4G56B

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
303
structure length
292
Chain Sequence
CMEVQIGAVRYRRDGALLLAASSLSSRTWGGSIWVFKDPENESLCTAGVQTEAGVTDVAWVSEKGILVASDSGAVELWLVNKFAKYEHDDIVKTLSVFSDGTQAVSGGKDFSVKVWDLSQKAVLKSYNAHSSEVNCVAACPGKDTIFLSCGEDGRILLWDTRKPKPATRIDFCASDTIPTSVTWHPEKDDTFACGDETGNVSLVNIKNPDSAQTSAVHSQNITGLAYSYHSSPFLASISEDCTVAVLDADFSEVFRDLSHRDFVTGVAWSPLDHSKFTTVGWDHKVLHHHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hsl7 protein
publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
source organism Xenopus laevis
total genus 59
structure length 292
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4g56B00
2AGWA 2GNQA 3IIYA 3I8CA 4NSXA 3AL8B 2B5NA 2CO0C 4FAND 1NEXB 1JOFA 1R5MA 2BCJB 4JXMA 1TYQC 1K32A 2YNNA 3RFHA 4E54B 4AEZA 3RLMD 3SJLD 4FB1D 4A0AA 1ERJA 3I2NA 4X63B 3JPXA 5FQDA 2H47A 2UZYB 2B5LA 3KRWB 3B7FA 3VH0A 3KRXB 2IUQA 3JROA 3IJ1A 4AOWA 2I0SA 1SQJA 3UR4A 2P9PC 2QXVA 1K8KC 4Y7RA 2H3XA 4GQBB 3N0EA 3DSMA 1S4UX 3I8EA 3SMRA 4PSWB 3SXTD 4JT5C 3I7HA 3EU7A 4J81A 4LGNA 2PM6B 2HJ4A 4CY1A 2XU7A 4EWRA 2PM7B 3MZLA 2H9NA 4FWWA 5TEFA 1MG3A 3A0FA 1MDAH 2B5MA 4GMBA 3I7OA 4ZOVA 5EAPA 3ZWLB 2G99A 5GMKn 1N6DA 3CIKB 3FRXA 5GSAA 3DXMC 2HKMA 2BBKH 5K1CC 3SBRA 4ERQA 3SLED 5I5IA 3J80g 2YMUA 4JSNC 1VYHC 3K26A 3UVOA 2IAAA 4Y5RD 3L4OD 2H6QA 5CYKA 2IWKA 2Z2OA 3PE7A 4ZN4A 2P9UC 3JZGA 3AL8A 3C75H 2GC4A 2H14A 3P4FA 4A2MA 2Z2NA 2AGXA 2P9NC 4L3GD 4A2LA 4CI3A 4FAVD 3AH8B 3EI3B 5FA5B 1XHMA 4L9OA 4ESGA 4TZ4A 4J79A 3BWSA 1U4CA 2J56H 3E0CA 1Q47A 4J84A 5CYKB 5HYNB 2UZXB 4GGDA 3I89A 5H14A 5FKRA 1PI6A 4OWRA 4D0KA 4FA4D 2CO0A 4FA5D 3RN0D 2CN3A 2PM9B 3CFVA 5FXYA 2XL2A 1SHYB 1TBGA 2H68A 3VGZA 3PXWD 4BH6A 5KDOB 3PSCB 3NVNA 4O3TB 3MZKA 4H5JA 3JZNA 3UKUC 2AH1A 5IT9g 4J86A 4A08A 3DM0A 5TF2A 5CXCB 1N6FA 2HYEA 5I5JA 3NVXA 2CNXA 1PBYB 2OVRB 1XIPA 4K3JB 1RI6A 2Z2PA 3UVKA 1JMXB 3IJCA 4KFMB 4JT6C 3DWLC 2I3TA 1GXRA 4ZOXA 1U2VC 5EARA 1B9YA 5I5MA 2H9MA 3EI4A 3I7PA 2P9LC 2XL3A 1FWXA 1JJUB 2I0TA 5HE0B 5TDHB 3SBQA 3FGBA 3V9FA 5AFU3 2AGLA 3HFQA 3SVWD 3IIWA 4CY5A 2HXCA 2B4EA 4A08B 4U1EI 3EI2A 4QL1A 4Z8LA 3C5MA 4XYIA 2AQ5A 3OL2A 4O9DA 4GM3A 3F3PA 2EBSA 2QC5A 4K3ID 4GM8A 5EMLB 2IUPA 3SFZA 4XEIC 2PBIB 3UKRC 1B9XA 4J8GA 4UI9R 2CE8A 3EI3A 3BG1A 3EI4B 4A11B 3C99A 4FA1D 3L4MD 5HQGA 1XKSA 4A09A 2OIZA 3F3GA 3MKQA 4JSVC 3JZHA 5EAMA 4HDJA 4QT8A 3RMZD 2YB8B 4GQ1A 2P9KC 5TEEA 2IWFA 3EI2B 4FHLA 2J57G 2OK6A 4CZXA 4N14A 4A0BA 1N6EA 5HE1B 4ERZA 3F3FA 3SHFA 4L1QD 3OL2B 3ORVD 1A0RB 2PM9A 5FKSA 5H1MA 2OJYA 2H13A 5CXBA 4CI2A 4GZ8A 3VA6A 5FKTA 4GGCA 3EI1B 3BG0A 4GQ2P 3OTTA 5THAA 5H17A 3K27A 2CE9A 3IKOA 4A09B 4I79A 2W18A 2G9AA 5K19A 3CFSB 4A7JA 4CI8A 4BUJC 4JSXC 3SWSD 5FLXg 3RRMC 5CXCA 4D6VA 5EMJB 4A0BB 5FKQA 1L0QA 4J87A 5EM2A 4JD2C 5B4WA 4CI1A 4X61B 1OLZA 4LG8A 3IJ0A 5HE3B 5CXBB 4H5IA 3C9CA 3ODTA 4QQEA 3EG6A 4PNKB 5IJ8E 4J82A 5EMMB 1PEVA 4XYHA 3OKYA 2H9LA 4GGAA 4CY2A 3UVNA 4PSXB 4YVDA 1SQ9A 2H6KA 3FM0A 3OKTA 2OVQB 5SXMA 3PVWB 4O1QD 3J81g 1P22A 2CN2A 5EM2B 5IC7A 4X3EA 4PC0A 4ES0A 3RN1D 4CC9A 3SN6B 1GOTB 4PBYA 3SCYA 5C2WB 1GP2B 4L3HD 3NVQA 5EALA 3PXTD 2Q7QA 4G56B 4A11A 3U4YA 3OKYB 3I7LA 2AGYA 3MMYA 4ZOYA 1QNIA 2XYIA 5C9ZB 4PBZA 2H9PA 5AJAA 3JB9L 2AH0A 4X60B 1PGUA 2TRCB 2YNPA 3EWEA 1YFQA 4J73A 4JSPC 3MKSB 4OZUA 3UVMA 4A0AB 1GG2B 3RFGA 5EMKB 4E5ZA 4J0WA 2P9SC 3I7KA 2IUVA 3PSLA 4J78A 4GM9A 3ULEC 5IJ7E 1JMZB 3EI1A 4MK0B 1OMWB 2O9KA 1NR0A 3I7NA 4R7AB 5JWZA 2OK4A 3SBPA 4PXWA 3GREA 2HJBA 4FA9D 4ZOZA 4ERYA 2IURA 2AGZA 4E5ZB 3AL9A 3PXSD 5HE2B 2P9IC 4LG9A 4O45A 5AMSA 2HESX 3UVLA 2MTAH 4J0XA 3RSEC 3OKWA 4BL0A 2YBAA 4CY3A 2I3SA 3V7DB 5C2VB 2I0RA 5GXHA 5A2Qg 5GXIA 3EMHA 4O3UB 3MXXA 1MG2A 4CZYA 3W15A 4E54A 3AFCA 3DXKC 4U7AA 3JAMg 5IGQA 4IA9A 4IMMA 2H6NA 4J77A 3GFCA 2J55H 2OVPB 4J8BA 2HKRA 3N0DA 2YNOA 4QRJA 4CZVA 3PVUB 2GC7A 3JRPA 5IGOA 3V5WB 3OW8A
