4G56B

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
303
structure length
292
Chain Sequence
CMEVQIGAVRYRRDGALLLAASSLSSRTWGGSIWVFKDPENESLCTAGVQTEAGVTDVAWVSEKGILVASDSGAVELWLVNKFAKYEHDDIVKTLSVFSDGTQAVSGGKDFSVKVWDLSQKAVLKSYNAHSSEVNCVAACPGKDTIFLSCGEDGRILLWDTRKPKPATRIDFCASDTIPTSVTWHPEKDDTFACGDETGNVSLVNIKNPDSAQTSAVHSQNITGLAYSYHSSPFLASISEDCTVAVLDADFSEVFRDLSHRDFVTGVAWSPLDHSKFTTVGWDHKVLHHHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hsl7 protein
publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transferase
total genus 59
structure length 292
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4g56B00
3I8EA 4MK0B 5CXCB 2P9PC 3GFCA 4I79A 4LG8A 4Y5RD 2HKMA 4E5ZB 3JAMg 2AGZA 3VGZA 5FKSA 4KFMB 4CY5A 3F3GA 2BCJB 2IURA 3DXKC 4ESGA 2HXCA 5JWZA 2GC4A 2XYIA 3MMYA 4J79A 3SN6B 4FHLA 4H5JA 5HE1B 3SJLD 3I7NA 3UVNA 5I5JA 1FWXA 3BG1A 5IGOA 1GXRA 4PBZA 2MTAH 1ERJA 4JSNC 4FA5D 4L3GD 1GP2B 2AGXA 3DSMA 3UR4A 3ORVD 2H14A 3I2NA 3I7OA 1SQJA 4A2LA 3IKOA 4U7AA 5K1CC 3EU7A 4GM3A 2AQ5A 4A0AB 2CNXA 3IIWA 2Z2PA 1GOTB 2XL2A 2I0SA 5EMKB 5H14A 3RMZD 3N0DA 2B5MA 3SWSD 3UKUC 2I3SA 3AL8A 4CZVA 2CN2A 1GG2B 1QNIA 2OIZA 3DWLC 4FA9D 5GSAA 3K26A 3RFGA 2H9LA 3EG6A 3JZNA 4J8GA 3IJ0A 5IC7A 1B9YA 5CYKB 5EMJB 4A0BB 4CY3A 4PC0A 4J0XA 3ULEC 2HESX 4K3JB 4J86A 4XYIA 4GQ1A 4JD2C 4AOWA 2CO0C 3RFHA 4A7JA 3RN1D 3EI4A 2UZXB 3MXXA 2XU7A 2J56H 3C75H 1N6DA 2Q7QA 3PVUB 2AGLA 2PM7B 2OK4A 2QXVA 4GM9A 2IWKA 5FQDA 2IUQA 1B9XA 3KRXB 3V7DB 4J73A 4EWRA 5IJ8E 1R5MA 5KDOB 3OL2B 4JSVC 3F3FA 1S4UX 3AH8B 5FKRA 2OK6A 4ERQA 3PXWD 2YMUA 4D6VA 1JOFA 3SBRA 3W15A 3PSCB 3E0CA 3B7FA 4A11B 2PM9A 3IIYA 4J84A 4N14A 5EM2A 1JMZB 1OLZA 3IJCA 1JJUB 3IJ1A 5B4WA 3F3PA 3EI3B 2AH1A 3SVWD 5IJ7E 2G9AA 3RN0D 2CE9A 4K3ID 5HQGA 1OMWB 1P22A 3EI1B 3ZWLB 2EBSA 3A0FA 2OVRB 5I5IA 5EAPA 3J81g 3KRWB 5CXCA 2I3TA 4CI2A 3UVOA 3I8CA 3V5WB 4E5ZA 3I7HA 3BG0A 3AFCA 3MZLA 3L4OD 5FA5B 4GGDA 1N6FA 4ZOXA 4QQEA 4A08B 3SXTD 4GQ2P 2HJ4A 3GREA 4E54B 2P9UC 3SCYA 4X61B 2B4EA 2YNOA 2I0TA 3EI2B 3I7LA 2QC5A 1N6EA 4CZYA 2P9KC 4NSXA 1RI6A 2YNPA 3OKWA 4XYHA 1XHMA 4J0WA 1XIPA 4L1QD 4X60B 4QL1A 1TBGA 1XKSA 2PBIB 3C9CA 3RSEC 3MKQA 4LGNA 2AH0A 3NVNA 4A0AA 3CFSB 3DM0A 2GNQA 3SFZA 3JROA 3OKYB 4PXWA 4CZXA 3VH0A 5HYNB 5C2VB 3OKTA 2OVQB 1PGUA 3PXTD 3VA6A 1U2VC 3RLMD 4O9DA 2GC7A 5H17A 2AGWA 3MKSB 5FKQA 5CYKA 4A0BA 4R7AB 5C2WB 5TEFA 4BL0A 3PVWB 1MG3A 4A09B 4O3TB 1VYHC 2P9SC 2TRCB 3JZGA 1U4CA 4JXMA 3PSLA 3SHFA 2HYEA 2Z2OA 3FM0A 4J87A 5TEEA 4O1QD 4CY2A 1SQ9A 3K27A 5CXBB 4CI1A 4J77A 2G99A 5GXIA 4O45A 3UVKA 4JT6C 3AL9A 4JSXC 4CI8A 2H68A 3OL2A 2YB8B 1YFQA 4FA1D 4GGAA 4ZOZA 4PSWB 5FXYA 4FB1D 3C99A 5TF2A 5C9ZB 1A0RB 5EAMA 4A11A 5HE0B 4FA4D 5HE3B 4JT5C 2AGYA 4GM8A 4YVDA 4G56B 4FAVD 4J82A 3SBPA 2PM6B 