4QAMA

Crystal structure of the rpgr rcc1-like domain in complex with the rpgr-interacting domain of rpgrip1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
364
structure length
364
Chain Sequence
ELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWVSCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords X-linked retinitis pigmentosa GTPase regulator
publication title C2 domains as protein-protein interaction modules in the ciliary transition zone.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 364
sequence length 364
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4qamA00
4NAAA 3KCIA 1A12A 3QHYB 4NBMA 4DNUA 4DNVA 4O2WA 3OF7A 1I2MB 1JTDB 4JHPC 4DNWA 4QAMA 4JHNA 4D9SA 4NC4A 4L1MA 3QI0A 3MVDK
chains in the Genus database with same CATH superfamily
4XYHA 1C9IA 1JOFA 1BPOA 1M1XA 3NIGA 4L9OA 5EAMA 4KFMB 2B4EA 2AGXA 1A0RB 2P9KC 5HE3B 4ZOXA 2IWFA 4G1MA 4QQEA 4ERYA 1NR0A 4O45A 3OF7A 4UI9R 3K26A 3SBPA 3VI3A 4PNKB 2XZGA 3P4FA 1JJUB 3UVOA 3C75H 2H9PA 3FRXA 2HJBA 4CY1A 4MMYA 2UZXB 4J86A 5CXBA 4GMBA 3RMZD 2P9PC 3ZE1A 2CO0C 2H6KA 2AGZA 1UTCA 3SFZA 5M5SA 3UVKA 3IIWA 4A0AB 5IGQA 4J8BA 5FQDA 3PSLA 2QC5A 4G1EA 4AOWA 5FKTA 4AMZA 2P9UC 4QL1A 4D0KA 5I5IA 2CNXA 4A11B 4D6VA 2CO0A 3PXTD 1L5GA 4NC4A 1YFQA 3F3FA 4AN0A 4GGCA 3K71A 4A2LA 3MKQA 5FKSA 1N6EA 4BP9A 5E6SA 2H14A 3O4IA 2I0RA 2YMUA 2OVPB 3SLED 2Q7QA 4NBMA 5EARA 2QR5A 5TEFA 3MUOA 4JXMA 5C9ZB 2EBSA 3PE7A 3SWSD 3I7LA 2HU8A 2G9AA 2CN3A 4IMMA 3C99A 4ZN4A 5THAA 3EMHA 1C9LA 1ERJA 3I7NA 3F3GA 3JB9L 4PBYA 3UKRC 5CXBB 3K6SA 2XL2A 2OK6A 3EQ9A 4BH6A 4L3GD 4JHPC 1PI6A 5H14A 5EMJB 5I5MA 3IUJA 3GD1I 3J81g 4PBZA 2OJYA 3J80g 2W18A 1TBGA 3CFSB 3IJCA 4ZOYA 5KDOB 4MMXA 2XU7A 3UKUC 4A0AA 4BCCA 1A12A 2GC7A 2VDRA 5HE0B 2H9MA 1O6FA 2QXVA 3SBRA 2HKMA 2B5MA 4A11A 1B9YA 2WQ8A 1UOPA 5M5TA 2H9NA 4NSXA 3AH8B 3EQ7A 3ZDXA 5FLXg 3IUMA 1U2VC 3CIKB 1UOQA 2P9SC 4A09B 3IIYA 4JSNC 3U4YA 2TRCB 4LG9A 1MDAH 1PEVA 4J82A 4FA5D 2OVRB 3KRWB 4BCBA 5IJ7E 3MZLA 4MMZA 4XYIA 