chains in the Genus database with same CATH superfamily
2AGWA 2GNQA 3IIYA 3I8CA 4NSXA 3AL8B 2B5NA 2CO0C 4FAND 2EIEA 1NEXB 1JOFA 4D9SA 1R5MA 2BCJB 4JXMA 1TYQC 1UOOA 1K32A 2YNNA 1TYEA 3RFHA 3T3MA 4E54B 4AEZA 3RLMD 3SJLD 4FB1D 4A0AA 1ERJA 3I2NA 4BCBA 4X63B 2XZGA 3OF7A 3ZE0A 3JPXA 5FQDA 1GOFA 2H47A 2UZYB 2B5LA 2WQ8A 3KRWB 3O4HA 3B7FA 3VH0A 3KRXB 2IUQA 3JROA 3IJ1A 4AOWA 3IVMA 2I0SA 1SQJA 3UR4A 2P9PC 4AN1A 2QXVA 1K8KC 1UOPA 4Y7RA 2H3XA 5M5RA 3IUJA 4GQBB 3N0EA 2BKLA 3DSMA 1S4UX 3I8EA 4MMZA 1E8NA 3SMRA 4BCDA 4PSWB 3SXTD 4JT5C 3I7HA 4O2WA 5M5SA 4UM8A 3EU7A 4IRZA 4J81A 4LGNA 2PM6B 3V4PA 3ZDXA 2HJ4A 4CY1A 2XU7A 4EWRA 2PM7B 3MZLA 2H9NA 4FWWA 5TEFA 1MG3A 3A0FA 1MDAH 1QFSA 2B5MA 4GMBA 3I7OA 4ZOVA 4BCCA 5EAPA 4Z7QA 3ZWLB 2G99A 4DNWA 5GMKn 1M1XA 4G1EA 1N6DA 3CIKB 3FRXA 4QAMA 4NC4A 5HDBA 5GSAA 4BP8A 3DXMC 2HKMA 2BBKH 5K1CC 3SBRA 4ERQA 3SLED 4AMYA 5I5IA 3J80g 4JHPC 4WK2A 2YMUA 4JSNC 1VYHC 1H2ZA 5M5UA 3K26A 1E8MA 3UVOA 2IAAA 4Y5RD 5E6RA 3MUOA 3L4OD 2H6QA 5CYKA 1BPOA 2IWKA 2Z2OA 3PE7A 4ZN4A 2P9UC 1C9LA 3JZGA 3AL8A 3C75H 1UTCA 2GC4A 3EQ8A 3K71A 2H14A 3P4FA 4A2MA 2Z2NA 2AGXA 1VZ2A 2P9NC 4L3GD 4A2LA 4CI3A 4FAVD 3AH8B 3EI3B 5FA5B 1XHMA 4L9OA 4ESGA 4TZ4A 3BWSA 4J79A 1U4CA 3ZE1A 2J56H 3E0CA 1Q47A 4J84A 3O4JA 5CYKB 1I2MB 5HYNB 2UZXB 4GGDA 3I89A 5H14A 5FKRA 1PI6A 4OWRA 4D0KA 4FA4D 2CO0A 4FA5D 3RN0D 2CN3A 2PM9B 3CFVA 5FXYA 2XL2A 1SHYB 1TBGA 2H68A 3VGZA 4MMXA 3PXWD 4BH6A 1JV2A 5KDOB 3IJEA 2VDPA 3PSCB 3NVNA 4O3TB 3MZKA 4H5JA 3JZNA 5E6UA 3UKUC 2AH1A 5IT9g 4DNUA 4J86A 3ZDZA 2HU8A 3K72A 1O6GA 4A08A 3DM0A 5TF2A 5CXCB 1N6FA 2HYEA 1L5GA 5I5JA 3NVXA 2CNXA 1PBYB 2OVRB 1XIPA 4K3JB 1RI6A 1VE7A 2Z2PA 3UVKA 1JMXB 3IJCA 4KFMB 4JT6C 3DWLC 2I3TA 1GXRA 4ZOXA 1U2VC 5EARA 1B9YA 5I5MA 3I7PA 2H9MA 3EI4A 3GC3B 2P9LC 2XL3A 1FWXA 4NBMA 1JJUB 2I0TA 5HE0B 5TDHB 3MVDK 3SBQA 2VDRA 3FGBA 3V9FA 5AFU3 2AGLA 3HFQA 3SVWD 5M5VA 3IIWA 3EQ9A 4CY5A 2HXCA 2B4EA 2QR5A 4U1EI 3EI2A 2VDLA 4A08B 4QL1A 3O4GA 3QHYB 4Z8LA 5FFGA 3C5MA 2VDMA 4AMZA 3IULA 4XYIA 2AQ5A 5E6SA 2VDKA 3OL2A 4O9DA 4GM3A 3F3PA 2EBSA 2QC5A 4K3ID 4GM8A 5EMLB 2IUPA 3SFZA 4XEIC 2PBIB 3UKRC 1B9XA 3T3PA 4J8GA 4UI9R 2CE8A 3EI3A 3BG1A 3EI4B 4A11B 3C99A 4FA1D 3L4MD 5HQGA 1XKSA 4A09A 2OIZA 3F3GA 3MKQA 4JSVC 3JZHA 5M61A 5EAMA 4HDJA 4QT8A 3RMZD 1H2WA 2YB8B 4GQ1A 2P9KC 5TEEA 2IWFA 3EI2B 4AN0A 4FHLA 2J57G 2OK6A 4O02A 4CZXA 4N14A 4A0BA 1N6EA 1H2YA 5HE1B 3ZE2A 4ERZA 3F3FA 3SHFA 4L1QD 3OL2B 3ORVD 1A0RB 2PM9A 2VZ1A 5FKSA 5H1MA 2VDOA 2OJYA 4Z7OA 2H13A 5CXBA 4CI2A 4GZ8A 3VA6A 5FKTA 3NIFA 4GGCA 3EI1B 3BG0A 4GQ2P 3OTTA 5THAA 5H17A 3K27A 2CE9A 3IKOA 4A09B 4I79A 1O6FA 2W18A 2G9AA 3VI4A 5K19A 3CFSB 4A7JA 4CI8A 4BUJC 2EIDA 4JSXC 3SWSD 2HU5A 5FLXg 3RRMC 5CXCA 4D6VA 5EMJB 3KCIA 4A0BB 3V4VA 3O4IA 5FKQA 1L0QA 4J87A 5EM2A 4JD2C 4MMYA 5M5TA 5B4WA 5C86A 4CI1A 4X61B 1JTDB 1OLZA 4LG8A 3IJ0A 5HE3B 5CXBB 4H5IA 3C9CA 3ODTA 4QQEA 3EG6A 4PNKB 5IJ8E 4J82A 2VDQA 5EMMB 1PEVA 4XYHA 3OKYA 1YR2A 4AX4A 2H9LA 4GGAA 1UOQA 4CY2A 3UVNA 4PSXB 