4G56B

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
303
structure length
292
Chain Sequence
CMEVQIGAVRYRRDGALLLAASSLSSRTWGGSIWVFKDPENESLCTAGVQTEAGVTDVAWVSEKGILVASDSGAVELWLVNKFAKYEHDDIVKTLSVFSDGTQAVSGGKDFSVKVWDLSQKAVLKSYNAHSSEVNCVAACPGKDTIFLSCGEDGRILLWDTRKPKPATRIDFCASDTIPTSVTWHPEKDDTFACGDETGNVSLVNIKNPDSAQTSAVHSQNITGLAYSYHSSPFLASISEDCTVAVLDADFSEVFRDLSHRDFVTGVAWSPLDHSKFTTVGWDHKVLHHHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transferase
molecule keywords Hsl7 protein
total genus 59
structure length 292
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4g56B00
3N0EA 2OVPB 4CC9A 4ERYA 4QRJA 3FM0A 5IT9g 2CNXA 3AH8B 2I0SA 4JSPC 2P9IC 4PXWA 3ORVD 1TYQC 3SXTD 2B5NA 2YNNA 2P9UC 4JT6C 4E5ZB 2HKRA 4A11B 4IA9A 5CYKB 5IJ7E 3F3FA 4CY3A 1JOFA 3EI3B 4FB1D 3JPXA 3JZHA 4QL1A 3SN6B 5TDHB 4ZOYA 4MK0B 3IIYA 4O3UB 2QC5A 3U4YA 3I8CA 2TRCB 5KDOB 3UVNA 2H6KA 3EI4B 5TEEA 2H47A 5HE1B 2H6NA 4Y7RA 3OKYB 3I89A 1K32A 1P22A 3SWSD 2IUQA 2CO0A 1SQJA 1K8KC 5FXYA 3A0FA 3IJCA 5H17A 4CI3A 4E5ZA 3RFGA 5IGQA 5EM2A 3K26A 3E0CA 4PSXB 4J86A 4L3GD 1N6FA 4FWWA 5THAA 2OVRB 2AH1A 5EMLB 4A08B 5H14A 1PEVA 2XL2A 4GQ1A 2YNPA 5C9ZB 2BBKH 5AMSA 3PVUB 2OK6A 3AL8A 2G9AA 4O9DA 4A7JA 4GGDA 4NSXA 1SHYB 4ZOZA 3FRXA 2IUVA 2IURA 3IKOA 2J55H 4H5IA 3RFHA 4FA5D 3I7HA 3UKRC 3DXKC 4D6VA 2YB8B 4J0WA 4H5JA 4J78A 4IMMA 4JXMA 2P9PC 1FWXA 3EWEA 2H9MA 1GP2B 5GXIA 4Z8LA 3PVWB 5JWZA 1YFQA 2YMUA 5IJ8E 2UZXB 3EI2A 1R5MA 4J8GA 4HDJA 3MMYA 4ZOXA 3UR4A 2OVQB 4O1QD 4J87A 3JZGA 3I2NA 1RI6A 3MKQA 5C2VB 4GGCA 2HXCA 1VYHC 2I3TA 3SVWD 3NVNA 5TF2A 3RN0D 4D0KA 1JMXB 2H14A 5FKTA 3MZKA 2HYEA 5FQDA 3DXMC 5HE0B 4J73A 1XHMA 2YBAA 4UI9R 2OK4A 3NVQA 3PXSD 3EI1A 2B5MA 1B9YA 4A11A 4A0BB 4X3EA 3DWLC 5K19A 3GFCA 4A0AB 3SBPA 2CO0C 3W15A 4JSVC 3V5WB 2H68A 5GMKn 3L4OD 5HE2B 4CY1A 4CI2A 1OLZA 4E54B 2XU7A 2HJ4A 3IJ1A 3J81g 2H9PA 5I5IA 2O9KA 1GOTB 3P4FA 3NVXA 2I0TA 2G99A 5CXBA 3OKYA 3OW8A 3J80g 2H6QA 2I3SA 4J8BA 4FAVD 4GGAA 4GQ2P 4U1EI 4XYHA 2HKMA 3SBQA 3F3GA 4BUJC 2W18A 4A0BA 3EG6A 4BH6A 2P9NC 4BL0A 5GSAA 4QQEA 4PNKB 4ZN4A 4O45A 2B5LA 3DM0A 3SJLD 3UVMA 4ES0A 2Z2NA 3VGZA 2Q7QA 3OTTA 4E54A 2P9LC 4GQBB 4CY5A 4XEIC 3AL8B 2GNQA 2CN2A 3I7NA 2P9KC 5EALA 4U7AA 4A2MA 4GM3A 2B4EA 3UVLA 1MDAH 3OL2B 2OJYA 4QT8A 5EARA 2AGZA 3PXTD 3V9FA 5SXMA 3I7KA 4A2LA 4OZUA 3C9CA 1PGUA 3I8EA 3N0DA 3SMRA 1GXRA 5IGOA 5EM2B 3CIKB 3RMZD 2HJBA 2J56H 2AGLA 1XKSA 5I5JA 4R7AB 3F3PA 5AJAA 5C2WB 4G56B 3CFVA 5FA5B 1U2VC 4A09A 5GXHA 4GMBA 5EMJB 4YVDA 2AGYA 3EI2B 4JSNC 5EMKB 4J84A 2XYIA 4X63B 4CY2A 3BWSA 3CFSB 3EMHA 2GC7A 4JT5C 1N6DA 1A0RB 3C99A 4LGNA 5FKQA 4LG8A 4FA4D 1JJUB 2HESX 4GM9A 3JRPA 1GG2B 3OKWA 5EAPA 2H3XA 5CXCB 2I0RA 3UVKA 4PSWB 1XIPA 3JAMg 4JSXC 2H9NA 2IAAA 1NR0A 4PBZA 3EI1B 4J82A 3ULEC 3JZNA 4GM8A 3PE7A 3MXXA 3EI4A 4A0AA 3VH0A 1SQ9A 2Z2PA 3MZLA 4PBYA 2PM9A 1U4CA 4CZYA 4XYIA 2XL3A 3PXWD 3JB9L 5K1CC 2QXVA 5CYKA 4CZXA 5I5MA 3BG0A 3EI3A 3RRMC 5CXCA 4FA9D 5CXBB 3IJ0A 3JROA 3UVOA 1MG3A 1S4UX 2OIZA 5HQGA 4TZ4A 2IWKA 4ERQA 3FGBA 4K3ID 1ERJA 4KFMB 3AFCA 1PBYB 3RSEC 4CI8A 2H13A 4L9OA 4N14A 2AGWA 3KRXB 4L3HD 5FKRA 3ODTA 4O3TB 4AEZA 2IUPA 2PBIB 2PM9B 3RN1D 3OKTA 4AOWA 3UKUC 3IIWA 1N6EA 4LG9A 3VA6A 5FLXg 3SHFA 3I7LA 3V7DB 5EAMA 2MTAH 2UZYB 2EBSA 3AL9A 2H9LA 3DSMA 4J77A 4EWRA 5HYNB 1MG2A 1L0QA 3EU7A 3PSCB 3I7PA 3SFZA 5A2Qg 4X60B 2Z2OA 3GREA 4L1QD 4GZ8A 4Y5RD 2IWFA 4ESGA 2AGXA 1Q47A 4X61B 5FKSA 2PM7B 3C5MA 4CZVA 4A09B 4J81A 2P9SC 3K27A 4J79A 1QNIA 3PSLA 4I79A 3L4MD 4OWRA 1TBGA 4PC0A 2YNOA 3RLMD 5TEFA 5B4WA 3ZWLB 4ZOVA 2CE8A 4JD2C 3MKSB 5HE3B 4FAND 3OL2A 1NEXB 3B7FA 2J57G 2PM6B 3KRWB 1OMWB 1PI6A 4FA1D 1JMZB 3BG1A 1B9XA 3SCYA 2AQ5A 3HFQA 5H1MA 2BCJB 3SLED 3SBRA 3C75H 5IC7A 5AFU3 5EMMB 4K3JB 2AH0A 2CE9A 4J0XA 4CI1A 4A08A 4FHLA 3I7OA 2GC4A 2CN3A 4ERZA