3EQ8A 4WK2A 3VGZA 5EALA 3DDUA 5EMLB 3EI3B 3ULEC 1H2YA 2J56H 3EI4B 4RE6A 4Y5RD 2AGLA 3IURA 2H13A 4O1QD 3F3PA 4TZ4A 4CC9A 3DM0A 5EM2A 2CE9A 3I2NA 4HDJA 5FA5B 3UVMA 1SQ9A 5FFOA 3E0CA 3JPXA 3PXSD 3PSCB 3BWSA 4OWRA 1GXRA 5IJ8E 2IUVA 4NAAA 3OL2A 1SQJA 4J77A 3VI4A 4R7AB 3QHYB 1QFSA 4PC0A 5EMMB 2VDKA 3O4HA 4PXWA 4ERQA 5IC7A 4IA9A 2H9LA 5HDBA 4JT5C 5M5UA 3EU7A 4QAMA 1O6GA 4U7AA 4I79A 2XE4A 4X3EA 2I3SA 2AGYA 4ZOVA 4N14A 5HE1B 4GM3A 4E54A 2B5NA 2Z2PA 1QFMA 2H47A 3RSEC 2AGWA 1XHMA 3C9CA 3OW8A 3NIFA 3AFCA 3B7FA 4WK0A 4UM8A 3UVNA 3JZNA 5C92A 3GFCA 5M5RA 1OMWB 3JZHA 3IVMA 5JWZA 3K72A 5IT9g 5C2WB 3AL8B 4CY2A 5FFGA 4A09A 3I89A 3L4OD 2EICA 5IGOA 3ORVD 3OKTA 4GGAA 4CY3A 4J0XA 1YR2A 3T3PA 1N6FA 3PXWD 2VC2A 2P9NC 2J55H 4OZUA 5EM2B 5HYNB 4YVDA 4G56B 3GREA 2VDOA 3EI3A 3EI4A 2BKLA 3IJEA 3A0FA 2YNNA 2PM9A 3CFVA 3IKOA 1H2WA 4GGDA 3V5WB 4DNUA 3OL2B 4GM9A 4FA9D 4CI3A 3NVQA 5AFU3 4A7JA 1GOTB 1JTDB 3SMRA 1H2XA 2VDNA 3OKYA 2H6QA 4CZXA 3V9FA 4JSXC 1QNIA 2AQ5A 3RFGA 3IUNA 1FWXA 4L1MA 5H1MA 1RI6A 4J84A 3L4MD 1GG2B 3V4VA 3FCSA 5E6UA 5I5JA 4X60B 3MZKA 2GNQA 3O4GA 4IRZA 3MVDK 2CN2A 4BCDA 4FB1D 3ZDYA 1N6DA 3SBQA 2P9LC 3IULA 4E54B 3ZE2A 1VE6A 2YNOA 4A08A 1JV2A 5A2Qg 2OVQB 5TF2A 2I0SA 4QRJA 5FKRA 2EIDA 3VH0A 3MMYA 1JMXB 3JZGA 1P22A 1L0QA 1S4UX 4O9DA 3ZDZA 3C5MA 4LGNA 2HESX 2HKRA 4AX4A 5B4WA 2XDWA 4E5ZB 2IWKA 3RFHA 4U1EI 1XKSA 4JSPC 2H3XA 1GP2B 4Z8LA 3AL8A 1TYEA 1VZ3A 3SJLD 3N0DA 2VDMA 4J81A 1E5TA 2PM6B 3I7PA 1K8KC 3SVWD 4K3JB 2PM9B 3EI2A 2IUPA 5K1CC 3K27A 5HE2B 3IJ1A 2AH1A 4CZVA 4X61B 4K3ID 4ZOZA 3AL9A 5E6RA 2I0TA 2G99A 4G55A 5CYKB 2XL3A 3OKYB 4X63B 1GOFA 2HYEA 4FA1D 5GXIA 2MTAH 3N0EA 4H5JA 3MXXA 1K3IA 3MKSB 2HU7A 3RLMD 3I8CA 3DWLC 4EWRA 4JSVC 3OKWA 4O3UB 5GMKn 4Z7QA 5AMSA 4J78A 2AH0A 5C2VB 2EIEA 4GQ1A 3ODTA 2IUQA 4ES0A 4QT8A 3DSMA 3FM0A 4NENA 2EIBA 4GM8A 2YB8B 1VE7A 5AJAA 1H2ZA 2VDLA 2YBAA 2P9IC 1NEXB 5H17A 1GOHA 2H68A 3IUQA 4A08B 4XEIC 1R5MA 3ZE0A 2OK4A 4J79A 1TYQC 2OIZA 3NVXA 4J87A 4O3TB 1VYHC 5GSAA 2YNPA 2QZPA 2HJ4A 