4QAMA

Crystal structure of the rpgr rcc1-like domain in complex with the rpgr-interacting domain of rpgrip1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
364
structure length
364
Chain Sequence
ELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWVSCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C2 domains as protein-protein interaction modules in the ciliary transition zone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords X-linked retinitis pigmentosa GTPase regulator
total genus 105
structure length 364
sequence length 364
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4qamA00
3OF7A 1I2MB 4NBMA 4DNUA 4NC4A 4L1MA 1JTDB 3KCIA 3QHYB 4JHNA 4O2WA 4D9SA 4DNWA 3QI0A 4JHPC 4NAAA 4DNVA 3MVDK 1A12A 4QAMA
chains in the Genus database with same CATH superfamily
2CO0C 4XYHA 2YB8B 5FKQA 1MDAH 1UOQA 4MK0B 2HESX 3IJ1A 1VZ3A 4J78A 3RN1D 2HJBA 5HYNB 3RLMD 5TEEA 5HE0B 2H6QA 4GM8A 3K6SA 1M1XA 4MMYA 1GOFA 4X63B 3IULA 2JKXA 5E6RA 4J81A 2AH0A 4DNUA 2VDRA 2QC5A 4GGCA 3FRXA 3I2NA 1QNIA 2YNNA 3JRPA 5HQGA 4X3EA 4L3HD 3IJCA 3ZDZA 1MG3A 4L9OA 2TRCB 1GOHA 5E6SA 5THAA 4DNVA 3VH0A 2H6NA 4N14A 5JWZA 4ES0A 3JAMg 3ZE0A 1YFQA 1QFMA 4KFMB 3I89A 3DDUA 3EI1A 1PGUA 3O4IA 5IGQA 5CYKB 1XKSA 1OLZA 3IVMA 3I7OA 3DXKC 4IA9A 3OW8A 2QXVA 4JSVC 3EQ9A 2Z2OA 3O4JA 4GMBA 3T3PA 4JHNA 4FB1D 2I3TA 4D0KA 4FWWA 3NVXA 5FA5B 2MTAH 5CYKA 4O45A 4WJKA 1JJUB 5EAPA 3E0CA 2G9AA 2B4EA 4J0WA 3RRMC 2GC7A 5EALA 5M61A 3AL9A 5I5MA 3SXTD 3V9FA 4BP9A 4MMXA 3MXXA 2QZPA 1C9IA 3IUQA 3PE7A 4EWRA 2H9PA 3NIGA 1U8CA 4ERZA 5IGOA 1A12A 2H3XA 2EIDA 2CNXA 4QL1A 1SQ9A 2XYIA 3EQ8A 3PVUB 3I7KA 3PXTD 3U4YA 2B5NA 3EI3A 2GC4A 3SBPA 4PBZA 3ODTA 4AN0A 3OKYA 1GG2B 1YR2A 4XEIC 4PNKB 1L0QA 5A2Qg 3JZHA 3UVMA 3I8EA 3HFQA 4U1EI 4J8BA 3FCSA 3N0EA 4CZVA 2O9KA 1GXRA 5HDBA 3EI1B 1PI6A 1U4CA 2I0SA 3F3GA 4JT6C 4JD2C 2XZGA 3GREA 3IJ0A 3O4HA 1XIPA 4GQ1A 5H14A 1VZ2A 1K32A 4HDJA 3PVWB 5EMKB 4BUJC 3MUOA 1JMXB 2EICA 4Y5RD 4ZOXA 2J56H 3RN0D 1JTDB 4TZ4A 2AH1A 