4QAMA

Crystal structure of the rpgr rcc1-like domain in complex with the rpgr-interacting domain of rpgrip1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
364
structure length
364
Chain Sequence
ELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWVSCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X-linked retinitis pigmentosa GTPase regulator
publication title C2 domains as protein-protein interaction modules in the ciliary transition zone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 105
structure length 364
sequence length 364
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4qamA00
4NC4A 4JHPC 4DNUA 4D9SA 3OF7A 4DNWA 4O2WA 4DNVA 4NAAA 1I2MB 4JHNA 3QHYB 4QAMA 4L1MA 3KCIA 3QI0A 3MVDK 1JTDB 4NBMA 1A12A
chains in the Genus database with same CATH superfamily
2VDOA 3T3PA 3NVNA 2P9NC 3I2NA 4J81A 3AL9A 4WK0A 4WJKA 3PE7A 3EQ8A 3V7DB 3OKWA 2HU5A 3OKTA 4OZUA 3RN1D 2VDPA 1QNIA 2CNXA 5EM2B 2HKRA 3ZE2A 4UI9R 5HQGA 3W15A 1VYHC 2H68A 3SJLD 3AH8B 3A0FA 4J78A 2J57G 3KCIA 3I8EA 1C9LA 4BL0A 3JB9L 5I5JA 3K72A 1TYEA 4NENA 3MUOA 3B7FA 3ZWLB 2CE9A 4CY1A 1XIPA 3SFZA 2AGYA 2I3TA 4PBYA 4MMYA 4Y5RD 5TDHB 1U8CA 4XYIA 4CC9A 5C9ZB 2B4EA 3ZDYA 5AFU3 4QT8A 2P9PC 3I7KA 1A0RB 3OW8A 5CXBA 5AJAA 3UKUC 2CN3A 4MMZA 2OVQB 3IKOA 2PM7B 1T2XA 3UR4A 4FAND 2O9KA 3IUQA 5M5SA 4BP9A 2IWKA 3FM0A 4LGNA 4FA1D 5C2WB 4PC0A 3IUJA 4GZ8A 5HE2B 3EI4A 5H14A 5K19A 2J56H 4GM8A 4JSPC 2XZGA 1JMZB 4O2WA 4X61B 3N0EA 2HU8A 2PM9A 3JRPA 1OMWB 2EBSA 2TRCB 3SWSD 4CI3A 3SVWD 3U4YA 4E54A 3IULA 4A2LA 5FKRA 4Z7NA 5HE3B 1JJUB 2P9UC 1JMXB 4AN1A 1SQ9A 3NIDA 3RMZD 1YFQA 4A0BB 3E0CA 1L5GA 4Z8LA 2AQ5A 3IJ1A 4FWWA 3F3FA 5FFGA 3UVKA 4DNWA 3C9CA 1O6FA 3I89A 3BWSA 2AGLA 3IUNA 1E5TA 5FKTA 5GXIA 2OJYA 5C2VB 2HU7A 3I7LA 3RSEC 4FAVD 3OL2A 3O4HA 4ZOYA 5CYKA 5M61A 3UVMA 4MK0B 2IWFA 1U4CA 2OK4A 2IUVA 4O45A 3MVDK 5THAA 1TYQC 1VZ3A 1SQJA 1FWXA 1P22A 4NBMA 1A12A 5EMKB 4ZN4A 2AH0A 2EICA 3OF7A 4CY3A 3HFQA 3SN6B 4Z7QA 4CY5A 5CXCA 3O4JA 2AGXA 1QFSA 