4G56B

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
303
structure length
292
Chain Sequence
b'CMEVQIGAVRYRRDGALLLAASSLSSRTWGGSIWVFKDPENESLCTAGVQTEAGVTDVAWVSEKGILVASDSGAVELWLVNKFAKYEHDDIVKTLSVFSDGTQAVSGGKDFSVKVWDLSQKAVLKSYNAHSSEVNCVAACPGKDTIFLSCGEDGRILLWDTRKPKPATRIDFCASDTIPTSVTWHPEKDDTFACGDETGNVSLVNIKNPDSAQTSAVHSQNITGLAYSYHSSPFLASISEDCTVAVLDADFSEVFRDLSHRDFVTGVAWSPLDHSKFTTVGWDHKVLHHHLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hsl7 protein
molecule tags Transferase
source organism Xenopus laevis
publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
total genus 59
structure length 292
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4g56B00
3I7OA 3JZHA 2H9LA 2PBIB 5CYKB 3BWSA 2AQ5A 5H14A 2PM6B 2IUVA 3UVKA 4D0KA 3SBQA 2I0SA 5H17A 4GZ8A 3I8CA 3VH0A 5FA5B 2PM7B 4PBZA 1A0RB 5HE0B 4U1EI 4FA4D 4GM8A 4J86A 2CN2A 3OKTA 1OLZA 3RRMC 3DWLC 4J0WA 4EWRA 4A0AA 3W15A 3SBPA 4ZOZA 2AGLA 5IGQA 4X3EA 3IJCA 4J82A 2HJBA 4GGCA 4JT5C 2H6QA 2XL3A 4Y5RD 2YBAA 2G9AA 3ORVD 2AH0A 4N14A 5IJ8E 4HDJA 1U4CA 3JZNA 4CI1A 3IJ1A 5HYNB 3CFVA 3PVWB 4CZYA 5CXBB 3NVQA 1QNIA 3SMRA 3F3FA 2P9PC 2CO0C 4BH6A 1GP2B 4GM3A 4Z8LA 4E5ZB 1VYHC 2AGZA 5CYKA 2H3XA 3A0FA 4O45A 4KFMB 3CIKB 4J79A 4GGDA 2CN3A 2HESX 4ZOYA 4H5IA 2AGYA 1NEXB 2H6KA 2B5NA 3JRPA 1MG2A 4ESGA 3DSMA 3AL9A 1XIPA 3EMHA 5GXIA 4ERYA 4CY2A 1TYQC 2H47A 3SJLD 4CZVA 3I8EA 5AJAA 3NVNA 1SQ9A 5IJ7E 4G56B 3K27A 2P9KC 3AL8A 2OK6A 4OZUA 3ODTA 2I0RA 3ULEC 3EI2B 1OMWB 3L4OD 1JOFA 1XHMA 2H13A 2QXVA 4QL1A 4UI9R 5FLXg 3UKRC 4D6VA 5HQGA 3UKUC 3PXTD 4A11A 3EWEA 2IAAA 2XYIA 4CI2A 4K3JB 2HXCA 3SHFA 4JSXC 3I7NA 3JZGA 2UZXB 5TEEA 2OJYA 1N6FA 1PGUA 4NSXA 1Q47A 3JROA 4QT8A 5I5JA 5KDOB 2G99A 2Z2OA 3OKWA 5IGOA 4A0BB 5SXMA 2I3SA 3I2NA 3AL8B 4IMMA 5AFU3 3SLED 3NVXA 3SVWD 4J87A 3C9CA 3JAMg 3GREA 3PE7A 3HFQA 4FB1D 3J80g 4PBYA 4A2LA 3L4MD 4ERQA 3RFGA 5C2WB 4A0AB 4A09A 3E0CA 2BBKH 3C5MA 4X63B 2IUQA 3KRXB 4A08B 2CE8A 5JWZA 3SWSD 3MZKA 5THAA 2J55H 1K8KC 3IKOA 3PSCB 4ZN4A 3UVLA 3UVOA 1K32A 1GXRA 5FKTA 2Q7QA 4R7AB 4X60B 3PSLA 3MMYA 4FA1D 5A2Qg 4H5JA 4JT6C 2QC5A 4JD2C 4A09B 2AGXA 3C99A 2PM9A 4BL0A 4PNKB 4CZXA 4PC0A 4CY5A 2B4EA 5H1MA 3UR4A 3MKSB 5HE3B 3IIWA 2CO0A 4FA9D 2IURA 4FAND 4GM9A 4CC9A 3MXXA 4IA9A 5EMJB 2P9LC 3SCYA 3RLMD 2OVQB 3CFSB 4O3TB 3OL2B 2HKMA 4L3GD 4A11B 5IT9g 2P9UC 4FHLA 2IWKA 3DXKC 4JSPC 5EAPA 2HYEA 3AH8B 1S4UX 1SHYB 5EAMA 3PXWD 5GMKn 3I7LA 2GNQA 3V7DB 4ERZA 3EI4B 3P4FA 3C75H 3B7FA 3FGBA 4XYIA 2BCJB 4J77A 3VGZA 4GGAA 3VA6A 4PSWB 2H9MA 3UVMA 5FXYA 4ZOXA 4CY1A 4L9OA 3BG0A 1L0QA 1GOTB 5EALA 3SN6B 3EU7A 5FKSA 4A2MA 1JMZB 4L3HD 4PSXB 3RMZD 2Z2PA 5TF2A 5TDHB 3V9FA 5I5IA 2YNPA 4LGNA 1ERJA 4JXMA 1PBYB 2OVRB 3SFZA 5GXHA 3IIYA 1N6DA 2OIZA 2B5LA 3N0EA 3RN1D 5HE2B 4A08A 3DM0A 3RN0D 4JSVC 4ZOVA 3MKQA 5FQDA 2P9NC 4O9DA 4E5ZA 5CXBA 3EI3A 3U4YA 3N0DA 3RFHA 2AGWA 5IC7A 4QQEA 4J78A 2H14A 3PVUB 1P22A 5FKRA 4OWRA 5GSAA 4MK0B 2P9IC 4YVDA 4GMBA 3KRWB 2IWFA 2O9KA 4A0BA 2P9SC 4AEZA 5B4WA 4AOWA 4LG8A 3EI3B 2HKRA 5K19A 3I7HA 4CI8A 4X61B 4J81A 3OW8A 1MG3A 1JJUB 2H68A 3SBRA 3DXMC 3K26A 4J73A 5AMSA 4GQ2P 2GC7A 5FKQA 5C9ZB 4XYHA 5TEFA 2MTAH 3JB9L 1JMXB 3V5WB 5EM2B 1GG2B 3FM0A 3SXTD 2IUPA 1SQJA 4QRJA 3I7KA 1MDAH 1FWXA 1XKSA 4U7AA 3OKYA 2I0TA 2J56H 2EBSA 4E54A 5EMKB 2UZYB 2HJ4A 3I89A 2B5MA 2XL2A 2GC4A 1N6EA 4CY3A 4PXWA 2CE9A 3EI4A 2CNXA 4CI3A 3RSEC 3J81g 4BUJC 3OTTA 4L1QD 3F3GA 1PEVA 3F3PA 4TZ4A 4A7JA 3EI1A 3EG6A 3OKYB 2H9PA 2W18A 4FWWA 3I7PA 4XEIC 4K3ID 3FRXA 2I3TA 5CXCB 5EMMB 1B9YA 2TRCB 5EM2A 3GFCA 2Z2NA 5CXCA 4J8GA 4FA5D 2XU7A 1B9XA 3OL2A 1YFQA 3UVNA 2J57G 4GQ1A 3EI2A 1R5MA 2YNOA 3EI1B 4O3UB 3PXSD 4O1QD 3IJ0A 1RI6A 2OVPB 5EMLB 3BG1A 5HE1B 3JPXA 5I5MA 4LG9A 4FAVD 2YB8B 4E54B 2H9NA 2YNNA 2PM9B 4J0XA 1NR0A 4GQBB 2AH1A 2OK4A 1TBGA 4JSNC 3AFCA 2YMUA 4Y7RA 4I79A 4J8BA 1PI6A 3MZLA 4J84A 2H6NA 3ZWLB 5C2VB 4ES0A 5K1CC 5EARA 1U2VC
