A 5EALA 4E54B 3B7FA 2IWFA 3NIDB 1NR0A 2B5MA 3GFCA 3EG6A 4A7JA 5I5MA 4FWWA 3AH8B 2XU7A 4Y5RD 3MKSB 4JSPC 4PC0A 4A08A 4TZ4A 5EMMB 4FAND 5E6UB 3C9CA 2YMUA 5CYKB 3RLMD 3C99A 5EMKB 2BBKH 4IMMA 1SQJA 4N14A 3PE7A 2AQ5A 5FA5B 2IAAA 5HDBB 4GMBA 4EWRA 4H5IA 1RI6A 4J0WA 4PSWB 4CY5A 1TYEB 1PBYB 4BUJC 1VYHC 3E0CA 2HKRA 4J82A 2PM9A 5TF2A 4A0AA 4A0AB 5GXIA 4UM8B 2P9IC 3I7LA 1N6FA 4MK0B 2CN3A 5IJ8E 2XL2A 2MTAH 4WK0B 3VGZA 2VDQB 5K19A 5E6RB 3F3PA 3ZWLB 2OK6A 4J8BA 3BG1A 2UZXB 2VDMB 4J78A 2AGZA 2J55H 4XYIA 4A2LA 3AL9A 2AGLA 2H47A 3OKWA 2H3XA 3KRXB 5C9ZB 4A0BA 3BWSA 4E5ZB 4QT8A 3ZDYB 3SMRA 1K32A 1TYQC 4X61B 1U2VC 3A0FA 3DWLC 4X63B 2AH0A 2AH1A 3UKUC 3T3MB 4ESGA 4K3JB 3UVLA 2HESX 1YUKA 3MZLA 4Z8LA 2B5LA 4O1QD 2HJBA 2CO0C 3I89A 5EM2A 4CI3A 2YNOA 2YNPA 3FRXA 4J87A 5I5JA 2H13A 3UVMA 3ZE1B 2VC2B 3RSEC 3AFCA 4JSVC 3FGBA 3VI3B 3RRMC 1XIPA 4JXMA 5E6SB 2XYIA 3JPXA 4CY3A 1ERJA 2UZYB 3SBPA 4ERZA 3IKOA 2HYEA 4BH6A 5HE3B 3EI1A 4L3GD 5C2VB 4GGCA 3C75H 4QQEA 2OK4A 2YNNA 1SSLA 3KRWB 5IJ7E 3UR4A 5JWZA 3I2NA 3IIWA 4CZVA 1JJUB 2P9LC 4GGDA 3JB9L 3SHFA 4PSXB 3CFVA 4D6VA 5GMKn 3ULEC 5EMLB 3CFSB 4Z7QB 3MZKA 3ZDZB 2B5NA 3I7NA 2PBIB 1L0QA 5HE0B 1MDAH 1FWXA 4IA9A 1PEVA 2J57G 3SCYA 4CI2A 5C2WB 4A08B 4J77A 4GGAA 3RMZD 2IUPA 4CZXA 4CI8A 2G99A 1S4UX 5IC7A 3PVUB 4CY2A 4KFMB 4GZ8A 2O9KA 5I5IA 3SWSD 4CZYA 5FKTA 3GREA 4Z7NB 3FCUB 3EI1B 2PM9B 3RFGA 1GXRA 1XHMA 2CE9A 3ZE2B 3PXWD 2B4EA 3MXXA 4G56B 4J0XA 3ORVD 4CC9A 2I0TA 5CXBB 4XEIC 3C5MA 3EI2B 4JSNC 1N6EA 4BL0A 1GOTB 3NVXA 3UVKA 3JZHA 4QRJA 4J79A 5TEEA 2VDNB 5EMJB 4JD2C 3SN6B 1JMZB 4U7AA 4D0KA 3EI4B 3OKYB 3OKYA 3ZDXB 4UM9D 4A0BB 3OKTA 4L9OA 1XKSA 4U1EI 4WJKB 4GQ1A 1SQ9A 4ZN4A 1GP2B 2IUQA 4I79A 4AOWA 1QNIA 4JSXC 4LG8A 2H6QA 2P9SC 4ZOXA 4GQBB 4WK2B 2OJYA 5IGQA 3RFHA 3EU7A 4JT6C 4A09A 4LG9A 4PNKB 4FA1D 2Z2OA 2H9PA 1MG3A 4E5ZA 3PXTD 2TRCB 2OVRB 4L1QD 4WK4B 5FXYA 3U4YA 5H17A 4J81A 2H9MA 3EI3A 5K1CC 5HE1B 3SFZA 5CXBA 3I7PA 4X3EA 3NVNA 3K26A 4OZUA 4A11A 4QL1A 2H9LA 3UKRC 3JROA 4LGNA 4O9DA 3OL2A 4X60B 3I7KA 3VH0A 3SVWD 3J81g 1GG2B 5FLXg 1U4CA 4O3TB 3MKQA 2PM7B 2CN2A 2I0RA 3NIGB 1YFQA 2IURA 4O3UB 1SHYB 3IIYA 3IJ0A 2GC4A 4Y7RA 5AMSA 2I3TA 3SXTD 2P28A 4FHLA 3PSLA 2OVQB 2H6KA 2HXCA 5H14A 5KDOB 2P9UC 2I0SA 2W18A 2P9NC 5FKRA 3SBRA
chains in the Genus database with same CATH superfamily
1UOQA 2I3SA 5FKQA 3VA6A 3IULA 1YR2A 5IGOA 2QC5A 3FM0A 5HYNB 4G1MA 3UVNA 3W15A 1E5TA 2VDOA 3V5WB 3AL8A 3OL2B 3AL8B 4NSXA 4OWRA 3RN1D 3JAMg 3OTTA 3EMHA 4PBYA 5THAA 3O4JA 2VDRA 3IUQA 2VDRB 3FCUA 4JHPC 5EAMA 4ERYA 3DXKC 3T3PB 2H6NA 3PXSD 4J86A 2VDLB 3I8EA 3V9FA 3N0EA 4AEZA 5AFU3 2IUVA 2YBAA 4FAVD 4UM9B 4J8GA 1P22A 2EBSA 3I8CA 4R7AB 1Q47A 2VDPB 3JZGA 2AGXA 3RN0D 4WK2A 4QAMA 1B9YA 1K3IA 5EM2B 1VZ2A 3EQ9A 3QHYB 4A2MA 1PI6A 2XL3A 2VDOB 3PSCB 4ZOVA 2VDMA 5H1MA 1PGUA 4GM3A 5M5UA 3IUJA 3UVOA 1JMXB 2Q7QA 5EAPA 5A2Qg 3ODTA 4RE6A 4UI9R 3EI4A 5GXHA 1N6DA 1VE6A 2IWKA 3NIFA 3OW8A 2CE8A 3ZDXA 5GSAA 4E54A 3CIKB 1U8CB 4GM8A 3SLED 4YVDA 3PVWB 5FQDA 3EI3B 2GNQA 4ERQA 4GQ2P 5C86A 4J73A 2QXVA 2XE4A 3SBQA 3IJ1A 2HU7A 4L3HD 5SXMA 3DSMA 4UM9A 3I7OA 5EARA 3QI0A 4WJKA 1A0RB 4A11B 4K3ID 3EWEA 4ZOYA 2CO0A 1OLZA 4A09B 4FA4D 2P26A 4MMXA 1H2YA 4IRZA 5CYKA 3P4FA 2VDKB 5CXCA 5CXCB 4Z7NA 4XYHA 2YB8B 3O4HA 4ZOZA 4RE5A 2GC7A 2P9PC 3NIFB 1OMWB 5FKSA 2AGWA 4FB1D 4JHNA 3F3GA 3K27A 4H5JA 2H14A 1E8MA 3MMYA 3I7HA 3V7DB 2JWHA 2HKMA 5M5TA 4CI1A 3J80g 3F3FA 4O45A 5M5SA 4G1EA 1TBGA 1R5MA 2Z2PA 3L4MD 