chains in the Genus database with same CATH superfamily
3N0EA 2OVPB 4CC9A 4ERYA 4QRJA 3FM0A 3V4PA 2VDRA 5IT9g 2CNXA 3AH8B 2I0SA 4JSPC 2P9IC 4PXWA 3ORVD 2EIDA 1TYQC 4IRZA 1GOFA 3EQ8A 4L1MA 3SXTD 2B5NA 2YNNA 4BCCA 2P9UC 4JT6C 4E5ZB 2HKRA 4A11B 4IA9A 3ZE0A 5CYKB 5IJ7E 3F3FA 4CY3A 1JOFA 3EI3B 4FB1D 3JPXA 3JZHA 4QL1A 3SN6B 5TDHB 4ZOYA 4MK0B 3IIYA 1C9LA 4O3UB 2QC5A 3U4YA 3K72A 4DNWA 3I8CA 1QFSA 2TRCB 5KDOB 4BCBA 3UVNA 2H6KA 3EI4B 5TEEA 2H47A 5HE1B 2H6NA 3T3MA 5E6RA 4Y7RA 3OKYB 3I89A 1K32A 1P22A 3SWSD 2IUQA 2CO0A 1GOHA 1SQJA 1K8KC 5FXYA 3ZE1A 3A0FA 3IJCA 5H17A 4CI3A 4E5ZA 3RFGA 1E8NA 5M5UA 3T3PA 5IGQA 5EM2A 3K26A 5HDBA 2EICA 3E0CA 3NIGA 4AN0A 4PSXB 4J86A 4L3GD 1N6FA 4FWWA 5THAA 2OVRB 2AH1A 1JV2A 2XDWA 3IUQA 5EMLB 4A08B 5H14A 2VDOA 1PEVA 1E5TA 2XL2A 4GQ1A 2YNPA 5C9ZB 2BBKH 5AMSA 3PVUB 3IUMA 2OK6A 3AL8A 2G9AA 4O9DA 5FFOA 3FCSA 4A7JA 4GGDA 4NSXA 1SHYB 4AN1A 4ZOZA 2JKXA 1VE6A 1QFMA 3FRXA 2IUVA 4NENA 2IURA 3IKOA 2J55H 4H5IA 4JHNA 3RFHA 4FA5D 2VC2A 3I7HA 3UKRC 1UOOA 3DXKC 4RE5A 4D6VA 2YB8B 4J0WA 4H5JA 4J78A 4IMMA 4JXMA 2P9PC 1FWXA 3EWEA 2H9MA 1GP2B 5GXIA 4UM8A 4Z8LA 3PVWB 3K71A 5JWZA 1YFQA 2YMUA 5IJ8E 5C86A 2UZXB 3EI2A 1R5MA 2VDPA 4J8GA 4HDJA 1JTDB 3MMYA 4WK2A 5M5VA 4ZOXA 3UR4A 4AMZA 4Z7OA 2OVQB 1O6FA 4O1QD 4J87A 3JZGA 3I2NA 1RI6A 1GOGA 1A12A 1H2YA 3DDUA 3MKQA 5C2VB 2HXCA 4GGCA 1VYHC 3IURA 2I3TA 3SVWD 3NVNA 3ZDZA 5TF2A 3RN0D 4D0KA 1JMXB 1T2XA 2H14A 5FKTA 3MZKA 4G1MA 2HYEA 1TYEA 5FQDA 3DXMC 5HE0B 4J73A 1H2WA 1XHMA 2YBAA 4UI9R 5C92A 3IVMA 2OK4A 3NVQA 3PXSD 3EI1A 2HU8A 2B5MA 1B9YA 4A11A 4QAMA 4A0BB 4X3EA 3DWLC 5K19A 3GFCA 4A0AB 3SBPA 2CO0C 3W15A 4JSVC 3V5WB 2H68A 5GMKn 3L4OD 5HE2B 4CY1A 1M1XA 4MMXA 4CI2A 1OLZA 4Z7NA 4E54B 2XU7A 2HJ4A 3IJ1A 4DNUA 3J81g 2H9PA 5I5IA 2O9KA 2VZ3A 3EQ9A 3MUNA 1GOTB 3O4JA 3P4FA 4Z7QA 3NVXA 2I0TA 5M61A 2G99A 3NIFA 5CXBA 3OKYA 2VDKA 3OW8A 3J80g 2H6QA 4WK0A 2I3SA 4J8BA 4FAVD 4GGAA 4GQ2P 4U1EI 4XYHA 2HKMA 4WK4A 1O6GA 3SBQA 3F3GA 3KCIA 5M5SA 4BUJC 2W18A 1H2XA 3EG6A 3O4IA 2P9NC 2VDNA 4BH6A 4BL0A 5GSAA 4A0BA 4QQEA 4PNKB 4ZN4A 4O45A 2B5LA 3DM0A 3SJLD 3UVMA 4ES0A 2Z2NA 3VGZA 2Q7QA 3OTTA 4E54A 4AMYA 2P9LC 4GQBB 4CY5A 4XEIC 4WJKA 3AL8B 2GNQA 2CN2A 3I7NA 4G55A 2P9KC 3GD1I 5EALA 4U7AA 4A2MA 3O4HA 4GM3A 2B4EA 3UVLA 3ZDYA 4BP8A 1MDAH 3OL2B 2OJYA 4QT8A 2HU5A 5EARA 3GC3B 2AGZA 3EQ7A 3PXTD 3V9FA 5SXMA 3I7KA 4A2LA 3MVDK 4OZUA 1VZ3A 3C9CA 4G1EA 1PGUA 3I8EA 3N0DA 3IJEA 3SMRA 1GXRA 5IGOA 5EM2B 3CIKB 3RMZD 2HJBA 2J56H 2AGLA 1XKSA 5I5JA 4R7AB 3F3PA 1E8MA 5AJAA 5C2WB 4G56B 3CFVA 5FA5B 1U2VC 1I2MB 1L5GA 4A09A 5GXHA 4GMBA 5EMJB 4YVDA 1C9IA 2AGYA 3EI2B 2HU7A 4JSNC 5EMKB 4J84A 2XYIA 4X63B 3MUOA 4CY2A 3BWSA 3CFSB 3EMHA 2GC7A 4JT5C 5E6UA 1N6DA 1A0RB 3C99A 4LGNA 5FKQA 4LG8A 1YR2A 2VDMA 4FA4D 1JJUB 2HESX 4GM9A 1VZ2A 3QHYB 3JRPA 1GG2B 4UM9A 3OKWA 5EAPA 2H3XA 5CXCB 2I0RA 3UVKA 3IUNA 3ZDXA 4PSWB 1XIPA 3JAMg 4JSXC 2H9NA 2IAAA 1NR0A 4PBZA 3EI1B 3OF7A 4J82A 4O02A 3JZNA 4GM8A 3ULEC 3PE7A 3MXXA 3EI4A 4A0AA 3VH0A 1SQ9A 2Z2PA 4D9SA 3MZLA 4PBYA 2PM9A 1U4CA 4CZYA 