chains in the Genus database with same CATH superfamily
3I7OA 3JZHA 2H9LA 2PBIB 1I2MB 5CYKB 5FFOA 3BWSA 2AQ5A 3EQ9A 2PM6B 5H14A 2EICA 2IUVA 3UVKA 4D0KA 3SBQA 2I0SA 5H17A 4GZ8A 3I8CA 3VH0A 5FA5B 2PM7B 4PBZA 1A0RB 5HE0B 4U1EI 3VI3A 4GM8A 4FA4D 4J86A 2CN2A 3OKTA 1OLZA 3RRMC 3DWLC 3O4GA 4J0WA 1UOQA 4EWRA 1QFSA 4A0AA 3K72A 3W15A 3SBPA 4ZOZA 2AGLA 1E8MA 5IGQA 4X3EA 3IJCA 4J82A 2HJBA 4GGCA 4JT5C 2H6QA 2XL3A 4Y5RD 2YBAA 3EQ7A 2QZPA 3MVDK 2G9AA 3ORVD 2AH0A 4N14A 5IJ8E 4HDJA 2XE4A 1U4CA 3JZNA 4CI1A 3IJ1A 5HYNB 3CFVA 3PVWB 4CZYA 4QAMA 5CXBB 2HU8A 3NVQA 5C86A 1QNIA 3SMRA 4WJKA 3F3FA 2P9PC 2CO0C 4BH6A 5M5VA 1GP2B 4GM3A 4Z8LA 4E5ZB 1VYHC 2AGZA 5CYKA 2H3XA 3A0FA 4BCCA 4O45A 2WQ8A 4KFMB 3CIKB 4J79A 1H2YA 2VDRA 4GGDA 4G1EA 4RE6A 2CN3A 2HESX 4ZOYA 4H5IA 2AGYA 2VDLA 1NEXB 2H6KA 2QR5A 4NENA 2B5NA 3JRPA 1MG2A 4ESGA 3DSMA 3AL9A 1XIPA 3EMHA 2VDKA 1TYEA 4ERYA 5GXIA 4CY2A 1C9IA 1TYQC 2H47A 3SJLD 4CZVA 3I8EA 5AJAA 3NVNA 1SQ9A 3KCIA 5IJ7E 4L1MA 4G56B 3K27A 2P9KC 3GD1I 3AL8A 2OK6A 4OZUA 3ODTA 2I0RA 5K1CC 3ULEC 1OMWB 3EI2B 3EQ8A 4BP9A 3L4OD 1JOFA 1BPOA 1XHMA 2H13A 2QXVA 4QL1A 4UI9R 5FLXg 3UKRC 4D6VA 5HQGA 3UKUC 3PXTD 4A11A 1GOHA 3EWEA 2IAAA 2XYIA 4IRZA 5M5RA 4CI2A 4K3JB 2HXCA 3SHFA 4JSXC 3I7NA 3JZGA 2UZXB 5TEEA 2OJYA 3QI0A 1N6FA 3IUQA 1PGUA 4NSXA 4O02A 1Q47A 3JROA 3GC3B 4QT8A 5I5JA 5KDOB 2G99A 2Z2OA 3OKWA 1C9LA 5IGOA 4A0BB 5SXMA 2I3SA 3I2NA 4JHPC 1H2ZA 3AL8B 5M5UA 4IMMA 5AFU3 3SLED 3NVXA 2BKLA 3SVWD 4J87A 3C9CA 3JAMg 3GREA 3V4VA 3PE7A 3HFQA 1O6GA 4FB1D 1VE7A 3J80g 4AN0A 3NIDA 4G55A 5M5SA 4Z7NA 4PBYA 4A2LA 3L4MD 4ERQA 3RFGA 1YR2A 5C2WB 4A0AB 4A09A 3E0CA 2BBKH 3C5MA 4X63B 2IUQA 3KRXB 4A08B 2CE8A 5JWZA 3SWSD 3MZKA 5THAA 2J55H 1K8KC 3IKOA 3PSCB 4ZN4A 1VZ2A 3UVLA 3UVOA 1K32A 1GXRA 5FKTA 4DNVA 2Q7QA 4R7AB 3IUJA 3PSLA 3MMYA 4X60B 4FA1D 5A2Qg 4H5JA 4JT6C 2EIBA 2VZ1A 2QC5A 4JD2C 5E6RA 4A09B 2AGXA 3C99A 2PM9A 4BL0A 4PNKB 4CZXA 2EIEA 1GOGA 4AX4A 4PC0A 4CY5A 2B4EA 5H1MA 3UR4A 3MKSB 2VDOA 5E6SA 5HE3B 3IIWA 2CO0A 1UTCA 3ZDYA 4FA9D 2IURA 4FAND 4GM9A 4CC9A 2VZ3A 3MXXA 4IA9A 5EMJB 2P9LC 3SCYA 3RLMD 2OVQB 3CFSB 4O3TB 3OL2B 2HKMA 4L3GD 4A11B 5IT9g 2P9UC 4FHLA 2IWKA 2VDNA 3DXKC 4JSPC 3V4PA 4UM9A 5EAPA 2HYEA 3AH8B 1H2XA 4G1MA 1S4UX 1SHYB 5EAMA 3PXWD 3T3PA 4DNWA 5GMKn 3I7LA 2GNQA 3V7DB 4ERZA 3EI4B 3P4FA 3ZE0A 4Z7OA 3C75H 5HDBA 3B7FA 3FGBA 2BCJB 4J77A 4XYIA 3VGZA 4GGAA 3VA6A 4PSWB 2H9MA 3UVMA 5FXYA 4ZOXA 4CY1A 3ZE1A 4L9OA 3BG0A 3ZE2A 1VZ3A 3T3MA 1L0QA 2EIDA 1GOTB 5EALA 5E6UA 3SN6B 3EU7A 5FKSA 3FCUA 4A2MA 1JMZB 4L3HD 4PSXB 3RMZD 2Z2PA 1UOOA 3IURA 5TF2A 5TDHB 3V9FA 5I5IA 2YNPA 1L5GA 3K71A 4LGNA 1ERJA 3IULA 4JXMA 1PBYB 2OVRB 3MUOA 3SFZA 5GXHA 3IIYA 4AMYA 1N6DA 2OIZA 2B5LA 3N0EA 3RN1D 5HE2B 4A08A 3DM0A 4MMYA 3RN0D 4JSVC 4ZOVA 4WK0A 3MKQA 5FQDA 2P9NC 1K3IA 4MMZA 2VDQA 4O9DA 4E5ZA 5CXBA 3O4JA 3IUMA 3EI3A 4BCDA 3OF7A 3U4YA 2VDPA 3N0DA 3RFHA 2AGWA 5IC7A 4QQEA 4J78A 2H14A 4BCBA 3PVUB 1P22A 5FKRA 4OWRA 3IUNA 3MUNA 5GSAA 4MK0B 