4YVDA 1A12A 1SQ9A 2H6KA 3FM0A 3OKTA 2OVQB 5SXMA 1U8CA 3PVWB 4O1QD 3J81g 4BP9A 4Z7NA 1P22A 3MUNA 2CN2A 5EM2B 5IC7A 4X3EA 4PC0A 4WK0A 4ES0A 3RN1D 4CC9A 3SN6B 1GOTB 4PBYA 5FFOA 3SCYA 5C2WB 1GP2B 4L3HD 3NVQA 5EALA 2VZ3A 2HU7A 2JKXA 1VE6A 3PXTD 2Q7QA 4G56B 4A11A 3U4YA 3OKYB 3I7LA 2AGYA 3MMYA 4NENA 3NIGA 4UM9A 4ZOYA 1QNIA 2XYIA 5C9ZB 4PBZA 2H9PA 5AJAA 3IUNA 1H2XA 3JB9L 3NIDA 2AH0A 4X60B 1PGUA 4DNVA 2TRCB 2YNPA 3EWEA 1YFQA 4J73A 4JSPC 3FCUA 3MKSB 4OZUA 3UVMA 4A0AB 4L1MA 1K3IA 1GG2B 3RFGA 2QZPA 5EMKB 4E5ZA 4J0WA 1GOHA 2P9SC 3IURA 3I7KA 2IUVA 1T2XA 3PSLA 2EICA 4GM9A 4J78A 1JMZB 2VC2A 3ULEC 5IJ7E 3EI1A 4MK0B 4RE6A 1OMWB 2O9KA 1NR0A 3I7NA 4R7AB 1C9IA 5JWZA 2OK4A 1GOGA 3EQ7A 1QFMA 3SBPA 2VDNA 4PXWA 3GREA 2HJBA 4FA9D 4ZOZA 4ERYA 3IUQA 2IURA 4G55A 2AGZA 2EIBA 3GD1I 4E5ZB 3AL9A 3PXSD 1VZ3A 5HE2B 2P9IC 4LG9A 4WJKA 4RE5A 4O45A 5AMSA 2HESX 3UVLA 2MTAH 4J0XA 3RSEC 3OKWA 3ZDYA 4BL0A 2YBAA 4CY3A 2I3SA 3V7DB 5C2VB 3IUMA 3FCSA 2I0RA 4NAAA 3VI3A 2XDWA 3QI0A 3DDUA 5A2Qg 5GXHA 5GXIA 3EMHA 4O3UB 3MXXA 1MG2A 4CZYA 4G1MA 3W15A 2XE4A 4E54A 3AFCA 3DXKC 4U7AA 3JAMg 5IGQA 4IA9A 4IMMA 2H6NA 4J77A 5C92A 3GFCA 2J55H 2OVPB 4J8BA 3K6SA 2HKRA 3N0DA 2YNOA 4QRJA 4CZVA 4WK4A 4JHNA 3PVUB 1E5TA 2GC7A 3JRPA 5IGOA 3V5WB 3OW8A
chains in the Genus database with same CATH topology
2AGWA 2GNQA 3IIYA 3I8CA 4NSXA 3AL8B 2B5NA 2CO0C 4FAND 1NEXB 1JOFA 1R5MA 2BCJB 4JXMA 1TYQC 1K32A 2YNNA 3RFHA 4E54B 4AEZA 3RLMD 3SJLD 4FB1D 4A0AA 1ERJA 3I2NA 4X63B 3JPXA 5FQDA 2H47A 2UZYB 2B5LA 3KRWB 3B7FA 3VH0A 3KRXB 2IUQA 3JROA 3IJ1A 4AOWA 2I0SA 1SQJA 3UR4A 2P9PC 2QXVA 1K8KC 4Y7RA 2H3XA 4GQBB 3N0EA 3DSMA 1S4UX 3I8EA 3SMRA 4PSWB 3SXTD 4JT5C 3I7HA 3EU7A 4J81A 4LGNA 2PM6B 2HJ4A 4CY1A 2XU7A 4EWRA 2PM7B 3MZLA 2H9NA 4FWWA 5TEFA 1MG3A 3A0FA 1MDAH 2B5MA 4GMBA 3I7OA 4ZOVA 5EAPA 3ZWLB 2G99A 5GMKn 1N6DA 3CIKB 3FRXA 5GSAA 3DXMC 2HKMA 2BBKH 5K1CC 3SBRA 4ERQA 3SLED 5I5IA 3J80g 2YMUA 4JSNC 1VYHC 3K26A 3UVOA 2IAAA 4Y5RD 3L4OD 2H6QA 5CYKA 2IWKA 2Z2OA 3PE7A 4ZN4A 2P9UC 3JZGA 3AL8A 3C75H 2GC4A 2H14A 3P4FA 4A2MA 2Z2NA 2AGXA 2P9NC 4L3GD 4A2LA 4CI3A 4FAVD 3AH8B 3EI3B 5FA5B 1XHMA 4L9OA 4ESGA 4TZ4A 4J79A 3BWSA 1U4CA 2J56H 3E0CA 1Q47A 4J84A 5CYKB 5HYNB 2UZXB 4GGDA 3I89A 5H14A 5FKRA 1PI6A 4OWRA 4D0KA 4FA4D 2CO0A 4FA5D 3RN0D 2CN3A 2PM9B 3CFVA 5FXYA 2XL2A 1SHYB 1TBGA 2H68A 3VGZA 3PXWD 4BH6A 5KDOB 3PSCB 3NVNA 4O3TB 3MZKA 4H5JA 3JZNA 3UKUC 2AH1A 5IT9g 4J86A 4A08A 3DM0A 5TF2A 5CXCB 1N6FA 2HYEA 5I5JA 3NVXA 2CNXA 1PBYB 2OVRB 1XIPA 4K3JB 1RI6A 2Z2PA 3UVKA 1JMXB 3IJCA 4KFMB 4JT6C 3DWLC 2I3TA 1GXRA 4ZOXA 1U2VC 5EARA 1B9YA 5I5MA 2H9MA 3EI4A 3I7PA 2P9LC 2XL3A 1FWXA 1JJUB 2I0TA 5HE0B 5TDHB 3SBQA 3FGBA 3V9FA 5AFU3 2AGLA 3HFQA 3SVWD 3IIWA 4CY5A 2HXCA 2B4EA 4A08B 4U1EI 3EI2A 4QL1A 4Z8LA 3C5MA 4XYIA 2AQ5A 3OL2A 4O9DA 4GM3A 3F3PA 2EBSA 2QC5A 4K3ID 4GM8A 5EMLB 2IUPA 3SFZA 4XEIC 2PBIB 3UKRC 1B9XA 4J8GA 4UI9R 2CE8A 3EI3A 3BG1A 3EI4B 4A11B 3C99A 4FA1D 3L4MD 5HQGA 1XKSA 4A09A 2OIZA 3F3GA 3MKQA 4JSVC 3JZHA 5EAMA 4HDJA 4QT8A 3RMZD 2YB8B 4GQ1A 2P9KC 5TEEA 2IWFA 3EI2B 4FHLA 2J57G 2OK6A 4CZXA 4N14A 4A0BA 1N6EA 5HE1B 4ERZA 3F3FA 3SHFA 4L1QD 3OL2B 3ORVD 1A0RB 2PM9A 5FKSA 5H1MA 2OJYA 2H13A 5CXBA 4CI2A 4GZ8A 3VA6A 5FKTA 4GGCA 3EI1B 3BG0A 4GQ2P 3OTTA 5THAA 5H17A 3K27A 2CE9A 3IKOA 4A09B 4I79A 2W18A 2G9AA 5K19A 3CFSB 4A7JA 4CI8A 4BUJC 4JSXC 3SWSD 5FLXg 3RRMC 5CXCA 4D6VA 5EMJB 4A0BB 5FKQA 1L0QA 4J87A 5EM2A 4JD2C 