1PGUA 2HXCA 3UVLA 4GQBB 5EMKB 4PSXB 4DNVA 3I7HA 5CXCB 3O4JA 4FAND 3BG0A 4A0BA 3NIDA 3IJ0A 3DXMC 2HU5A 4O02A 4PSWB 3I8EA 4CY5A 2BBKH 1K32A 3BG1A 4BP8A 2O9KA 3EI2B 4E5ZA 5M5VA 2J57G 4FHLA 2B5LA 4L1QD 2IAAA 3SXTD 2Z2OA 3EI1B 3JROA 3VA6A 5C86A 4FWWA 3JRPA 3KCIA 2VZ1A 3SHFA 3EWEA 2UZYB 1MG2A 1T2XA 3GC3B 4BUJC 2VDPA 5FKQA 1SHYB 5TDHB 5CYKA 4FA4D 3T3MA 4ERZA 1VZ2A 2BCJB 3DXKC 4FAVD 4AMYA 3SCYA 5SXMA 4J0WA 3I7KA 3HFQA 3I7OA 5HQGA 2Z2NA 3FCUA 2PM7B 5K19A 3FGBA 1B9XA 3PVWB 3W15A 1U8CA 2CE8A 3SN6B 4ESGA 2JKXA 1I2MB 4JD2C 3UR4A 4RE5A 5GXHA 3JAMg 4CI1A 4JHNA 4CI8A 2XYIA 2I3TA 4D9SA 2H6NA 4GQ2P 4JT6C 4MK0B 3V7DB 5TEEA 2PBIB 3ZWLB 4A0BB 4CZYA 4Z7NA 3QI0A 4J73A 1MG3A 3V4PA 4AEZA 1Q47A 3NVNA 3OTTA 3RN0D 1E8NA 2VDQA 3EG6A 3MUNA 4A2MA 4Z7OA 1JMZB 4AN1A 3RRMC 5CXCA 4WK4A 4L3HD 4LG8A 3KRXB 4O2WA 2IURA 4Y7RA 4CI2A 4WJKA 1U4CA 1PBYB 4DNWA 5EAPA 1XIPA 2VZ3A 5FXYA 4H5IA 1GOGA 1UOOA 3PVUB 3EI1A 4GZ8A 2GC4A 1OLZA 3RN1D 5M61A 4UM9A 4BL0A 4J8GA 1E8MA
chains in the Genus database with same CATH topology
4NAAA 3KCIA 1A12A 3QHYB 4NBMA 4DNUA 4DNVA 4O2WA 3OF7A 1I2MB 1JTDB 4JHPC 4DNWA 4QAMA 4JHNA 4D9SA 4NC4A 4L1MA 3QI0A 3MVDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAA A;  3KCI A;  1A12 A;  3QHY B;  4NBM A;  4DNU A;  4DNV A;  4O2W A;  3OF7 A;  1I2M B;  1JTD B;  4JHP C;  4DNW A;  4QAM A;  4JHN A;  4D9S A;  4NC4 A;  4L1M A;  3QI0 A;  3MVD K; 
#chains in the Genus database with same CATH topology
 4XYH A;  1C9I A;  1JOF A;  1BPO A;  1M1X A;  3NIG A;  4L9O A;  5EAM A;  4KFM B;  2B4E A;  2AGX A;  1A0R B;  2P9K C;  5HE3 B;  4ZOX A;  2IWF A;  4G1M A;  4QQE A;  4ERY A;  1NR0 A;  4O45 A;  3OF7 A;  4UI9 R;  3K26 A;  3SBP A;  3VI3 A;  4PNK B;  2XZG A;  3P4F A;  1JJU B;  3UVO A;  3C75 H;  2H9P A;  3FRX A;  2HJB A;  4CY1 A;  4MMY A;  2UZX B;  4J86 A;  5CXB A;  4GMB A;  3RMZ D;  2P9P C;  3ZE1 A;  2CO0 C;  2H6K A;  2AGZ A;  1UTC A;  3SFZ A;  5M5S A;  3UVK A;  3IIW A;  4A0A B;  5IGQ A;  4J8B A;  5FQD A;  3PSL A;  2QC5 A;  