4QAMA

Crystal structure of the rpgr rcc1-like domain in complex with the rpgr-interacting domain of rpgrip1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
364
structure length
364
Chain Sequence
ELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWVSCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X-linked retinitis pigmentosa GTPase regulator
publication title C2 domains as protein-protein interaction modules in the ciliary transition zone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 105
structure length 364
sequence length 364
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4qamA00
3QHYB 3OF7A 4NBMA 4QAMA 3QI0A 4JHPC 1JTDB 4DNWA 1I2MB 4O2WA 4JHNA 4NAAA 4L1MA 3MVDK 3KCIA 4NC4A 4DNVA 4D9SA 4DNUA 1A12A
chains in the Genus database with same CATH superfamily
2AGYA 4XYIA 4BP9A 2VDLA 5FFGA 5IJ8E 4X61B 5TF2A 5KDOB 2BBKH 3EWEA 2CE9A 3V5WB 1Q47A 1JJUB 3W15A 2W18A 2G99A 2YB8B 2O9KA 3OKWA 4G1MA 1JV2A 2XE4A 2YNNA 1VE7A 5M5SA 2VDOA 1N6DA 5FQDA 4WK4A 2EIEA 4E5ZB 3OKTA 3MZLA 5IT9g 5TEFA 3IULA 3EI4A 3MMYA 5EMKB 4WK0A 4AX4A 2PBIB 3GFCA 3C99A 3N0EA 1SHYB 4RE5A 3EQ7A 3UVMA 1C9IA 1QNIA 3SMRA 3JROA 5GXHA 2J56H 2CN3A 2GNQA 2VC2A 3VI4A 4GM8A 4JHNA 5I5IA 4CY5A 3EI1A 2HKRA 3I8EA 4BP8A 3N0DA 4H5IA 2IUQA 4GQ2P 4DNUA 4YVDA 3ZDXA 5FKRA 2EICA 4ESGA 3KRWB 5EARA 1L0QA 3FCSA 3SFZA 1TYQC 3V7DB 5SXMA 3QHYB 3E0CA 1P22A 3O4GA 2G9AA 3I89A 3A0FA 4RE6A 4JT5C 4CY2A 1I2MB 4ZOXA 4Y5RD 4OWRA 3UKUC 3NVNA 4WJKA 4ERZA 2H68A 3NIDA 4U7AA 2H3XA 3IJEA 4E54A 3I7KA 4L3GD 1K8KC 3JB9L 2YNPA 1K32A 3P4FA 3NVXA 3EQ8A 1PI6A 2CN2A 1QFMA 5AMSA 2P9PC 1N6EA 3JAMg 3UVLA 1MG2A 5IJ7E 2PM9B 3IUQA 4IRZA 1S4UX 4JD2C 3VGZA 2I0TA 4PBYA 2OJYA 3SN6B 4D9SA 2PM6B 2H9LA 4G56B 1E8MA 4GGCA 1JMZB 3PE7A 5CXBB 3K26A 4BH6A 3RN0D 4PSXB 3I7PA 4I79A 4TZ4A 5JWZA 2EIBA 4J0WA 2AGZA 4ZOVA 3QI0A 2H9MA 4PXWA 3SJLD 3SVWD 4IMMA 4J79A 3RN1D 3K71A 2IUPA 2J57G 2QZPA 3BWSA 5TEEA 3ZE1A 5IGQA 4J8GA 5H17A 3AL9A 2VZ1A 1GP2B 3MVDK 1A0RB 3ZDZA 3RLMD 2OVPB 