2P9IC 4YVDA 4GMBA 3KRWB 2IWFA 2O9KA 4A0BA 2P9SC 1H2WA 4AEZA 5B4WA 4AOWA 4LG8A 1E5TA 3EI3B 2HKRA 2VDMA 5K19A 4JHNA 2VC2A 3I7HA 4CI8A 4X61B 4J81A 3OW8A 4WK2A 1MG3A 1JJUB 2H68A 4DNUA 4Z7QA 3SBRA 3DXMC 1JV2A 4AMZA 3K26A 4J73A 5AMSA 4GQ2P 3O4HA 2GC7A 5FKQA 5C9ZB 4XYHA 1A12A 5TEFA 2MTAH 3JB9L 1JMXB 3V5WB 5EM2B 1GG2B 3FM0A 3NIFA 3SXTD 5M61A 2IUPA 1SQJA 1QFMA 4QRJA 3I7KA 3ZDXA 1JTDB 1MDAH 3FCSA 1FWXA 1XKSA 4U7AA 3OKYA 2I0TA 2J56H 2EBSA 4E54A 5EMKB 2UZYB 5FFGA 2HJ4A 2XDWA 3I89A 2B5MA 2XL2A 2GC4A 1N6EA 4CY3A 2HU5A 4PXWA 1GOFA 2CE9A 5M5TA 3EI4A 2CNXA 4CI3A 3VI4A 3RSEC 3J81g 4BUJC 3OTTA 4L1QD 3F3GA 1PEVA 3F3PA 4TZ4A 2XZGA 4WK4A 4A7JA 3EG6A 3EI1A 3OKYB 2H9PA 2W18A 4FWWA 3I7PA 4XEIC 4K3ID 3FRXA 2I3TA 3IVMA 1T2XA 3NIGA 5CXCB 5EMMB 1B9YA 2TRCB 5EM2A 3GFCA 2Z2NA 5C92A 5CXCA 4J8GA 4FA5D 2XU7A 1B9XA 4O2WA 3OL2A 4RE5A 1VE6A 1O6FA 1YFQA 3UVNA 2J57G 4NC4A 4GQ1A 1E8NA 3EI2A 1R5MA 2YNOA 3EI1B 4O3UB 3PXSD 4O1QD 1M1XA 3IJ0A 1RI6A 2OVPB 5EMLB 2HU7A 3BG1A 5HE1B 3JPXA 3O4IA 4NAAA 5I5MA 4LG9A 1U8CA 4FAVD 2YB8B 3ZDZA 4E54B 4AN1A 4UM8A 2H9NA 2YNNA 1UOPA 2PM9B 4J0XA 1NR0A 4GQBB 2AH1A 2OK4A 1TBGA 2JKXA 3AFCA 2YMUA 4JSNC 4NBMA 4Y7RA 4I79A 4BP8A 4MMXA 3K6SA 4J8BA 4D9SA 1PI6A 3IJEA 3MZLA 3DDUA 4J84A 2H6NA 3ZWLB 5C2VB 4ES0A 3QHYB 5EARA 1U2VC
chains in the Genus database with same CATH topology
3I7OA 3JZHA 2H9LA 2PBIB 5CYKB 3BWSA 2AQ5A 5H14A 2PM6B 2IUVA 3UVKA 4D0KA 3SBQA 2I0SA 5H17A 4GZ8A 3I8CA 3VH0A 5FA5B 2PM7B 4PBZA 1A0RB 5HE0B 4U1EI 4FA4D 4GM8A 4J86A 2CN2A 3OKTA 1OLZA 3RRMC 3DWLC 4J0WA 4EWRA 4A0AA 3W15A 3SBPA 4ZOZA 2AGLA 5IGQA 4X3EA 3IJCA 4J82A 2HJBA 4GGCA 4JT5C 2H6QA 2XL3A 4Y5RD 2YBAA 2G9AA 3ORVD 2AH0A 4N14A 5IJ8E 4HDJA 1U4CA 3JZNA 4CI1A 3IJ1A 5HYNB 3CFVA 3PVWB 4CZYA 5CXBB 3NVQA 1QNIA 3SMRA 3F3FA 2P9PC 2CO0C 4BH6A 1GP2B 4GM3A 4Z8LA 4E5ZB 1VYHC 2AGZA 5CYKA 2H3XA 3A0FA 4O45A 4KFMB 3CIKB 4J79A 4GGDA 2CN3A 2HESX 4ZOYA 4H5IA 2AGYA 1NEXB 2H6KA 2B5NA 3JRPA 1MG2A 4ESGA 3DSMA 3AL9A 1XIPA 3EMHA 5GXIA 4ERYA 4CY2A 1TYQC 2H47A 3SJLD 4CZVA 3I8EA 5AJAA 3NVNA 1SQ9A 5IJ7E 4G56B 3K27A 2P9KC 3AL8A 2OK6A 4OZUA 3ODTA 2I0RA 3ULEC 3EI2B 1OMWB 3L4OD 1JOFA 1XHMA 2H13A 2QXVA 4QL1A 4UI9R 5FLXg 3UKRC 4D6VA 5HQGA 3UKUC 3PXTD 4A11A 3EWEA 2IAAA 2XYIA 4CI2A 4K3JB 2HXCA 3SHFA 4JSXC 3I7NA 3JZGA 2UZXB 5TEEA 2OJYA 1N6FA 1PGUA 4NSXA 1Q47A 3JROA 4QT8A 5I5JA 5KDOB 2G99A 2Z2OA 3OKWA 5IGOA 4A0BB 5SXMA 2I3SA 3I2NA 3AL8B 4IMMA 5AFU3 3SLED 3NVXA 3SVWD 4J87A 3C9CA 3JAMg 3GREA 3PE7A 3HFQA 4FB1D 3J80g 4PBYA 4A2LA 3L4MD 4ERQA 3RFGA 5C2WB 4A0AB 4A09A 3E0CA 2BBKH 3C5MA 4X63B 2IUQA 3KRXB 4A08B 2CE8A 5JWZA 3SWSD 3MZKA 5THAA 2J55H 1K8KC 3IKOA 3PSCB 4ZN4A 3UVLA 3UVOA 1K32A 1GXRA 5FKTA 2Q7QA 4R7AB 4X60B 3PSLA 3MMYA 4FA1D 5A2Qg 4H5JA 4JT6C 2QC5A 4JD2C 4A09B 2AGXA 3C99A 2PM9A 4BL0A 4PNKB 4CZXA 4PC0A 4CY5A 2B4EA 5H1MA 3UR4A 3MKSB 5HE3B 3IIWA 2CO0A 4FA9D 2IURA 4FAND 4GM9A 4CC9A 3MXXA 4IA9A 5EMJB 2P9LC 3SCYA 3RLMD 2OVQB 3CFSB 4O3TB 3OL2B 2HKMA 4L3GD 4A11B 5IT9g 2P9UC 4FHLA 2IWKA 3DXKC 4JSPC 5EAPA 2HYEA 3AH8B 1S4UX 1SHYB 5EAMA 3PXWD 5GMKn 3I7LA 2GNQA 3V7DB 4ERZA 3EI4B 3P4FA 3C75H 3B7FA 3FGBA 4XYIA 2BCJB 4J77A 3VGZA 4GGAA 3VA6A 4PSWB 2H9MA 3UVMA 5FXYA 4ZOXA 4CY1A 4L9OA 3BG0A 1L0QA 1GOTB 5EALA 3SN6B 3EU7A 5FKSA 4A2MA 1JMZB 4L3HD 4PSXB 3RMZD 2Z2PA 5TF2A 5TDHB 3V9FA 5I5IA 2YNPA 4LGNA 1ERJA 4JXMA 1PBYB 2OVRB 3SFZA 5GXHA 3IIYA 1N6DA 2OIZA 2B5LA 3N0EA 3RN1D 5HE2B 4A08A 3DM0A 3RN0D 4JSVC 4ZOVA 