3NVQA 5B4WA 3IUMA 5TEFA 4Z7OA 4PXWA 3VI4B 3DM0A 2BCJB 5TDHB 3SJLD 3BG0A 5HQGA 2HJ4A 2P9KC 1U8CA 3ZE0B 1NEXB 1JOFA 5AJAA 4FA9D 3DXMC 4ES0A 2AGYA 4CY1A 2CNXA 4HDJA 2JWGA 4JT5C 3N0DA 5HE2B 4MMYA 1MG2A 4PBZA 5IT9g 2OVPB 2PM6B 2Z2NA 3EI2A 2VDQA 3JRPA 2OIZA 3IJCA 1B9XA 3ZE1A 2J56H 2H9NA 4L1MA 4Z7OB 2XZGA 4FA5D 2G9AA 3JZNA 1K8KC 1O6FA 2H68A 3GC3B 3HFQA 3L4OD 4GM9A 4BCBA 4J84A 5EALA 4E54B 3B7FA 2IWFA 3ZE0A 3NIDB 3KCIA 1NR0A 2B5MA 3GFCA 3EG6A 4A7JA 5I5MA 1I2MB 4FWWA 3AH8B 2XU7A 4Y5RD 3MKSB 4JSPC 4PC0A 4A08A 4TZ4A 5EMMB 5E6UA 4FAND 5E6UB 3C9CA 2YMUA 5CYKB 3RLMD 3C99A 5EMKB 2BBKH 4BP8A 4IMMA 1SQJA 4N14A 2HU5A 3OF7A 3PE7A 2AQ5A 5FA5B 3T3PA 2IAAA 5HDBB 4GMBA 4EWRA 2BKLA 4H5IA 1RI6A 4J0WA 4PSWB 4CY5A 2WQ8A 1PBYB 3ZE2A 1TYEB 4BUJC 1VYHC 3E0CA 2HKRA 4J82A 2PM9A 1QFSA 5TF2A 4A0AA 4A0AB 5GXIA 4UM8B 4UM8A 5M5RA 2P9IC 3I7LA 1BPOA 1N6FA 4MK0B 2CN3A 5IJ8E 2XL2A 2MTAH 4MMZA 4WK0B 3VGZA 2VDQB 5K19A 5E6RB 3F3PA 3ZWLB 2OK6A 4J8BA 2VC2A 3BG1A 2UZXB 2VDMB 4J78A 2AGZA 2J55H 4XYIA 4A2LA 3AL9A 2AGLA 2H47A 3OKWA 5M5VA 2H3XA 3KRXB 5C9ZB 4A0BA 3BWSA 4E5ZB 4QT8A 3ZDYB 3SMRA 1JV2A 1K32A 1TYQC 4D9SA 4X61B 1U2VC 3A0FA 3DWLC 4X63B 2AH0A 2AH1A 3UKUC 3T3MB 4ESGA 4K3JB 3UVLA 2HESX 1YUKA 3MZLA 4Z8LA 5FFGA 2B5LA 4O1QD 2HJBA 2CO0C 3I89A 4NBMA 4NENA 5EM2A 2YNOA 4AN1A 4CI3A 2YNPA 3FRXA 4J87A 4O02A 5I5JA 2H13A 3UVMA 3ZE1B 2VC2B 3RSEC 3AFCA 4JSVC 3FGBA 3VI3B 3VI3A 3RRMC 1XIPA 4JXMA 1A12A 5E6SB 2XYIA 3FCSA 3JPXA 4CY3A 1ERJA 1GOHA 2UZYB 3SBPA 4ERZA 2QR5A 3IKOA 2HYEA 4BH6A 5HE3B 3EI1A 4L3GD 5C2VB 3EQ7A 4GGCA 3T3MA 3C75H 4QQEA 2OK4A 1UOPA 2YNNA 1SSLA 2XDWA 3EQ8A 5M61A 3KRWB 5IJ7E 3UR4A 1UTCA 5JWZA 3I2NA 2EIEA 3IIWA 4CZVA 1JJUB 2P9LC 2VDNA 4GGDA 2VZ1A 3JB9L 5E6SA 4PSXB 3SHFA 3CFVA 4D6VA 3IJEA 5GMKn 3ULEC 5EMLB 3CFSB 4Z7QB 3MZKA 3K6SA 3ZDZB 2B5NA 3I7NA 3NIDA 2PBIB 3MVDK 1L0QA 5HE0B 1MDAH 1FWXA 1H2XA 4IA9A 1PEVA 2J57G 3SCYA 4CI2A 5C2WB 4A08B 4J77A 4GGAA 3RMZD 3O4IA 2IUPA 3IUNA 1M1XA 4CZXA 4CI8A 3VI4A 2G99A 1C9LA 1S4UX 4DNVA 3IVMA 5IC7A 3PVUB 4CY2A 4KFMB 4GZ8A 2O9KA 5I5IA 3SWSD 4CZYA 5FKTA 3GREA 4Z7NB 3FCUB 3EI1B 1C9IA 2PM9B 1QFMA 3RFGA 1GXRA 1XHMA 2CE9A 1TYEA 3ZE2B 3PXWD 2VDPA 2B4EA 3MXXA 4G56B 4J0XA 3ORVD 4CC9A 2I0TA 5CXBB 4XEIC 3C5MA 3EI2B 4JSNC 1N6EA 4BL0A 1GOTB 3NVXA 3UVKA 3JZHA 4QRJA 4J79A 5TEEA 2VDNB 5EMJB 2EIDA 4JD2C 4DNUA 3SN6B 1JMZB 4WK4A 4U7AA 4D0KA 4BP9A 3EI4B 3OKYB 3OKYA 2EIBA 4UM9D 3ZDXB 4A0BB 4DNWA 3OKTA 4G55A 4L9OA 3ZDYA 1XKSA 4U1EI 4WJKB 1L5GA 4WK0A 1UOOA 4GQ1A 1SQ9A 4ZN4A 1GP2B 2IUQA 4I79A 4AOWA 1QNIA 4JSXC 4LG8A 2H6QA 2P9SC 4AX4A 4BCCA 4ZOXA 4GQBB 4WK2B 2OJYA 5IGQA 3RFHA 3EU7A 4JT6C 4A09A 4LG9A 2JKXA 4O2WA 4PNKB 4FA1D 2Z2OA 3K72A 2H9PA 4AN0A 1MG3A 4E5ZA 1E8NA 3PXTD 5HDBA 2TRCB 2OVRB 4L1QD 4WK4B 3DDUA 5FXYA 3U4YA 5H17A 4J81A 2H9MA 4NAAA 3NIGA 3MUNA 3V4VA 3EI3A 3IURA 3K71A 1T2XA 5K1CC 5HE1B 3SFZA 5C92A 5CXBA 3I7PA 2QZPA 4X3EA 1VZ3A 3NVNA 1O6GA 3K26A 4OZUA 5E6RA 4A11A 2EICA 4QL1A 2H9LA 3UKRC 1H2ZA 5FFOA 3JROA 4LGNA 4O9DA 3OL2A 4X60B 1VE7A 3I7KA 3VH0A 3SVWD 2VDKA 3J81g 3O4GA 1GG2B 3GD1I 1H2WA 5FLXg 1U4CA 4NC4A 3MKQA 4O3TB 2PM7B 2CN2A 2I0RA 4AMYA 3ZDZA 2VDLA 3NIGB 1YFQA 4AMZA 1JTDB 1GOGA 2IURA 2VZ3A 4Z7QA 1SHYB 4O3UB 3IIYA 3IJ0A 2GC4A 3MUOA 4Y7RA 2I3TA 5AMSA 3V4PA 3SXTD 2P28A 4FHLA 1GOFA 3PSLA 2OVQB 2HU8A 2H6KA 2HXCA 5H14A 4BCDA 2P9UC 5KDOB 2I0SA 2W18A 2P9NC 5FKRA 3SBRA
chains in the Genus database with same CATH topology