5B4WA 4CI1A 4X61B 1OLZA 4LG8A 3IJ0A 5HE3B 5CXBB 4H5IA 3C9CA 3ODTA 4QQEA 3EG6A 4PNKB 5IJ8E 4J82A 5EMMB 1PEVA 4XYHA 3OKYA 2H9LA 4GGAA 4CY2A 3UVNA 4PSXB 4YVDA 1SQ9A 2H6KA 3FM0A 3OKTA 2OVQB 5SXMA 3PVWB 4O1QD 3J81g 1P22A 2CN2A 5EM2B 5IC7A 4X3EA 4PC0A 4ES0A 3RN1D 4CC9A 3SN6B 1GOTB 4PBYA 3SCYA 5C2WB 1GP2B 4L3HD 3NVQA 5EALA 3PXTD 2Q7QA 4G56B 4A11A 3U4YA 3OKYB 3I7LA 2AGYA 3MMYA 4ZOYA 1QNIA 2XYIA 5C9ZB 4PBZA 2H9PA 5AJAA 3JB9L 2AH0A 4X60B 1PGUA 2TRCB 2YNPA 3EWEA 1YFQA 4J73A 4JSPC 3MKSB 4OZUA 3UVMA 4A0AB 1GG2B 3RFGA 5EMKB 4E5ZA 4J0WA 2P9SC 3I7KA 2IUVA 3PSLA 4J78A 4GM9A 3ULEC 5IJ7E 1JMZB 3EI1A 4MK0B 1OMWB 2O9KA 1NR0A 3I7NA 4R7AB 5JWZA 2OK4A 3SBPA 4PXWA 3GREA 2HJBA 4FA9D 4ZOZA 4ERYA 2IURA 2AGZA 4E5ZB 3AL9A 3PXSD 5HE2B 2P9IC 4LG9A 4O45A 5AMSA 2HESX 3UVLA 2MTAH 4J0XA 3RSEC 3OKWA 4BL0A 2YBAA 4CY3A 2I3SA 3V7DB 5C2VB 2I0RA 5GXHA 5A2Qg 5GXIA 3EMHA 4O3UB 3MXXA 1MG2A 4CZYA 3W15A 4E54A 3AFCA 3DXKC 4U7AA 3JAMg 5IGQA 4IA9A 4IMMA 2H6NA 4J77A 3GFCA 2J55H 2OVPB 4J8BA 2HKRA 3N0DA 2YNOA 4QRJA 4CZVA 3PVUB 2GC7A 3JRPA 5IGOA 3V5WB 3OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW A;  2GNQ A;  3IIY A;  3I8C A;  4NSX A;  3AL8 B;  2B5N A;  2CO0 C;  4FAN D;  1NEX B;  1JOF A;  1R5M A;  2BCJ B;  4JXM A;  1TYQ C;  1K32 A;  2YNN A;  3RFH A;  4E54 B;  4AEZ A;  3RLM D;  3SJL D;  4FB1 D;  4A0A A;  1ERJ A;  3I2N A;  4X63 B;  3JPX A;  5FQD A;  2H47 A;  2UZY B;  2B5L A;  3KRW B;  3B7F A;  3VH0 A;  3KRX B;  2IUQ A;  3JRO A;  3IJ1 A;  4AOW A;  2I0S A;  1SQJ A;  3UR4 A;  2P9P C;  2QXV A;  1K8K C;  4Y7R A;  2H3X A;  4GQB B;  3N0E A;  3DSM A;  1S4U X;  3I8E A;  3SMR A;  4PSW B;  3SXT D;  4JT5 C;  3I7H A;  3EU7 A;  4J81 A;  4LGN A;  2PM6 B;  2HJ4 A;  4CY1 A;  2XU7 A;  4EWR A;  2PM7 B;  3MZL A;  2H9N A;  4FWW A;  5TEF A;  1MG3 A;  3A0F A;  1MDA H;  2B5M A;  4GMB A;  3I7O A;  4ZOV A;  5EAP A;  3ZWL B;  2G99 A;  5GMK n;  1N6D A;  3CIK B;  3FRX A;  5GSA A;  3DXM C;  2HKM A;  2BBK H;  5K1C C;  3SBR A;  4ERQ A;  3SLE D;  5I5I A;  3J80 g;  2YMU A;  4JSN C;  1VYH C;  3K26 A;  3UVO A;  2IAA A;  4Y5R D;  3L4O D;  2H6Q A;  5CYK A;  2IWK A;  2Z2O A;  3PE7 A;  4ZN4 A;  2P9U C;  3JZG A;  3AL8 A;  3C75 H;  2GC4 A;  2H14 A;  3P4F A;  4A2M A;  2Z2N A;  2AGX A;  2P9N C;  4L3G D;  4A2L A;  4CI3 A;  4FAV D;  3AH8 B;  3EI3 B;  5FA5 B;  1XHM A;  4L9O A;  4ESG A;  4TZ4 A;  4J79 A;  3BWS A;  1U4C A;  2J56 H;  3E0C A;  1Q47 A;  4J84 A;  5CYK B;  5HYN B;  2UZX B;  4GGD A;  3I89 A;  5H14 A;  5FKR A;  1PI6 A;  4OWR A;  4D0K A;  4FA4 D;  2CO0 A;  4FA5 D;  3RN0 D;  2CN3 A;  2PM9 B;  3CFV A;  5FXY A;  2XL2 A;  1SHY B;  1TBG A;  2H68 A;  3VGZ A;  3PXW D;  4BH6 A;  5KDO B;  3PSC B;  3NVN A;  4O3T B;  3MZK A;  4H5J A;  3JZN A;  3UKU C;  2AH1 A;  5IT9 g;  4J86 A;  4A08 A;  3DM0 A;  5TF2 A;  5CXC B;  1N6F A;  2HYE A;  5I5J A;  3NVX A;  2CNX A;  1PBY B;  2OVR B;  1XIP A;  4K3J B;  1RI6 A;  2Z2P A;  3UVK A;  1JMX B;  3IJC A;  4KFM B;  4JT6 C;  3DWL C;  2I3T A;  1GXR A;  4ZOX A;  1U2V C;  5EAR A;  1B9Y A;  5I5M A;  2H9M A;  3EI4 A;  3I7P A;  2P9L C;  2XL3 A;  1FWX A;  1JJU B;  2I0T A;  5HE0 B;  5TDH B;  3SBQ A;  3FGB A;  3V9F A;  5AFU 3;  2AGL A;  3HFQ A;  3SVW D;  3IIW A;  4CY5 A;  2HXC A;  2B4E A;  4A08 B;  4U1E I;  3EI2 A;  4QL1 A;  4Z8L A;  3C5M A;  4XYI A;  2AQ5 A;  3OL2 A;  4O9D A;  4GM3 A;  3F3P A;  2EBS A;  2QC5 A;  4K3I D;  4GM8 A;  5EML B;  2IUP A;  3SFZ A;  