3MKQA 5FQDA 2P9NC 4O9DA 4E5ZA 5CXBA 3EI3A 3U4YA 3N0DA 3RFHA 2AGWA 5IC7A 4QQEA 4J78A 2H14A 3PVUB 1P22A 5FKRA 4OWRA 5GSAA 4MK0B 2P9IC 4YVDA 4GMBA 3KRWB 2IWFA 2O9KA 4A0BA 2P9SC 4AEZA 5B4WA 4AOWA 4LG8A 3EI3B 2HKRA 5K19A 3I7HA 4CI8A 4X61B 4J81A 3OW8A 1MG3A 1JJUB 2H68A 3SBRA 3DXMC 3K26A 4J73A 5AMSA 4GQ2P 2GC7A 5FKQA 5C9ZB 4XYHA 5TEFA 2MTAH 3JB9L 1JMXB 3V5WB 5EM2B 1GG2B 3FM0A 3SXTD 2IUPA 1SQJA 4QRJA 3I7KA 1MDAH 1FWXA 1XKSA 4U7AA 3OKYA 2I0TA 2J56H 2EBSA 4E54A 5EMKB 2UZYB 2HJ4A 3I89A 2B5MA 2XL2A 2GC4A 1N6EA 4CY3A 4PXWA 2CE9A 3EI4A 2CNXA 4CI3A 3RSEC 3J81g 4BUJC 3OTTA 4L1QD 3F3GA 1PEVA 3F3PA 4TZ4A 4A7JA 3EI1A 3EG6A 3OKYB 2H9PA 2W18A 4FWWA 3I7PA 4XEIC 4K3ID 3FRXA 2I3TA 5CXCB 5EMMB 1B9YA 2TRCB 5EM2A 3GFCA 2Z2NA 5CXCA 4J8GA 4FA5D 2XU7A 1B9XA 3OL2A 1YFQA 3UVNA 2J57G 4GQ1A 3EI2A 1R5MA 2YNOA 3EI1B 4O3UB 3PXSD 4O1QD 3IJ0A 1RI6A 2OVPB 5EMLB 3BG1A 5HE1B 3JPXA 5I5MA 4LG9A 4FAVD 2YB8B 4E54B 2H9NA 2YNNA 2PM9B 4J0XA 1NR0A 4GQBB 2AH1A 2OK4A 1TBGA 4JSNC 3AFCA 2YMUA 4Y7RA 4I79A 4J8BA 1PI6A 3MZLA 4J84A 2H6NA 3ZWLB 5C2VB 4ES0A 5K1CC 5EARA 1U2VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7O A;  3JZH A;  2H9L A;  2PBI B;  5CYK B;  3BWS A;  2AQ5 A;  5H14 A;  2PM6 B;  2IUV A;  3UVK A;  4D0K A;  3SBQ A;  2I0S A;  5H17 A;  4GZ8 A;  3I8C A;  3VH0 A;  5FA5 B;  2PM7 B;  4PBZ A;  1A0R B;  5HE0 B;  4U1E I;  4FA4 D;  4GM8 A;  4J86 A;  2CN2 A;  3OKT A;  1OLZ A;  3RRM C;  3DWL C;  4J0W A;  4EWR A;  4A0A A;  3W15 A;  3SBP A;  4ZOZ A;  2AGL A;  5IGQ A;  4X3E A;  3IJC A;  4J82 A;  2HJB A;  4GGC A;  4JT5 C;  2H6Q A;  2XL3 A;  4Y5R D;  2YBA A;  2G9A A;  3ORV D;  2AH0 A;  4N14 A;  5IJ8 E;  4HDJ A;  1U4C A;  3JZN A;  4CI1 A;  3IJ1 A;  5HYN B;  3CFV A;  3PVW B;  4CZY A;  5CXB B;  3NVQ A;  1QNI A;  3SMR A;  3F3F A;  2P9P C;  2CO0 C;  4BH6 A;  1GP2 B;  4GM3 A;  4Z8L A;  4E5Z B;  1VYH C;  2AGZ A;  5CYK A;  2H3X A;  3A0F A;  4O45 A;  4KFM B;  3CIK B;  4J79 A;  4GGD A;  2CN3 A;  2HES X;  4ZOY A;  4H5I A;  2AGY A;  1NEX B;  2H6K A;  2B5N A;  3JRP A;  1MG2 A;  4ESG A;  3DSM A;  3AL9 A;  1XIP A;  3EMH A;  5GXI A;  4ERY A;  4CY2 A;  1TYQ C;  2H47 A;  3SJL D;  4CZV A;  3I8E A;  5AJA A;  3NVN A;  1SQ9 A;  5IJ7 E;  4G56 B;  3K27 A;  2P9K C;  3AL8 A;  2OK6 A;  4OZU A;  3ODT A;  2I0R A;  3ULE C;  3EI2 B;  1OMW B;  3L4O D;  1JOF A;  1XHM A;  2H13 A;  2QXV A;  4QL1 A;  4UI9 R;  5FLX g;  3UKR C;  4D6V A;  5HQG A;  3UKU C;  3PXT D;  4A11 A;  3EWE A;  2IAA A;  2XYI A;  4CI2 A;  4K3J B;  2HXC A;  3SHF A;  4JSX C;  3I7N A;  3JZG A;  2UZX B;  5TEE A;  2OJY A;  1N6F A;  1PGU A;  4NSX A;  1Q47 A;  3JRO A;  4QT8 A;  5I5J A;  5KDO B;  2G99 A;  2Z2O A;  3OKW A;  5IGO A;  4A0B B;  5SXM A;  2I3S A;  3I2N A;  3AL8 B;  4IMM A;  5AFU 3;  3SLE D;  3NVX A;  3SVW D;  4J87 A;  3C9C A;  3JAM g;  3GRE A;  3PE7 A;  3HFQ A;  4FB1 D;  3J80 g;  4PBY A;  4A2L A;  3L4M D;  4ERQ A;  3RFG A;  5C2W B;  4A0A B;  4A09 A;  3E0C A;  2BBK H;  3C5M A;  4X63 B;  2IUQ A;  3KRX B;  4A08 B;  2CE8 A;  5JWZ A;  3SWS D;  3MZK A;  5THA A;  2J55 H;  1K8K C;  3IKO A;  3PSC B;  4ZN4 A;  3UVL A;  3UVO A;  1K32 A;  1GXR A;  5FKT A;  2Q7Q A;  4R7A B;  4X60 B;  3PSL A;  3MMY A;  4FA1 D;  5A2Q g;  4H5J A;  4JT6 C;  2QC5 A;  4JD2 C;  4A09 B;  2AGX A;  3C99 A;  2PM9 A;  4BL0 A;  4PNK B;  4CZX A;  4PC0 A;  4CY5 A;  2B4E A;  5H1M A;  3UR4 A;  3MKS B;  5HE3 B;  3IIW A;  2CO0 A;  4FA9 D;  2IUR A;  4FAN