2I3SA 5FKQA 3VA6A 5IGOA 2QC5A 3FM0A 5HYNB 3UVNA 3W15A 3V5WB 3AL8A 3OL2B 3AL8B 4NSXA 4OWRA 3RN1D 3JAMg 3OTTA 3EMHA 4PBYA 5THAA 2VDRB 5EAMA 4ERYA 3DXKC 3T3PB 2H6NA 3PXSD 4J86A 2VDLB 3I8EA 3V9FA 3N0EA 4AEZA 5AFU3 2IUVA 2YBAA 4FAVD 4UM9B 4J8GA 1P22A 2EBSA 3I8CA 4R7AB 1Q47A 2VDPB 3JZGA 2AGXA 3RN0D 1B9YA 5EM2B 4A2MA 1PI6A 2XL3A 2VDOB 3PSCB 4ZOVA 5H1MA 1PGUA 4GM3A 3UVOA 1JMXB 2Q7QA 5EAPA 5A2Qg 3ODTA 4UI9R 5GXHA 3EI4A 1N6DA 2IWKA 3OW8A 2CE8A 5GSAA 4E54A 3CIKB 1U8CB 4GM8A 3SLED 4YVDA 3PVWB 5FQDA 3EI3B 2GNQA 4ERQA 4GQ2P 4J73A 2QXVA 3SBQA 3IJ1A 4L3HD 5SXMA 3DSMA 3I7OA 5EARA 1A0RB 4A11B 4K3ID 3EWEA 4ZOYA 2CO0A 1OLZA 4A09B 4FA4D 2P26A 5CYKA 3P4FA 2VDKB 5CXCA 5CXCB 4XYHA 2YB8B 4ZOZA 2GC7A 2P9PC 3NIFB 1OMWB 5FKSA 2AGWA 4FB1D 3F3GA 3K27A 4H5JA 2H14A 3MMYA 3I7HA 3V7DB 2JWHA 2HKMA 4CI1A 3J80g 3F3FA 4O45A 1TBGA 1R5MA 2Z2PA 3L4MD 3NVQA 5B4WA 5TEFA 4PXWA 3VI4B 3DM0A 2BCJB 5TDHB 3SJLD 3BG0A 5HQGA 2HJ4A 2P9KC 3ZE0B 1NEXB 1JOFA 5AJAA 4FA9D 3DXMC 4ES0A 2AGYA 4CY1A 2CNXA 4HDJA 2JWGA 4JT5C 3N0DA 5HE2B 1MG2A 4PBZA 5IT9g 2OVPB 2PM6B 2Z2NA 3EI2A 3JRPA 2OIZA 3IJCA 1B9XA 2J56H 2H9NA 4Z7OB 4FA5D 2G9AA 3JZNA 1K8KC 2H68A 3HFQA 4GM9A 3L4OD 4J84A 5EALA 4E54B 3B7FA 2IWFA 3NIDB 1NR0A 2B5MA 3GFCA 3EG6A 4A7JA 5I5MA 4FWWA 3AH8B 2XU7A 4Y5RD 3MKSB 4JSPC 4PC0A 4A08A 4TZ4A 5EMMB 4FAND 5E6UB 3C9CA 2YMUA 5CYKB 3RLMD 3C99A 5EMKB 2BBKH 4IMMA 1SQJA 4N14A 3PE7A 2AQ5A 5FA5B 2IAAA 5HDBB 4GMBA 4EWRA 4H5IA 1RI6A 4J0WA 4PSWB 4CY5A 1TYEB 1PBYB 4BUJC 1VYHC 3E0CA 2HKRA 4J82A 2PM9A 5TF2A 4A0AA 4A0AB 5GXIA 4UM8B 2P9IC 3I7LA 1N6FA 4MK0B 2CN3A 5IJ8E 2XL2A 2MTAH 4WK0B 3VGZA 2VDQB 5K19A 5E6RB 3F3PA 3ZWLB 2OK6A 4J8BA 3BG1A 2UZXB 2VDMB 4J78A 2AGZA 2J55H 4XYIA 4A2LA 3AL9A 2AGLA 2H47A 3OKWA 2H3XA 3KRXB 5C9ZB 4A0BA 3BWSA 4E5ZB 4QT8A 3ZDYB 3SMRA 1K32A 1TYQC 4X61B 1U2VC 3A0FA 3DWLC 4X63B 2AH0A 2AH1A 3UKUC 3T3MB 4ESGA 4K3JB 3UVLA 2HESX 1YUKA 3MZLA 4Z8LA 2B5LA 4O1QD 2HJBA 2CO0C 3I89A 5EM2A 4CI3A 2YNOA 2YNPA 3FRXA 4J87A 5I5JA 2H13A 3UVMA 3ZE1B 2VC2B 3RSEC 3AFCA 4JSVC 3FGBA 3VI3B 3RRMC 1XIPA 4JXMA 5E6SB 2XYIA 3JPXA 4CY3A 1ERJA 2UZYB 3SBPA 4ERZA 3IKOA 2HYEA 4BH6A 5HE3B 3EI1A 4L3GD 5C2VB 4GGCA 3C75H 4QQEA 2OK4A 2YNNA 1SSLA 3KRWB 5IJ7E 3UR4A 5JWZA 3I2NA 3IIWA 4CZVA 1JJUB 2P9LC 4GGDA 3JB9L 3SHFA 4PSXB 3CFVA 4D6VA 5GMKn 3ULEC 5EMLB 3CFSB 4Z7QB 3MZKA 3ZDZB 2B5NA 3I7NA 2PBIB 1L0QA 5HE0B 1MDAH 1FWXA 4IA9A 1PEVA 2J57G 3SCYA 4CI2A 5C2WB 4A08B 4J77A 4GGAA 3RMZD 2IUPA 4CZXA 4CI8A 2G99A 1S4UX 5IC7A 3PVUB 4CY2A 4KFMB 4GZ8A 2O9KA 5I5IA 3SWSD 4CZYA 5FKTA 3GREA 4Z7NB 3FCUB 3EI1B 2PM9B 3RFGA 1GXRA 1XHMA 2CE9A 3ZE2B 3PXWD 2B4EA 3MXXA 4G56B 4J0XA 3ORVD 4CC9A 2I0TA 5CXBB 4XEIC 3C5MA 3EI2B 4JSNC 1N6EA 4BL0A 1GOTB 3NVXA 3UVKA 3JZHA 4QRJA 4J79A 5TEEA 2VDNB 5EMJB 4JD2C 3SN6B 1JMZB 4U7AA 4D0KA 3EI4B 3OKYB 3OKYA 3ZDXB 4UM9D 4A0BB 3OKTA 4L9OA 1XKSA 4U1EI 4WJKB 4GQ1A 1SQ9A 4ZN4A 1GP2B 2IUQA 4I79A 4AOWA 1QNIA 4JSXC 4LG8A 2H6QA 2P9SC 4ZOXA 4GQBB 4WK2B 2OJYA 5IGQA 3RFHA 3EU7A 4JT6C 4A09A 4LG9A 4PNKB 4FA1D 2Z2OA 2H9PA 1MG3A 4E5ZA 3PXTD 2TRCB 2OVRB 4L1QD 4WK4B 5FXYA 3U4YA 5H17A 4J81A 2H9MA 3EI3A 5K1CC 5HE1B 3SFZA 5CXBA 3I7PA 4X3EA 3NVNA 3K26A 4OZUA 4A11A 4QL1A 2H9LA 3UKRC 3JROA 4LGNA 4O9DA 3OL2A 4X60B 3I7KA 3VH0A 3SVWD 3J81g 1GG2B 5FLXg 1U4CA 4O3TB 3MKQA 2PM7B 2CN2A 2I0RA 3NIGB 1YFQA 2IURA 4O3UB 1SHYB 3IIYA 3IJ0A 2GC4A 4Y7RA 5AMSA 2I3TA 3SXTD 2P28A 4FHLA 3PSLA 2OVQB 2H6KA 2HXCA 5H14A 5KDOB 2P9UC 2I0SA 2W18A 2P9NC 5FKRA 3SBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3S