2H9PA 2XL3A 4IA9A 5GMKn 3EI3A 2O9KA 5EMLB 4D0KA 2YBAA 1SHYB 5I5MA 3MZKA 4Y7RA 2J57G 3N0EA 4U1EI 3EI1A 3JPXA 3HFQA 3EWEA 2HKRA 4XEIC 2P9NC 3J80g 4OWRA 5K19A 3JRPA 5THAA 1NR0A 4O3UB 5IT9g 5AMSA 4PBYA 4X63B 3FRXA 5GXHA 4FWWA 1K32A 2HJBA 2YNNA 3U4YA 4A08A 4A2MA 1L0QA 2Z2NA 4E54A 4PSXB 2P9IC 5H1MA 2IWFA 1NEXB 3EI2A 2B5LA 4ZOVA 4L3HD 3EMHA 2I0RA 1PEVA 1K8KC 3SBQA 3L4MD 3AL8B 3I7KA 4QRJA 4UI9R 3C5MA 3ODTA 4PNKB 3UKRC 5FKTA 3V9FA 4JSPC 5IGQA 4QT8A 4HDJA 2H13A 5A2Qg 4OZUA 3OTTA 5AFU3 3I89A 3P4FA 3OKYA 5FLXg 2OJYA 3FGBA 5EALA 2P9LC 4LG9A 4ES0A 2H9NA 3EI4B 1MG2A 5EMMB 4ERZA 4J81A 2CE8A 4TZ4A 5HE2B 3RRMC 2J55H 4FAND 4X3EA 4BUJC 4A09A 4AEZA 1JMXB 2B5NA 2H3XA 1PI6A 3NVXA 4Z8LA 2H47A 2UZYB 3CFVA 4GGCA 5TDHB 2IAAA 2CO0A 2H9MA 3DXMC 4IMMA 4GZ8A 2IUVA 1TYQC 2H6NA 5CXBA 3OW8A 4GMBA 5AJAA 5EARA 3SLED 4H5IA 4L9OA 4ERYA 3JZHA 4BH6A 2PM9B 2IUPA 3UVMA 4CI3A 1Q47A 1PBYB 2H6QA 5EM2B 3PXSD 4ZOYA 2BBKH 3CIKB 3BWSA 3SMRA 3JB9L 3PE7A 4GQBB 3I7PA 2H6KA 4J8BA 2W18A 2OVPB 4ZN4A 3NVQA 4CC9A 2CN3A 4J78A 5SXMA 1MDAH 3UVLA 4CY1A
chains in the Genus database with same CATH superfamily
3I8EA 4MK0B 5CXCB 2P9PC 3GFCA 1JV2A 4I79A 4LG8A 4Y5RD 2HKMA 4E5ZB 3JAMg 2AGZA 3VGZA 5FKSA 4BCCA 4KFMB 4CY5A 3F3GA 3O4GA 2BCJB 2IURA 3DXKC 4ESGA 2HXCA 3KCIA 5JWZA 2GC4A 2XYIA 3MMYA 4J79A 3SN6B 5M5RA 4FHLA 4H5JA 4Z7QA 5HE1B 3SJLD 3I7NA 3UVNA 5I5JA 1FWXA 2JKXA 3BG1A 3O4HA 1GXRA 5IGOA 4PBZA 3IUMA 2MTAH 1ERJA 3NIGA 4JSNC 5E6RA 1L5GA 4FA5D 4G55A 4L3GD 1GP2B 2AGXA 3DSMA 3UR4A 3ORVD 1UOQA 2H14A 3I2NA 3I7OA 1SQJA 4A2LA 3IKOA 4U7AA 1I2MB 2WQ8A 1O6FA 5K1CC 3NIDA 3EU7A 3K6SA 4GM3A 2AQ5A 4A0AB 2CNXA 3IIWA 2Z2PA 1GOTB 2XL2A 2I0SA 5EMKB 5H14A 3RMZD 5C92A 3N0DA 2B5MA 3GD1I 3SWSD 4DNWA 3UKUC 3MUOA 2I3SA 3AL8A 4CZVA 2CN2A 2HU7A 1GG2B 1QNIA 2OIZA 3DWLC 4FA9D 5GSAA 3K26A 3RFGA 2H9LA 3EG6A 3JZNA 4J8GA 3IJ0A 1K3IA 4NAAA 5IC7A 3IULA 1B9YA 1E8MA 3FCUA 5CYKB 5EMJB 2EIBA 3K71A 1UOPA 4RE5A 4A0BB 4UM8A 3IUNA 4CY3A 4PC0A 4J0XA 4MMZA 3ULEC 4JHPC 2HESX 4K3JB 4J86A 2QR5A 4XYIA 4GQ1A 4JD2C 4AOWA 2CO0C 3QHYB 3RFHA 4A7JA 3RN1D 3EI4A 2UZXB 4AMYA 3MXXA 2XU7A 2J56H 3C75H 1N6DA 2Q7QA 3PVUB 5M5SA 2AGLA 2PM7B 2OK4A 2QXVA 4GM9A 2IWKA 3ZE1A 5FQDA 1C9IA 2IUQA 1A12A 1B9XA 3KRXB 5HDBA 2VDQA 3V7DB 4J73A 4EWRA 5IJ8E 1VZ3A 1R5MA 5KDOB 3OL2B 4JSVC 2VC2A 3F3FA 1S4UX 3AH8B 1YR2A 5FKRA 2OK6A 2HU8A 5FFOA 4ERQA 5FFGA 3PXWD 4Z7NA 4G1EA 2YMUA 4D6VA 1JOFA 3SBRA 1JTDB 3ZDZA 3W15A 3PSCB 3E0CA 3B7FA 4A11B 2PM9A 3IIYA 4J84A 4N14A 5EM2A 2VDNA 1JMZB 1OLZA 3IJCA 1JJUB 3IJ1A 5B4WA 3F3PA 4WK4A 3T3MA 3EI3B 2AH1A 3IUQA 2QZPA 5IJ7E 3SVWD 2G9AA 3RN0D 2CE9A 4K3ID 3DDUA 5HQGA 1OMWB 1P22A 3NIFA 3EI1B 3ZWLB 2EBSA 3A0FA 2OVRB 5I5IA 4NC4A 5EAPA 3J81g 3KRWB 1H2YA 5CXCA 2I3TA 4CI2A 3UVOA 3I8CA 3V5WB 5C86A 4E5ZA 