3VA6A 5CXCB 2CO0A 5B4WA 2H13A 3IUJA 3V4PA 4GQBB 4A0AB 4NBMA 3EQ9A 2VDNA 2VDPA 3I7LA 4CI2A 2JKXA 4X3EA 3DXKC 5M5VA 4AEZA 3F3GA 3ZWLB 4LG9A 1XIPA 3EI2B 3OL2A 2XL3A 4O3UB 2HXCA 4DNVA 2I3SA 5EM2A 1C9LA 2QC5A 1T2XA 4J86A 2HU5A 2VZ3A 4AN1A 4J82A 2PM7B 3J80g 1QFSA 4J87A 3ORVD 5C9ZB 4IA9A 1GOTB 4L1QD 4FHLA 5A2Qg 5HYNB 4A09A 3F3FA 4XEIC 3SBPA 3VH0A 4GM9A 4Z7NA 2H6QA 5EAMA 4O1QD 5HE1B 2IWKA 3OTTA 2Z2NA 3SXTD 3EI3A 3SLED 2MTAH 2VDMA 4A2MA 4NAAA 4AOWA 5FKSA 2P9IC 1JOFA 3AL8A 1BPOA 3NIGA 4FWWA 2CE8A 1PGUA 2AQ5A 2IURA 4LG8A 2EIDA 3MUNA 3UVNA 2AGLA 1GOFA 3MXXA 3MKQA 4CI8A 3PXTD 5C86A 2AGWA 5THAA 4PBZA 1MG3A 2XZGA 4JSPC 2P9KC 4XYHA 3V9FA 1U2VC 3EI4B 3EG6A 3OF7A 3O4HA 3CFVA 3KRXB 1GG2B 4A08A 4U1EI 4ZN4A 3IIWA 4HDJA 1ERJA 4CY3A 3O4JA 3DXMC 3IJ1A 2OVQB 3RFHA 3GREA 4X60B 3UVKA 4ES0A 4GGAA 1YFQA 3EI1B 2P9UC 2H9NA 3SCYA 4BL0A 4UM9A 1OMWB 3K6SA 4NSXA 3VI3A 3OKYA 2Z2PA 4D6VA 1B9XA 3I7HA 3ZDYA 2XYIA 5M61A 3HFQA 4A11A 4FA5D 4O3TB 4R7AB 4G55A 4CZXA 4MK0B 4K3ID 3SHFA 3ZE0A 4CZVA 4BUJC 3ZE2A 4PSWB 1GXRA 4J78A 5I5JA 5EALA 5HE2B 4ERYA 4BCDA 2Q7QA 3IKOA 3JRPA 3RFGA 2QR5A 5E6UA 1L5GA 4Z7OA 4E54B 3IUNA 5HE0B 4CI3A 1XKSA 3T3MA 3DSMA 1H2WA 3JZGA 1XHMA 4GQ1A 4JXMA 2IUVA 2GC7A 2OIZA 3UR4A 1VYHC 5EMJB 4DNWA 3U4YA 2BKLA 1E5TA 4L9OA 4A0BA 2VDKA 5K1CC 4FB1D 2AH0A 2IAAA 5IC7A 1H2XA 1UOPA 4FA4D 3C75H 2OK6A 3FCUA 2AH1A 1UOQA 2H6NA 2P9SC 3PSCB 3IUMA 5CYKA 3IURA 1B9YA 5TDHB 4J0XA 4UI9R 4J84A 5HDBA 3V4VA 1TBGA 4EWRA 3IIYA 1E8NA 4O9DA 2IWFA 1OLZA 5FXYA 4MMZA 1JTDB 5C2VB 4CZYA 4CC9A 4AN0A 2VDRA 2OVRB 4O2WA 2HKMA 3IJ0A 3L4OD 3K72A 3EMHA 3AH8B 3SBRA 2YBAA 4G1EA 3JPXA 4QL1A 2HYEA 4FA1D 4O45A 5FKQA 2YNOA 3FRXA 4JSNC 4ERQA 2J55H 2HESX 2VDQA 2B5NA 4ZOYA 4JSVC 2B4EA 2WQ8A 3I7NA 3BG1A 2UZYB 3B7FA 3OW8A 2YMUA 5EMMB 2P9LC 5M5UA 3GD1I 4KFMB 5GSAA 3FGBA 1RI6A 4WK2A 5AFU3 4ZOZA 1NR0A 4L1MA 4QQEA 4UM8A 4A7JA 3J81g 2I3TA 2CO0C 3T3PA 4AMYA 1U4CA 2H9PA 2HU7A 1U8CA 3OL2B 5HQGA 4N14A 5EM2B 1SQ9A 5I5MA 2B5MA 1YR2A 4X63B 2H6KA 3SWSD 3UKRC 2OK4A 1O6FA 