4XEI C;  2PBI B;  3UKR C;  1B9X A;  4J8G A;  4UI9 R;  2CE8 A;  3EI3 A;  3BG1 A;  3EI4 B;  4A11 B;  3C99 A;  4FA1 D;  3L4M D;  5HQG A;  1XKS A;  4A09 A;  2OIZ A;  3F3G A;  3MKQ A;  4JSV C;  3JZH A;  5EAM A;  4HDJ A;  4QT8 A;  3RMZ D;  2YB8 B;  4GQ1 A;  2P9K C;  5TEE A;  2IWF A;  3EI2 B;  4FHL A;  2J57 G;  2OK6 A;  4CZX A;  4N14 A;  4A0B A;  1N6E A;  5HE1 B;  4ERZ A;  3F3F A;  3SHF A;  4L1Q D;  3OL2 B;  3ORV D;  1A0R B;  2PM9 A;  5FKS A;  5H1M A;  2OJY A;  2H13 A;  5CXB A;  4CI2 A;  4GZ8 A;  3VA6 A;  5FKT A;  4GGC A;  3EI1 B;  3BG0 A;  4GQ2 P;  3OTT A;  5THA A;  5H17 A;  3K27 A;  2CE9 A;  3IKO A;  4A09 B;  4I79 A;  2W18 A;  2G9A A;  5K19 A;  3CFS B;  4A7J A;  4CI8 A;  4BUJ C;  4JSX C;  3SWS D;  5FLX g;  3RRM C;  5CXC A;  4D6V A;  5EMJ B;  4A0B B;  5FKQ A;  1L0Q A;  4J87 A;  5EM2 A;  4JD2 C;  5B4W A;  4CI1 A;  4X61 B;  1OLZ A;  4LG8 A;  3IJ0 A;  5HE3 B;  5CXB B;  4H5I A;  3C9C A;  3ODT A;  4QQE A;  3EG6 A;  4PNK B;  5IJ8 E;  4J82 A;  5EMM B;  1PEV A;  4XYH A;  3OKY A;  2H9L A;  4GGA A;  4CY2 A;  3UVN A;  4PSX B;  4YVD A;  1SQ9 A;  2H6K A;  3FM0 A;  3OKT A;  2OVQ B;  5SXM A;  3PVW B;  4O1Q D;  3J81 g;  1P22 A;  2CN2 A;  5EM2 B;  5IC7 A;  4X3E A;  4PC0 A;  4ES0 A;  3RN1 D;  4CC9 A;  3SN6 B;  1GOT B;  4PBY A;  3SCY A;  5C2W B;  1GP2 B;  4L3H D;  3NVQ A;  5EAL A;  3PXT D;  2Q7Q A;  4G56 B;  4A11 A;  3U4Y A;  3OKY B;  3I7L A;  2AGY A;  3MMY A;  4ZOY A;  1QNI A;  2XYI A;  5C9Z B;  4PBZ A;  2H9P A;  5AJA A;  3JB9 L;  2AH0 A;  4X60 B;  1PGU A;  2TRC B;  2YNP A;  3EWE A;  1YFQ A;  4J73 A;  4JSP C;  3MKS B;  4OZU A;  3UVM A;  4A0A B;  1GG2 B;  3RFG A;  5EMK B;  4E5Z A;  4J0W A;  2P9S C;  3I7K A;  2IUV A;  3PSL A;  4J78 A;  4GM9 A;  3ULE C;  5IJ7 E;  1JMZ B;  3EI1 A;  4MK0 B;  1OMW B;  2O9K A;  1NR0 A;  3I7N A;  4R7A B;  5JWZ A;  2OK4 A;  3SBP A;  4PXW A;  3GRE A;  2HJB A;  4FA9 D;  4ZOZ A;  4ERY A;  2IUR A;  2AGZ A;  4E5Z B;  3AL9 A;  3PXS D;  5HE2 B;  2P9I C;  4LG9 A;  4O45 A;  5AMS A;  2HES X;  3UVL A;  2MTA H;  4J0X A;  3RSE C;  3OKW A;  4BL0 A;  2YBA A;  4CY3 A;  2I3S A;  3V7D B;  5C2V B;  2I0R A;  5GXH A;  5A2Q g;  5GXI A;  3EMH A;  4O3U B;  3MXX A;  1MG2 A;  4CZY A;  3W15 A;  4E54 A;  3AFC A;  3DXK C;  4U7A A;  3JAM g;  5IGQ A;  4IA9 A;  4IMM A;  2H6N A;  4J77 A;  3GFC A;  2J55 H;  2OVP B;  4J8B A;  2HKR A;  3N0D A;  2YNO A;  4QRJ A;  4CZV A;  3PVU B;  2GC7 A;  3JRP A;  5IGO A;  3V5W B;  3OW8 A; 
#chains in the Genus database with same CATH topology
 2AGW A;  2GNQ A;  3IIY A;  3I8C A;  4NSX A;  3AL8 B;  2B5N A;  2CO0 C;  4FAN D;  2EIE A;  1NEX B;  1JOF A;  4D9S A;  1R5M A;  2BCJ B;  4JXM A;  1TYQ C;  1UOO A;  1K32 A;  2YNN A;  1TYE A;  3RFH A;  3T3M A;  4E54 B;  4AEZ A;  3RLM D;  3SJL D;  4FB1 D;  4A0A A;  1ERJ A;  3I2N A;  4BCB A;  4X63 B;  2XZG A;  3OF7 A;  3ZE0 A;  3JPX A;  5FQD A;  1GOF A;  2H47 A;  2UZY B;  2B5L A;  2WQ8 A;  3KRW B;  3O4H A;  3B7F A;  3VH0 A;  3KRX B;  2IUQ A;  3JRO A;  3IJ1 A;  4AOW A;  3IVM A;  2I0S A;  1SQJ A;  3UR4 A;  2P9P C;  4AN1 A;  2QXV A;  1K8K C;  1UOP A;  4Y7R A;  2H3X A;  5M5R A;  3IUJ A;  4GQB B;  3N0E A;  2BKL A;  3DSM A;  1S4U X;  3I8E A;  4MMZ A;  1E8N A;  3SMR A;  4BCD A;  4PSW B;  3SXT D;  4JT5 C;  3I7H A;  4O2W A;  5M5S A;  4UM8 A;  3EU7 A;  4IRZ A;  4J81 A;  4LGN A;  2PM6 B;  3V4P A;  3ZDX A;  2HJ4 A;  4CY1 A;  2XU7 A;  4EWR A;  2PM7 B;  3MZL A;  2H9N