3I7HA 3BG0A 3AFCA 3MZLA 3L4OD 5FA5B 2VDLA 4GGDA 1N6FA 4ZOXA 4QQEA 1C9LA 4A08B 3SXTD 4GQ2P 2HJ4A 3GREA 4E54B 2P9UC 3SCYA 4X61B 3EQ9A 2B4EA 2YNOA 2I0TA 3EI2B 3I7LA 2QC5A 1N6EA 4RE6A 4CZYA 1GOGA 1M1XA 2P9KC 4L1MA 4NSXA 1RI6A 2YNPA 3OKWA 4BP9A 5M5UA 4XYHA 1XHMA 3ZE2A 4J0WA 1XIPA 4L1QD 4X60B 4QL1A 1TBGA 1XKSA 2PBIB 3C9CA 3RSEC 3MKQA 2AH0A 4LGNA 3NVNA 4A0AA 3CFSB 3DM0A 2GNQA 2XE4A 1TYEA 4QAMA 3SFZA 3IUJA 3JROA 1H2XA 3OKYB 4PXWA 4CZXA 4O02A 3VH0A 4AN0A 3K72A 5HYNB 5C2VB 3OKTA 2OVQB 1PGUA 3PXTD 3VA6A 1U2VC 3RLMD 4O9DA 2GC7A 5H17A 2AGWA 1UOOA 3T3PA 4G1MA 3MKSB 5FKQA 5CYKA 4A0BA 4R7AB 3VI4A 5C2WB 5TEFA 4BL0A 3PVWB 1MG3A 3MVDK 4O3TB 4A09B 1VYHC 2P9SC 1BPOA 2VZ3A 2TRCB 3JZGA 1U4CA 4UM9A 4JXMA 3QI0A 3VI3A 3PSLA 3SHFA 2HYEA 2Z2OA 5M61A 3FM0A 4J87A 5TEEA 4O1QD 4CY2A 1SQ9A 3ZDXA 3K27A 5CXBB 4CI1A 4J77A 2G99A 1QFSA 5GXIA 4O45A 1QFMA 1H2ZA 2VDOA 3UVKA 4JT6C 3AL9A 4JSXC 4CI8A 2H68A 3OL2A 2YB8B 1YFQA 4FA1D 4IRZA 4GGAA 4ZOZA 4MMXA 4PSWB 3GC3B 5FXYA 4FB1D 3C99A 5TF2A 5C9ZB 3MUNA 4WK2A 1A0RB 4MMYA 5EAMA 4A11A 5HE0B 2XZGA 3IJEA 4FA4D 5HE3B 4JT5C 2AGYA 4GM8A 4YVDA 4G56B 4FAVD 4J82A 3SBPA 2PM6B 1E8NA 2H9PA 2XL3A 4IA9A 4DNUA 1VE7A 5GMKn 3EI3A 2O9KA 5EMLB 4D0KA 2YBAA 4AX4A 4WJKA 4DNVA 1SHYB 5I5MA 3MZKA 4Y7RA 2J57G 3N0EA 4U1EI 3EI1A 3JPXA 3HFQA 3EWEA 1GOFA 2HKRA 2EIEA 4XEIC 2P9NC 3J80g 4OWRA 5K19A 3JRPA 5THAA 1NR0A 4O3UB 5IT9g 5AMSA 4PBYA 1UTCA 4BCBA 4X63B 3FRXA 5GXHA 4FWWA 1K32A 4O2WA 2HJBA 2YNNA 3U4YA 1VE6A 4A08A 4A2MA 1L0QA 2Z2NA 4D9SA 4E54A 4PSXB 2P9IC 5H1MA 2IWFA 1NEXB 3EI2A 2HU5A 5E6SA 2B5LA 4ZOVA 4L3HD 3EMHA 2EIDA 2I0RA 3ZE0A 1PEVA 1K8KC 2VDRA 3SBQA 3L4MD 3AL8B 3I7KA 4QRJA 4UI9R 3C5MA 3ODTA 4PNKB 3UKRC 5FKTA 3IVMA 3V9FA 1GOHA 4JSPC 4BCDA 5IGQA 4QT8A 4HDJA 2H13A 5A2Qg 4OZUA 3OTTA 5AFU3 3I89A 3P4FA 3V4VA 4BP8A 3OKYA 5FLXg 2OJYA 3FGBA 5EALA 2P9LC 4LG9A 4NENA 4ES0A 1O6GA 2BKLA 2H9NA 3ZDYA 3EI4B 1MG2A 5EMMB 4ERZA 5E6UA 1E5TA 4J81A 3V4PA 2CE8A 5M5VA 4TZ4A 5HE2B 2VDPA 4AN1A 2EICA 3RRMC 2J55H 4FAND 4X3EA 4BUJC 5M5TA 4A09A 4AEZA 3O4IA 1JMXB 1T2XA 2B5NA 4JHNA 2H3XA 1PI6A 3NVXA 4Z8LA 2H47A 3FCSA 2UZYB 3CFVA 4GGCA 5TDHB 2IAAA 4NBMA 2XDWA 2CO0A 1U8CA 2H9MA 3DXMC 3IURA 4IMMA 4GZ8A 2IUVA 3EQ7A 1TYQC 2H6NA 2VDMA 3EQ8A 5CXBA 3OW8A 3O4JA 4GMBA 5AJAA 5EARA 3SLED 4Z7OA 1H2WA 4H5IA 2VZ1A 4L9OA 4ERYA 3JZHA 4BH6A 2PM9B 2IUPA 3UVMA 4CI3A 1Q47A 1PBYB 2H6QA 5EM2B 2VDKA 3PXSD 3OF7A 4ZOYA 2BBKH 4AMZA 3CIKB 3BWSA 3SMRA 3JB9L 3PE7A 4GQBB 4WK0A 3I7PA 2H6KA 4J8BA 2W18A 1VZ2A 2OVPB 4ZN4A 3NVQA 4CC9A 2CN3A 4J78A 5SXMA 1MDAH 3UVLA 4CY1A
chains in the Genus database with same CATH topology