A;  5FKQ A;  3VA6 A;  5IGO A;  2QC5 A;  3FM0 A;  5HYN B;  3UVN A;  3W15 A;  3V5W B;  3AL8 A;  3OL2 B;  3AL8 B;  4NSX A;  4OWR A;  3RN1 D;  3JAM g;  3OTT A;  3EMH A;  4PBY A;  5THA A;  2VDR B;  5EAM A;  4ERY A;  3DXK C;  3T3P B;  2H6N A;  3PXS D;  4J86 A;  2VDL B;  3I8E A;  3V9F A;  3N0E A;  4AEZ A;  5AFU 3;  2IUV A;  2YBA A;  4FAV D;  4UM9 B;  4J8G A;  1P22 A;  2EBS A;  3I8C A;  4R7A B;  1Q47 A;  2VDP B;  3JZG A;  2AGX A;  3RN0 D;  1B9Y A;  5EM2 B;  4A2M A;  1PI6 A;  2XL3 A;  2VDO B;  3PSC B;  4ZOV A;  5H1M A;  1PGU A;  4GM3 A;  3UVO A;  1JMX B;  2Q7Q A;  5EAP A;  5A2Q g;  3ODT A;  4UI9 R;  5GXH A;  3EI4 A;  1N6D A;  2IWK A;  3OW8 A;  2CE8 A;  5GSA A;  4E54 A;  3CIK B;  1U8C B;  4GM8 A;  3SLE D;  4YVD A;  3PVW B;  5FQD A;  3EI3 B;  2GNQ A;  4ERQ A;  4GQ2 P;  4J73 A;  2QXV A;  3SBQ A;  3IJ1 A;  4L3H D;  5SXM A;  3DSM A;  3I7O A;  5EAR A;  1A0R B;  4A11 B;  4K3I D;  3EWE A;  4ZOY A;  2CO0 A;  1OLZ A;  4A09 B;  4FA4 D;  2P26 A;  5CYK A;  3P4F A;  2VDK B;  5CXC A;  5CXC B;  4XYH A;  2YB8 B;  4ZOZ A;  2GC7 A;  2P9P C;  3NIF B;  1OMW B;  5FKS A;  2AGW A;  4FB1 D;  3F3G A;  3K27 A;  4H5J A;  2H14 A;  3MMY A;  3I7H A;  3V7D B;  2HKM A;  4CI1 A;  3J80 g;  3F3F A;  4O45 A;  1TBG A;  1R5M A;  2Z2P A;  3L4M D;  3NVQ A;  5B4W A;  5TEF A;  4PXW A;  3VI4 B;  3DM0 A;  2BCJ B;  5TDH B;  3SJL D;  3BG0 A;  5HQG A;  2HJ4 A;  2P9K C;  3ZE0 B;  1NEX B;  1JOF A;  5AJA A;  4FA9 D;  3DXM C;  4ES0 A;  2AGY A;  4CY1 A;  2CNX A;  4HDJ A;  4JT5 C;  3N0D A;  5HE2 B;  1MG2 A;  4PBZ A;  5IT9 g;  2OVP B;  2PM6 B;  2Z2N A;  3EI2 A;  3JRP A;  2OIZ A;  3IJC A;  1B9X A;  2J56 H;  2H9N A;  4Z7O B;  4FA5 D;  2G9A A;  3JZN A;  1K8K C;  2H68 A;  3HFQ A;  4GM9 A;  3L4O D;  4J84 A;  5EAL A;  4E54 B;  3B7F A;  2IWF A;  3NID B;  1NR0 A;  2B5M A;  3GFC A;  3EG6 A;  4A7J A;  5I5M A;  4FWW A;  3AH8 B;  2XU7 A;  4Y5R D;  3MKS B;  4JSP C;  4PC0 A;  4A08 A;  4TZ4 A;  5EMM B;  4FAN D;  5E6U B;  3C9C A;  2YMU A;  5CYK B;  3RLM D;  3C99 A;  5EMK B;  2BBK H;  4IMM A;  1SQJ A;  4N14 A;  3PE7 A;  2AQ5 A;  5FA5 B;  2IAA A;  5HDB B;  4GMB A;  4EWR A;  4H5I A;  1RI6 A;  4J0W A;  4PSW B;  4CY5 A;  1TYE B;  1PBY B;  4BUJ C;  1VYH C;  3E0C A;  2HKR A;  4J82 A;  2PM9 A;  5TF2 A;  4A0A A;  4A0A B;  5GXI A;  4UM8 B;  2P9I C;  3I7L A;  1N6F A;  4MK0 B;  2CN3 A;  5IJ8 E;  2XL2 A;  2MTA H;  4WK0 B;  3VGZ A;  2VDQ B;  5K19 A;  5E6R B;  3F3P A;  3ZWL B;  2OK6 A;  4J8B A;  3BG1 A;  2UZX B;  2VDM B;  4J78 A;  2AGZ A;  2J55 H;  4XYI A;  4A2L A;  3AL9 A;  2AGL A;  2H47 A;  3OKW A;  2H3X A;  3KRX B;  5C9Z B;  4A0B A;  3BWS A;  4E5Z B;  4QT8 A;  3ZDY B;  3SMR A;  1K32 A;  1TYQ C;  4X61 B;  1U2V C;  3A0F A;  3DWL C;  4X63 B;  2AH0 A;  2AH1 A;  3UKU C;  3T3M B;  4ESG A;  4K3J B;  3UVL A;  2HES X;  1YUK A;  3MZL A;  4Z8L A;  2B5L A;  4O1Q D;  2HJB A;  2CO0 C;  3I89 A;  5EM2 A;  4CI3 A;  2YNO A;  2YNP A;  3FRX A;  4J87 A;  5I5J A;  2H13 A;  3UVM A;  3ZE1 B;  2VC2 B;  3RSE C;  3AFC A;  4JSV C;  3FGB A;  3VI3 B;  3RRM C;  1XIP A;  4JXM A;  5E6S B;  2XYI A;  3JPX A;  4CY3 A;  1ERJ A;  2UZY B;  3SBP A;  4ERZ A;  3IKO A;  2HYE A;  4BH6 A;  5HE3 B;  3EI1 A;  4L3G D;  5C2V B;  4GGC A;  3C75 H;  4QQE A;  2OK4 A;  2YNN A;  1SSL A;  3KRW B;  5IJ7 E;  3UR4 A;  5JWZ A;  3I2N A;  3IIW A;  4CZV A;  1JJU B;  2P9L C;  4GGD A;  3JB9 L;  3SHF A;  4PSX B;  3CFV A;  4D6V A;  5GMK n;  3ULE C;  