A;  4FWW A;  5TEF A;  1MG3 A;  3A0F A;  1MDA H;  1QFS A;  2B5M A;  4GMB A;  3I7O A;  4ZOV A;  4BCC A;  5EAP A;  4Z7Q A;  3ZWL B;  2G99 A;  4DNW A;  5GMK n;  1M1X A;  4G1E A;  1N6D A;  3CIK B;  3FRX A;  4QAM A;  4NC4 A;  5HDB A;  5GSA A;  4BP8 A;  3DXM C;  2HKM A;  2BBK H;  5K1C C;  3SBR A;  4ERQ A;  3SLE D;  4AMY A;  5I5I A;  3J80 g;  4JHP C;  4WK2 A;  2YMU A;  4JSN C;  1VYH C;  1H2Z A;  5M5U A;  3K26 A;  1E8M A;  3UVO A;  2IAA A;  4Y5R D;  5E6R A;  3MUO A;  3L4O D;  2H6Q A;  5CYK A;  1BPO A;  2IWK A;  2Z2O A;  3PE7 A;  4ZN4 A;  2P9U C;  1C9L A;  3JZG A;  3AL8 A;  3C75 H;  1UTC A;  2GC4 A;  3EQ8 A;  3K71 A;  2H14 A;  3P4F A;  4A2M A;  2Z2N A;  2AGX A;  1VZ2 A;  2P9N C;  4L3G D;  4A2L A;  4CI3 A;  4FAV D;  3AH8 B;  3EI3 B;  5FA5 B;  1XHM A;  4L9O A;  4ESG A;  4TZ4 A;  3BWS A;  4J79 A;  1U4C A;  3ZE1 A;  2J56 H;  3E0C A;  1Q47 A;  4J84 A;  3O4J A;  5CYK B;  1I2M B;  5HYN B;  2UZX B;  4GGD A;  3I89 A;  5H14 A;  5FKR A;  1PI6 A;  4OWR A;  4D0K A;  4FA4 D;  2CO0 A;  4FA5 D;  3RN0 D;  2CN3 A;  2PM9 B;  3CFV A;  5FXY A;  2XL2 A;  1SHY B;  1TBG A;  2H68 A;  3VGZ A;  4MMX A;  3PXW D;  4BH6 A;  1JV2 A;  5KDO B;  3IJE A;  2VDP A;  3PSC B;  3NVN A;  4O3T B;  3MZK A;  4H5J A;  3JZN A;  5E6U A;  3UKU C;  2AH1 A;  5IT9 g;  4DNU A;  4J86 A;  3ZDZ A;  2HU8 A;  3K72 A;  1O6G A;  4A08 A;  3DM0 A;  5TF2 A;  5CXC B;  1N6F A;  2HYE A;  1L5G A;  5I5J A;  3NVX A;  2CNX A;  1PBY B;  2OVR B;  1XIP A;  4K3J B;  1RI6 A;  1VE7 A;  2Z2P A;  3UVK A;  1JMX B;  3IJC A;  4KFM B;  4JT6 C;  3DWL C;  2I3T A;  1GXR A;  4ZOX A;  1U2V C;  5EAR A;  1B9Y A;  5I5M A;  3I7P A;  2H9M A;  3EI4 A;  3GC3 B;  2P9L C;  2XL3 A;  1FWX A;  4NBM A;  1JJU B;  2I0T A;  5HE0 B;  5TDH B;  3MVD K;  3SBQ A;  2VDR A;  3FGB A;  3V9F A;  5AFU 3;  2AGL A;  3HFQ A;  3SVW D;  5M5V A;  3IIW A;  3EQ9 A;  4CY5 A;  2HXC A;  2B4E A;  2QR5 A;  4U1E I;  3EI2 A;  2VDL A;  4A08 B;  4QL1 A;  3O4G A;  3QHY B;  4Z8L A;  5FFG A;  3C5M A;  2VDM A;  4AMZ A;  3IUL A;  4XYI A;  2AQ5 A;  5E6S A;  2VDK A;  3OL2 A;  4O9D A;  4GM3 A;  3F3P A;  2EBS A;  2QC5 A;  4K3I D;  4GM8 A;  5EML B;  2IUP A;  3SFZ A;  4XEI C;  2PBI B;  3UKR C;  1B9X A;  3T3P A;  4J8G A;  4UI9 R;  2CE8 A;  3EI3 A;  3BG1 A;  3EI4 B;  4A11 B;  3C99 A;  4FA1 D;  3L4M D;  5HQG A;  1XKS A;  4A09 A;  2OIZ A;  3F3G A;  3MKQ A;  4JSV C;  3JZH A;  5M61 A;  5EAM A;  4HDJ A;  4QT8 A;  3RMZ D;  1H2W A;  2YB8 B;  4GQ1 A;  2P9K C;  5TEE A;  2IWF A;  3EI2 B;  4AN0 A;  4FHL A;  2J57 G;  2OK6 A;  4O02 A;  4CZX A;  4N14 A;  4A0B A;  1N6E A;  1H2Y A;  5HE1 B;  3ZE2 A;  4ERZ A;  3F3F A;  3SHF A;  4L1Q D;  3OL2 B;  3ORV D;  1A0R B;  2PM9 A;  2VZ1 A;  5FKS A;  5H1M A;  2VDO A;  2OJY A;  4Z7O A;  2H13 A;  5CXB A;  4CI2 A;  4GZ8 A;  3VA6 A;  5FKT A;  3NIF A;  4GGC A;  3EI1 B;  3BG0 A;  4GQ2 P;  3OTT A;  5THA A;  5H17 A;  3K27 A;  2CE9 A;  3IKO A;  4A09 B;  4I79 A;  1O6F A;  2W18 A;  2G9A A;  3VI4 A;  5K19 A;  3CFS B;  4A7J A;  4CI8 A;  4BUJ C;  2EID A;  4JSX C;  3SWS D;  2HU5 A;  5FLX g;  3RRM C;  5CXC A;  4D6V A;  5EMJ B;  3KCI A;  4A0B B;  3V4V A;  3O4I A;  5FKQ A;  1L0Q A;  4J87 A;  5EM2 A;  4JD2 C;  4MMY A;  5M5T A;  5B4W A;  5C86 A;  4CI1 A;  4X61 B;  1JTD B;  1OLZ A;  4LG8 A;  3IJ0 A;  5HE3 B;  5CXB B;  4H5I A;  3C9C A;  3ODT A;  4QQE A;  3EG6 A;  4PNK B;  5IJ8 E;  4J82 A;  2VDQ A;  5EMM B;  1PEV A;  4XYH A;  3OKY A;  