4G1E A;  4AOW A;  5FKT A;  4AMZ A;  2P9U C;  4QL1 A;  4D0K A;  5I5I A;  2CNX A;  4A11 B;  4D6V A;  2CO0 A;  3PXT D;  1L5G A;  4NC4 A;  1YFQ A;  3F3F A;  4AN0 A;  4GGC A;  3K71 A;  4A2L A;  3MKQ A;  5FKS A;  1N6E A;  4BP9 A;  5E6S A;  2H14 A;  3O4I A;  2I0R A;  2YMU A;  2OVP B;  3SLE D;  2Q7Q A;  4NBM A;  5EAR A;  2QR5 A;  5TEF A;  3MUO A;  4JXM A;  5C9Z B;  2EBS A;  3PE7 A;  3SWS D;  3I7L A;  2HU8 A;  2G9A A;  2CN3 A;  4IMM A;  3C99 A;  4ZN4 A;  5THA A;  3EMH A;  1C9L A;  1ERJ A;  3I7N A;  3F3G A;  3JB9 L;  4PBY A;  3UKR C;  5CXB B;  3K6S A;  2XL2 A;  2OK6 A;  3EQ9 A;  4BH6 A;  4L3G D;  4JHP C;  1PI6 A;  5H14 A;  5EMJ B;  5I5M A;  3IUJ A;  3GD1 I;  3J81 g;  4PBZ A;  2OJY A;  3J80 g;  2W18 A;  1TBG A;  3CFS B;  3IJC A;  4ZOY A;  5KDO B;  4MMX A;  2XU7 A;  3UKU C;  4A0A A;  4BCC A;  1A12 A;  2GC7 A;  2VDR A;  5HE0 B;  2H9M A;  1O6F A;  2QXV A;  3SBR A;  2HKM A;  2B5M A;  4A11 A;  1B9Y A;  2WQ8 A;  1UOP A;  5M5T A;  2H9N A;  4NSX A;  3AH8 B;  3EQ7 A;  3ZDX A;  5FLX g;  3IUM A;  1U2V C;  3CIK B;  1UOQ A;  2P9S C;  4A09 B;  3IIY A;  4JSN C;  3U4Y A;  2TRC B;  4LG9 A;  1MDA H;  1PEV A;  4J82 A;  4FA5 D;  2OVR B;  3KRW B;  4BCB A;  5IJ7 E;  3MZL A;  4MMZ A;  4XYI A;  3EQ8 A;  4WK2 A;  3VGZ A;  5EAL A;  3DDU A;  5EML B;  3EI3 B;  3ULE C;  1H2Y A;  2J56 H;  3EI4 B;  4RE6 A;  4Y5R D;  2AGL A;  3IUR A;  2H13 A;  4O1Q D;  3F3P A;  4TZ4 A;  4CC9 A;  3DM0 A;  5EM2 A;  2CE9 A;  3I2N A;  4HDJ A;  5FA5 B;  3UVM A;  1SQ9 A;  5FFO A;  3E0C A;  3JPX A;  3PXS D;  3PSC B;  3BWS A;  4OWR A;  1GXR A;  5IJ8 E;  2IUV A;  4NAA A;  3OL2 A;  1SQJ A;  4J77 A;  3VI4 A;  4R7A B;  3QHY B;  1QFS A;  4PC0 A;  5EMM B;  2VDK A;  3O4H A;  4PXW A;  4ERQ A;  5IC7 A;  4IA9 A;  2H9L A;  5HDB A;  4JT5 C;  5M5U A;  3EU7 A;  4QAM A;  1O6G A;  4U7A A;  4I79 A;  2XE4 A;  4X3E A;  2I3S A;  2AGY A;  4ZOV A;  4N14 A;  5HE1 B;  4GM3 A;  4E54 A;  2B5N A;  2Z2P A;  1QFM A;  2H47 A;  3RSE C;  2AGW A;  1XHM A;  3C9C A;  3OW8 A;  3NIF