4XYIA 4DNVA 2XL3A 5M5RA 3PXWD 3JB9L 5K1CC 2QR5A 5E6SA 2QXVA 4NC4A 3ZE2A 2XE4A 2WQ8A 5CYKA 4CZXA 5I5MA 3BG0A 3IUJA 3EI3A 3RRMC 5CXCA 4FA9D 5CXBB 3IJ0A 3VI3A 3JROA 1H2ZA 3UVOA 1MG3A 2OIZA 1S4UX 5HQGA 4TZ4A 2IWKA 4ERQA 3FGBA 2EIEA 4K3ID 1ERJA 4KFMB 3AFCA 1PBYB 3RSEC 3VI4A 4CI8A 1UOQA 1U8CA 2H13A 4NBMA 4L9OA 3K6SA 4N14A 4O2WA 2AGWA 3KRXB 4L3HD 5FKRA 3ODTA 4O3TB 4AEZA 2IUPA 2PBIB 2PM9B 3RN1D 3OKTA 4AOWA 3UKUC 3IIWA 3IULA 4MMZA 2VDLA 1N6EA 2VZ1A 4LG9A 3VA6A 2QZPA 5FLXg 3SHFA 3I7LA 3V7DB 5EAMA 2MTAH 2UZYB 2EBSA 3AL9A 2H9LA 3DSMA 4J77A 4EWRA 5HYNB 1MG2A 1L0QA 1K3IA 3EU7A 3PSCB 3I7PA 3SFZA 5A2Qg 3QI0A 4X60B 2Z2OA 3GREA 4L1QD 4GZ8A 4Y5RD 1UOPA 2IWFA 4RE6A 4JHPC 4ESGA 2AGXA 1Q47A 1UTCA 4X61B 5FKSA 2PM7B 3C5MA 4CZVA 3O4GA 4A09B 4J81A 5FFGA 2P9SC 3K27A 3NIDA 3FCUA 4J79A 1QNIA 3PSLA 2VDQA 4I79A 3L4MD 4OWRA 3V4VA 1TBGA 4PC0A 5M5TA 1VE7A 2YNOA 3RLMD 5TEFA 5B4WA 4NAAA 3ZWLB 4ZOVA 2CE8A 2EIBA 4JD2C 3MKSB 5HE3B 4FAND 3OL2A 1NEXB 3B7FA 2J57G 1BPOA 4AX4A 2PM6B 3KRWB 1OMWB 1PI6A 4FA1D 1JMZB 3BG1A 4BCDA 4MMYA 1B9XA 3SCYA 2AQ5A 3HFQA 5H1MA 4BP9A 2BCJB 3SLED 3SBRA 3C75H 5IC7A 2XZGA 2BKLA 5AFU3 5EMMB 4K3JB 2AH0A 2CE9A 4J0XA 4CI1A 4A08A 4FHLA 3I7OA 2GC4A 2CN3A 4ERZA
chains in the Genus database with same CATH topology
3N0EA 2OVPB 4CC9A 4ERYA 4QRJA 3FM0A 5IT9g 2CNXA 3AH8B 2I0SA 4JSPC 2P9IC 4PXWA 3ORVD 1TYQC 3SXTD 2B5NA 2YNNA 2P9UC 4JT6C 4E5ZB 2HKRA 4A11B 4IA9A 5CYKB 5IJ7E 3F3FA 4CY3A 1JOFA 3EI3B 4FB1D 3JPXA 3JZHA 4QL1A 3SN6B 5TDHB 4ZOYA 4MK0B 3IIYA 4O3UB 2QC5A 3U4YA 3I8CA 2TRCB 5KDOB 3UVNA 2H6KA 3EI4B 5TEEA 2H47A 5HE1B 2H6NA 4Y7RA 3OKYB 3I89A 1K32A 1P22A 3SWSD 2IUQA 2CO0A 1SQJA 1K8KC 5FXYA 3A0FA 3IJCA 5H17A 4CI3A 4E5ZA 3RFGA 5IGQA 5EM2A 3K26A 3E0CA 4PSXB 4J86A 4L3GD 1N6FA 4FWWA 5THAA 2OVRB 2AH1A 5EMLB 4A08B 5H14A 1PEVA 2XL2A 4GQ1A 2YNPA 5C9ZB 2BBKH 5AMSA 3PVUB 2OK6A 3AL8A 2G9AA 4O9DA 4A7JA 4GGDA 4NSXA 1SHYB 4ZOZA 3FRXA 2IUVA 2IURA 3IKOA 2J55H 4H5IA 3RFHA 4FA5D 3I7HA 3UKRC 3DXKC 4D6VA 2YB8B 4J0WA 4H5JA 4J78A 4IMMA 4JXMA 2P9PC 1FWXA 3EWEA 2H9MA 1GP2B 5GXIA 4Z8LA 3PVWB 5JWZA 1YFQA 2YMUA 5IJ8E 2UZXB 3EI2A 1R5MA 4J8GA 4HDJA 3MMYA 4ZOXA 3UR4A 2OVQB 4O1QD 4J87A 3JZGA 3I2NA 1RI6A 3MKQA 5C2VB 4GGCA 2HXCA 1VYHC 2I3TA 3SVWD 3NVNA 5TF2A 3RN0D 4D0KA 1JMXB 2H14A 5FKTA 3MZKA 2HYEA 5FQDA 3DXMC 5HE0B 4J73A 1XHMA 2YBAA 4UI9R 2OK4A 3NVQA 3PXSD 3EI1A 2B5MA 1B9YA 4A11A 4A0BB 4X3EA 3DWLC 5K19A 3GFCA 4A0AB 3SBPA 2CO0C 3W15A 4JSVC 3V5WB 2H68A 5GMKn 3L4OD 5HE2B 4CY1A 4CI2A 1OLZA 4E54B 2XU7A 2HJ4A 3IJ1A 3J81g 2H9PA 5I5IA 2O9KA 1GOTB 3P4FA 3NVXA 2I0TA 2G99A 5CXBA 3OKYA 3OW8A 3J80g 2H6QA 2I3SA 4J8BA 4FAVD 4GGAA 4GQ2P 4U1EI 4XYHA 2HKMA 3SBQA 3F3GA 4BUJC 2W18A 4A0BA 3EG6A 4BH6A 2P9NC 4BL0A 5GSAA 4QQEA 4PNKB 4ZN4A 4O45A 2B5LA 3DM0A 3SJLD 3UVMA 4ES0A 2Z2NA 3VGZA 2Q7QA 3OTTA 4E54A 2P9LC 4GQBB 4CY5A 4XEIC 3AL8B 2GNQA 2CN2A 3I7NA 2P9KC 5EALA 4U7AA 4A2MA 4GM3A 2B4EA 3UVLA 1MDAH 3OL2B 2OJYA 4QT8A 5EARA 2AGZA 3PXTD 3V9FA 5SXMA 3I7KA 4A2LA 4OZUA 3C9CA 1PGUA 3I8EA 3N0DA 3SMRA 1GXRA 5IGOA 5EM2B 3CIKB 3RMZD 2HJBA 2J56H 2AGLA 1XKSA 5I5JA 4R7AB 3F3PA 5AJAA 5C2WB 4G56B 3CFVA 5FA5B 1U2VC 4A09A 5GXHA 4GMBA 5EMJB 4YVDA 2AGYA 3EI2B 4JSNC 5EMKB 4J84A 2XYIA 4X63B 4CY2A 3BWSA 3CFSB 3EMHA 2GC7A 4JT5C 1N6DA 1A0RB 3C99A 4LGNA 5FKQA 4LG8A 4FA4D 1JJUB 2HESX 4GM9A 3JRPA 1GG2B 3OKWA 5EAPA 2H3XA 5CXCB 2I0RA 3UVKA 4PSWB 1XIPA 3JAMg 4JSXC 2H9NA 2IAAA 1NR0A 4PBZA 3EI1B 