5EML B;  3CFS B;  4Z7Q B;  3MZK A;  3ZDZ B;  2B5N A;  3I7N A;  2PBI B;  1L0Q A;  5HE0 B;  1MDA H;  1FWX A;  4IA9 A;  1PEV A;  2J57 G;  3SCY A;  4CI2 A;  5C2W B;  4A08 B;  4J77 A;  4GGA A;  3RMZ D;  2IUP A;  4CZX A;  4CI8 A;  2G99 A;  1S4U X;  5IC7 A;  3PVU B;  4CY2 A;  4KFM B;  4GZ8 A;  2O9K A;  5I5I A;  3SWS D;  4CZY A;  5FKT A;  3GRE A;  4Z7N B;  3FCU B;  3EI1 B;  2PM9 B;  3RFG A;  1GXR A;  1XHM A;  2CE9 A;  3ZE2 B;  3PXW D;  2B4E A;  3MXX A;  4G56 B;  4J0X A;  3ORV D;  4CC9 A;  2I0T A;  5CXB B;  4XEI C;  3C5M A;  3EI2 B;  4JSN C;  1N6E A;  4BL0 A;  1GOT B;  3NVX A;  3UVK A;  3JZH A;  4QRJ A;  4J79 A;  5TEE A;  2VDN B;  5EMJ B;  4JD2 C;  3SN6 B;  1JMZ B;  4U7A A;  4D0K A;  3EI4 B;  3OKY B;  3OKY A;  3ZDX B;  4UM9 D;  4A0B B;  3OKT A;  4L9O A;  1XKS A;  4U1E I;  4WJK B;  4GQ1 A;  1SQ9 A;  4ZN4 A;  1GP2 B;  2IUQ A;  4I79 A;  4AOW A;  1QNI A;  4JSX C;  4LG8 A;  2H6Q A;  2P9S C;  4ZOX A;  4GQB B;  4WK2 B;  2OJY A;  5IGQ A;  3RFH A;  3EU7 A;  4JT6 C;  4A09 A;  4LG9 A;  4PNK B;  4FA1 D;  2Z2O A;  2H9P A;  1MG3 A;  4E5Z A;  3PXT D;  2TRC B;  2OVR B;  4L1Q D;  4WK4 B;  5FXY A;  3U4Y A;  5H17 A;  4J81 A;  2H9M A;  3EI3 A;  5K1C C;  5HE1 B;  3SFZ A;  5CXB A;  3I7P A;  4X3E A;  3NVN A;  3K26 A;  4OZU A;  4A11 A;  4QL1 A;  2H9L A;  3UKR C;  3JRO A;  4LGN A;  4O9D A;  3OL2 A;  4X60 B;  3I7K A;  3VH0 A;  3SVW D;  3J81 g;  1GG2 B;  5FLX g;  1U4C A;  4O3T B;  3MKQ A;  2PM7 B;  2CN2 A;  2I0R A;  3NIG B;  1YFQ A;  2IUR A;  4O3U B;  1SHY B;  3IIY A;  3IJ0 A;  2GC4 A;  4Y7R A;  5AMS A;  2I3T A;  3SXT D;  2P28 A;  4FHL A;  3PSL A;  2OVQ B;  2H6K A;  2HXC A;  5H14 A;  5KDO B;  2P9U C;  2I0S A;  2W18 A;  2P9N C;  5FKR A;  3SBR A; 
#chains in the Genus database with same CATH topology
 1UOQ A;  2I3S A;  5FKQ A;  3VA6 A;  3IUL A;  1YR2 A;  5IGO A;  2QC5 A;  3FM0 A;  5HYN B;  4G1M A;  3UVN A;  3W15 A;  1E5T A;  2VDO A;  3V5W B;  3AL8 A;  3OL2 B;  3AL8 B;  4NSX A;  4OWR A;  3RN1 D;  3JAM g;  3OTT A;  3EMH A;  4PBY A;  5THA A;  3O4J A;  2VDR A;  3IUQ A;  2VDR B;  3FCU A;  4JHP C;  5EAM A;  4ERY A;  3DXK C;  3T3P B;  2H6N A;  3PXS D;  4J86 A;  2VDL B;  3I8E A;  3V9F A;  3N0E A;  4AEZ A;  5AFU 3;  2IUV A;  2YBA A;  4FAV D;  4UM9 B;  4J8G A;  1P22 A;  2EBS A;  3I8C A;  4R7A B;  1Q47 A;  2VDP B;  3JZG A;  2AGX A;  3RN0 D;  4WK2 A;  4QAM A;  1B9Y A;  1K3I A;  5EM2 B;  1VZ2 A;  3EQ9 A;  3QHY B;  4A2M A;  1PI6 A;  2XL3 A;  2VDO B;  3PSC B;  4ZOV A;  2VDM A;  5H1M A;  1PGU A;  4GM3 A;  5M5U A;  3IUJ A;  3UVO A;  1JMX B;  2Q7Q A;  5EAP A;  5A2Q g;  3ODT A;  4RE6 A;  4UI9 R;  3EI4 A;  5GXH A;  1N6D A;  1VE6 A;  2IWK A;  3NIF A;  3OW8 A;  2CE8 A;  3ZDX A;  5GSA A;  4E54 A;  3CIK B;  1U8C B;  4GM8 A;  3SLE D;  4YVD A;  3PVW B;  5FQD A;  3EI3 B;  2GNQ A;  4ERQ A;  4GQ2 P;  5C86 A;  4J73 A;  2QXV A;  2XE4 A;  3SBQ A;  3IJ1 A;  2HU7 A;  4L3H D;  5SXM A;  3DSM A;  4UM9 A;  3I7O A;  5EAR A;  3QI0 A;  4WJK A;  1A0R B;  4A11 B;  4K3I D;  3EWE A;  4ZOY A;  2CO0 A;  1OLZ A;  4A09 B;  4FA4 D;  2P26 A;  4MMX A;  1H2Y A;  4IRZ A;  5CYK A;  3P4F A;  2VDK B;  5CXC A;  5CXC B;  4Z7N A;  4XYH A;  2YB8 B;  3O4H A;  4ZOZ A;  4RE5 A;  2GC7 A;  2P9P C;  3NIF B;  1OMW B;  5FKS A;  2AGW A;  4FB1 D;  4JHN A;  3F3G A;  3K27 A;  4H5J A;  2H14 A;  1E8M A;  3MMY A;  3I7H A;  3V7D B;  2JWH A;  2HKM A;  5M5T A;  4CI1 A;  3J80 g;  3F3F A;  4O45 A;  5M5S A;  4G1E A;  1TBG A;  1R5M