A;  3AFC A;  3B7F A;  4WK0 A;  4UM8 A;  3UVN A;  3JZN A;  5C92 A;  3GFC A;  5M5R A;  1OMW B;  3JZH A;  3IVM A;  5JWZ A;  3K72 A;  5IT9 g;  5C2W B;  3AL8 B;  4CY2 A;  5FFG A;  4A09 A;  3I89 A;  3L4O D;  2EIC A;  5IGO A;  3ORV D;  3OKT A;  4GGA A;  4CY3 A;  4J0X A;  1YR2 A;  3T3P A;  1N6F A;  3PXW D;  2VC2 A;  2P9N C;  2J55 H;  4OZU A;  5EM2 B;  5HYN B;  4YVD A;  4G56 B;  3GRE A;  2VDO A;  3EI3 A;  3EI4 A;  2BKL A;  3IJE A;  3A0F A;  2YNN A;  2PM9 A;  3CFV A;  3IKO A;  1H2W A;  4GGD A;  3V5W B;  4DNU A;  3OL2 B;  4GM9 A;  4FA9 D;  4CI3 A;  3NVQ A;  5AFU 3;  4A7J A;  1GOT B;  1JTD B;  3SMR A;  1H2X A;  2VDN A;  3OKY A;  2H6Q A;  4CZX A;  3V9F A;  4JSX C;  1QNI A;  2AQ5 A;  3RFG A;  3IUN A;  1FWX A;  4L1M A;  5H1M A;  1RI6 A;  4J84 A;  3L4M D;  1GG2 B;  3V4V A;  3FCS A;  5E6U A;  5I5J A;  4X60 B;  3MZK A;  2GNQ A;  3O4G A;  4IRZ A;  3MVD K;  2CN2 A;  4BCD A;  4FB1 D;  3ZDY A;  1N6D A;  3SBQ A;  2P9L C;  3IUL A;  4E54 B;  3ZE2 A;  1VE6 A;  2YNO A;  4A08 A;  1JV2 A;  5A2Q g;  2OVQ B;  5TF2 A;  2I0S A;  4QRJ A;  5FKR A;  2EID A;  3VH0 A;  3MMY A;  1JMX B;  3JZG A;  1P22 A;  1L0Q A;  1S4U X;  4O9D A;  3ZDZ A;  3C5M A;  4LGN A;  2HES X;  2HKR A;  4AX4 A;  5B4W A;  2XDW A;  4E5Z B;  2IWK A;  3RFH A;  4U1E I;  1XKS A;  4JSP C;  2H3X A;  1GP2 B;  4Z8L A;  3AL8 A;  1TYE A;  1VZ3 A;  3SJL D;  3N0D A;  2VDM A;  4J81 A;  1E5T A;  2PM6 B;  3I7P A;  1K8K C;  3SVW D;  4K3J B;  2PM9 B;  3EI2 A;  2IUP A;  5K1C C;  3K27 A;  5HE2 B;  3IJ1 A;  2AH1 A;  4CZV A;  4X61 B;  4K3I D;  4ZOZ A;  3AL9 A;  5E6R A;  2I0T A;  2G99 A;  4G55 A;  5CYK B;  2XL3 A;  3OKY B;  4X63 B;  1GOF A;  2HYE A;  4FA1 D;  5GXI A;  2MTA H;  3N0E A;  4H5J A;  3MXX A;  1K3I A;  3MKS B;  2HU7 A;  3RLM D;  3I8C A;  3DWL C;  4EWR A;  4JSV C;  3OKW A;  4O3U B;  5GMK n;  4Z7Q A;  5AMS A;  4J78 A;  2AH0 A;  5C2V B;  2EIE A;  4GQ1 A;  3ODT A;  2IUQ A;  4ES0 A;  4QT8 A;  3DSM A;  3FM0 A;  4NEN A;  2EIB A;  4GM8 A;  2YB8 B;  1VE7 A;  5AJA A;  