4J82A 3ULEC 3JZNA 4GM8A 3PE7A 3MXXA 3EI4A 4A0AA 3VH0A 1SQ9A 2Z2PA 3MZLA 4PBYA 2PM9A 1U4CA 4CZYA 4XYIA 2XL3A 3PXWD 3JB9L 5K1CC 2QXVA 5CYKA 4CZXA 5I5MA 3BG0A 3EI3A 3RRMC 5CXCA 4FA9D 5CXBB 3IJ0A 3JROA 3UVOA 1MG3A 1S4UX 2OIZA 5HQGA 4TZ4A 2IWKA 4ERQA 3FGBA 4K3ID 1ERJA 4KFMB 3AFCA 1PBYB 3RSEC 4CI8A 2H13A 4L9OA 4N14A 2AGWA 3KRXB 4L3HD 5FKRA 3ODTA 4O3TB 4AEZA 2IUPA 2PBIB 2PM9B 3RN1D 3OKTA 4AOWA 3UKUC 3IIWA 1N6EA 4LG9A 3VA6A 5FLXg 3SHFA 3I7LA 3V7DB 5EAMA 2MTAH 2UZYB 2EBSA 3AL9A 2H9LA 3DSMA 4J77A 4EWRA 5HYNB 1MG2A 1L0QA 3EU7A 3PSCB 3I7PA 3SFZA 5A2Qg 4X60B 2Z2OA 3GREA 4L1QD 4GZ8A 4Y5RD 2IWFA 4ESGA 2AGXA 1Q47A 4X61B 5FKSA 2PM7B 3C5MA 4CZVA 4A09B 4J81A 2P9SC 3K27A 4J79A 1QNIA 3PSLA 4I79A 3L4MD 4OWRA 1TBGA 4PC0A 2YNOA 3RLMD 5TEFA 5B4WA 3ZWLB 4ZOVA 2CE8A 4JD2C 3MKSB 5HE3B 4FAND 3OL2A 1NEXB 3B7FA 2J57G 2PM6B 3KRWB 1OMWB 1PI6A 4FA1D 1JMZB 3BG1A 1B9XA 3SCYA 2AQ5A 3HFQA 5H1MA 2BCJB 3SLED 3SBRA 3C75H 5IC7A 5AFU3 5EMMB 4K3JB 2AH0A 2CE9A 4J0XA 4CI1A 4A08A 4FHLA 3I7OA 2GC4A 2CN3A 4ERZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0E A;  2OVP B;  4CC9 A;  4ERY A;  4QRJ A;  3FM0 A;  5IT9 g;  2CNX A;  3AH8 B;  2I0S A;  4JSP C;  2P9I C;  4PXW A;  3ORV D;  1TYQ C;  3SXT D;  2B5N A;  2YNN A;  2P9U C;  4JT6 C;  4E5Z B;  2HKR A;  4A11 B;  4IA9 A;  5CYK B;  5IJ7 E;  3F3F A;  4CY3 A;  1JOF A;  3EI3 B;  4FB1 D;  3JPX A;  3JZH A;  4QL1 A;  3SN6 B;  5TDH B;  4ZOY A;  4MK0 B;  3IIY A;  4O3U B;  2QC5 A;  3U4Y A;  3I8C A;  2TRC B;  5KDO B;  3UVN A;  2H6K A;  3EI4 B;  5TEE A;  2H47 A;  5HE1 B;  2H6N A;  4Y7R A;  3OKY B;  3I89 A;  1K32 A;  1P22 A;  3SWS D;  2IUQ A;  2CO0 A;  1SQJ A;  1K8K C;  5FXY A;  3A0F A;  3IJC A;  5H17 A;  4CI3 A;  4E5Z A;  3RFG A;  5IGQ A;  5EM2 A;  3K26 A;  3E0C A;  4PSX B;  4J86 A;  4L3G D;  1N6F A;  4FWW A;  5THA A;  2OVR B;  2AH1 A;  5EML B;  4A08 B;  5H14 A;  1PEV A;  2XL2 A;  4GQ1 A;  2YNP A;  5C9Z B;  2BBK H;  5AMS A;  3PVU B;  2OK6 A;  3AL8 A;  2G9A A;  4O9D A;  4A7J A;  4GGD A;  4NSX A;  1SHY B;  4ZOZ A;  3FRX A;  2IUV A;  2IUR A;  3IKO A;  2J55 H;  4H5I A;  3RFH A;  4FA5 D;  3I7H A;  3UKR C;  3DXK C;  4D6V A;  2YB8 B;  4J0W A;  4H5J A;  4J78 A;  4IMM A;  4JXM A;  2P9P C;  1FWX A;  3EWE A;  2H9M A;  1GP2 B;  5GXI A;  4Z8L A;  3PVW B;  5JWZ A;  1YFQ A;  2YMU A;  5IJ8 E;  2UZX B;  3EI2 A;  1R5M A;  4J8G A;  4HDJ A;  3MMY A;  4ZOX A;  3UR4 A;  2OVQ B;  4O1Q D;  4J87 A;  3JZG A;  3I2N A;  1RI6 A;  3MKQ A;  5C2V B;  4GGC A;  2HXC A;  1VYH C;  2I3T A;  3SVW D;  3NVN A;  5TF2 A;  3RN0 D;  4D0K A;  1JMX B;  2H14 A;  5FKT A;  3MZK A;  2HYE A;  5FQD A;  3DXM C;  5HE0 B;  4J73 A;  1XHM A;  2YBA A;  4UI9 R;  2OK4 A;  3NVQ A;  3PXS D;  3EI1 A;  2B5M A;  1B9Y A;  4A11 A;  4A0B B;  4X3E A;  3DWL C;  5K19 A;  3GFC A;  4A0A B;  3SBP A;  2CO0 C;  3W15 A;  4JSV C;  3V5W B;  2H68 A;  5GMK n;  3L4O D;  5HE2 B;  4CY1 A;  4CI2 A;  1OLZ A;  4E54 B;  2XU7 A;  2HJ4 A;  3IJ1 A;  3J81 g;  2H9P A;  5I5I A;  2O9K A;  1GOT B;  3P4F A;  3NVX A;  2I0T A;  2G99 A;  5CXB A;  3OKY A;  3OW8 A;  3J80 g;  2H6Q A;  2I3S A;  4J8B A;  4FAV D;  4GGA A;  4GQ2 P;  4U1E I;  4XYH A;  2HKM A;  3SBQ A;  3F3G A;  4BUJ C;  2W18 A;  4A0B A;  3EG6 A;  4BH6 A;  2P9N C;  4BL0 A;  5GSA A;  4QQE A;  4PNK B;  4ZN4 A;  4O45 A;  2B5L A;  3DM0 A;  3SJL D;  3UVM A;  4ES0 A;  2Z2N A;  3VGZ A;  2Q7Q A;  3OTT A;  4E54 A;  2P9L C;  4GQB B;  4CY5 