3DSMA 3L4MD 1GG2B 2IUQA 3F3PA 3ODTA 4ZOXA 3DXKC 1R5MA 3N0DA 1BPOA 5TEFA 1GOTB 4J73A 4CI1A 2I3SA 2XL3A 5HYNB 2J55H 3IVMA 3IURA 2QXVA 4FA9D 2CO0A 3EQ7A 3SBPA 4D6VA 4ZOVA 4GQ2P 3PSLA 2AH1A 2Z2OA 4XYHA 3SLED 5C92A 2B5MA 2OIZA 4GM3A 5TEEA 4AEZA 4E5ZB 3O4IA 2I0SA 3C99A 2IUPA 1XHMA 3VA6A 2YNPA 4Y7RA 2VDKA 2H6KA 2YMUA 3CFVA 2YB8B 3OKYB 4ESGA 2PBIB 2YBAA 5A2Qg 3I7NA 4CY2A 3PXWD 3O4GA 1JV2A 4WK4A 2H9NA 4NSXA 2VDMA 3K71A 1U2VC 1N6EA 3GC3B 3JROA 5HE1B 4AMZA 4U1EI 4GM9A 4G1MA 2OVPB 5I5IA 3V4VA 3EU7A 4JSNC 3PVWB 4A09B 5GSAA 2YNNA 4LG8A 3EI2B 4PSWB 2P9KC 4H5JA 4O9DA 1C9IA 4FA5D 4UM8A 4J77A 4G55A 1VE6A 2HYEA 4J0XA 3UVNA 2BBKH 4JHPC 4GGCA 4IA9A 2BKLA 4LG9A 5AMSA 4AOWA 5EALA 2P9SC 5C86A 2XU7A 3NIGA 4Z7OA 2CE8A 5I5MA 4JHNA 3QHYB 3SCYA 1QFMA 3FRXA 5FXYA 4O3TB 2VZ3A 2H9PA 4MMXA 4EWRA 4A11A 1GOGA 3EWEA 5IJ8E 5H17A 1ERJA 4K3ID 3SHFA 3C75H 1YR2A 4CZXA 2HXCA 2VZ1A 5H1MA 3VGZA 3L4OD 4BCCA 3KRWB 4N14A 3VH0A 3EMHA 1VZ2A 2I0RA 4J79A 2B5NA 2H9LA 3RFGA 1PBYB 1N6DA 5IT9g 3IJ0A 4JD2C 4J8GA 4E54B 4L1MA 3RFHA 2Z2PA 3SBRA 2WQ8A 2MTAH 2VDNA 1PI6A 3BG1A 3ZE1A 3GFCA 4D0KA 2UZYB 2QC5A 3MUNA 5EMLB 3ZDXA 4A08A 5FQDA 3V4PA 3EI1A 4FA4D 3UKRC 1UOPA 3ULEC 4PNKB 3SMRA 5JWZA 4X63B 4L3GD 4QL1A 3UVLA 5FA5B 5IGQA 3SXTD 4A0AB 4RE6A 4A2MA 4KFMB 2Q7QA 1H2WA 2AGWA 2EIEA 4PSXB 5E6UA 3ZE0A 2H6QA 2OVRB 5CYKB 2HJ4A 5GXHA 5FFOA 2HJBA 5M5TA 5HDBA 4BP8A 1NEXB 3IIYA 3ORVD 4WK2A 4J8BA 5EM2A 3SBQA 2XE4A 5IGOA 4J0WA 4R7AB 4FHLA 1M1XA 4G56B 5EAPA 3EI3B 5CXCB 5EMJB 2YNOA 3MZKA 3PXTD 1MG2A 1I2MB 3AL8B 3OKYA 4K3JB 1GOHA 1H2ZA 2VDRA 2H9MA 3MKSB 1RI6A 3BG0A 4AMYA 4FB1D 2JKXA 4GGDA 4L1QD 5E6RA 1NR0A 3C5MA 4IRZA 4PXWA 3FCSA 4G1EA 4BCDA 1N6FA 2EIDA 3I7OA 1K3IA 1K8KC 4CZVA 4JT6C 4TZ4A 2EIBA 5TF2A 4A09A 2HKMA 1E8MA 3EI2A 2AGZA 3EG6A 4I79A 5E6SA 1O6GA 2XDWA 3GD1I 3K6SA 4PBZA 1MG3A 4RE5A 3NVQA 4JXMA 3V5WB 4ZOZA 3V9FA 3JAMg 3CIKB 1JTDB 3IJEA 2H6NA 2H13A 5IJ7E 3MXXA 4ERZA 2VDLA 4D9SA 1XKSA 4YVDA 4ES0A 4UM9A 5EMMB 4XEIC 2P9IC 3DWLC 2W18A 4QRJA 1TBGA 3GREA 3VI3A 