D;  4GM9 A;  4CC9 A;  3MXX A;  4IA9 A;  5EMJ B;  2P9L C;  3SCY A;  3RLM D;  2OVQ B;  3CFS B;  4O3T B;  3OL2 B;  2HKM A;  4L3G D;  4A11 B;  5IT9 g;  2P9U C;  4FHL A;  2IWK A;  3DXK C;  4JSP C;  5EAP A;  2HYE A;  3AH8 B;  1S4U X;  1SHY B;  5EAM A;  3PXW D;  5GMK n;  3I7L A;  2GNQ A;  3V7D B;  4ERZ A;  3EI4 B;  3P4F A;  3C75 H;  3B7F A;  3FGB A;  4XYI A;  2BCJ B;  4J77 A;  3VGZ A;  4GGA A;  3VA6 A;  4PSW B;  2H9M A;  3UVM A;  5FXY A;  4ZOX A;  4CY1 A;  4L9O A;  3BG0 A;  1L0Q A;  1GOT B;  5EAL A;  3SN6 B;  3EU7 A;  5FKS A;  4A2M A;  1JMZ B;  4L3H D;  4PSX B;  3RMZ D;  2Z2P A;  5TF2 A;  5TDH B;  3V9F A;  5I5I A;  2YNP A;  4LGN A;  1ERJ A;  4JXM A;  1PBY B;  2OVR B;  3SFZ A;  5GXH A;  3IIY A;  1N6D A;  2OIZ A;  2B5L A;  3N0E A;  3RN1 D;  5HE2 B;  4A08 A;  3DM0 A;  3RN0 D;  4JSV C;  4ZOV A;  3MKQ A;  5FQD A;  2P9N C;  4O9D A;  4E5Z A;  5CXB A;  3EI3 A;  3U4Y A;  3N0D A;  3RFH A;  2AGW A;  5IC7 A;  4QQE A;  4J78 A;  2H14 A;  3PVU B;  1P22 A;  5FKR A;  4OWR A;  5GSA A;  4MK0 B;  2P9I C;  4YVD A;  4GMB A;  3KRW B;  2IWF A;  2O9K A;  4A0B A;  2P9S C;  4AEZ A;  5B4W A;  4AOW A;  4LG8 A;  3EI3 B;  2HKR A;  5K19 A;  3I7H A;  4CI8 A;  4X61 B;  4J81 A;  3OW8 A;  1MG3 A;  1JJU B;  2H68 A;  3SBR A;  3DXM C;  3K26 A;  4J73 A;  5AMS A;  4GQ2 P;  2GC7 A;  5FKQ A;  5C9Z B;  4XYH A;  5TEF A;  2MTA H;  3JB9 L;  1JMX B;  3V5W B;  5EM2 B;  1GG2 B;  3FM0 A;  3SXT D;  2IUP A;  1SQJ A;  4QRJ A;  3I7K A;  1MDA H;  1FWX A;  1XKS A;  4U7A A;  3OKY A;  2I0T A;  2J56 H;  2EBS A;  4E54 A;  5EMK B;  2UZY B;  2HJ4 A;  3I89 A;  2B5M A;  2XL2 A;  2GC4 A;  1N6E A;  4CY3 A;  4PXW A;  2CE9 A;  3EI4 A;  2CNX A;  4CI3 A;  3RSE C;  3J81 g;  4BUJ C;  3OTT A;  4L1Q D;  3F3G A;  1PEV A;  3F3P A;  4TZ4 A;  4A7J A;  3EI1 A;  3EG6 A;  3OKY B;  2H9P A;  2W18 A;  4FWW A;  3I7P A;  4XEI C;  4K3I D;  3FRX A;  2I3T A;  5CXC B;  5EMM B;  1B9Y A;  2TRC B;  5EM2 A;  3GFC A;  2Z2N A;  5CXC A;  4J8G A;  4FA5 D;  2XU7 A;  1B9X A;  3OL2 A;  1YFQ A;  3UVN A;  2J57 G;  4GQ1 A;  3EI2 A;  1R5M A;  2YNO A;  3EI1 B;  4O3U B;  3PXS D;  4O1Q D;  3IJ0 A;  1RI6 A;  2OVP B;  5EML B;  3BG1 A;  5HE1 B;  3JPX A;  5I5M A;  4LG9 A;  4FAV D;  2YB8 B;  4E54 B;  2H9N A;  2YNN A;  2PM9 B;  4J0X A;  1NR0 A;  4GQB B;  2AH1 A;  2OK4 A;  1TBG A;  4JSN C;  3AFC A;  2YMU A;  4Y7R A;  4I79 A;  4J8B A;  1PI6 A;  3MZL A;  4J84 A;  2H6N A;  3ZWL B;  5C2V B;  4ES0 A;  5K1C C;  5EAR A;  1U2V C; 
#chains in the Genus database with same CATH topology
 3I7O A;  3JZH A;  2H9L A;  2PBI B;  1I2M B;  5CYK B;  5FFO A;  3BWS A;  2AQ5 A;  3EQ9 A;  2PM6 B;  5H14 A;  2EIC A;  2IUV A;  3UVK A;  4D0K A;  3SBQ A;  2I0S A;  5H17 A;  4GZ8 A;  3I8C A;  3VH0 A;  5FA5 B;  2PM7 B;  4PBZ A;  1A0R B;  5HE0 B;  4U1E I;  3VI3 A;  4GM8 A;  4FA4 D;  4J86 A;  2CN2 A;  3OKT A;  1OLZ A;  3RRM C;  3DWL C;  3O4G A;  4J0W A;  1UOQ A;  4EWR A;  1QFS A;  4A0A A;  3K72 A;  3W15 A;  3SBP A;  4ZOZ A;  2AGL A;  1E8M A;  5IGQ A;  4X3E A;  3IJC A;  4J82 A;  2HJB A;  4GGC A;  4JT5 C;  2H6Q A;  2XL3 A;  4Y5R D;  2YBA A;  3EQ7 A;  2QZP A;  3MVD K;  2G9A A;  3ORV D;  2AH0 A;  4N14 A;  5IJ8 E;  4HDJ A;  2XE4 A;  1U4C A;  3JZN A;  4CI1 A;  3IJ1 A;  5HYN B;  3CFV A;  3PVW B;  4CZY A;  4QAM A;  5CXB B;  2HU8 A;  3NVQ A;  5C86 A;  1QNI A;  3SMR A;  4WJK A;  3F3F A;  2P9P C;  2CO0 C;  4BH6 A;  5M5V A;  1GP2 B;  4GM3 A;  4Z8L A;  