A;  4XEI C;  3AL8 B;  2GNQ A;  2CN2 A;  3I7N A;  2P9K C;  5EAL A;  4U7A A;  4A2M A;  4GM3 A;  2B4E A;  3UVL A;  1MDA H;  3OL2 B;  2OJY A;  4QT8 A;  5EAR A;  2AGZ A;  3PXT D;  3V9F A;  5SXM A;  3I7K A;  4A2L A;  4OZU A;  3C9C A;  1PGU A;  3I8E A;  3N0D A;  3SMR A;  1GXR A;  5IGO A;  5EM2 B;  3CIK B;  3RMZ D;  2HJB A;  2J56 H;  2AGL A;  1XKS A;  5I5J A;  4R7A B;  3F3P A;  5AJA A;  5C2W B;  4G56 B;  3CFV A;  5FA5 B;  1U2V C;  4A09 A;  5GXH A;  4GMB A;  5EMJ B;  4YVD A;  2AGY A;  3EI2 B;  4JSN C;  5EMK B;  4J84 A;  2XYI A;  4X63 B;  4CY2 A;  3BWS A;  3CFS B;  3EMH A;  2GC7 A;  4JT5 C;  1N6D A;  1A0R B;  3C99 A;  4LGN A;  5FKQ A;  4LG8 A;  4FA4 D;  1JJU B;  2HES X;  4GM9 A;  3JRP A;  1GG2 B;  3OKW A;  5EAP A;  2H3X A;  5CXC B;  2I0R A;  3UVK A;  4PSW B;  1XIP A;  3JAM g;  4JSX C;  2H9N A;  2IAA A;  1NR0 A;  4PBZ A;  3EI1 B;  4J82 A;  3ULE C;  3JZN A;  4GM8 A;  3PE7 A;  3MXX A;  3EI4 A;  4A0A A;  3VH0 A;  1SQ9 A;  2Z2P A;  3MZL A;  4PBY A;  2PM9 A;  1U4C A;  4CZY A;  4XYI A;  2XL3 A;  3PXW D;  3JB9 L;  5K1C C;  2QXV A;  5CYK A;  4CZX A;  5I5M A;  3BG0 A;  3EI3 A;  3RRM C;  5CXC A;  4FA9 D;  5CXB B;  3IJ0 A;  3JRO A;  3UVO A;  1MG3 A;  1S4U X;  2OIZ A;  5HQG A;  4TZ4 A;  2IWK A;  4ERQ A;  3FGB A;  4K3I D;  1ERJ A;  4KFM B;  3AFC A;  1PBY B;  3RSE C;  4CI8 A;  2H13 A;  4L9O A;  4N14 A;  2AGW A;  3KRX B;  4L3H D;  5FKR A;  3ODT A;  4O3T B;  4AEZ A;  2IUP A;  2PBI B;  2PM9 B;  3RN1 D;  3OKT A;  4AOW A;  3UKU C;  3IIW A;  1N6E A;  4LG9 A;  3VA6 A;  5FLX g;  3SHF A;  3I7L A;  3V7D B;  5EAM A;  2MTA H;  2UZY B;  2EBS A;  3AL9 A;  2H9L A;  3DSM A;  4J77 A;  4EWR A;  5HYN B;  1MG2 A;  1L0Q A;  3EU7 A;  3PSC B;  3I7P A;  3SFZ A;  5A2Q g;  4X60 B;  2Z2O A;  3GRE A;  4L1Q D;  4GZ8 A;  4Y5R D;  2IWF A;  4ESG A;  2AGX A;  1Q47 A;  4X61 B;  5FKS A;  2PM7 B;  3C5M A;  4CZV A;  4A09 B;  4J81 A;  2P9S C;  3K27 A;  4J79 A;  1QNI A;  3PSL A;  4I79 A;  3L4M D;  4OWR A;  1TBG A;  4PC0 A;  2YNO A;  3RLM D;  5TEF A;  5B4W A;  3ZWL B;  4ZOV A;  2CE8 A;  4JD2 C;  3MKS B;  5HE3 B;  4FAN D;  3OL2 A;  1NEX B;  3B7F A;  2J57 G;  2PM6 B;  3KRW B;  1OMW B;  1PI6 A;  4FA1 D;  1JMZ B;  3BG1 A;  1B9X A;  3SCY A;  2AQ5 A;  3HFQ A;  5H1M A;  2BCJ B;  3SLE D;  3SBR A;  3C75 H;  5IC7 A;  5AFU 3;  5EMM B;  4K3J B;  2AH0 A;  2CE9 A;  4J0X A;  4CI1 A;  4A08 A;  4FHL A;  3I7O A;  2GC4 A;  2CN3 A;  4ERZ A; 
#chains in the Genus database with same CATH topology
 3N0E A;  2OVP B;  4CC9 A;  4ERY A;  4QRJ A;  3FM0 A;  3V4P A;  2VDR A;  5IT9 g;  2CNX A;  3AH8 B;  2I0S A;  4JSP C;  2P9I C;  4PXW A;  3ORV D;  2EID A;  1TYQ C;  4IRZ A;  1GOF A;  3EQ8 A;  4L1M A;  3SXT D;  2B5N A;  2YNN A;  4BCC A;  2P9U C;  4JT6 C;  4E5Z B;  2HKR A;  4A11 B;  4IA9 A;  3ZE0 A;  5CYK B;  5IJ7 E;  3F3F A;  4CY3 A;  1JOF A;  3EI3 B;  4FB1 D;  3JPX A;  3JZH A;  4QL1 A;  3SN6 B;  5TDH B;  4ZOY A;  4MK0 B;  3IIY A;  1C9L A;  4O3U B;  2QC5 A;  3U4Y A;  3K72 A;  4DNW A;  3I8C A;  1QFS A;  2TRC B;  5KDO B;  4BCB A;  3UVN A;  2H6K A;  3EI4 B;  5TEE A;  2H47 A;  5HE1 B;  2H6N A;  3T3M A;  5E6R A;  4Y7R A;  3OKY B;  3I89 A;  1K32 A;  1P22 A;  3SWS D;  2IUQ A;  2CO0 A;  1GOH A;  1SQJ A;  1K8K C;  5FXY A;  3ZE1 A;  3A0F A;  3IJC A;  5H17 A;  4CI3 A;  4E5Z A;  3RFG A;  1E8N A;  5M5U A;  3T3P A;  5IGQ A;  5EM2 A;  3K26 A;  5HDB A;  2EIC A;  3E0C A;  3NIG A;  4AN0 A;  