1VE7A 4ERYA 4A0BA 1B9XA 4QAMA 3I7PA 3KRXB 4ERQA 3MMYA 4IMMA 4AN0A 2CO0C 2B5LA 2HESX 3NIFA 3RLMD 2GNQA 1UTCA 5CXBB 4GGAA 4H5IA 4CI8A 2UZXB 4U7AA 5EAMA 4DNUA 3I8CA 3IJCA 3IIWA 2PM6B 4L3HD 4X60B 3MKQA 2QR5A 3K26A 4GMBA 4BH6A 3EI4B 3FGBA 5B4WA 1PEVA 2VDQA 3PVUB 4J86A 2OK6A 2PM9B 3PSCB 4CZYA 2H47A 3RN0D 3T3MA 3J80g 2H14A 4J84A 4A7JA 3VI4A 1H2YA 1OLZA 4J82A 4NC4A 2IURA 1MDAH 3J81g 3DDUA 3RRMC 5SXMA 5GMKn 4A11B 4J87A 5M5RA 2BCJB 1PGUA 2GC4A 1S4UX 2G9AA 2QZPA 3K27A 3DXMC 4QQEA 2Z2NA 3P4FA 4HDJA 5M5VA 5FLXg 4CI2A 4A0AA 1H2XA 4DNVA 4JSVC 3NVXA 4NAAA 5HE0B 4GQ1A 5K1CC 4O1QD 3IUMA 4X3EA 5EARA 3AFCA 1Q47A 3JPXA 1GP2B 5FKQA 5M5UA 3EQ9A 3PXSD 2H3XA 3OL2B 1JOFA 3JZNA 3ZDZA 4BUJC 1GOFA 2G99A 2IAAA 1K32A 2I0TA 4L9OA 2P9LC 4GQBB 4BCBA 1GXRA 2XL2A 3EI3A 5FKSA 3I7HA 1E8NA 1B9YA 3UVOA 4E5ZA 3AL8A 4A08B 5IC7A 3MZLA 3EI1B 2GC7A 3F3GA 2XYIA 3CFSB 2VC2A 3JZGA 3DM0A 3JZHA 4JT5C 1L0QA 4OWRA 4AX4A 5KDOB 4O3UB 2CN2A 3FCUA 1UOOA 3QI0A 4JSXC 1SHYB 3OTTA 4O02A 1UOQA
chains in the Genus database with same CATH topology
4NC4A 4JHPC 4DNUA 4D9SA 3OF7A 4DNWA 4O2WA 4DNVA 4NAAA 1I2MB 4JHNA 3QHYB 4QAMA 4L1MA 3KCIA 3QI0A 3MVDK 1JTDB 4NBMA 1A12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC4 A;  4JHP C;  4DNU A;  4D9S A;  3OF7 A;  4DNW A;  4O2W A;  4DNV A;  4NAA A;  1I2M B;  4JHN A;  3QHY B;  4QAM A;  4L1M A;  3KCI A;  3QI0 A;  3MVD K;  1JTD B;  4NBM A;  1A12 A; 
#chains in the Genus database with same CATH topology
 2VDO A;  3T3P A;  3NVN A;  2P9N C;  3I2N A;  4J81 A;  3AL9 A;  4WK0 A;  4WJK A;  3PE7 A;  3EQ8 A;  3V7D B;  3OKW A;  2HU5 A;  3OKT A;  4OZU A;  3RN1 D;  2VDP A;  1QNI A;  2CNX A;  5EM2 B;  2HKR A;  3ZE2 A;  4UI9 R;  5HQG A;  3W15 A;  1VYH C;  2H68 A;  3SJL D;  3AH8 B;  3A0F A;  4J78 A;  2J57 G;  3KCI A;  3I8E A;  1C9L A;  4BL0 A;  3JB9 L;  5I5J A;  3K72 A;  1TYE A;  4NEN A;  3MUO A;  3B7F A;  3ZWL B;  2CE9 A;  4CY1 A;  1XIP A;  3SFZ A;  2AGY A;  2I3T A;  4PBY A;  4MMY A;  4Y5R D;  5TDH B;  1U8C A;  4XYI A;  