1H2Z A;  2VDL A;  2YBA A;  2P9I C;  1NEX B;  5H17 A;  1GOH A;  2H68 A;  3IUQ A;  4A08 B;  4XEI C;  1R5M A;  3ZE0 A;  2OK4 A;  4J79 A;  1TYQ C;  2OIZ A;  3NVX A;  4J87 A;  4O3T B;  1VYH C;  5GSA A;  2YNP A;  2QZP A;  2HJ4 A;  1PGU A;  2HXC A;  3UVL A;  4GQB B;  5EMK B;  4PSX B;  4DNV A;  3I7H A;  5CXC B;  3O4J A;  4FAN D;  3BG0 A;  4A0B A;  3NID A;  3IJ0 A;  3DXM C;  2HU5 A;  4O02 A;  4PSW B;  3I8E A;  4CY5 A;  2BBK H;  1K32 A;  3BG1 A;  4BP8 A;  2O9K A;  3EI2 B;  4E5Z A;  5M5V A;  2J57 G;  4FHL A;  2B5L A;  4L1Q D;  2IAA A;  3SXT D;  2Z2O A;  3EI1 B;  3JRO A;  3VA6 A;  5C86 A;  4FWW A;  3JRP A;  3KCI A;  2VZ1 A;  3SHF A;  3EWE A;  2UZY B;  1MG2 A;  1T2X A;  3GC3 B;  4BUJ C;  2VDP A;  5FKQ A;  1SHY B;  5TDH B;  5CYK A;  4FA4 D;  3T3M A;  4ERZ A;  1VZ2 A;  2BCJ B;  3DXK C;  4FAV D;  4AMY A;  3SCY A;  5SXM A;  4J0W A;  3I7K A;  3HFQ A;  3I7O A;  5HQG A;  2Z2N A;  3FCU A;  2PM7 B;  5K19 A;  3FGB A;  1B9X A;  3PVW B;  3W15 A;  1U8C A;  2CE8 A;  3SN6 B;  4ESG A;  2JKX A;  1I2M B;  4JD2 C;  3UR4 A;  4RE5 A;  5GXH A;  3JAM g;  4CI1 A;  4JHN A;  4CI8 A;  2XYI A;  2I3T A;  4D9S A;  2H6N A;  4GQ2 P;  4JT6 C;  4MK0 B;  3V7D B;  5TEE A;  2PBI B;  3ZWL B;  4A0B B;  4CZY A;  4Z7N A;  3QI0 A;  4J73 A;  1MG3 A;  3V4P A;  4AEZ A;  1Q47 A;  3NVN A;  3OTT A;  3RN0 D;  1E8N A;  2VDQ A;  3EG6 A;  3MUN A;  4A2M A;  4Z7O A;  1JMZ B;  4AN1 A;  3RRM C;  5CXC A;  4WK4 A;  4L3H D;  4LG8 A;  3KRX B;  4O2W A;  2IUR A;  4Y7R A;  4CI2 A;  4WJK A;  1U4C A;  1PBY B;  4DNW A;  5EAP A;  1XIP A;  2VZ3 A;  5FXY A;  4H5I A;  1GOG A;  1UOO A;  3PVU B;  3EI1 A;  4GZ8 A;  2GC4 A;  1OLZ A;  3RN1 D;  5M61 A;  4UM9 A;  4BL0 A;  4J8G A;  1E8M A; 
#chains in the Genus database with same CATH homology
 4NAA A;  3KCI A;  1A12 A;  3QHY B;  4NBM A;  4DNU A;  4DNV A;  4O2W A;  3OF7 A;  1I2M B;  1JTD B;  4JHP C;  4DNW A;  4QAM A;  4JHN A;  4D9S A;  4NC4 A;  4L1M A;  3QI0 A;  3MVD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...