4E5Z B;  1VYH C;  2AGZ A;  5CYK A;  2H3X A;  3A0F A;  4BCC A;  4O45 A;  2WQ8 A;  4KFM B;  3CIK B;  4J79 A;  1H2Y A;  2VDR A;  4GGD A;  4G1E A;  4RE6 A;  2CN3 A;  2HES X;  4ZOY A;  4H5I A;  2AGY A;  2VDL A;  1NEX B;  2H6K A;  2QR5 A;  4NEN A;  2B5N A;  3JRP A;  1MG2 A;  4ESG A;  3DSM A;  3AL9 A;  1XIP A;  3EMH A;  2VDK A;  1TYE A;  4ERY A;  5GXI A;  4CY2 A;  1C9I A;  1TYQ C;  2H47 A;  3SJL D;  4CZV A;  3I8E A;  5AJA A;  3NVN A;  1SQ9 A;  3KCI A;  5IJ7 E;  4L1M A;  4G56 B;  3K27 A;  2P9K C;  3GD1 I;  3AL8 A;  2OK6 A;  4OZU A;  3ODT A;  2I0R A;  5K1C C;  3ULE C;  1OMW B;  3EI2 B;  3EQ8 A;  4BP9 A;  3L4O D;  1JOF A;  1BPO A;  1XHM A;  2H13 A;  2QXV A;  4QL1 A;  4UI9 R;  5FLX g;  3UKR C;  4D6V A;  5HQG A;  3UKU C;  3PXT D;  4A11 A;  1GOH A;  3EWE A;  2IAA A;  2XYI A;  4IRZ A;  5M5R A;  4CI2 A;  4K3J B;  2HXC A;  3SHF A;  4JSX C;  3I7N A;  3JZG A;  2UZX B;  5TEE A;  2OJY A;  3QI0 A;  1N6F A;  3IUQ A;  1PGU A;  4NSX A;  4O02 A;  1Q47 A;  3JRO A;  3GC3 B;  4QT8 A;  5I5J A;  5KDO B;  2G99 A;  2Z2O A;  3OKW A;  1C9L A;  5IGO A;  4A0B B;  5SXM A;  2I3S A;  3I2N A;  4JHP C;  1H2Z A;  3AL8 B;  5M5U A;  4IMM A;  5AFU 3;  3SLE D;  3NVX A;  2BKL A;  3SVW D;  4J87 A;  3C9C A;  3JAM g;  3GRE A;  3V4V A;  3PE7 A;  3HFQ A;  1O6G A;  4FB1 D;  1VE7 A;  3J80 g;  4AN0 A;  3NID A;  4G55 A;  5M5S A;  4Z7N A;  4PBY A;  4A2L A;  3L4M D;  4ERQ A;  3RFG A;  1YR2 A;  5C2W B;  4A0A B;  4A09 A;  3E0C A;  2BBK H;  3C5M A;  4X63 B;  2IUQ A;  3KRX B;  4A08 B;  2CE8 A;  5JWZ A;  3SWS D;  3MZK A;  5THA A;  2J55 H;  1K8K C;  3IKO A;  3PSC B;  4ZN4 A;  1VZ2 A;  3UVL A;  3UVO A;  1K32 A;  1GXR A;  5FKT A;  4DNV A;  2Q7Q A;  4R7A B;  3IUJ A;  3PSL A;  3MMY A;  4X60 B;  4FA1 D;  5A2Q g;  4H5J A;  4JT6 C;  2EIB A;  2VZ1 A;  2QC5 A;  4JD2 C;  5E6R A;  4A09 B;  2AGX A;  3C99 A;  2PM9 A;  4BL0 A;  4PNK B;  4CZX A;  2EIE A;  1GOG A;  4AX4 A;  4PC0 A;  4CY5 A;  2B4E A;  5H1M A;  3UR4 A;  3MKS B;  2VDO A;  5E6S A;  5HE3 B;  3IIW A;  2CO0 A;  1UTC A;  3ZDY A;  4FA9 D;  2IUR A;  4FAN D;  4GM9 A;  4CC9 A;  2VZ3 A;  3MXX A;  4IA9 A;  5EMJ B;  2P9L C;  3SCY A;  3RLM D;  2OVQ B;  3CFS B;  4O3T B;  3OL2 B;  2HKM A;  4L3G D;  4A11 B;  5IT9 g;  2P9U C;  4FHL A;  2IWK A;  2VDN A;  3DXK C;  4JSP C;  3V4P A;  4UM9 A;  5EAP A;  2HYE A;  3AH8 B;  1H2X A;  4G1M A;  1S4U X;  1SHY B;  5EAM A;  3PXW D;  3T3P A;  4DNW A;  5GMK n;  3I7L A;  2GNQ A;  3V7D B;  4ERZ A;  3EI4 B;  3P4F A;  3ZE0 A;  4Z7O A;  3C75 H;  5HDB A;  3B7F A;  3FGB A;  2BCJ B;  4J77 A;  4XYI A;  3VGZ A;  4GGA A;  3VA6 A;  4PSW B;  2H9M A;  3UVM A;  5FXY A;  4ZOX A;  4CY1 A;  3ZE1 A;  4L9O A;  3BG0 A;  3ZE2 A;  1VZ3 A;  3T3M A;  1L0Q A;  2EID A;  1GOT B;  5EAL A;  5E6U A;  3SN6 B;  3EU7 A;  5FKS A;  3FCU A;  4A2M A;  1JMZ B;  4L3H D;  4PSX B;  3RMZ D;  2Z2P A;  1UOO A;  3IUR A;  5TF2 A;  5TDH B;  3V9F A;  5I5I A;  2YNP A;  1L5G A;  3K71 A;  4LGN A;  1ERJ A;  3IUL A;  4JXM A;  1PBY B;  2OVR B;  3MUO A;  3SFZ A;  5GXH A;  3IIY A;  4AMY A;  1N6D A;  2OIZ A;  2B5L A;  3N0E A;  3RN1 D;  5HE2 B;  4A08 A;  3DM0 A;  4MMY A;  3RN0 D;  4JSV C;  4ZOV A;  4WK0 A;  3MKQ A;  5FQD A;  2P9N C;  1K3I A;  4MMZ A;  2VDQ A;  4O9D A;  4E5Z A;  5CXB A;  3O4J A;  3IUM A;  3EI3 A;  4BCD A;  3OF7 A;  3U4Y A;  2VDP A;  3N0D A;  3RFH A;  2AGW A;  5IC7 A;  4QQE A;  4J78 A;  2H14 A;  4BCB A;  3PVU B;  1P22 A;  5FKR A;  