4E54B 3N0DA 1VE6A 3W15A 4A08B 2H6KA 4G1EA 2Z2NA 3BWSA 2VDMA 3MZKA 4K3ID 4H5IA 1ERJA 4NENA 1N6FA 4CI8A 3CFSB 5C9ZB 4LG9A 4ZOVA 3SLED 4G55A 4PXWA 4FA9D 1OMWB 1TBGA 2IUVA 2VDNA 2P9UC 5AMSA 3NIFA 4CI3A 4NSXA 3UKUC 5M5TA 4GQBB 2I0RA 3EWEA 4LGNA 3T3MA 4A09B 3A0FA 5FXYA 4R7AB 3IIWA 5FKTA 2VDLA 1O6GA 1TYQC 3RFGA 1NR0A 4BL0A 5K19A 4JSXC 1BPOA 3PSCB 1K3IA 1QFSA 2VC2A 1VE7A 1PEVA 4UM8A 5FFOA 4J87A 5AJAA 2PBIB 2HU5A 3ZE2A 3BG0A 2VDOA 4ZN4A 4BP8A 2OK4A 4RE5A 2VZ3A 4I79A 4PC0A 4FA1D 2P9LC 5GMKn 5B4WA 3OKWA 4A2LA 3AL8A 5M5RA 2H9NA 3EI2A 2AGYA 4WK4A 4FHLA 2B5LA 4AN1A 5CXCA 3FM0A 3UVNA 4NAAA 3MVDK 2CN3A 3C9CA 1FWXA 2IUPA 3MKSB 4D9SA 4OZUA 3IIYA 3OKYB 4PSXB 4GQ2P 5C2VB 4X61B 3JPXA 1H2YA 3SJLD 1H2XA 1S4UX 3DXMC 3ZE1A 2WQ8A 3RSEC 4QRJA 3SHFA 5I5JA 5TEFA 2PM9A 4CI2A 4O3TB 4A0BB 3F3FA 4J84A 4LG8A 4BCCA 3C99A 5EMMB 2P9PC 4J0XA 2XDWA 3MKQA 1I2MB 1XHMA 3IUNA 2YMUA 3GFCA 5CXBB 2W18A 5GSAA 3K26A 2P9SC 3VI4A 2I3SA 2CN2A 1N6EA 1UOPA 4GM9A 2AGZA 2XE4A 4A08A 3OL2A 5M5SA 4A0BA 3KCIA 2PM9B 2XL3A 1U2VC 3MZLA 5CXBA 4ERQA 5IT9g 3CIKB 2AGXA 3L4MD 3C75H 3RMZD 2HU8A 3EQ7A 4MMZA 4GZ8A 4A7JA 1P22A 3EMHA 3EI3B 2BCJB 3VI3A 4Z7NA 2HXCA 4AOWA 2VDKA 4O1QD 4PBYA 2YNPA 3DSMA 5C86A 3J80g 4E5ZB 3UR4A 2PM6B 4G1MA 2OVQB 5C2WB 3K71A 3EU7A 5IJ7E 1NEXB 2EIBA 3V5WB 4GGAA 2J55H 3BG1A 5EAMA 3IKOA 4QQEA 2CO0A 2H9LA 4A0AB 5M5VA 3GC3B 5EARA 4CZXA 1Q47A 4UI9R 2H13A 5EM2B 4JSPC 4CY2A 2AGLA 4L1MA 3ZDXA 4J77A 3O4GA 3SCYA 1B9YA 4H5JA 4AEZA 2HJ4A 5I5IA 4IMMA 5E6UA 2B5MA 4CZYA 5IJ8E 4AX4A 1H2ZA 4ZOZA 4E5ZA 2IUQA 5GXIA 4A11A 4DNWA 4Z8LA 4JHPC 4FA5D 1JV2A 3SFZA 3SBQA 3AL8B 4NC4A 1E8MA 3UVKA 2HU7A 4FAND 3IJEA 4J86A 2IWKA 5HE3B 5EMLB 3K27A 2Q7QA 3OL2B 5GXHA 2PM7B 3I8CA 2H9MA 2IURA 5FFGA 4AMZA 5FKSA 4CY5A 2OJYA 3AH8B 5EM2A 3UKRC 2CE9A 3SVWD 1C9LA 3OTTA 1A0RB 3GD1I 2EBSA 3VGZA 3I7HA 4QT8A 3NVNA 3OKTA 2GNQA 4X60B 2XU7A 2UZXB 2VZ1A 3ORVD 3K72A 3SBRA 2VDPA 2OK6A 1L5GA 3IURA 3FGBA 3EI4A 3IUJA 4PSWB 3JB9L 1H2WA 4NBMA 1GOTB 3B7FA 5M5UA 3JZNA 5FQDA 4U7AA 4Y7RA 