3I8EA 4MK0B 5CXCB 2P9PC 3GFCA 4I79A 4LG8A 4Y5RD 2HKMA 4E5ZB 3JAMg 2AGZA 3VGZA 5FKSA 4KFMB 4CY5A 3F3GA 2BCJB 2IURA 3DXKC 4ESGA 2HXCA 5JWZA 2GC4A 2XYIA 3MMYA 4J79A 3SN6B 4FHLA 4H5JA 5HE1B 3SJLD 3I7NA 3UVNA 5I5JA 1FWXA 3BG1A 5IGOA 1GXRA 4PBZA 2MTAH 1ERJA 4JSNC 4FA5D 4L3GD 1GP2B 2AGXA 3DSMA 3UR4A 3ORVD 2H14A 3I2NA 3I7OA 1SQJA 4A2LA 3IKOA 4U7AA 5K1CC 3EU7A 4GM3A 2AQ5A 4A0AB 2CNXA 3IIWA 2Z2PA 1GOTB 2XL2A 2I0SA 5EMKB 5H14A 3RMZD 3N0DA 2B5MA 3SWSD 3UKUC 2I3SA 3AL8A 4CZVA 2CN2A 1GG2B 1QNIA 2OIZA 3DWLC 4FA9D 5GSAA 3K26A 3RFGA 2H9LA 3EG6A 3JZNA 4J8GA 3IJ0A 5IC7A 1B9YA 5CYKB 5EMJB 4A0BB 4CY3A 4PC0A 4J0XA 3ULEC 2HESX 4K3JB 4J86A 4XYIA 4GQ1A 4JD2C 4AOWA 2CO0C 3RFHA 4A7JA 3RN1D 3EI4A 2UZXB 3MXXA 2XU7A 2J56H 3C75H 1N6DA 2Q7QA 3PVUB 2AGLA 2PM7B 2OK4A 2QXVA 4GM9A 2IWKA 5FQDA 2IUQA 1B9XA 3KRXB 3V7DB 4J73A 4EWRA 5IJ8E 1R5MA 5KDOB 3OL2B 4JSVC 3F3FA 1S4UX 3AH8B 5FKRA 2OK6A 4ERQA 3PXWD 2YMUA 4D6VA 1JOFA 3SBRA 3W15A 3PSCB 3E0CA 3B7FA 4A11B 2PM9A 3IIYA 4J84A 4N14A 5EM2A 1JMZB 1OLZA 3IJCA 1JJUB 3IJ1A 5B4WA 3F3PA 3EI3B 2AH1A 3SVWD 5IJ7E 2G9AA 3RN0D 2CE9A 4K3ID 5HQGA 1OMWB 1P22A 3EI1B 3ZWLB 2EBSA 3A0FA 2OVRB 5I5IA 5EAPA 3J81g 3KRWB 5CXCA 2I3TA 4CI2A 3UVOA 3I8CA 3V5WB 4E5ZA 3I7HA 3BG0A 3AFCA 3MZLA 3L4OD 5FA5B 4GGDA 1N6FA 4ZOXA 4QQEA 4A08B 3SXTD 4GQ2P 2HJ4A 3GREA 4E54B 2P9UC 3SCYA 4X61B 2B4EA 2YNOA 2I0TA 3EI2B 3I7LA 2QC5A 1N6EA 4CZYA 2P9KC 4NSXA 1RI6A 2YNPA 3OKWA 4XYHA 1XHMA 4J0WA 1XIPA 4L1QD 4X60B 4QL1A 1TBGA 1XKSA 2PBIB 3C9CA 3RSEC 3MKQA 4LGNA 2AH0A 3NVNA 4A0AA 3CFSB 3DM0A 2GNQA 3SFZA 3JROA 3OKYB 4PXWA 4CZXA 3VH0A 5HYNB 5C2VB 3OKTA 2OVQB 1PGUA 3PXTD 3VA6A 1U2VC 3RLMD 4O9DA 2GC7A 5H17A 2AGWA 3MKSB 5FKQA 5CYKA 4A0BA 4R7AB 5C2WB 5TEFA 4BL0A 3PVWB 1MG3A 4A09B 4O3TB 1VYHC 2P9SC 2TRCB 3JZGA 1U4CA 4JXMA 3PSLA 3SHFA 2HYEA 2Z2OA 3FM0A 4J87A 5TEEA 4O1QD 4CY2A 1SQ9A 3K27A 5CXBB 4CI1A 4J77A 2G99A 5GXIA 4O45A 3UVKA 4JT6C 3AL9A 4JSXC 4CI8A 2H68A 3OL2A 2YB8B 1YFQA 4FA1D 4GGAA 4ZOZA 4PSWB 5FXYA 4FB1D 3C99A 5TF2A 5C9ZB 1A0RB 5EAMA 4A11A 5HE0B 4FA4D 5HE3B 4JT5C 2AGYA 4GM8A 4YVDA 4G56B 4FAVD 4J82A 3SBPA 2PM6B 2H9PA 2XL3A 4IA9A 5GMKn 3EI3A 2O9KA 5EMLB 4D0KA 2YBAA 1SHYB 5I5MA 3MZKA 4Y7RA 2J57G 3N0EA 4U1EI 3EI1A 3JPXA 3HFQA 3EWEA 2HKRA 4XEIC 2P9NC 3J80g 4OWRA 5K19A 3JRPA 5THAA 1NR0A 4O3UB 5IT9g 5AMSA 4PBYA 4X63B 3FRXA 5GXHA 4FWWA 1K32A 2HJBA 2YNNA 3U4YA 4A08A 4A2MA 1L0QA 2Z2NA 4E54A 4PSXB 2P9IC 5H1MA 2IWFA 1NEXB 3EI2A 2B5LA 4ZOVA 4L3HD 3EMHA 2I0RA 1PEVA 1K8KC 3SBQA 3L4MD 3AL8B 3I7KA 4QRJA 4UI9R 3C5MA 3ODTA 4PNKB 3UKRC 5FKTA 3V9FA 4JSPC 5IGQA 4QT8A 4HDJA 2H13A 5A2Qg 4OZUA 3OTTA 5AFU3 3I89A 3P4FA 3OKYA 5FLXg 2OJYA 3FGBA 5EALA 2P9LC 4LG9A 4ES0A 2H9NA 3EI4B 1MG2A 5EMMB 4ERZA 4J81A 2CE8A 4TZ4A 5HE2B 3RRMC 2J55H 4FAND 4X3EA 4BUJC 4A09A 4AEZA 1JMXB 2B5NA 2H3XA 1PI6A 3NVXA 4Z8LA 2H47A 2UZYB 3CFVA 4GGCA 5TDHB 2IAAA 2CO0A 2H9MA 3DXMC 4IMMA 4GZ8A 2IUVA 1TYQC 2H6NA 5CXBA 3OW8A 