4A09B 4CI1A 2EBSA 3BG0A 3C5MA 3EU7A 4NENA 4Y7RA 2XL2A 1FWXA 2QXVA 4A2LA 1VZ3A 3RRMC 3NVQA 4QRJA 4J77A 4PC0A 3GC3B 3O4IA 3DDUA 3PXSD 3EI3B 3L4MD 5FKTA 5FFOA 3MKSB 5GXIA 4QT8A 3RMZD 1NEXB 3AL8B 3CFSB 3PVUB 5K19A 4FA9D 3IJCA 2PM9A 2XU7A 4Z7QA 3I2NA 5AJAA 1SQJA 3NIFA 4JHPC 4BCBA 5M5TA 4AMZA 1N6FA 4J81A 3RSEC 4A08B 4GMBA 3PSLA 4FAVD 3ULEC 1VZ2A 5EAPA 1M1XA 1MDAH 3JZNA 2XDWA 3MUOA 4BCCA 1K3IA 4OZUA 5CXBA 2P9NC 4CY1A 3MZKA 5H14A 5C92A 2HU8A 4LGNA 4H5JA 4J73A 1PBYB 4GZ8A 4JT6C 4GGDA 5H1MA 5FA5B 4PNKB 2H47A 3I7OA 1GOHA 3OKYB 5FLXg 5IGOA 1H2YA 3PXWD 4JSXC 3ODTA 3IVMA 1TYEA 4A11B 2AGXA 3SBQA 3F3PA 3UVOA 2Z2OA 4O02A 3I8CA 3FM0A 2UZXB 3KCIA 3PVWB 5CXCA 2B5LA 3AFCA 1A12A 2CNXA 5C2WB 4L3HD 4MMXA 4FAND 4J8BA 2BCJB 2HJBA 2I0RA 5EMLB 3DM0A 4A0AA 3C9CA 4QAMA 3JZHA 2H14A 4MMYA 2GC4A 1R5MA 1H2ZA 2TRCB 2HJ4A 3EI2A 3CIKB 5M5RA 4A0BB 3DWLC 1GOGA 5GMKn 1PEVA 1UTCA 3K27A 4NC4A 1JMXB 2I0SA 4D0KA 4E5ZA 4GM3A 4K3JB 5E6SA 1O6GA 1UOOA 5E6RA 5CYKB 1VE6A 5HE3B 4Z8LA
chains in the Genus database with same CATH topology
3QHYB 3OF7A 4NBMA 4QAMA 3QI0A 4JHPC 1JTDB 4DNWA 1I2MB 4O2WA 4JHNA 4NAAA 4L1MA 3MVDK 3KCIA 4NC4A 4DNVA 4D9SA 4DNUA 1A12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHY B;  3OF7 A;  4NBM A;  4QAM A;  3QI0 A;  4JHP C;  1JTD B;  4DNW A;  1I2M B;  4O2W A;  4JHN A;  4NAA A;  4L1M A;  3MVD K;  3KCI A;  4NC4 A;  4DNV A;  4D9S A;  4DNU A;  1A12 A; 
#chains in the Genus database with same CATH topology
 2AGY A;  4XYI A;  4BP9 A;  2VDL A;  5FFG A;  5IJ8 E;  4X61 B;  5TF2 A;  5KDO B;  2BBK H;  3EWE A;  2CE9 A;  3V5W B;  1Q47 A;  1JJU B;  3W15 A;  2W18 A;  2G99 A;  2YB8 B;  2O9K A;  3OKW A;  4G1M A;  1JV2 A;  2XE4 A;  2YNN A;  1VE7 A;  5M5S A;  2VDO A;  1N6D A;  5FQD A;  4WK4 A;  2EIE A;  4E5Z B;  3OKT A;  3MZL A;  5IT9 g;  5TEF A;  3IUL A;  3EI4 A;  3MMY A;  5EMK B;  4WK0 A;  4AX4 A;  2PBI B;  3GFC A;  3C99 A;  3N0E A;  1SHY B;  4RE5 A;  3EQ7 A;  3UVM A;  1C9I A;  1QNI A;  3SMR A;  3JRO A;  5GXH A;  2J56 H;  