4J79A 5IC7A 5FKRA 3PXSD 2OVRB 1VYHC 2OVPB 2AGWA 3PSLA 3AFCA 5TF2A 3V7DB 1T2XA 5EMJB 5CXCB 1GP2B 2BBKH 3I7PA 4J82A 3J81g 2UZYB 3EI2B 3DWLC 5K1CC 1N6DA 3KRXB 3OF7A 2Z2PA 4L1QD 2IWFA 3ZWLB 1UOOA 4J73A 4WK0A 3V4PA 4O02A 4QAMA 3CFVA 2H68A 3MUNA 4JT5C 2YNOA 5HE2B 2YBAA 2IAAA 1K8KC 3NIDA 4FAVD 3C5MA 4JXMA 1UTCA 4UM9A 4Z7QA 4RE6A 4WK2A 1E5TA 4BCDA 1MG2A 2J57G 1JMZB 2P9NC 1R5MA 3UVLA 3NVQA 4XYIA 5TDHB 4GM3A 4O9DA 4L3GD 4D6VA 2XL2A 3QI0A 2EIEA 3ULEC 5SXMA 3L4OD 3SN6B 4CI1A 4A0AA 4CY1A 3EG6A 4AMYA 2H14A 3EI4B 3IUMA 3DM0A 2I0TA 5C92A 4ERYA 3F3PA 4FA4D 4Z7OA 2OIZA 3MMYA 2H47A 4CY3A 4CC9A 2P9KC 4A09A 1GOGA 3ZDYA 1TYEA 2G99A 3JROA 4OWRA 5AFU3 3V4VA 1E8NA 5KDOB 3JZGA 1SHYB 1JOFA 1O6FA 2BKLA 4JSNC 3UVOA 1RI6A 3I7NA 4BH6A 3KRWB 3SMRA 3I7LA 2QR5A 3P4FA 2HKMA 4E54A 2VDQA 2P9IC 2CE8A 1SQJA 4G56B 5H1MA 4BCBA 4IRZA 5FLXg 2HYEA 4GGDA 2HKRA 1B9XA 4YVDA 4J8GA 5HE1B 3FCUA 4A11B 3RFHA 4O3UB 2AQ5A 4O2WA 3QHYB 1PBYB 3VA6A 4ESGA 4K3JB 3SWSD 4ZOYA 5H17A 3PXWD 4A2MA
chains in the Genus database with same CATH topology
3OF7A 1I2MB 4NBMA 4DNUA 4NC4A 4L1MA 1JTDB 3KCIA 3QHYB 4JHNA 4O2WA 4D9SA 4DNWA 3QI0A 4JHPC 4NAAA 4DNVA 3MVDK 1A12A 4QAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF7 A;  1I2M B;  4NBM A;  4DNU A;  4NC4 A;  4L1M A;  1JTD B;  3KCI A;  3QHY B;  4JHN A;  4O2W A;  4D9S A;  4DNW A;  3QI0 A;  4JHP C;  4NAA A;  4DNV A;  3MVD K;  1A12 A;  4QAM A; 
#chains in the Genus database with same CATH topology
 2CO0 C;  4XYH A;  2YB8 B;  5FKQ A;  1MDA H;  1UOQ A;  4MK0 B;  2HES X;  3IJ1 A;  1VZ3 A;  4J78 A;  3RN1 D;  2HJB A;  5HYN B;  3RLM D;  5TEE A;  5HE0 B;  2H6Q A;  4GM8 A;  3K6S A;  1M1X A;  4MMY A;  1GOF A;  4X63 B;  3IUL A;  2JKX A;  5E6R A;  4J81 A;  2AH0 A;  4DNU A;  2VDR A;  2QC5 A;  4GGC A;  3FRX A;  3I2N A;  1QNI A;  2YNN A;  3JRP A;  5HQG A;  4X3E A;  4L3H D;  3IJC A;  3ZDZ A;  1MG3 A;  4L9O A;  2TRC B;  1GOH A;  5E6S A;  5THA A;  4DNV A;  3VH0 A;  2H6N A;  4N14 A;  5JWZ A;  4ES0 A;  3JAM g;  3ZE0 A;  