4GMBA 5AJAA 5EARA 3SLED 4H5IA 4L9OA 4ERYA 3JZHA 4BH6A 2PM9B 2IUPA 3UVMA 4CI3A 1Q47A 1PBYB 2H6QA 5EM2B 3PXSD 4ZOYA 2BBKH 3CIKB 3BWSA 3SMRA 3JB9L 3PE7A 4GQBB 3I7PA 2H6KA 4J8BA 2W18A 2OVPB 4ZN4A 3NVQA 4CC9A 2CN3A 4J78A 5SXMA 1MDAH 3UVLA 4CY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I8E A;  4MK0 B;  5CXC B;  2P9P C;  3GFC A;  4I79 A;  4LG8 A;  4Y5R D;  2HKM A;  4E5Z B;  3JAM g;  2AGZ A;  3VGZ A;  5FKS A;  4KFM B;  4CY5 A;  3F3G A;  2BCJ B;  2IUR A;  3DXK C;  4ESG A;  2HXC A;  5JWZ A;  2GC4 A;  2XYI A;  3MMY A;  4J79 A;  3SN6 B;  4FHL A;  4H5J A;  5HE1 B;  3SJL D;  3I7N A;  3UVN A;  5I5J A;  1FWX A;  3BG1 A;  5IGO A;  1GXR A;  4PBZ A;  2MTA H;  1ERJ A;  4JSN C;  4FA5 D;  4L3G D;  1GP2 B;  2AGX A;  3DSM A;  3UR4 A;  3ORV D;  2H14 A;  3I2N A;  3I7O A;  1SQJ A;  4A2L A;  3IKO A;  4U7A A;  5K1C C;  3EU7 A;  4GM3 A;  2AQ5 A;  4A0A B;  2CNX A;  3IIW A;  2Z2P A;  1GOT B;  2XL2 A;  2I0S A;  5EMK B;  5H14 A;  3RMZ D;  3N0D A;  2B5M A;  3SWS D;  3UKU C;  2I3S A;  3AL8 A;  4CZV A;  2CN2 A;  1GG2 B;  1QNI A;  2OIZ A;  3DWL C;  4FA9 D;  5GSA A;  3K26 A;  3RFG A;  2H9L A;  3EG6 A;  3JZN A;  4J8G A;  3IJ0 A;  5IC7 A;  1B9Y A;  5CYK B;  5EMJ B;  4A0B B;  4CY3 A;  4PC0 A;  4J0X A;  3ULE C;  2HES X;  4K3J B;  4J86 A;  4XYI A;  4GQ1 A;  4JD2 C;  4AOW A;  2CO0 C;  3RFH A;  4A7J A;  3RN1 D;  3EI4 A;  2UZX B;  3MXX A;  2XU7 A;  2J56 H;  3C75 H;  1N6D A;  2Q7Q A;  3PVU B;  2AGL A;  2PM7 B;  2OK4 A;  2QXV A;  4GM9 A;  2IWK A;  5FQD A;  2IUQ A;  1B9X A;  3KRX B;  3V7D B;  4J73 A;  4EWR A;  5IJ8 E;  1R5M A;  5KDO B;  3OL2 B;  4JSV C;  3F3F A;  1S4U X;  3AH8 B;  5FKR A;  2OK6 A;  4ERQ A;  3PXW D;  2YMU A;  4D6V A;  1JOF A;  3SBR A;  3W15 A;  3PSC B;  3E0C A;  3B7F A;  4A11 B;  2PM9 A;  3IIY A;  4J84 A;  4N14 A;  5EM2 A;  1JMZ B;  1OLZ A;  3IJC A;  1JJU B;  3IJ1 A;  5B4W A;  3F3P A;  3EI3 B;  2AH1 A;  3SVW D;  5IJ7 E;  2G9A A;  3RN0 D;  2CE9 A;  4K3I D;  5HQG A;  1OMW B;  1P22 A;  3EI1 B;  3ZWL B;  2EBS A;  3A0F A;  2OVR B;  5I5I A;  5EAP A;  3J81 g;  3KRW B;  5CXC A;  2I3T A;  4CI2 A;  3UVO A;  3I8C A;  3V5W B;  4E5Z A;  3I7H A;  3BG0 A;  3AFC A;  3MZL A;  3L4O D;  5FA5 B;  4GGD A;  1N6F A;  4ZOX A;  4QQE A;  4A08 B;  3SXT D;  4GQ2 P;  2HJ4 A;  3GRE A;  4E54 B;  2P9U C;  3SCY A;  4X61 B;  2B4E A;  2YNO A;  2I0T A;  3EI2 B;  3I7L A;  2QC5 A;  1N6E A;  4CZY A;  2P9K C;  4NSX A;  1RI6 A;  2YNP A;  3OKW A;  4XYH A;  1XHM A;  4J0W A;  1XIP A;  4L1Q D;  4X60 B;  4QL1 A;  1TBG A;  1XKS A;  2PBI B;  3C9C A;  3RSE C;  3MKQ A;  4LGN A;  2AH0 A;  3NVN A;  4A0A A;  3CFS B;  3DM0 A;  2GNQ A;  3SFZ A;  3JRO A;  3OKY B;  4PXW A;  4CZX A;  3VH0 A;  5HYN B;  5C2V B;  3OKT A;  2OVQ B;  1PGU A;  3PXT D;  3VA6 A;  1U2V