4PSX B;  4J86 A;  4L3G D;  1N6F A;  4FWW A;  5THA A;  2OVR B;  2AH1 A;  1JV2 A;  2XDW A;  3IUQ A;  5EML B;  4A08 B;  5H14 A;  2VDO A;  1PEV A;  1E5T A;  2XL2 A;  4GQ1 A;  2YNP A;  5C9Z B;  2BBK H;  5AMS A;  3PVU B;  3IUM A;  2OK6 A;  3AL8 A;  2G9A A;  4O9D A;  5FFO A;  3FCS A;  4A7J A;  4GGD A;  4NSX A;  1SHY B;  4AN1 A;  4ZOZ A;  2JKX A;  1VE6 A;  1QFM A;  3FRX A;  2IUV A;  4NEN A;  2IUR A;  3IKO A;  2J55 H;  4H5I A;  4JHN A;  3RFH A;  4FA5 D;  2VC2 A;  3I7H A;  3UKR C;  1UOO A;  3DXK C;  4RE5 A;  4D6V A;  2YB8 B;  4J0W A;  4H5J A;  4J78 A;  4IMM A;  4JXM A;  2P9P C;  1FWX A;  3EWE A;  2H9M A;  1GP2 B;  5GXI A;  4UM8 A;  4Z8L A;  3PVW B;  3K71 A;  5JWZ A;  1YFQ A;  2YMU A;  5IJ8 E;  5C86 A;  2UZX B;  3EI2 A;  1R5M A;  2VDP A;  4J8G A;  4HDJ A;  1JTD B;  3MMY A;  4WK2 A;  5M5V A;  4ZOX A;  3UR4 A;  4AMZ A;  4Z7O A;  2OVQ B;  1O6F A;  4O1Q D;  4J87 A;  3JZG A;  3I2N A;  1RI6 A;  1GOG A;  1A12 A;  1H2Y A;  3DDU A;  3MKQ A;  5C2V B;  2HXC A;  4GGC A;  1VYH C;  3IUR A;  2I3T A;  3SVW D;  3NVN A;  3ZDZ A;  5TF2 A;  3RN0 D;  4D0K A;  1JMX B;  1T2X A;  2H14 A;  5FKT A;  3MZK A;  4G1M A;  2HYE A;  1TYE A;  5FQD A;  3DXM C;  5HE0 B;  4J73 A;  1H2W A;  1XHM A;  2YBA A;  4UI9 R;  5C92 A;  3IVM A;  2OK4 A;  3NVQ A;  3PXS D;  3EI1 A;  2HU8 A;  2B5M A;  1B9Y A;  4A11 A;  4QAM A;  4A0B B;  4X3E A;  3DWL C;  5K19 A;  3GFC A;  4A0A B;  3SBP A;  2CO0 C;  3W15 A;  4JSV C;  3V5W B;  2H68 A;  5GMK n;  3L4O D;  5HE2 B;  4CY1 A;  1M1X A;  4MMX A;  4CI2 A;  1OLZ A;  4Z7N A;  4E54 B;  2XU7 A;  2HJ4 A;  3IJ1 A;  4DNU A;  3J81 g;  2H9P A;  5I5I A;  2O9K A;  2VZ3 A;  3EQ9 A;  3MUN A;  1GOT B;  3O4J A;  3P4F A;  4Z7Q A;  3NVX A;  2I0T A;  5M61 A;  2G99 A;  3NIF A;  5CXB A;  3OKY A;  2VDK A;  3OW8 A;  3J80 g;  2H6Q A;  4WK0 A;  2I3S A;  4J8B A;  4FAV D;  4GGA A;  4GQ2 P;  4U1E I;  4XYH A;  2HKM A;  4WK4 A;  1O6G A;  3SBQ A;  3F3G A;  3KCI A;  5M5S A;  4BUJ C;  2W18 A;  1H2X A;  3EG6 A;  3O4I A;  2P9N C;  2VDN A;  4BH6 A;  4BL0 A;  5GSA A;  4A0B A;  4QQE A;  4PNK B;  4ZN4 A;  4O45 A;  2B5L A;  3DM0 A;  3SJL D;  3UVM A;  4ES0 A;  2Z2N A;  3VGZ A;  2Q7Q A;  3OTT A;  4E54 A;  4AMY A;  2P9L C;  4GQB B;  4CY5 A;  4XEI C;  4WJK A;  3AL8 B;  2GNQ A;  2CN2 A;  3I7N A;  4G55 A;  2P9K C;  3GD1 I;  5EAL A;  4U7A A;  4A2M A;  3O4H A;  4GM3 A;  2B4E A;  3UVL A;  3ZDY A;  4BP8 A;  1MDA H;  3OL2 B;  2OJY A;  4QT8 A;  2HU5 A;  5EAR A;  3GC3 B;  2AGZ A;  3EQ7 A;  3PXT D;  3V9F A;  5SXM A;  3I7K A;  4A2L A;  3MVD K;  4OZU A;  1VZ3 A;  3C9C A;  4G1E A;  1PGU A;  3I8E A;  3N0D A;  3IJE A;  3SMR A;  1GXR A;  5IGO A;  5EM2 B;  3CIK B;  3RMZ D;  2HJB A;  2J56 H;  2AGL A;  1XKS A;  5I5J A;  4R7A B;  3F3P A;  1E8M A;  5AJA A;  5C2W B;  4G56 B;  3CFV A;  5FA5 B;  1U2V C;  1I2M B;  1L5G A;  4A09 A;  5GXH A;  4GMB A;  5EMJ B;  4YVD A;  1C9I A;  2AGY A;  3EI2 B;  2HU7 A;  4JSN C;  5EMK B;  4J84 A;  2XYI A;  4X63 B;  3MUO A;  4CY2 A;  3BWS A;  3CFS B;  3EMH A;  2GC7 A;  4JT5 C;  5E6U A;  1N6D A;  1A0R B;  3C99 A;  4LGN A;  5FKQ A;  4LG8 A;  1YR2 A;  2VDM A;  4FA4 D;  1JJU B;  2HES X;  4GM9 A;  1VZ2 A;  3QHY B;  3JRP A;  1GG2 B;  4UM9 A;  3OKW A;  5EAP A;  2H3X A;  5CXC B;  2I0R A;  3UVK A;  3IUN A;  3ZDX A;  4PSW B;  1XIP A;  3JAM g;  4JSX C;  2H9N A;  2IAA A;  1NR0 A;  4PBZ A;  3EI1 B;  3OF7 A;  4J82 A;  4O02 A;  3JZN A;  4GM8 A;  3ULE