4OWR A;  3IUN A;  3MUN A;  5GSA A;  4MK0 B;  2P9I C;  4YVD A;  4GMB A;  3KRW B;  2IWF A;  2O9K A;  4A0B A;  2P9S C;  1H2W A;  4AEZ A;  5B4W A;  4AOW A;  4LG8 A;  1E5T A;  3EI3 B;  2HKR A;  2VDM A;  5K19 A;  4JHN A;  2VC2 A;  3I7H A;  4CI8 A;  4X61 B;  4J81 A;  3OW8 A;  4WK2 A;  1MG3 A;  1JJU B;  2H68 A;  4DNU A;  4Z7Q A;  3SBR A;  3DXM C;  1JV2 A;  4AMZ A;  3K26 A;  4J73 A;  5AMS A;  4GQ2 P;  3O4H A;  2GC7 A;  5FKQ A;  5C9Z B;  4XYH A;  1A12 A;  5TEF A;  2MTA H;  3JB9 L;  1JMX B;  3V5W B;  5EM2 B;  1GG2 B;  3FM0 A;  3NIF A;  3SXT D;  5M61 A;  2IUP A;  1SQJ A;  1QFM A;  4QRJ A;  3I7K A;  3ZDX A;  1JTD B;  1MDA H;  3FCS A;  1FWX A;  1XKS A;  4U7A A;  3OKY A;  2I0T A;  2J56 H;  2EBS A;  4E54 A;  5EMK B;  2UZY B;  5FFG A;  2HJ4 A;  2XDW A;  3I89 A;  2B5M A;  2XL2 A;  2GC4 A;  1N6E A;  4CY3 A;  2HU5 A;  4PXW A;  1GOF A;  2CE9 A;  5M5T A;  3EI4 A;  2CNX A;  4CI3 A;  3VI4 A;  3RSE C;  3J81 g;  4BUJ C;  3OTT A;  4L1Q D;  3F3G A;  1PEV A;  3F3P A;  4TZ4 A;  2XZG A;  4WK4 A;  4A7J A;  3EG6 A;  3EI1 A;  3OKY B;  2H9P A;  2W18 A;  4FWW A;  3I7P A;  4XEI C;  4K3I D;  3FRX A;  2I3T A;  3IVM A;  1T2X A;  3NIG A;  5CXC B;  5EMM B;  1B9Y A;  2TRC B;  5EM2 A;  3GFC A;  2Z2N A;  5C92 A;  5CXC A;  4J8G A;  4FA5 D;  2XU7 A;  1B9X A;  4O2W A;  3OL2 A;  4RE5 A;  1VE6 A;  1O6F A;  1YFQ A;  3UVN A;  2J57 G;  4NC4 A;  4GQ1 A;  1E8N A;  3EI2 A;  1R5M A;  2YNO A;  3EI1 B;  4O3U B;  3PXS D;  4O1Q D;  1M1X A;  3IJ0 A;  1RI6 A;  2OVP B;  5EML B;  2HU7 A;  3BG1 A;  5HE1 B;  3JPX A;  3O4I A;  4NAA A;  5I5M A;  4LG9 A;  1U8C A;  4FAV D;  2YB8 B;  3ZDZ A;  4E54 B;  4AN1 A;  4UM8 A;  2H9N A;  2YNN A;  1UOP A;  2PM9 B;  4J0X A;  1NR0 A;  4GQB B;  2AH1 A;  2OK4 A;  1TBG A;  2JKX A;  3AFC A;  2YMU A;  4JSN C;  4NBM A;  4Y7R A;  4I79 A;  4BP8 A;  4MMX A;  3K6S A;  4J8B A;  4D9S A;  1PI6 A;  3IJE A;  3MZL A;  3DDU A;  4J84 A;  2H6N A;  3ZWL B;  5C2V B;  4ES0 A;  3QHY B;  5EAR A;  1U2V C; 
#chains in the Genus database with same CATH homology
 3I7O A;  3JZH A;  2H9L A;  2PBI B;  5CYK B;  3BWS A;  2AQ5 A;  5H14 A;  2PM6 B;  2IUV A;  3UVK A;  4D0K A;  3SBQ A;  2I0S A;  5H17 A;  4GZ8 A;  3I8C A;  3VH0 A;  5FA5 B;  2PM7 B;  4PBZ A;  1A0R B;  5HE0 B;  4U1E I;  4FA4 D;  4GM8 A;  4J86 A;  2CN2 A;  3OKT A;  1OLZ A;  3RRM C;  3DWL C;  4J0W A;  4EWR A;  4A0A A;  3W15 A;  3SBP A;  4ZOZ A;  2AGL A;  5IGQ A;  4X3E A;  3IJC A;  4J82 A;  2HJB A;  4GGC A;  4JT5 C;  2H6Q A;  2XL3 A;  4Y5R D;  2YBA A;  2G9A A;  3ORV D;  2AH0 A;  4N14 A;  5IJ8 E;  4HDJ A;  1U4C A;  3JZN A;  4CI1 A;  3IJ1 A;  5HYN B;  3CFV A;  3PVW B;  4CZY A;  5CXB B;  3NVQ A;  1QNI A;  3SMR A;  3F3F A;  2P9P C;  2CO0 C;  4BH6 A;  1GP2 B;  4GM3 A;  4Z8L A;  4E5Z B;  1VYH C;  2AGZ A;  5CYK A;  2H3X A;  3A0F A;  4O45 A;  4KFM B;  3CIK B;  4J79 A;  4GGD A;  2CN3 A;  2HES X;  4ZOY A;  4H5I A;  2AGY A;  1NEX B;  2H6K A;  2B5N A;  3JRP A;  1MG2 A;  4ESG A;  3DSM A;  3AL9 A;  1XIP A;  3EMH A;  5GXI A;  4ERY A;  4CY2 A;  1TYQ C;  2H47 A;  3SJL D;  4CZV A;  3I8E A;  5AJA A;  3NVN A;  1SQ9 A;  5IJ7 E;  4G56 B;  3K27 A;  2P9K C;  3AL8 A;  2OK6 A;  4OZU A;  3ODT A;  2I0R A;  3ULE C;  3EI2 B;  1OMW B;  3L4O D;  1JOF A;  1XHM A;  2H13 A;  2QXV A;  4QL1 A;  4UI9 R;  5FLX g;  3UKR C;  4D6V A;  5HQG A;  3UKU C;  3PXT D;  4A11 A;  3EWE A;  2IAA A;  2XYI A;  4CI2 A;  4K3J B;  2HXC A;  3SHF A;  4JSX C;  