4CC9 A;  5C9Z B;  2B4E A;  3ZDY A;  5AFU 3;  4QT8 A;  2P9P C;  3I7K A;  1A0R B;  3OW8 A;  5CXB A;  5AJA A;  3UKU C;  2CN3 A;  4MMZ A;  2OVQ B;  3IKO A;  2PM7 B;  1T2X A;  3UR4 A;  4FAN D;  2O9K A;  3IUQ A;  5M5S A;  4BP9 A;  2IWK A;  3FM0 A;  4LGN A;  4FA1 D;  5C2W B;  4PC0 A;  3IUJ A;  4GZ8 A;  5HE2 B;  3EI4 A;  5H14 A;  5K19 A;  2J56 H;  4GM8 A;  4JSP C;  2XZG A;  1JMZ B;  4O2W A;  4X61 B;  3N0E A;  2HU8 A;  2PM9 A;  3JRP A;  1OMW B;  2EBS A;  2TRC B;  3SWS D;  4CI3 A;  3SVW D;  3U4Y A;  4E54 A;  3IUL A;  4A2L A;  5FKR A;  4Z7N A;  5HE3 B;  1JJU B;  2P9U C;  1JMX B;  4AN1 A;  1SQ9 A;  3NID A;  3RMZ D;  1YFQ A;  4A0B B;  3E0C A;  1L5G A;  4Z8L A;  2AQ5 A;  3IJ1 A;  4FWW A;  3F3F A;  5FFG A;  3UVK A;  4DNW A;  3C9C A;  1O6F A;  3I89 A;  3BWS A;  2AGL A;  3IUN A;  1E5T A;  5FKT A;  5GXI A;  2OJY A;  5C2V B;  2HU7 A;  3I7L A;  3RSE C;  4FAV D;  3OL2 A;  3O4H A;  4ZOY A;  5CYK A;  5M61 A;  3UVM A;  4MK0 B;  2IWF A;  1U4C A;  2OK4 A;  2IUV A;  4O45 A;  3MVD K;  5THA A;  1TYQ C;  1VZ3 A;  1SQJ A;  1FWX A;  1P22 A;  4NBM A;  1A12 A;  5EMK B;  4ZN4 A;  2AH0 A;  2EIC A;  3OF7 A;  4CY3 A;  3HFQ A;  3SN6 B;  4Z7Q A;  4CY5 A;  5CXC A;  3O4J A;  2AGX A;  1QFS A;  3DSM A;  3L4M D;  1GG2 B;  2IUQ A;  3F3P A;  3ODT A;  4ZOX A;  3DXK C;  1R5M A;  3N0D A;  1BPO A;  5TEF A;  1GOT B;  4J73 A;  4CI1 A;  2I3S A;  2XL3 A;  5HYN B;  2J55 H;  3IVM A;  3IUR A;  2QXV A;  4FA9 D;  2CO0 A;  3EQ7 A;  3SBP A;  4D6V A;  4ZOV A;  4GQ2 P;  3PSL A;  2AH1 A;  2Z2O A;  4XYH A;  3SLE D;  5C92 A;  2B5M A;  2OIZ A;  4GM3 A;  5TEE A;  4AEZ A;  4E5Z B;  3O4I A;  2I0S A;  3C99 A;  2IUP A;  1XHM A;  3VA6 A;  2YNP A;  4Y7R A;  2VDK A;  2H6K A;  2YMU A;  3CFV A;  2YB8 B;  3OKY B;  4ESG A;  2PBI B;  2YBA A;  5A2Q g;  3I7N A;  4CY2 A;  3PXW D;  3O4G A;  1JV2 A;  4WK4 A;  2H9N A;  4NSX A;  2VDM A;  3K71 A;  1U2V C;  1N6E A;  3GC3 B;  3JRO A;  5HE1 B;  4AMZ A;  4U1E I;  4GM9 A;  4G1M A;  2OVP B;  5I5I A;  3V4V A;  3EU7 A;  4JSN C;  