2CN3 A;  2GNQ A;  2VC2 A;  3VI4 A;  4GM8 A;  4JHN A;  5I5I A;  4CY5 A;  3EI1 A;  2HKR A;  3I8E A;  4BP8 A;  3N0D A;  4H5I A;  2IUQ A;  4GQ2 P;  4DNU A;  4YVD A;  3ZDX A;  5FKR A;  2EIC A;  4ESG A;  3KRW B;  5EAR A;  1L0Q A;  3FCS A;  3SFZ A;  1TYQ C;  3V7D B;  5SXM A;  3QHY B;  3E0C A;  1P22 A;  3O4G A;  2G9A A;  3I89 A;  3A0F A;  4RE6 A;  4JT5 C;  4CY2 A;  1I2M B;  4ZOX A;  4Y5R D;  4OWR A;  3UKU C;  3NVN A;  4WJK A;  4ERZ A;  2H68 A;  3NID A;  4U7A A;  2H3X A;  3IJE A;  4E54 A;  3I7K A;  4L3G D;  1K8K C;  3JB9 L;  2YNP A;  1K32 A;  3P4F A;  3NVX A;  3EQ8 A;  1PI6 A;  2CN2 A;  1QFM A;  5AMS A;  2P9P C;  1N6E A;  3JAM g;  3UVL A;  1MG2 A;  5IJ7 E;  2PM9 B;  3IUQ A;  4IRZ A;  1S4U X;  4JD2 C;  3VGZ A;  2I0T A;  4PBY A;  2OJY A;  3SN6 B;  4D9S A;  2PM6 B;  2H9L A;  4G56 B;  1E8M A;  4GGC A;  1JMZ B;  3PE7 A;  5CXB B;  3K26 A;  4BH6 A;  3RN0 D;  4PSX B;  3I7P A;  4I79 A;  4TZ4 A;  5JWZ A;  2EIB A;  4J0W A;  2AGZ A;  4ZOV A;  3QI0 A;  2H9M A;  4PXW A;  3SJL D;  3SVW D;  4IMM A;  4J79 A;  3RN1 D;  3K71 A;  2IUP A;  2J57 G;  2QZP A;  3BWS A;  5TEE A;  3ZE1 A;  5IGQ A;  4J8G A;  5H17 A;  3AL9 A;  2VZ1 A;  1GP2 B;  3MVD K;  1A0R B;  3ZDZ A;  3RLM D;  2OVP B;  3VA6 A;  5CXC B;  2CO0 A;  5B4W A;  2H13 A;  3IUJ A;  3V4P A;  4GQB B;  4A0A B;  4NBM A;  3EQ9 A;  2VDN A;  2VDP A;  3I7L A;  4CI2 A;  2JKX A;  4X3E A;  3DXK C;  5M5V A;  4AEZ A;  3F3G A;  3ZWL B;  4LG9 A;  1XIP A;  3EI2 B;  3OL2 A;  2XL3 A;  4O3U B;  2HXC A;  4DNV A;  2I3S A;  5EM2 A;  1C9L A;  2QC5 A;  1T2X A;  4J86 A;  2HU5 A;  2VZ3 A;  4AN1 A;  4J82 A;  2PM7 B;  3J80 g;  1QFS A;  4J87 A;  3ORV D;  5C9Z B;  4IA9 A;  1GOT B;  4L1Q D;  4FHL A;  5A2Q g;  5HYN B;  4A09 A;  3F3F A;  4XEI C;  3SBP A;  3VH0 A;  4GM9 A;  4Z7N A;  2H6Q A;  5EAM A;  4O1Q D;  5HE1 B;  2IWK A;  3OTT A;  2Z2N A;  3SXT D;  3EI3 A;  3SLE D;  2MTA H;  2VDM A;  4A2M A;  4NAA A;  4AOW A;  5FKS A;  2P9I C;  1JOF A;  3AL8 A;  1BPO A;  3NIG A;  4FWW A;  2CE8 A;  1PGU A;  