1YR2 A;  4AX4 A;  2H9L A;  4GGA A;  1UOQ A;  4CY2 A;  3UVN A;  4PSX B;  4YVD A;  1A12 A;  1SQ9 A;  2H6K A;  3FM0 A;  3OKT A;  2OVQ B;  5SXM A;  1U8C A;  3PVW B;  4O1Q D;  3J81 g;  4BP9 A;  4Z7N A;  1P22 A;  3MUN A;  2CN2 A;  5EM2 B;  5IC7 A;  4X3E A;  4PC0 A;  4WK0 A;  4ES0 A;  3RN1 D;  4CC9 A;  3SN6 B;  1GOT B;  4PBY A;  5FFO A;  3SCY A;  5C2W B;  1GP2 B;  4L3H D;  3NVQ A;  5EAL A;  2VZ3 A;  2HU7 A;  2JKX A;  1VE6 A;  3PXT D;  2Q7Q A;  4G56 B;  4A11 A;  3U4Y A;  3OKY B;  3I7L A;  2AGY A;  3MMY A;  4NEN A;  3NIG A;  4UM9 A;  4ZOY A;  1QNI A;  2XYI A;  5C9Z B;  4PBZ A;  2H9P A;  5AJA A;  3IUN A;  1H2X A;  3JB9 L;  3NID A;  2AH0 A;  4X60 B;  1PGU A;  4DNV A;  2TRC B;  2YNP A;  3EWE A;  1YFQ A;  4J73 A;  4JSP C;  3FCU A;  3MKS B;  4OZU A;  3UVM A;  4A0A B;  4L1M A;  1K3I A;  1GG2 B;  3RFG A;  2QZP A;  5EMK B;  4E5Z A;  4J0W A;  1GOH A;  2P9S C;  3IUR A;  3I7K A;  2IUV A;  1T2X A;  3PSL A;  2EIC A;  4GM9 A;  4J78 A;  1JMZ B;  2VC2 A;  3ULE C;  5IJ7 E;  3EI1 A;  4MK0 B;  4RE6 A;  1OMW B;  2O9K A;  1NR0 A;  3I7N A;  4R7A B;  1C9I A;  5JWZ A;  2OK4 A;  1GOG A;  3EQ7 A;  1QFM A;  3SBP A;  2VDN A;  4PXW A;  3GRE A;  2HJB A;  4FA9 D;  4ZOZ A;  4ERY A;  3IUQ A;  2IUR A;  4G55 A;  2AGZ A;  2EIB A;  3GD1 I;  4E5Z B;  3AL9 A;  3PXS D;  1VZ3 A;  5HE2 B;  2P9I C;  4LG9 A;  4WJK A;  4RE5 A;  4O45 A;  5AMS A;  2HES X;  3UVL A;  2MTA H;  4J0X A;  3RSE C;  3OKW A;  3ZDY A;  4BL0 A;  2YBA A;  4CY3 A;  2I3S A;  3V7D B;  5C2V B;  3IUM A;  3FCS A;  2I0R A;  4NAA A;  3VI3 A;  2XDW A;  3QI0 A;  3DDU A;  5A2Q g;  5GXH A;  5GXI A;  3EMH A;  4O3U B;  3MXX A;  1MG2 A;  4CZY A;  4G1M A;  3W15 A;  2XE4 A;  4E54 A;  3AFC A;  3DXK C;  4U7A A;  3JAM g;  5IGQ A;  4IA9 A;  4IMM A;  2H6N A;  4J77 A;  5C92 A;  3GFC A;  2J55 H;  2OVP B;  4J8B A;  3K6S A;  2HKR A;  3N0D A;  2YNO A;  4QRJ A;  4CZV A;  4WK4 A;  4JHN A;  3PVU B;  1E5T A;  2GC7 A;  3JRP A;  5IGO A;  3V5W B;  3OW8 A; 
#chains in the Genus database with same CATH homology
 2AGW A;  2GNQ A;  3IIY A;  3I8C A;  4NSX A;  3AL8 B;  2B5N A;  2CO0 C;  4FAN D;  1NEX B;  1JOF A;  1R5M A;  2BCJ B;  4JXM A;  1TYQ C;  1K32 A;  2YNN A;  3RFH A;  4E54 B;  4AEZ A;  3RLM D;  3SJL D;  4FB1 D;  4A0A A;  1ERJ A;  3I2N A;  4X63 B;  3JPX A;  5FQD A;  2H47 A;  2UZY B;  2B5L A;  3KRW B;  3B7F A;  3VH0 A;  3KRX B;  2IUQ A;  3JRO A;  3IJ1 A;  4AOW A;  2I0S A;  1SQJ A;  3UR4 A;  2P9P C;  2QXV A;  1K8K C;  4Y7R A;  2H3X A;  4GQB B;  3N0E A;  3DSM A;  1S4U X;  3I8E A;  3SMR A;  4PSW B;  3SXT D;  4JT5 C;  3I7H A;  3EU7 A;  4J81 A;  4LGN A;  2PM6 B;  2HJ4 A;  4CY1 A;  2XU7 A;  4EWR A;  2PM7 B;  3MZL A;  2H9N A;  4FWW A;  5TEF A;  1MG3 A;  3A0F A;  1MDA H;  2B5M A;  4GMB A;  3I7O A;  4ZOV A;  5EAP A;  3ZWL B;  2G99 A;  5GMK n;  1N6D A;  3CIK B;  3FRX A;  5GSA A;  3DXM C;  2HKM A;  2BBK H;  5K1C C;  3SBR A;  4ERQ A;  3SLE D;  5I5I A;  3J80 g;  2YMU A;  4JSN C;  1VYH C;  3K26 A;  3UVO A;  2IAA A;  4Y5R D;  3L4O D;  2H6Q A;  5CYK A;  2IWK A;  2Z2O A;  3PE7 A;  4ZN4 A;  2P9U C;  3JZG A;  3AL8 A;  3C75 H;  2GC4 A;  2H14 A;  3P4F A;  4A2M A;  2Z2N A;  2AGX A;  2P9N C;  4L3G D;  4A2L A;  4CI3 A;  4FAV D;  3AH8 B;  3EI3 B;  5FA5 B;  1XHM A;  4L9O A;  4ESG A;  4TZ4 A;  4J79 A;  3BWS A;  1U4C A;  2J56 H;  3E0C A;  1Q47 A;  4J84 A;  5CYK B;  5HYN B;  2UZX B;  4GGD A;  3I89 A;  5H14 A;  5FKR A;  1PI6 A;  