3PVW B;  4A09 B;  5GSA A;  2YNN A;  4LG8 A;  3EI2 B;  4PSW B;  2P9K C;  4H5J A;  4O9D A;  1C9I A;  4FA5 D;  4UM8 A;  4J77 A;  4G55 A;  1VE6 A;  2HYE A;  4J0X A;  3UVN A;  2BBK H;  4JHP C;  4GGC A;  4IA9 A;  2BKL A;  4LG9 A;  5AMS A;  4AOW A;  5EAL A;  2P9S C;  5C86 A;  2XU7 A;  3NIG A;  4Z7O A;  2CE8 A;  5I5M A;  4JHN A;  3QHY B;  3SCY A;  1QFM A;  3FRX A;  5FXY A;  4O3T B;  2VZ3 A;  2H9P A;  4MMX A;  4EWR A;  4A11 A;  1GOG A;  3EWE A;  5IJ8 E;  5H17 A;  1ERJ A;  4K3I D;  3SHF A;  3C75 H;  1YR2 A;  4CZX A;  2HXC A;  2VZ1 A;  5H1M A;  3VGZ A;  3L4O D;  4BCC A;  3KRW B;  4N14 A;  3VH0 A;  3EMH A;  1VZ2 A;  2I0R A;  4J79 A;  2B5N A;  2H9L A;  3RFG A;  1PBY B;  1N6D A;  5IT9 g;  3IJ0 A;  4JD2 C;  4J8G A;  4E54 B;  4L1M A;  3RFH A;  2Z2P A;  3SBR A;  2WQ8 A;  2MTA H;  2VDN A;  1PI6 A;  3BG1 A;  3ZE1 A;  3GFC A;  4D0K A;  2UZY B;  2QC5 A;  3MUN A;  5EML B;  3ZDX A;  4A08 A;  5FQD A;  3V4P A;  3EI1 A;  4FA4 D;  3UKR C;  1UOP A;  3ULE C;  4PNK B;  3SMR A;  5JWZ A;  4X63 B;  4L3G D;  4QL1 A;  3UVL A;  5FA5 B;  5IGQ A;  3SXT D;  4A0A B;  4RE6 A;  4A2M A;  4KFM B;  2Q7Q A;  1H2W A;  2AGW A;  2EIE A;  4PSX B;  5E6U A;  3ZE0 A;  2H6Q A;  2OVR B;  5CYK B;  2HJ4 A;  5GXH A;  5FFO A;  2HJB A;  5M5T A;  5HDB A;  4BP8 A;  1NEX B;  3IIY A;  3ORV D;  4WK2 A;  4J8B A;  5EM2 A;  3SBQ A;  2XE4 A;  5IGO A;  4J0W A;  4R7A B;  4FHL A;  1M1X A;  4G56 B;  5EAP A;  3EI3 B;  5CXC B;  5EMJ B;  2YNO A;  3MZK A;  3PXT D;  1MG2 A;  1I2M B;  3AL8 B;  3OKY A;  4K3J B;  1GOH A;  1H2Z A;  2VDR A;  2H9M A;  3MKS B;  1RI6 A;  3BG0 A;  4AMY A;  4FB1 D;  2JKX A;  4GGD A;  4L1Q D;  5E6R A;  1NR0 A;  3C5M A;  4IRZ A;  4PXW A;  3FCS A;  4G1E A;  4BCD A;  1N6F A;  2EID A;  3I7O A;  1K3I A;  1K8K C;  4CZV A;  4JT6 C;  4TZ4 A;  2EIB A;  5TF2 A;  4A09 A;  2HKM A;  1E8M A;  3EI2 A;  2AGZ A;  3EG6 A;  4I79 A;  5E6S A;  1O6G A;  2XDW A;  3GD1 I;  3K6S A;  4PBZ A;  1MG3 A;  4RE5 A;  3NVQ A;  4JXM A;  3V5W B;  4ZOZ A;  3V9F A;  3JAM g;  