2AQ5 A;  2IUR A;  4LG8 A;  2EID A;  3MUN A;  3UVN A;  2AGL A;  1GOF A;  3MXX A;  3MKQ A;  4CI8 A;  3PXT D;  5C86 A;  2AGW A;  5THA A;  4PBZ A;  1MG3 A;  2XZG A;  4JSP C;  2P9K C;  4XYH A;  3V9F A;  1U2V C;  3EI4 B;  3EG6 A;  3OF7 A;  3O4H A;  3CFV A;  3KRX B;  1GG2 B;  4A08 A;  4U1E I;  4ZN4 A;  3IIW A;  4HDJ A;  1ERJ A;  4CY3 A;  3O4J A;  3DXM C;  3IJ1 A;  2OVQ B;  3RFH A;  3GRE A;  4X60 B;  3UVK A;  4ES0 A;  4GGA A;  1YFQ A;  3EI1 B;  2P9U C;  2H9N A;  3SCY A;  4BL0 A;  4UM9 A;  1OMW B;  3K6S A;  4NSX A;  3VI3 A;  3OKY A;  2Z2P A;  4D6V A;  1B9X A;  3I7H A;  3ZDY A;  2XYI A;  5M61 A;  3HFQ A;  4A11 A;  4FA5 D;  4O3T B;  4R7A B;  4G55 A;  4CZX A;  4MK0 B;  4K3I D;  3SHF A;  3ZE0 A;  4CZV A;  4BUJ C;  3ZE2 A;  4PSW B;  1GXR A;  4J78 A;  5I5J A;  5EAL A;  5HE2 B;  4ERY A;  4BCD A;  2Q7Q A;  3IKO A;  3JRP A;  3RFG A;  2QR5 A;  5E6U A;  1L5G A;  4Z7O A;  4E54 B;  3IUN A;  5HE0 B;  4CI3 A;  1XKS A;  3T3M A;  3DSM A;  1H2W A;  3JZG A;  1XHM A;  4GQ1 A;  4JXM A;  2IUV A;  2GC7 A;  2OIZ A;  3UR4 A;  1VYH C;  5EMJ B;  4DNW A;  3U4Y A;  2BKL A;  1E5T A;  4L9O A;  4A0B A;  2VDK A;  5K1C C;  4FB1 D;  2AH0 A;  2IAA A;  5IC7 A;  1H2X A;  1UOP A;  4FA4 D;  3C75 H;  2OK6 A;  3FCU A;  2AH1 A;  1UOQ A;  2H6N A;  2P9S C;  3PSC B;  3IUM A;  5CYK A;  3IUR A;  1B9Y A;  5TDH B;  4J0X A;  4UI9 R;  4J84 A;  5HDB A;  3V4V A;  1TBG A;  4EWR A;  3IIY A;  1E8N A;  4O9D A;  2IWF A;  1OLZ A;  5FXY A;  4MMZ A;  1JTD B;  5C2V B;  4CZY A;  4CC9 A;  4AN0 A;  2VDR A;  2OVR B;  4O2W A;  2HKM A;  3IJ0 A;  3L4O D;  3K72 A;  3EMH A;  3AH8 B;  3SBR A;  2YBA A;  4G1E A;  3JPX A;  4QL1 A;  2HYE A;  4FA1 D;  4O45 A;  5FKQ A;  2YNO A;  3FRX A;  4JSN C;  4ERQ A;  2J55 H;  2HES X;  2VDQ A;  2B5N A;  4ZOY A;  4JSV C;  2B4E A;  2WQ8 A;  3I7N A;  3BG1 A;  2UZY B;  3B7F A;  3OW8 A;  2YMU A;  5EMM B;  2P9L C;  5M5U A;  3GD1 I;  4KFM B;  5GSA A;  3FGB A;  1RI6 A;  4WK2 A;  5AFU 3;  4ZOZ A;  1NR0 A;  4L1M A;  4QQE A;  4UM8 A;  4A7J A;  