1YFQ A;  1QFM A;  4KFM B;  3I89 A;  3DDU A;  3EI1 A;  1PGU A;  3O4I A;  5IGQ A;  5CYK B;  1XKS A;  1OLZ A;  3IVM A;  3I7O A;  3DXK C;  4IA9 A;  3OW8 A;  2QXV A;  4JSV C;  3EQ9 A;  2Z2O A;  3O4J A;  4GMB A;  3T3P A;  4JHN A;  4FB1 D;  2I3T A;  4D0K A;  4FWW A;  3NVX A;  5FA5 B;  2MTA H;  5CYK A;  4O45 A;  4WJK A;  1JJU B;  5EAP A;  3E0C A;  2G9A A;  2B4E A;  4J0W A;  3RRM C;  2GC7 A;  5EAL A;  5M61 A;  3AL9 A;  5I5M A;  3SXT D;  3V9F A;  4BP9 A;  4MMX A;  3MXX A;  2QZP A;  1C9I A;  3IUQ A;  3PE7 A;  4EWR A;  2H9P A;  3NIG A;  1U8C A;  4ERZ A;  5IGO A;  1A12 A;  2H3X A;  2EID A;  2CNX A;  4QL1 A;  1SQ9 A;  2XYI A;  3EQ8 A;  3PVU B;  3I7K A;  3PXT D;  3U4Y A;  2B5N A;  3EI3 A;  2GC4 A;  3SBP A;  4PBZ A;  3ODT A;  4AN0 A;  3OKY A;  1GG2 B;  1YR2 A;  4XEI C;  4PNK B;  1L0Q A;  5A2Q g;  3JZH A;  3UVM A;  3I8E A;  3HFQ A;  4U1E I;  4J8B A;  3FCS A;  3N0E A;  4CZV A;  2O9K A;  1GXR A;  5HDB A;  3EI1 B;  1PI6 A;  1U4C A;  2I0S A;  3F3G A;  4JT6 C;  4JD2 C;  2XZG A;  3GRE A;  3IJ0 A;  3O4H A;  1XIP A;  4GQ1 A;  5H14 A;  1VZ2 A;  1K32 A;  4HDJ A;  3PVW B;  5EMK B;  4BUJ C;  3MUO A;  1JMX B;  2EIC A;  4Y5R D;  4ZOX A;  2J56 H;  3RN0 D;  1JTD B;  4TZ4 A;  2AH1 A;  4E54 B;  3N0D A;  1VE6 A;  3W15 A;  4A08 B;  2H6K A;  4G1E A;  2Z2N A;  3BWS A;  2VDM A;  3MZK A;  4K3I D;  4H5I A;  1ERJ A;  4NEN A;  1N6F A;  4CI8 A;  3CFS B;  5C9Z B;  4LG9 A;  4ZOV A;  3SLE D;  4G55 A;  4PXW A;  4FA9 D;  1OMW B;  1TBG A;  2IUV A;  2VDN A;  2P9U C;  5AMS A;  3NIF A;  4CI3 A;  4NSX A;  3UKU C;  5M5T A;  4GQB B;  2I0R A;  3EWE A;  4LGN A;  3T3M A;  4A09 B;  3A0F A;  5FXY A;  4R7A B;  3IIW A;  5FKT A;  2VDL A;  1O6G A;  1TYQ C;  3RFG A;  1NR0 A;  4BL0 A;  5K19 A;  4JSX C;  1BPO A;  3PSC B;  1K3I A;  1QFS A;  2VC2 A;  1VE7 A;  1PEV A;  4UM8 A;  5FFO A;  4J87 A;  5AJA A;  2PBI B;  2HU5 A;  3ZE2 A;  3BG0 A;  2VDO A;  4ZN4 A;  4BP8 A;  2OK4 A;  4RE5 A;  2VZ3 A;  4I79 A;  4PC0 A;  4FA1 D;  2P9L C;  5GMK n;  5B4W A;  3OKW A;  