A;  2Z2P A;  3L4M D;  3NVQ A;  5B4W A;  3IUM A;  5TEF A;  4Z7O A;  4PXW A;  3VI4 B;  3DM0 A;  2BCJ B;  5TDH B;  3SJL D;  3BG0 A;  5HQG A;  2HJ4 A;  2P9K C;  1U8C A;  3ZE0 B;  1NEX B;  1JOF A;  5AJA A;  4FA9 D;  3DXM C;  4ES0 A;  2AGY A;  4CY1 A;  2CNX A;  4HDJ A;  2JWG A;  4JT5 C;  3N0D A;  5HE2 B;  4MMY A;  1MG2 A;  4PBZ A;  5IT9 g;  2OVP B;  2PM6 B;  2Z2N A;  3EI2 A;  2VDQ A;  3JRP A;  2OIZ A;  3IJC A;  1B9X A;  3ZE1 A;  2J56 H;  2H9N A;  4L1M A;  4Z7O B;  2XZG A;  4FA5 D;  2G9A A;  3JZN A;  1K8K C;  1O6F A;  2H68 A;  3GC3 B;  3HFQ A;  3L4O D;  4GM9 A;  4BCB A;  4J84 A;  5EAL A;  4E54 B;  3B7F A;  2IWF A;  3ZE0 A;  3NID B;  3KCI A;  1NR0 A;  2B5M A;  3GFC A;  3EG6 A;  4A7J A;  5I5M A;  1I2M B;  4FWW A;  3AH8 B;  2XU7 A;  4Y5R D;  3MKS B;  4JSP C;  4PC0 A;  4A08 A;  4TZ4 A;  5EMM B;  5E6U A;  4FAN D;  5E6U B;  3C9C A;  2YMU A;  5CYK B;  3RLM D;  3C99 A;  5EMK B;  2BBK H;  4BP8 A;  4IMM A;  1SQJ A;  4N14 A;  2HU5 A;  3OF7 A;  3PE7 A;  2AQ5 A;  5FA5 B;  3T3P A;  2IAA A;  5HDB B;  4GMB A;  4EWR A;  2BKL A;  4H5I A;  1RI6 A;  4J0W A;  4PSW B;  4CY5 A;  2WQ8 A;  1PBY B;  3ZE2 A;  1TYE B;  4BUJ C;  1VYH C;  3E0C A;  2HKR A;  4J82 A;  2PM9 A;  1QFS A;  5TF2 A;  4A0A A;  4A0A B;  5GXI A;  4UM8 B;  4UM8 A;  5M5R A;  2P9I C;  3I7L A;  1BPO A;  1N6F A;  4MK0 B;  2CN3 A;  5IJ8 E;  2XL2 A;  2MTA H;  4MMZ A;  4WK0 B;  3VGZ A;  2VDQ B;  5K19 A;  5E6R B;  3F3P A;  3ZWL B;  2OK6 A;  4J8B A;  2VC2 A;  3BG1 A;  2UZX B;  2VDM B;  4J78 A;  2AGZ A;  2J55 H;  4XYI A;  4A2L A;  3AL9 A;  2AGL A;  2H47 A;  3OKW A;  5M5V A;  2H3X A;  3KRX B;  5C9Z B;  4A0B A;  3BWS A;  4E5Z B;  4QT8 A;  3ZDY B;  3SMR A;  1JV2 A;  1K32 A;  1TYQ C;  4D9S A;  4X61 B;  1U2V C;  3A0F A;  3DWL C;  4X63 B;  2AH0 A;  2AH1 A;  3UKU C;  3T3M B;  4ESG A;  4K3J B;  3UVL A;  2HES X;  1YUK A;  3MZL A;  4Z8L A;  5FFG A;  2B5L A;  4O1Q D;  2HJB A;  2CO0 C;  3I89 A;  4NBM A;  4NEN A;  5EM2 A;  2YNO A;  4AN1 A;  4CI3 A;  2YNP A;  3FRX A;  4J87 A;  4O02 A;  5I5J A;  2H13 A;  3UVM A;  3ZE1 B;  2VC2 B;  3RSE C;  3AFC A;  4JSV C;  3FGB A;  3VI3 B;  3VI3 A;  3RRM C;  1XIP A;  4JXM A;  1A12 A;  5E6S B;  2XYI A;  3FCS A;  3JPX A;  4CY3 A;  1ERJ A;  1GOH A;  2UZY B;  3SBP A;  4ERZ A;  2QR5 A;  3IKO A;  2HYE A;  4BH6 A;  5HE3 B;  3EI1 A;  4L3G D;  5C2V B;  3EQ7 A;  4GGC A;  3T3M A;  3C75 H;  4QQE A;  2OK4 A;  1UOP A;  2YNN A;  1SSL A;  2XDW A;  3EQ8 A;  5M61 A;  3KRW B;  5IJ7 E;  3UR4 A;  1UTC A;  5JWZ A;  3I2N A;  2EIE A;  3IIW A;  4CZV A;  1JJU B;  2P9L C;  2VDN A;  4GGD A;  2VZ1 A;  3JB9 L;  5E6S A;  4PSX B;  3SHF A;  3CFV A;  4D6V A;  3IJE A;  5GMK n;  3ULE C;  5EML B;  3CFS B;  4Z7Q B;  3MZK A;  3K6S A;  3ZDZ B;  2B5N A;  3I7N A;  3NID A;  2PBI B;  3MVD K;  1L0Q A;  5HE0 B;  1MDA H;  1FWX A;  1H2X A;  4IA9 A;  1PEV A;  2J57 G;  3SCY A;  4CI2 A;  5C2W B;  4A08 B;  4J77 A;  4GGA A;  3RMZ D;  3O4I A;  2IUP A;  3IUN A;  1M1X A;  4CZX A;  4CI8 A;  3VI4 A;  2G99 A;  1C9L A;  1S4U X;  4DNV A;  3IVM A;  5IC7 A;  3PVU B;  4CY2 A;  4KFM B;  4GZ8 A;  2O9K A;  5I5I A;  3SWS D;  4CZY A;  5FKT A;  3GRE A;  4Z7N B;  3FCU B;  3EI1 B;  1C9I A;  2PM9 B;  1QFM A;  3RFG A;  1GXR A;  1XHM A;  2CE9 A;  1TYE A;  3ZE2 B;  3PXW D;  2VDP A;  2B4E A;  3MXX A;  4G56 B;  4J0X A;  3ORV D;  4CC9 A;  2I0T A;  5CXB B;  4XEI C;  3C5M A;  3EI2 B;  4JSN C;  1N6E A;  4BL0 A;  1GOT B;  3NVX A;  3UVK A;  3JZH A;  