C;  3RLM D;  4O9D A;  2GC7 A;  5H17 A;  2AGW A;  3MKS B;  5FKQ A;  5CYK A;  4A0B A;  4R7A B;  5C2W B;  5TEF A;  4BL0 A;  3PVW B;  1MG3 A;  4A09 B;  4O3T B;  1VYH C;  2P9S C;  2TRC B;  3JZG A;  1U4C A;  4JXM A;  3PSL A;  3SHF A;  2HYE A;  2Z2O A;  3FM0 A;  4J87 A;  5TEE A;  4O1Q D;  4CY2 A;  1SQ9 A;  3K27 A;  5CXB B;  4CI1 A;  4J77 A;  2G99 A;  5GXI A;  4O45 A;  3UVK A;  4JT6 C;  3AL9 A;  4JSX C;  4CI8 A;  2H68 A;  3OL2 A;  2YB8 B;  1YFQ A;  4FA1 D;  4GGA A;  4ZOZ A;  4PSW B;  5FXY A;  4FB1 D;  3C99 A;  5TF2 A;  5C9Z B;  1A0R B;  5EAM A;  4A11 A;  5HE0 B;  4FA4 D;  5HE3 B;  4JT5 C;  2AGY A;  4GM8 A;  4YVD A;  4G56 B;  4FAV D;  4J82 A;  3SBP A;  2PM6 B;  2H9P A;  2XL3 A;  4IA9 A;  5GMK n;  3EI3 A;  2O9K A;  5EML B;  4D0K A;  2YBA A;  1SHY B;  5I5M A;  3MZK A;  4Y7R A;  2J57 G;  3N0E A;  4U1E I;  3EI1 A;  3JPX A;  3HFQ A;  3EWE A;  2HKR A;  4XEI C;  2P9N C;  3J80 g;  4OWR A;  5K19 A;  3JRP A;  5THA A;  1NR0 A;  4O3U B;  5IT9 g;  5AMS A;  4PBY A;  4X63 B;  3FRX A;  5GXH A;  4FWW A;  1K32 A;  2HJB A;  2YNN A;  3U4Y A;  4A08 A;  4A2M A;  1L0Q A;  2Z2N A;  4E54 A;  4PSX B;  2P9I C;  5H1M A;  2IWF A;  1NEX B;  3EI2 A;  2B5L A;  4ZOV A;  4L3H D;  3EMH A;  2I0R A;  1PEV A;  1K8K C;  3SBQ A;  3L4M D;  3AL8 B;  3I7K A;  4QRJ A;  4UI9 R;  3C5M A;  3ODT A;  4PNK B;  3UKR C;  5FKT A;  3V9F A;  4JSP C;  5IGQ A;  4QT8 A;  4HDJ A;  2H13 A;  5A2Q g;  4OZU A;  3OTT A;  5AFU 3;  3I89 A;  3P4F A;  3OKY A;  5FLX g;  2OJY A;  3FGB A;  5EAL A;  2P9L C;  4LG9 A;  4ES0 A;  2H9N A;  3EI4 B;  1MG2 A;  5EMM B;  4ERZ A;  4J81 A;  2CE8 A;  4TZ4 A;  5HE2 B;  3RRM C;  2J55 H;  4FAN D;  4X3E A;  4BUJ C;  4A09 A;  4AEZ A;  1JMX B;  2B5N A;  2H3X A;  1PI6 A;  3NVX A;  4Z8L A;  2H47 A;  2UZY B;  3CFV A;  4GGC A;  5TDH B;  2IAA A;  2CO0 A;  2H9M A;  3DXM C;  4IMM A;  4GZ8 A;  2IUV A;  1TYQ C;  2H6N A;  5CXB A;  3OW8 A;  4GMB A;  5AJA A;  5EAR A;  3SLE D;  4H5I A;  4L9O A;  4ERY A;  3JZH A;  4BH6 A;  2PM9 B;  2IUP A;  3UVM A;  4CI3 A;  1Q47 A;  1PBY B;  2H6Q A;  5EM2 B;  3PXS D;  4ZOY A;  2BBK H;  3CIK B;  3BWS A;  3SMR A;  3JB9 L;  3PE7 A;  4GQB B;  3I7P A;  2H6K A;  4J8B A;  2W18 A;  2OVP B;  4ZN4 A;  3NVQ A;  4CC9 A;  2CN3 A;  4J78 A;  5SXM A;  1MDA H;  3UVL A;  4CY1 A; 
#chains in the Genus database with same CATH topology
 3I8E A;  4MK0 B;  5CXC B;  2P9P C;  3GFC A;  1JV2 A;  4I79 A;  4LG8 A;  4Y5R D;  2HKM A;  4E5Z B;  3JAM g;  2AGZ A;  3VGZ A;  5FKS A;  4BCC A;  4KFM B;  4CY5 A;  3F3G A;  3O4G A;  2BCJ B;  2IUR A;  3DXK C;  4ESG A;  2HXC A;  3KCI A;  5JWZ A;  2GC4 A;  2XYI A;  3MMY A;  4J79 A;  3SN6 B;  5M5R A;  4FHL A;  4H5J A;  4Z7Q A;  5HE1 B;  3SJL D;  3I7N A;  3UVN A;  5I5J A;  1FWX A;  2JKX A;  3BG1 