3I7N A;  3JZG A;  2UZX B;  5TEE A;  2OJY A;  1N6F A;  1PGU A;  4NSX A;  1Q47 A;  3JRO A;  4QT8 A;  5I5J A;  5KDO B;  2G99 A;  2Z2O A;  3OKW A;  5IGO A;  4A0B B;  5SXM A;  2I3S A;  3I2N A;  3AL8 B;  4IMM A;  5AFU 3;  3SLE D;  3NVX A;  3SVW D;  4J87 A;  3C9C A;  3JAM g;  3GRE A;  3PE7 A;  3HFQ A;  4FB1 D;  3J80 g;  4PBY A;  4A2L A;  3L4M D;  4ERQ A;  3RFG A;  5C2W B;  4A0A B;  4A09 A;  3E0C A;  2BBK H;  3C5M A;  4X63 B;  2IUQ A;  3KRX B;  4A08 B;  2CE8 A;  5JWZ A;  3SWS D;  3MZK A;  5THA A;  2J55 H;  1K8K C;  3IKO A;  3PSC B;  4ZN4 A;  3UVL A;  3UVO A;  1K32 A;  1GXR A;  5FKT A;  2Q7Q A;  4R7A B;  4X60 B;  3PSL A;  3MMY A;  4FA1 D;  5A2Q g;  4H5J A;  4JT6 C;  2QC5 A;  4JD2 C;  4A09 B;  2AGX A;  3C99 A;  2PM9 A;  4BL0 A;  4PNK B;  4CZX A;  4PC0 A;  4CY5 A;  2B4E A;  5H1M A;  3UR4 A;  3MKS B;  5HE3 B;  3IIW A;  2CO0 A;  4FA9 D;  2IUR A;  4FAN D;  4GM9 A;  4CC9 A;  3MXX A;  4IA9 A;  5EMJ B;  2P9L C;  3SCY A;  3RLM D;  2OVQ B;  3CFS B;  4O3T B;  3OL2 B;  2HKM A;  4L3G D;  4A11 B;  5IT9 g;  2P9U C;  4FHL A;  2IWK A;  3DXK C;  4JSP C;  5EAP A;  2HYE A;  3AH8 B;  1S4U X;  1SHY B;  5EAM A;  3PXW D;  5GMK n;  3I7L A;  2GNQ A;  3V7D B;  4ERZ A;  3EI4 B;  3P4F A;  3C75 H;  3B7F A;  3FGB A;  4XYI A;  2BCJ B;  4J77 A;  3VGZ A;  4GGA A;  3VA6 A;  4PSW B;  2H9M A;  3UVM A;  5FXY A;  4ZOX A;  4CY1 A;  4L9O A;  3BG0 A;  1L0Q A;  1GOT B;  5EAL A;  3SN6 B;  3EU7 A;  5FKS A;  4A2M A;  1JMZ B;  4L3H D;  4PSX B;  3RMZ D;  2Z2P A;  5TF2 A;  5TDH B;  3V9F A;  5I5I A;  2YNP A;  4LGN A;  1ERJ A;  4JXM A;  1PBY B;  2OVR B;  3SFZ A;  5GXH A;  3IIY A;  1N6D A;  2OIZ A;  2B5L A;  3N0E A;  3RN1 D;  5HE2 B;  4A08 A;  3DM0 A;  3RN0 D;  4JSV C;  4ZOV A;  3MKQ A;  5FQD A;  2P9N C;  4O9D A;  4E5Z A;  5CXB A;  3EI3 A;  3U4Y A;  3N0D A;  3RFH A;  2AGW A;  5IC7 A;  4QQE A;  4J78 A;  2H14 A;  3PVU B;  1P22 A;  5FKR A;  4OWR A;  5GSA A;  4MK0 B;  2P9I C;  4YVD A;  4GMB A;  3KRW B;  2IWF A;  2O9K A;  4A0B A;  2P9S C;  4AEZ A;  5B4W A;  4AOW A;  4LG8 A;  3EI3 B;  2HKR A;  5K19 A;  3I7H A;  4CI8 A;  4X61 B;  4J81 A;  3OW8 A;  1MG3 A;  1JJU B;  2H68 A;  3SBR A;  3DXM C;  3K26 A;  4J73 A;  5AMS A;  4GQ2 P;  2GC7 A;  5FKQ A;  5C9Z B;  4XYH A;  5TEF A;  2MTA H;  3JB9 L;  1JMX B;  3V5W B;  5EM2 B;  1GG2 B;  3FM0 A;  3SXT D;  2IUP A;  1SQJ A;  4QRJ A;  3I7K A;  1MDA H;  1FWX A;  1XKS A;  4U7A A;  3OKY A;  2I0T A;  2J56 H;  2EBS A;  4E54 A;  5EMK B;  2UZY B;  2HJ4 A;  3I89 A;  2B5M A;  2XL2 A;  2GC4 A;  1N6E A;  4CY3 A;  4PXW A;  2CE9 A;  3EI4 A;  2CNX A;  4CI3 A;  3RSE C;  3J81 g;  4BUJ C;  3OTT A;  4L1Q D;  3F3G A;  1PEV A;  3F3P A;  4TZ4 A;  4A7J A;  3EI1 A;  3EG6 A;  3OKY B;  2H9P A;  2W18 A;  4FWW A;  3I7P A;  4XEI C;  4K3I D;  3FRX A;  2I3T A;  5CXC B;  5EMM B;  1B9Y A;  2TRC B;  5EM2 A;  3GFC A;  2Z2N A;  5CXC A;  4J8G A;  4FA5 D;  2XU7 A;  1B9X A;  3OL2 A;  1YFQ A;  3UVN A;  2J57 G;  4GQ1 A;  3EI2 A;  1R5M A;  2YNO A;  3EI1 B;  4O3U B;  3PXS D;  4O1Q D;  3IJ0 A;  1RI6 A;  2OVP B;  5EML B;  3BG1 A;  5HE1 B;  3JPX A;  5I5M A;  4LG9 A;  4FAV D;  2YB8 B;  4E54 B;  2H9N A;  2YNN A;  2PM9 B;  4J0X A;  1NR0 A;  4GQB B;  2AH1 A;  2OK4 A;  1TBG A;  4JSN C;  3AFC A;  2YMU A;  4Y7R A;  4I79 A;  4J8B A;  1PI6 A;  3MZL A;  4J84 A;  2H6N A;  3ZWL B;  5C2V B;  4ES0 A;  5K1C C;  5EAR A;  1U2V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...