4QRJ A;  4J79 A;  5TEE A;  2VDN B;  5EMJ B;  2EID A;  4JD2 C;  4DNU A;  3SN6 B;  1JMZ B;  4WK4 A;  4U7A A;  4D0K A;  4BP9 A;  3EI4 B;  3OKY B;  3OKY A;  2EIB A;  4UM9 D;  3ZDX B;  4A0B B;  4DNW A;  3OKT A;  4G55 A;  4L9O A;  3ZDY A;  1XKS A;  4U1E I;  4WJK B;  1L5G A;  4WK0 A;  1UOO A;  4GQ1 A;  1SQ9 A;  4ZN4 A;  1GP2 B;  2IUQ A;  4I79 A;  4AOW A;  1QNI A;  4JSX C;  4LG8 A;  2H6Q A;  2P9S C;  4AX4 A;  4BCC A;  4ZOX A;  4GQB B;  4WK2 B;  2OJY A;  5IGQ A;  3RFH A;  3EU7 A;  4JT6 C;  4A09 A;  4LG9 A;  2JKX A;  4O2W A;  4PNK B;  4FA1 D;  2Z2O A;  3K72 A;  2H9P A;  4AN0 A;  1MG3 A;  4E5Z A;  1E8N A;  3PXT D;  5HDB A;  2TRC B;  2OVR B;  4L1Q D;  4WK4 B;  3DDU A;  5FXY A;  3U4Y A;  5H17 A;  4J81 A;  2H9M A;  4NAA A;  3NIG A;  3MUN A;  3V4V A;  3EI3 A;  3IUR A;  3K71 A;  1T2X A;  5K1C C;  5HE1 B;  3SFZ A;  5C92 A;  5CXB A;  3I7P A;  2QZP A;  4X3E A;  1VZ3 A;  3NVN A;  1O6G A;  3K26 A;  4OZU A;  5E6R A;  4A11 A;  2EIC A;  4QL1 A;  2H9L A;  3UKR C;  1H2Z A;  5FFO A;  3JRO A;  4LGN A;  4O9D A;  3OL2 A;  4X60 B;  1VE7 A;  3I7K A;  3VH0 A;  3SVW D;  2VDK A;  3J81 g;  3O4G A;  1GG2 B;  3GD1 I;  1H2W A;  5FLX g;  1U4C A;  4NC4 A;  3MKQ A;  4O3T B;  2PM7 B;  2CN2 A;  2I0R A;  4AMY A;  3ZDZ A;  2VDL A;  3NIG B;  1YFQ A;  4AMZ A;  1JTD B;  1GOG A;  2IUR A;  2VZ3 A;  4Z7Q A;  1SHY B;  4O3U B;  3IIY A;  3IJ0 A;  2GC4 A;  3MUO A;  4Y7R A;  2I3T A;  5AMS A;  3V4P A;  3SXT D;  2P28 A;  4FHL A;  1GOF A;  3PSL A;  2OVQ B;  2HU8 A;  2H6K A;  2HXC A;  5H14 A;  4BCD A;  2P9U C;  5KDO B;  2I0S A;  2W18 A;  2P9N C;  5FKR A;  3SBR A; 
#chains in the Genus database with same CATH homology
 2I3S A;  5FKQ A;  3VA6 A;  5IGO A;  2QC5 A;  3FM0 A;  5HYN B;  3UVN A;  3W15 A;  3V5W B;  3AL8 A;  3OL2 B;  3AL8 B;  4NSX A;  4OWR A;  3RN1 D;  3JAM g;  3OTT A;  3EMH A;  4PBY A;  5THA A;  2VDR B;  5EAM A;  4ERY A;  3DXK C;  3T3P B;  2H6N A;  3PXS D;  4J86 A;  2VDL B;  3I8E A;  3V9F A;  3N0E A;  4AEZ A;  5AFU 3;  2IUV A;  2YBA A;  4FAV D;  4UM9 B;  4J8G A;  1P22 A;  2EBS A;  3I8C A;  4R7A B;  1Q47 A;  2VDP B;  3JZG A;  2AGX A;  3RN0 D;  1B9Y A;  5EM2 B;  4A2M A;  1PI6 A;  2XL3 A;  2VDO B;  3PSC B;  4ZOV A;  5H1M A;  1PGU A;  4GM3 A;  3UVO A;  1JMX B;  2Q7Q A;  5EAP A;  5A2Q g;  3ODT A;  4UI9 R;  5GXH A;  3EI4 A;  1N6D A;  2IWK A;  3OW8 A;  2CE8 A;  5GSA A;  4E54 A;  3CIK B;  1U8C B;  4GM8 A;  3SLE D;  4YVD A;  3PVW B;  5FQD A;  3EI3 B;  2GNQ A;  4ERQ A;  4GQ2 P;  4J73 A;  2QXV A;  3SBQ A;  3IJ1 A;  4L3H D;  5SXM A;  3DSM A;  3I7O A;  5EAR A;  1A0R B;  4A11 B;  4K3I D;  3EWE A;  4ZOY A;  2CO0 A;  1OLZ A;  4A09 B;  4FA4 D;  2P26 A;  5CYK A;  3P4F A;  2VDK B;  5CXC A;  5CXC B;  4XYH A;  2YB8 B;  4ZOZ A;  2GC7 A;  2P9P C;  3NIF B;  1OMW B;  5FKS A;  2AGW A;  4FB1 D;  3F3G A;  3K27 A;  4H5J A;  2H14 A;  3MMY A;  3I7H A;  3V7D B;  2JWH A;  2HKM A;  4CI1 A;  3J80 g;  3F3F A;  4O45 A;  1TBG A;  1R5M A;  2Z2P A;  3L4M D;  3NVQ A;  5B4W A;  5TEF A;  4PXW A;  3VI4 B;  3DM0 A;  2BCJ B;  5TDH B;  3SJL D;  3BG0 A;  5HQG A;  2HJ4 A;  2P9K C;  3ZE0 B;  1NEX B;  1JOF A;  5AJA A;  4FA9 D;  3DXM C;  4ES0 A;  2AGY A;  4CY1 A;  2CNX A;  4HDJ A;  2JWG A;  4JT5 C;  3N0D A;  5HE2 B;  1MG2 A;  4PBZ A;  5IT9 g;  2OVP B;  2PM6 B;  2Z2N A;  3EI2 A;  3JRP A;  2OIZ A;  3IJC A;  1B9X A;  2J56 H;  2H9N A;  4Z7O B;  4FA5 D;  2G9A A;  3JZN A;  1K8K C;  2H68 A;  3HFQ A;  4GM9 A;  3L4O D;  4J84 A;  