4A2L A;  3AL8 A;  5M5R A;  2H9N A;  3EI2 A;  2AGY A;  4WK4 A;  4FHL A;  2B5L A;  4AN1 A;  5CXC A;  3FM0 A;  3UVN A;  4NAA A;  3MVD K;  2CN3 A;  3C9C A;  1FWX A;  2IUP A;  3MKS B;  4D9S A;  4OZU A;  3IIY A;  3OKY B;  4PSX B;  4GQ2 P;  5C2V B;  4X61 B;  3JPX A;  1H2Y A;  3SJL D;  1H2X A;  1S4U X;  3DXM C;  3ZE1 A;  2WQ8 A;  3RSE C;  4QRJ A;  3SHF A;  5I5J A;  5TEF A;  2PM9 A;  4CI2 A;  4O3T B;  4A0B B;  3F3F A;  4J84 A;  4LG8 A;  4BCC A;  3C99 A;  5EMM B;  2P9P C;  4J0X A;  2XDW A;  3MKQ A;  1I2M B;  1XHM A;  3IUN A;  2YMU A;  3GFC A;  5CXB B;  2W18 A;  5GSA A;  3K26 A;  2P9S C;  3VI4 A;  2I3S A;  2CN2 A;  1N6E A;  1UOP A;  4GM9 A;  2AGZ A;  2XE4 A;  4A08 A;  3OL2 A;  5M5S A;  4A0B A;  3KCI A;  2PM9 B;  2XL3 A;  1U2V C;  3MZL A;  5CXB A;  4ERQ A;  5IT9 g;  3CIK B;  2AGX A;  3L4M D;  3C75 H;  3RMZ D;  2HU8 A;  3EQ7 A;  4MMZ A;  4GZ8 A;  4A7J A;  1P22 A;  3EMH A;  3EI3 B;  2BCJ B;  3VI3 A;  4Z7N A;  2HXC A;  4AOW A;  2VDK A;  4O1Q D;  4PBY A;  2YNP A;  3DSM A;  5C86 A;  3J80 g;  4E5Z B;  3UR4 A;  2PM6 B;  4G1M A;  2OVQ B;  5C2W B;  3K71 A;  3EU7 A;  5IJ7 E;  1NEX B;  2EIB A;  3V5W B;  4GGA A;  2J55 H;  3BG1 A;  5EAM A;  3IKO A;  4QQE A;  2CO0 A;  2H9L A;  4A0A B;  5M5V A;  3GC3 B;  5EAR A;  4CZX A;  1Q47 A;  4UI9 R;  2H13 A;  5EM2 B;  4JSP C;  4CY2 A;  2AGL A;  4L1M A;  3ZDX A;  4J77 A;  3O4G A;  3SCY A;  1B9Y A;  4H5J A;  4AEZ A;  2HJ4 A;  5I5I A;  4IMM A;  5E6U A;  2B5M A;  4CZY A;  5IJ8 E;  4AX4 A;  1H2Z A;  4ZOZ A;  4E5Z A;  2IUQ A;  5GXI A;  4A11 A;  4DNW A;  4Z8L A;  4JHP C;  4FA5 D;  1JV2 A;  3SFZ A;  3SBQ A;  3AL8 B;  4NC4 A;  1E8M A;  3UVK A;  2HU7 A;  4FAN D;  3IJE A;  4J86 A;  2IWK A;  5HE3 B;  5EML B;  3K27 A;  2Q7Q A;  3OL2 B;  5GXH A;  2PM7 B;  3I8C A;  2H9M A;  2IUR A;  5FFG A;  4AMZ A;  5FKS A;  4CY5 A;  2OJY A;  3AH8 B;  5EM2 A;  3UKR C;  2CE9 A;  3SVW D;  1C9L A;  3OTT A;  1A0R B;  3GD1 I;  2EBS A;  3VGZ A;  3I7H A;  4QT8 A;  3NVN A;  3OKT A;  2GNQ A;  4X60 B;  2XU7 A;  