C;  3PE7 A;  3MXX A;  3EI4 A;  4A0A A;  3VH0 A;  1SQ9 A;  2Z2P A;  4D9S A;  3MZL A;  4PBY A;  2PM9 A;  1U4C A;  4CZY A;  4XYI A;  4DNV A;  2XL3 A;  5M5R A;  3PXW D;  3JB9 L;  5K1C C;  2QR5 A;  5E6S A;  2QXV A;  4NC4 A;  3ZE2 A;  2XE4 A;  2WQ8 A;  5CYK A;  4CZX A;  5I5M A;  3BG0 A;  3IUJ A;  3EI3 A;  3RRM C;  5CXC A;  4FA9 D;  5CXB B;  3IJ0 A;  3VI3 A;  3JRO A;  1H2Z A;  3UVO A;  1MG3 A;  2OIZ A;  1S4U X;  5HQG A;  4TZ4 A;  2IWK A;  4ERQ A;  3FGB A;  2EIE A;  4K3I D;  1ERJ A;  4KFM B;  3AFC A;  1PBY B;  3RSE C;  3VI4 A;  4CI8 A;  1UOQ A;  1U8C A;  2H13 A;  4NBM A;  4L9O A;  3K6S A;  4N14 A;  4O2W A;  2AGW A;  3KRX B;  4L3H D;  5FKR A;  3ODT A;  4O3T B;  4AEZ A;  2IUP A;  2PBI B;  2PM9 B;  3RN1 D;  3OKT A;  4AOW A;  3UKU C;  3IIW A;  3IUL A;  4MMZ A;  2VDL A;  1N6E A;  2VZ1 A;  4LG9 A;  3VA6 A;  2QZP A;  5FLX g;  3SHF A;  3I7L A;  3V7D B;  5EAM A;  2MTA H;  2UZY B;  2EBS A;  3AL9 A;  2H9L A;  3DSM A;  4J77 A;  4EWR A;  5HYN B;  1MG2 A;  1L0Q A;  1K3I A;  3EU7 A;  3PSC B;  3I7P A;  3SFZ A;  5A2Q g;  3QI0 A;  4X60 B;  2Z2O A;  3GRE A;  4L1Q D;  4GZ8 A;  4Y5R D;  1UOP A;  2IWF A;  4RE6 A;  4JHP C;  4ESG A;  2AGX A;  1Q47 A;  1UTC A;  4X61 B;  5FKS A;  2PM7 B;  3C5M A;  4CZV A;  3O4G A;  4A09 B;  4J81 A;  5FFG A;  2P9S C;  3K27 A;  3NID A;  3FCU A;  4J79 A;  1QNI A;  3PSL A;  2VDQ A;  4I79 A;  3L4M D;  4OWR A;  3V4V A;  1TBG A;  4PC0 A;  5M5T A;  1VE7 A;  2YNO A;  3RLM D;  5TEF A;  5B4W A;  4NAA A;  3ZWL B;  4ZOV A;  2CE8 A;  2EIB A;  4JD2 C;  3MKS B;  5HE3 B;  4FAN D;  3OL2 A;  1NEX B;  3B7F A;  2J57 G;  1BPO A;  4AX4 A;  2PM6 B;  3KRW B;  1OMW B;  1PI6 A;  4FA1 D;  1JMZ B;  3BG1 A;  4BCD A;  4MMY A;  1B9X A;  3SCY A;  2AQ5 A;  3HFQ A;  5H1M A;  4BP9 A;  2BCJ B;  3SLE D;  3SBR A;  3C75 H;  5IC7 A;  2XZG A;  2BKL A;  5AFU 3;  5EMM B;  4K3J B;  2AH0 A;  2CE9 A;  4J0X A;  4CI1 A;  4A08 A;  4FHL A;  3I7O A;  2GC4 A;  2CN3 A;  4ERZ A; 
#chains in the Genus database with same CATH homology
 3N0E A;  2OVP B;  4CC9 A;  4ERY A;  4QRJ A;  3FM0 A;  5IT9 g;  2CNX A;  3AH8 B;  2I0S A;  4JSP C;  2P9I C;  4PXW A;  3ORV D;  1TYQ C;  3SXT D;  2B5N A;  2YNN A;  2P9U C;  4JT6 C;  4E5Z B;  2HKR A;  4A11 B;  4IA9 A;  5CYK B;  5IJ7 E;  3F3F A;  4CY3 A;  1JOF A;  3EI3 B;  4FB1 D;  3JPX A;  3JZH A;  4QL1 A;  3SN6 B;  5TDH B;  4ZOY A;  4MK0 B;  3IIY A;  4O3U B;  2QC5 A;  3U4Y A;  3I8C A;  2TRC B;  5KDO B;  3UVN A;  2H6K A;  3EI4 B;  5TEE A;  2H47 A;  5HE1 B;  2H6N A;  4Y7R A;  3OKY B;  3I89 A;  1K32 A;  1P22 A;  3SWS D;  2IUQ A;  2CO0 A;  1SQJ A;  1K8K C;  5FXY A;  3A0F A;  3IJC A;  5H17 A;  4CI3 A;  4E5Z A;  3RFG A;  5IGQ A;  5EM2 A;  3K26 A;  3E0C A;  4PSX B;  4J86 A;  4L3G D;  1N6F A;  4FWW A;  5THA A;  2OVR B;  2AH1 A;  5EML B;  4A08 B;  5H14 A;  1PEV A;  2XL2 A;  4GQ1 A;  2YNP A;  5C9Z B;  2BBK H;  5AMS A;  3PVU B;  2OK6 A;  3AL8 A;  2G9A A;  4O9D A;  4A7J A;  4GGD A;  4NSX A;  1SHY B;  4ZOZ A;  3FRX A;  2IUV A;  2IUR A;  3IKO A;  2J55 H;  4H5I A;  3RFH A;  4FA5 D;  3I7H A;  3UKR C;  3DXK C;  4D6V A;  2YB8 B;  4J0W A;  4H5J A;  4J78 A;  4IMM A;  4JXM A;  2P9P C;  1FWX A;  3EWE A;  2H9M A;  1GP2 B;  5GXI A;  4Z8L A;  3PVW B;  5JWZ A;  1YFQ A;  2YMU A;  5IJ8 E;  2UZX B;  3EI2 A;  1R5M A;  4J8G A;  4HDJ A;  3MMY A;  4ZOX A;  3UR4 A;  2OVQ B;  4O1Q D;  4J87 A;  3JZG A;  3I2N A;  1RI6 A;  3MKQ A;  5C2V B;  