A;  3O4H A;  1GXR A;  5IGO A;  4PBZ A;  3IUM A;  2MTA H;  1ERJ A;  3NIG A;  4JSN C;  5E6R A;  1L5G A;  4FA5 D;  4G55 A;  4L3G D;  1GP2 B;  2AGX A;  3DSM A;  3UR4 A;  3ORV D;  1UOQ A;  2H14 A;  3I2N A;  3I7O A;  1SQJ A;  4A2L A;  3IKO A;  4U7A A;  1I2M B;  2WQ8 A;  1O6F A;  5K1C C;  3NID A;  3EU7 A;  3K6S A;  4GM3 A;  2AQ5 A;  4A0A B;  2CNX A;  3IIW A;  2Z2P A;  1GOT B;  2XL2 A;  2I0S A;  5EMK B;  5H14 A;  3RMZ D;  5C92 A;  3N0D A;  2B5M A;  3GD1 I;  3SWS D;  4DNW A;  3UKU C;  3MUO A;  2I3S A;  3AL8 A;  4CZV A;  2CN2 A;  2HU7 A;  1GG2 B;  1QNI A;  2OIZ A;  3DWL C;  4FA9 D;  5GSA A;  3K26 A;  3RFG A;  2H9L A;  3EG6 A;  3JZN A;  4J8G A;  3IJ0 A;  1K3I A;  4NAA A;  5IC7 A;  3IUL A;  1B9Y A;  1E8M A;  3FCU A;  5CYK B;  5EMJ B;  2EIB A;  3K71 A;  1UOP A;  4RE5 A;  4A0B B;  4UM8 A;  3IUN A;  4CY3 A;  4PC0 A;  4J0X A;  4MMZ A;  3ULE C;  4JHP C;  2HES X;  4K3J B;  4J86 A;  2QR5 A;  4XYI A;  4GQ1 A;  4JD2 C;  4AOW A;  2CO0 C;  3QHY B;  3RFH A;  4A7J A;  3RN1 D;  3EI4 A;  2UZX B;  4AMY A;  3MXX A;  2XU7 A;  2J56 H;  3C75 H;  1N6D A;  2Q7Q A;  3PVU B;  5M5S A;  2AGL A;  2PM7 B;  2OK4 A;  2QXV A;  4GM9 A;  2IWK A;  3ZE1 A;  5FQD A;  1C9I A;  2IUQ A;  1A12 A;  1B9X A;  3KRX B;  5HDB A;  2VDQ A;  3V7D B;  4J73 A;  4EWR A;  5IJ8 E;  1VZ3 A;  1R5M A;  5KDO B;  3OL2 B;  4JSV C;  2VC2 A;  3F3F A;  1S4U X;  3AH8 B;  1YR2 A;  5FKR A;  2OK6 A;  2HU8 A;  5FFO A;  4ERQ A;  5FFG A;  3PXW D;  4Z7N A;  4G1E A;  2YMU A;  4D6V A;  1JOF A;  3SBR A;  1JTD B;  3ZDZ A;  3W15 A;  3PSC B;  3E0C A;  3B7F A;  4A11 B;  2PM9 A;  3IIY A;  4J84 A;  4N14 A;  5EM2 A;  2VDN A;  1JMZ B;  1OLZ A;  3IJC A;  1JJU B;  3IJ1 A;  5B4W A;  3F3P A;  4WK4 A;  3T3M A;  3EI3 B;  2AH1 A;  3IUQ A;  2QZP A;  5IJ7 E;  3SVW D;  2G9A A;  3RN0 D;  2CE9 A;  4K3I D;  3DDU A;  5HQG A;  1OMW B;  1P22 A;  3NIF A;  3EI1 B;  3ZWL B;  2EBS A;  3A0F A;  2OVR B;  5I5I A;  4NC4 A;  5EAP A;  3J81 g;  3KRW B;  1H2Y A;  5CXC A;  2I3T A;  4CI2 A;  3UVO A;  3I8C A;  3V5W B;  5C86 A;  4E5Z A;  3I7H A;  3BG0 A;  3AFC A;  3MZL A;  3L4O D;  5FA5 B;  2VDL A;  4GGD A;  1N6F A;  4ZOX A;  4QQE A;  1C9L A;  4A08 B;  3SXT D;  4GQ2 P;  2HJ4 A;  3GRE A;  4E54 B;  2P9U C;  3SCY A;  4X61 B;  3EQ9 A;  2B4E A;  2YNO A;  2I0T A;  3EI2 B;  3I7L A;  2QC5 A;  1N6E A;  4RE6 A;  4CZY A;  1GOG A;  1M1X A;  2P9K C;  4L1M A;  4NSX A;  1RI6 A;  2YNP A;  3OKW A;  4BP9 A;  5M5U A;  4XYH A;  1XHM A;  3ZE2 A;  4J0W A;  1XIP A;  4L1Q D;  4X60 B;  4QL1 A;  1TBG A;  1XKS A;  2PBI B;  3C9C A;  3RSE C;  3MKQ A;  2AH0 A;  4LGN A;  3NVN A;  4A0A A;  3CFS B;  3DM0 A;  2GNQ A;  2XE4 A;  1TYE A;  4QAM A;  3SFZ A;  3IUJ A;  3JRO A;  1H2X A;  3OKY B;  4PXW A;  4CZX A;  4O02 A;  3VH0 A;  4AN0 A;  