5EAL A;  4E54 B;  3B7F A;  2IWF A;  3NID B;  1NR0 A;  2B5M A;  3GFC A;  3EG6 A;  4A7J A;  5I5M A;  4FWW A;  3AH8 B;  2XU7 A;  4Y5R D;  3MKS B;  4JSP C;  4PC0 A;  4A08 A;  4TZ4 A;  5EMM B;  4FAN D;  5E6U B;  3C9C A;  2YMU A;  5CYK B;  3RLM D;  3C99 A;  5EMK B;  2BBK H;  4IMM A;  1SQJ A;  4N14 A;  3PE7 A;  2AQ5 A;  5FA5 B;  2IAA A;  5HDB B;  4GMB A;  4EWR A;  4H5I A;  1RI6 A;  4J0W A;  4PSW B;  4CY5 A;  1TYE B;  1PBY B;  4BUJ C;  1VYH C;  3E0C A;  2HKR A;  4J82 A;  2PM9 A;  5TF2 A;  4A0A A;  4A0A B;  5GXI A;  4UM8 B;  2P9I C;  3I7L A;  1N6F A;  4MK0 B;  2CN3 A;  5IJ8 E;  2XL2 A;  2MTA H;  4WK0 B;  3VGZ A;  2VDQ B;  5K19 A;  5E6R B;  3F3P A;  3ZWL B;  2OK6 A;  4J8B A;  3BG1 A;  2UZX B;  2VDM B;  4J78 A;  2AGZ A;  2J55 H;  4XYI A;  4A2L A;  3AL9 A;  2AGL A;  2H47 A;  3OKW A;  2H3X A;  3KRX B;  5C9Z B;  4A0B A;  3BWS A;  4E5Z B;  4QT8 A;  3ZDY B;  3SMR A;  1K32 A;  1TYQ C;  4X61 B;  1U2V C;  3A0F A;  3DWL C;  4X63 B;  2AH0 A;  2AH1 A;  3UKU C;  3T3M B;  4ESG A;  4K3J B;  3UVL A;  2HES X;  1YUK A;  3MZL A;  4Z8L A;  2B5L A;  4O1Q D;  2HJB A;  2CO0 C;  3I89 A;  5EM2 A;  4CI3 A;  2YNO A;  2YNP A;  3FRX A;  4J87 A;  5I5J A;  2H13 A;  3UVM A;  3ZE1 B;  2VC2 B;  3RSE C;  3AFC A;  4JSV C;  3FGB A;  3VI3 B;  3RRM C;  1XIP A;  4JXM A;  5E6S B;  2XYI A;  3JPX A;  4CY3 A;  1ERJ A;  2UZY B;  3SBP A;  4ERZ A;  3IKO A;  2HYE A;  4BH6 A;  5HE3 B;  3EI1 A;  4L3G D;  5C2V B;  4GGC A;  3C75 H;  4QQE A;  2OK4 A;  2YNN A;  1SSL A;  3KRW B;  5IJ7 E;  3UR4 A;  5JWZ A;  3I2N A;  3IIW A;  4CZV A;  1JJU B;  2P9L C;  4GGD A;  3JB9 L;  3SHF A;  4PSX B;  3CFV A;  4D6V A;  5GMK n;  3ULE C;  5EML B;  3CFS B;  4Z7Q B;  3MZK A;  3ZDZ B;  2B5N A;  3I7N A;  2PBI B;  1L0Q A;  5HE0 B;  1MDA H;  1FWX A;  4IA9 A;  1PEV A;  2J57 G;  3SCY A;  4CI2 A;  5C2W B;  4A08 B;  4J77 A;  4GGA A;  3RMZ D;  2IUP A;  4CZX A;  4CI8 A;  2G99 A;  1S4U X;  5IC7 A;  3PVU B;  4CY2 A;  4KFM B;  4GZ8 A;  2O9K A;  5I5I A;  3SWS D;  4CZY A;  5FKT A;  3GRE A;  4Z7N B;  3FCU B;  3EI1 B;  2PM9 B;  3RFG A;  1GXR A;  1XHM A;  2CE9 A;  3ZE2 B;  3PXW D;  2B4E A;  3MXX A;  4G56 B;  4J0X A;  3ORV D;  4CC9 A;  2I0T A;  5CXB B;  4XEI C;  3C5M A;  3EI2 B;  4JSN C;  1N6E A;  4BL0 A;  1GOT B;  3NVX A;  3UVK A;  3JZH A;  4QRJ A;  4J79 A;  5TEE A;  2VDN B;  5EMJ B;  4JD2 C;  3SN6 B;  1JMZ B;  4U7A A;  4D0K A;  3EI4 B;  3OKY B;  3OKY A;  3ZDX B;  4UM9 D;  4A0B B;  3OKT A;  4L9O A;  1XKS A;  4U1E I;  4WJK B;  4GQ1 A;  1SQ9 A;  4ZN4 A;  1GP2 B;  2IUQ A;  4I79 A;  4AOW A;  1QNI A;  4JSX C;  4LG8 A;  2H6Q A;  2P9S C;  4ZOX A;  4GQB B;  4WK2 B;  2OJY A;  5IGQ A;  3RFH A;  3EU7 A;  4JT6 C;  4A09 A;  4LG9 A;  4PNK B;  4FA1 D;  2Z2O A;  2H9P A;  1MG3 A;  4E5Z A;  3PXT D;  2TRC B;  2OVR B;  4L1Q D;  4WK4 B;  5FXY A;  3U4Y A;  5H17 A;  4J81 A;  2H9M A;  3EI3 A;  5K1C C;  5HE1 B;  3SFZ A;  5CXB A;  3I7P A;  4X3E A;  3NVN A;  3K26 A;  4OZU A;  4A11 A;  4QL1 A;  2H9L A;  3UKR C;  3JRO A;  4LGN A;  4O9D A;  3OL2 A;  4X60 B;  3I7K A;  3VH0 A;  3SVW D;  3J81 g;  1GG2 B;  5FLX g;  1U4C A;  4O3T B;  3MKQ A;  2PM7 B;  2CN2 A;  2I0R A;  3NIG B;  1YFQ A;  2IUR A;  4O3U B;  1SHY B;  3IIY A;  3IJ0 A;  2GC4 A;  4Y7R A;  5AMS A;  2I3T A;  3SXT D;  2P28 A;  4FHL A;  3PSL A;  2OVQ B;  2H6K A;  2HXC A;  5H14 A;  5KDO B;  2P9U C;  2I0S A;  2W18 A;  2P9N C;  5FKR A;  3SBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...