2UZX B;  2VZ1 A;  3ORV D;  3K72 A;  3SBR A;  2VDP A;  2OK6 A;  1L5G A;  3IUR A;  3FGB A;  3EI4 A;  3IUJ A;  4PSW B;  3JB9 L;  1H2W A;  4NBM A;  1GOT B;  3B7F A;  5M5U A;  3JZN A;  5FQD A;  4U7A A;  4Y7R A;  4J79 A;  5IC7 A;  5FKR A;  3PXS D;  2OVR B;  1VYH C;  2OVP B;  2AGW A;  3PSL A;  3AFC A;  5TF2 A;  3V7D B;  1T2X A;  5EMJ B;  5CXC B;  1GP2 B;  2BBK H;  3I7P A;  4J82 A;  3J81 g;  2UZY B;  3EI2 B;  3DWL C;  5K1C C;  1N6D A;  3KRX B;  3OF7 A;  2Z2P A;  4L1Q D;  2IWF A;  3ZWL B;  1UOO A;  4J73 A;  4WK0 A;  3V4P A;  4O02 A;  4QAM A;  3CFV A;  2H68 A;  3MUN A;  4JT5 C;  2YNO A;  5HE2 B;  2YBA A;  2IAA A;  1K8K C;  3NID A;  4FAV D;  3C5M A;  4JXM A;  1UTC A;  4UM9 A;  4Z7Q A;  4RE6 A;  4WK2 A;  1E5T A;  4BCD A;  1MG2 A;  2J57 G;  1JMZ B;  2P9N C;  1R5M A;  3UVL A;  3NVQ A;  4XYI A;  5TDH B;  4GM3 A;  4O9D A;  4L3G D;  4D6V A;  2XL2 A;  3QI0 A;  2EIE A;  3ULE C;  5SXM A;  3L4O D;  3SN6 B;  4CI1 A;  4A0A A;  4CY1 A;  3EG6 A;  4AMY A;  2H14 A;  3EI4 B;  3IUM A;  3DM0 A;  2I0T A;  5C92 A;  4ERY A;  3F3P A;  4FA4 D;  4Z7O A;  2OIZ A;  3MMY A;  2H47 A;  4CY3 A;  4CC9 A;  2P9K C;  4A09 A;  1GOG A;  3ZDY A;  1TYE A;  2G99 A;  3JRO A;  4OWR A;  5AFU 3;  3V4V A;  1E8N A;  5KDO B;  3JZG A;  1SHY B;  1JOF A;  1O6F A;  2BKL A;  4JSN C;  3UVO A;  1RI6 A;  3I7N A;  4BH6 A;  3KRW B;  3SMR A;  3I7L A;  2QR5 A;  3P4F A;  2HKM A;  4E54 A;  2VDQ A;  2P9I C;  2CE8 A;  1SQJ A;  4G56 B;  5H1M A;  4BCB A;  4IRZ A;  5FLX g;  2HYE A;  4GGD A;  2HKR A;  1B9X A;  4YVD A;  4J8G A;  5HE1 B;  3FCU A;  4A11 B;  3RFH A;  4O3U B;  2AQ5 A;  4O2W A;  3QHY B;  1PBY B;  3VA6 A;  4ESG A;  4K3J B;  3SWS D;  4ZOY A;  5H17 A;  3PXW D;  4A2M A; 
#chains in the Genus database with same CATH homology
 3OF7 A;  1I2M B;  4NBM A;  4DNU A;  4NC4 A;  4L1M A;  1JTD B;  3KCI A;  3QHY B;  4JHN A;  4O2W A;  4D9S A;  4DNW A;  3QI0 A;  4JHP C;  4NAA A;  4DNV A;  3MVD K;  1A12 A;  4QAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...