3J81 g;  2I3T A;  2CO0 C;  3T3P A;  4AMY A;  1U4C A;  2H9P A;  2HU7 A;  1U8C A;  3OL2 B;  5HQG A;  4N14 A;  5EM2 B;  1SQ9 A;  5I5M A;  2B5M A;  1YR2 A;  4X63 B;  2H6K A;  3SWS D;  3UKR C;  2OK4 A;  1O6F A;  4A09 B;  4CI1 A;  2EBS A;  3BG0 A;  3C5M A;  3EU7 A;  4NEN A;  4Y7R A;  2XL2 A;  1FWX A;  2QXV A;  4A2L A;  1VZ3 A;  3RRM C;  3NVQ A;  4QRJ A;  4J77 A;  4PC0 A;  3GC3 B;  3O4I A;  3DDU A;  3PXS D;  3EI3 B;  3L4M D;  5FKT A;  5FFO A;  3MKS B;  5GXI A;  4QT8 A;  3RMZ D;  1NEX B;  3AL8 B;  3CFS B;  3PVU B;  5K19 A;  4FA9 D;  3IJC A;  2PM9 A;  2XU7 A;  4Z7Q A;  3I2N A;  5AJA A;  1SQJ A;  3NIF A;  4JHP C;  4BCB A;  5M5T A;  4AMZ A;  1N6F A;  4J81 A;  3RSE C;  4A08 B;  4GMB A;  3PSL A;  4FAV D;  3ULE C;  1VZ2 A;  5EAP A;  1M1X A;  1MDA H;  3JZN A;  2XDW A;  3MUO A;  4BCC A;  1K3I A;  4OZU A;  5CXB A;  2P9N C;  4CY1 A;  3MZK A;  5H14 A;  5C92 A;  2HU8 A;  4LGN A;  4H5J A;  4J73 A;  1PBY B;  4GZ8 A;  4JT6 C;  4GGD A;  5H1M A;  5FA5 B;  4PNK B;  2H47 A;  3I7O A;  1GOH A;  3OKY B;  5FLX g;  5IGO A;  1H2Y A;  3PXW D;  4JSX C;  3ODT A;  3IVM A;  1TYE A;  4A11 B;  2AGX A;  3SBQ A;  3F3P A;  3UVO A;  2Z2O A;  4O02 A;  3I8C A;  3FM0 A;  2UZX B;  3KCI A;  3PVW B;  5CXC A;  2B5L A;  3AFC A;  1A12 A;  2CNX A;  5C2W B;  4L3H D;  4MMX A;  4FAN D;  4J8B A;  2BCJ B;  2HJB A;  2I0R A;  5EML B;  3DM0 A;  4A0A A;  3C9C A;  4QAM A;  3JZH A;  2H14 A;  4MMY A;  2GC4 A;  1R5M A;  1H2Z A;  2TRC B;  2HJ4 A;  3EI2 A;  3CIK B;  5M5R A;  4A0B B;  3DWL C;  1GOG A;  5GMK n;  1PEV A;  1UTC A;  3K27 A;  4NC4 A;  1JMX B;  2I0S A;  4D0K A;  4E5Z A;  4GM3 A;  4K3J B;  5E6S A;  1O6G A;  1UOO A;  5E6R A;  5CYK B;  1VE6 A;  5HE3 B;  4Z8L A; 
#chains in the Genus database with same CATH homology
 3QHY B;  3OF7 A;  4NBM A;  4QAM A;  3QI0 A;  4JHP C;  1JTD B;  4DNW A;  1I2M B;  4O2W A;  4JHN A;  4NAA A;  4L1M A;  3MVD K;  3KCI A;  4NC4 A;  4DNV A;  4D9S A;  4DNU A;  1A12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...