4OWR A;  4D0K A;  4FA4 D;  2CO0 A;  4FA5 D;  3RN0 D;  2CN3 A;  2PM9 B;  3CFV A;  5FXY A;  2XL2 A;  1SHY B;  1TBG A;  2H68 A;  3VGZ A;  3PXW D;  4BH6 A;  5KDO B;  3PSC B;  3NVN A;  4O3T B;  3MZK A;  4H5J A;  3JZN A;  3UKU C;  2AH1 A;  5IT9 g;  4J86 A;  4A08 A;  3DM0 A;  5TF2 A;  5CXC B;  1N6F A;  2HYE A;  5I5J A;  3NVX A;  2CNX A;  1PBY B;  2OVR B;  1XIP A;  4K3J B;  1RI6 A;  2Z2P A;  3UVK A;  1JMX B;  3IJC A;  4KFM B;  4JT6 C;  3DWL C;  2I3T A;  1GXR A;  4ZOX A;  1U2V C;  5EAR A;  1B9Y A;  5I5M A;  2H9M A;  3EI4 A;  3I7P A;  2P9L C;  2XL3 A;  1FWX A;  1JJU B;  2I0T A;  5HE0 B;  5TDH B;  3SBQ A;  3FGB A;  3V9F A;  5AFU 3;  2AGL A;  3HFQ A;  3SVW D;  3IIW A;  4CY5 A;  2HXC A;  2B4E A;  4A08 B;  4U1E I;  3EI2 A;  4QL1 A;  4Z8L A;  3C5M A;  4XYI A;  2AQ5 A;  3OL2 A;  4O9D A;  4GM3 A;  3F3P A;  2EBS A;  2QC5 A;  4K3I D;  4GM8 A;  5EML B;  2IUP A;  3SFZ A;  4XEI C;  2PBI B;  3UKR C;  1B9X A;  4J8G A;  4UI9 R;  2CE8 A;  3EI3 A;  3BG1 A;  3EI4 B;  4A11 B;  3C99 A;  4FA1 D;  3L4M D;  5HQG A;  1XKS A;  4A09 A;  2OIZ A;  3F3G A;  3MKQ A;  4JSV C;  3JZH A;  5EAM A;  4HDJ A;  4QT8 A;  3RMZ D;  2YB8 B;  4GQ1 A;  2P9K C;  5TEE A;  2IWF A;  3EI2 B;  4FHL A;  2J57 G;  2OK6 A;  4CZX A;  4N14 A;  4A0B A;  1N6E A;  5HE1 B;  4ERZ A;  3F3F A;  3SHF A;  4L1Q D;  3OL2 B;  3ORV D;  1A0R B;  2PM9 A;  5FKS A;  5H1M A;  2OJY A;  2H13 A;  5CXB A;  4CI2 A;  4GZ8 A;  3VA6 A;  5FKT A;  4GGC A;  3EI1 B;  3BG0 A;  4GQ2 P;  3OTT A;  5THA A;  5H17 A;  3K27 A;  2CE9 A;  3IKO A;  4A09 B;  4I79 A;  2W18 A;  2G9A A;  5K19 A;  3CFS B;  4A7J A;  4CI8 A;  4BUJ C;  4JSX C;  3SWS D;  5FLX g;  3RRM C;  5CXC A;  4D6V A;  5EMJ B;  4A0B B;  5FKQ A;  1L0Q A;  4J87 A;  5EM2 A;  4JD2 C;  5B4W A;  4CI1 A;  4X61 B;  1OLZ A;  4LG8 A;  3IJ0 A;  5HE3 B;  5CXB B;  4H5I A;  3C9C A;  3ODT A;  4QQE A;  3EG6 A;  4PNK B;  5IJ8 E;  4J82 A;  5EMM B;  1PEV A;  4XYH A;  3OKY A;  2H9L A;  4GGA A;  4CY2 A;  3UVN A;  4PSX B;  4YVD A;  1SQ9 A;  2H6K A;  3FM0 A;  3OKT A;  2OVQ B;  5SXM A;  3PVW B;  4O1Q D;  3J81 g;  1P22 A;  2CN2 A;  5EM2 B;  5IC7 A;  4X3E A;  4PC0 A;  4ES0 A;  3RN1 D;  4CC9 A;  3SN6 B;  1GOT B;  4PBY A;  3SCY A;  5C2W B;  1GP2 B;  4L3H D;  3NVQ A;  5EAL A;  3PXT D;  2Q7Q A;  4G56 B;  4A11 A;  3U4Y A;  3OKY B;  3I7L A;  2AGY A;  3MMY A;  4ZOY A;  1QNI A;  2XYI A;  5C9Z B;  4PBZ A;  2H9P A;  5AJA A;  3JB9 L;  2AH0 A;  4X60 B;  1PGU A;  2TRC B;  2YNP A;  3EWE A;  1YFQ A;  4J73 A;  4JSP C;  3MKS B;  4OZU A;  3UVM A;  4A0A B;  1GG2 B;  3RFG A;  5EMK B;  4E5Z A;  4J0W A;  2P9S C;  3I7K A;  2IUV A;  3PSL A;  4J78 A;  4GM9 A;  3ULE C;  5IJ7 E;  1JMZ B;  3EI1 A;  4MK0 B;  1OMW B;  2O9K A;  1NR0 A;  3I7N A;  4R7A B;  5JWZ A;  2OK4 A;  3SBP A;  4PXW A;  3GRE A;  2HJB A;  4FA9 D;  4ZOZ A;  4ERY A;  2IUR A;  2AGZ A;  4E5Z B;  3AL9 A;  3PXS D;  5HE2 B;  2P9I C;  4LG9 A;  4O45 A;  5AMS A;  2HES X;  3UVL A;  2MTA H;  4J0X A;  3RSE C;  3OKW A;  4BL0 A;  2YBA A;  4CY3 A;  2I3S A;  3V7D B;  5C2V B;  2I0R A;  5GXH A;  5A2Q g;  5GXI A;  3EMH A;  4O3U B;  3MXX A;  1MG2 A;  4CZY A;  3W15 A;  4E54 A;  3AFC A;  3DXK C;  4U7A A;  3JAM g;  5IGQ A;  4IA9 A;  4IMM A;  2H6N A;  4J77 A;  3GFC A;  2J55 H;  2OVP B;  4J8B A;  2HKR A;  3N0D A;  2YNO A;  4QRJ A;  4CZV A;  3PVU B;  2GC7 A;  3JRP A;  5IGO A;  3V5W B;  3OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...