4GGC A;  2HXC A;  1VYH C;  2I3T A;  3SVW D;  3NVN A;  5TF2 A;  3RN0 D;  4D0K A;  1JMX B;  2H14 A;  5FKT A;  3MZK A;  2HYE A;  5FQD A;  3DXM C;  5HE0 B;  4J73 A;  1XHM A;  2YBA A;  4UI9 R;  2OK4 A;  3NVQ A;  3PXS D;  3EI1 A;  2B5M A;  1B9Y A;  4A11 A;  4A0B B;  4X3E A;  3DWL C;  5K19 A;  3GFC A;  4A0A B;  3SBP A;  2CO0 C;  3W15 A;  4JSV C;  3V5W B;  2H68 A;  5GMK n;  3L4O D;  5HE2 B;  4CY1 A;  4CI2 A;  1OLZ A;  4E54 B;  2XU7 A;  2HJ4 A;  3IJ1 A;  3J81 g;  2H9P A;  5I5I A;  2O9K A;  1GOT B;  3P4F A;  3NVX A;  2I0T A;  2G99 A;  5CXB A;  3OKY A;  3OW8 A;  3J80 g;  2H6Q A;  2I3S A;  4J8B A;  4FAV D;  4GGA A;  4GQ2 P;  4U1E I;  4XYH A;  2HKM A;  3SBQ A;  3F3G A;  4BUJ C;  2W18 A;  4A0B A;  3EG6 A;  4BH6 A;  2P9N C;  4BL0 A;  5GSA A;  4QQE A;  4PNK B;  4ZN4 A;  4O45 A;  2B5L A;  3DM0 A;  3SJL D;  3UVM A;  4ES0 A;  2Z2N A;  3VGZ A;  2Q7Q A;  3OTT A;  4E54 A;  2P9L C;  4GQB B;  4CY5 A;  4XEI C;  3AL8 B;  2GNQ A;  2CN2 A;  3I7N A;  2P9K C;  5EAL A;  4U7A A;  4A2M A;  4GM3 A;  2B4E A;  3UVL A;  1MDA H;  3OL2 B;  2OJY A;  4QT8 A;  5EAR A;  2AGZ A;  3PXT D;  3V9F A;  5SXM A;  3I7K A;  4A2L A;  4OZU A;  3C9C A;  1PGU A;  3I8E A;  3N0D A;  3SMR A;  1GXR A;  5IGO A;  5EM2 B;  3CIK B;  3RMZ D;  2HJB A;  2J56 H;  2AGL A;  1XKS A;  5I5J A;  4R7A B;  3F3P A;  5AJA A;  5C2W B;  4G56 B;  3CFV A;  5FA5 B;  1U2V C;  4A09 A;  5GXH A;  4GMB A;  5EMJ B;  4YVD A;  2AGY A;  3EI2 B;  4JSN C;  5EMK B;  4J84 A;  2XYI A;  4X63 B;  4CY2 A;  3BWS A;  3CFS B;  3EMH A;  2GC7 A;  4JT5 C;  1N6D A;  1A0R B;  3C99 A;  4LGN A;  5FKQ A;  4LG8 A;  4FA4 D;  1JJU B;  2HES X;  4GM9 A;  3JRP A;  1GG2 B;  3OKW A;  5EAP A;  2H3X A;  5CXC B;  2I0R A;  3UVK A;  4PSW B;  1XIP A;  3JAM g;  4JSX C;  2H9N A;  2IAA A;  1NR0 A;  4PBZ A;  3EI1 B;  4J82 A;  3ULE C;  3JZN A;  4GM8 A;  3PE7 A;  3MXX A;  3EI4 A;  4A0A A;  3VH0 A;  1SQ9 A;  2Z2P A;  3MZL A;  4PBY A;  2PM9 A;  1U4C A;  4CZY A;  4XYI A;  2XL3 A;  3PXW D;  3JB9 L;  5K1C C;  2QXV A;  5CYK A;  4CZX A;  5I5M A;  3BG0 A;  3EI3 A;  3RRM C;  5CXC A;  4FA9 D;  5CXB B;  3IJ0 A;  3JRO A;  3UVO A;  1MG3 A;  1S4U X;  2OIZ A;  5HQG A;  4TZ4 A;  2IWK A;  4ERQ A;  3FGB A;  4K3I D;  1ERJ A;  4KFM B;  3AFC A;  1PBY B;  3RSE C;  4CI8 A;  2H13 A;  4L9O A;  4N14 A;  2AGW A;  3KRX B;  4L3H D;  5FKR A;  3ODT A;  4O3T B;  4AEZ A;  2IUP A;  2PBI B;  2PM9 B;  3RN1 D;  3OKT A;  4AOW A;  3UKU C;  3IIW A;  1N6E A;  4LG9 A;  3VA6 A;  5FLX g;  3SHF A;  3I7L A;  3V7D B;  5EAM A;  2MTA H;  2UZY B;  2EBS A;  3AL9 A;  2H9L A;  3DSM A;  4J77 A;  4EWR A;  5HYN B;  1MG2 A;  1L0Q A;  3EU7 A;  3PSC B;  3I7P A;  3SFZ A;  5A2Q g;  4X60 B;  2Z2O A;  3GRE A;  4L1Q D;  4GZ8 A;  4Y5R D;  2IWF A;  4ESG A;  2AGX A;  1Q47 A;  4X61 B;  5FKS A;  2PM7 B;  3C5M A;  4CZV A;  4A09 B;  4J81 A;  2P9S C;  3K27 A;  4J79 A;  1QNI A;  3PSL A;  4I79 A;  3L4M D;  4OWR A;  1TBG A;  4PC0 A;  2YNO A;  3RLM D;  5TEF A;  5B4W A;  3ZWL B;  4ZOV A;  2CE8 A;  4JD2 C;  3MKS B;  5HE3 B;  4FAN D;  3OL2 A;  1NEX B;  3B7F A;  2J57 G;  2PM6 B;  3KRW B;  1OMW B;  1PI6 A;  4FA1 D;  1JMZ B;  3BG1 A;  1B9X A;  3SCY A;  2AQ5 A;  3HFQ A;  5H1M A;  2BCJ B;  3SLE D;  3SBR A;  3C75 H;  5IC7 A;  5AFU 3;  5EMM B;  4K3J B;  2AH0 A;  2CE9 A;  4J0X A;  4CI1 A;  4A08 A;  4FHL A;  3I7O A;  2GC4 A;  2CN3 A;  4ERZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...