3CIK B;  1JTD B;  3IJE A;  2H6N A;  2H13 A;  5IJ7 E;  3MXX A;  4ERZ A;  2VDL A;  4D9S A;  1XKS A;  4YVD A;  4ES0 A;  4UM9 A;  5EMM B;  4XEI C;  2P9I C;  3DWL C;  2W18 A;  4QRJ A;  1TBG A;  3GRE A;  3VI3 A;  1VE7 A;  4ERY A;  4A0B A;  1B9X A;  4QAM A;  3I7P A;  3KRX B;  4ERQ A;  3MMY A;  4IMM A;  4AN0 A;  2CO0 C;  2B5L A;  2HES X;  3NIF A;  3RLM D;  2GNQ A;  1UTC A;  5CXB B;  4GGA A;  4H5I A;  4CI8 A;  2UZX B;  4U7A A;  5EAM A;  4DNU A;  3I8C A;  3IJC A;  3IIW A;  2PM6 B;  4L3H D;  4X60 B;  3MKQ A;  2QR5 A;  3K26 A;  4GMB A;  4BH6 A;  3EI4 B;  3FGB A;  5B4W A;  1PEV A;  2VDQ A;  3PVU B;  4J86 A;  2OK6 A;  2PM9 B;  3PSC B;  4CZY A;  2H47 A;  3RN0 D;  3T3M A;  3J80 g;  2H14 A;  4J84 A;  4A7J A;  3VI4 A;  1H2Y A;  1OLZ A;  4J82 A;  4NC4 A;  2IUR A;  1MDA H;  3J81 g;  3DDU A;  3RRM C;  5SXM A;  5GMK n;  4A11 B;  4J87 A;  5M5R A;  2BCJ B;  1PGU A;  2GC4 A;  1S4U X;  2G9A A;  2QZP A;  3K27 A;  3DXM C;  4QQE A;  2Z2N A;  3P4F A;  4HDJ A;  5M5V A;  5FLX g;  4CI2 A;  4A0A A;  1H2X A;  4DNV A;  4JSV C;  3NVX A;  4NAA A;  5HE0 B;  4GQ1 A;  5K1C C;  4O1Q D;  3IUM A;  4X3E A;  5EAR A;  3AFC A;  1Q47 A;  3JPX A;  1GP2 B;  5FKQ A;  5M5U A;  3EQ9 A;  3PXS D;  2H3X A;  3OL2 B;  1JOF A;  3JZN A;  3ZDZ A;  4BUJ C;  1GOF A;  2G99 A;  2IAA A;  1K32 A;  2I0T A;  4L9O A;  2P9L C;  4GQB B;  4BCB A;  1GXR A;  2XL2 A;  3EI3 A;  5FKS A;  3I7H A;  1E8N A;  1B9Y A;  3UVO A;  4E5Z A;  3AL8 A;  4A08 B;  5IC7 A;  3MZL A;  3EI1 B;  2GC7 A;  3F3G A;  2XYI A;  3CFS B;  2VC2 A;  3JZG A;  3DM0 A;  3JZH A;  4JT5 C;  1L0Q A;  4OWR A;  4AX4 A;  5KDO B;  4O3U B;  2CN2 A;  3FCU A;  1UOO A;  3QI0 A;  4JSX C;  1SHY B;  3OTT A;  4O02 A;  1UOQ A; 
#chains in the Genus database with same CATH homology
 4NC4 A;  4JHP C;  4DNU A;  4D9S A;  3OF7 A;  4DNW A;  4O2W A;  4DNV A;  4NAA A;  1I2M B;  4JHN A;  3QHY B;  4QAM A;  4L1M A;  3KCI A;  3QI0 A;  3MVD K;  1JTD B;  4NBM A;  1A12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...