3K72 A;  5HYN B;  5C2V B;  3OKT A;  2OVQ B;  1PGU A;  3PXT D;  3VA6 A;  1U2V C;  3RLM D;  4O9D A;  2GC7 A;  5H17 A;  2AGW A;  1UOO A;  3T3P A;  4G1M A;  3MKS B;  5FKQ A;  5CYK A;  4A0B A;  4R7A B;  3VI4 A;  5C2W B;  5TEF A;  4BL0 A;  3PVW B;  1MG3 A;  3MVD K;  4O3T B;  4A09 B;  1VYH C;  2P9S C;  1BPO A;  2VZ3 A;  2TRC B;  3JZG A;  1U4C A;  4UM9 A;  4JXM A;  3QI0 A;  3VI3 A;  3PSL A;  3SHF A;  2HYE A;  2Z2O A;  5M61 A;  3FM0 A;  4J87 A;  5TEE A;  4O1Q D;  4CY2 A;  1SQ9 A;  3ZDX A;  3K27 A;  5CXB B;  4CI1 A;  4J77 A;  2G99 A;  1QFS A;  5GXI A;  4O45 A;  1QFM A;  1H2Z A;  2VDO A;  3UVK A;  4JT6 C;  3AL9 A;  4JSX C;  4CI8 A;  2H68 A;  3OL2 A;  2YB8 B;  1YFQ A;  4FA1 D;  4IRZ A;  4GGA A;  4ZOZ A;  4MMX A;  4PSW B;  3GC3 B;  5FXY A;  4FB1 D;  3C99 A;  5TF2 A;  5C9Z B;  3MUN A;  4WK2 A;  1A0R B;  4MMY A;  5EAM A;  4A11 A;  5HE0 B;  2XZG A;  3IJE A;  4FA4 D;  5HE3 B;  4JT5 C;  2AGY A;  4GM8 A;  4YVD A;  4G56 B;  4FAV D;  4J82 A;  3SBP A;  2PM6 B;  1E8N A;  2H9P A;  2XL3 A;  4IA9 A;  4DNU A;  1VE7 A;  5GMK n;  3EI3 A;  2O9K A;  5EML B;  4D0K A;  2YBA A;  4AX4 A;  4WJK A;  4DNV A;  1SHY B;  5I5M A;  3MZK A;  4Y7R A;  2J57 G;  3N0E A;  4U1E I;  3EI1 A;  3JPX A;  3HFQ A;  3EWE A;  1GOF A;  2HKR A;  2EIE A;  4XEI C;  2P9N C;  3J80 g;  4OWR A;  5K19 A;  3JRP A;  5THA A;  1NR0 A;  4O3U B;  5IT9 g;  5AMS A;  4PBY A;  1UTC A;  4BCB A;  4X63 B;  3FRX A;  5GXH A;  4FWW A;  1K32 A;  4O2W A;  2HJB A;  2YNN A;  3U4Y A;  1VE6 A;  4A08 A;  4A2M A;  1L0Q A;  2Z2N A;  4D9S A;  4E54 A;  4PSX B;  2P9I C;  5H1M A;  2IWF A;  1NEX B;  3EI2 A;  2HU5 A;  5E6S A;  2B5L A;  4ZOV A;  4L3H D;  3EMH A;  2EID A;  2I0R A;  3ZE0 A;  1PEV A;  1K8K C;  2VDR A;  3SBQ A;  3L4M D;  3AL8 B;  3I7K A;  4QRJ A;  4UI9 R;  3C5M A;  3ODT A;  4PNK B;  3UKR C;  5FKT A;  3IVM A;  3V9F A;  1GOH A;  4JSP C;  4BCD A;  5IGQ A;  4QT8 A;  4HDJ A;  2H13 A;  5A2Q g;  4OZU A;  3OTT A;  5AFU 3;  3I89 A;  3P4F A;  3V4V A;  4BP8 A;  3OKY A;  5FLX g;  2OJY A;  3FGB A;  5EAL A;  2P9L C;  4LG9 A;  4NEN A;  4ES0 A;  1O6G A;  2BKL A;  2H9N A;  3ZDY A;  3EI4 B;  1MG2 A;  5EMM B;  4ERZ A;  5E6U A;  1E5T A;  4J81 A;  3V4P A;  2CE8 A;  5M5V A;  4TZ4 A;  5HE2 B;  2VDP A;  4AN1 A;  2EIC A;  3RRM C;  2J55 H;  4FAN D;  4X3E A;  4BUJ C;  5M5T A;  4A09 A;  4AEZ A;  3O4I A;  1JMX B;  1T2X A;  2B5N A;  4JHN A;  2H3X A;  1PI6 A;  3NVX A;  4Z8L A;  2H47 A;  3FCS A;  2UZY B;  3CFV A;  4GGC A;  5TDH B;  2IAA A;  4NBM A;  2XDW A;  2CO0 A;  1U8C A;  2H9M A;  3DXM C;  3IUR A;  4IMM A;  4GZ8 A;  2IUV A;  3EQ7 A;  1TYQ C;  2H6N A;  2VDM A;  3EQ8 A;  5CXB A;  3OW8 A;  3O4J A;  4GMB A;  5AJA A;  5EAR A;  3SLE D;  4Z7O A;  1H2W A;  4H5I A;  2VZ1 A;  4L9O A;  4ERY A;  3JZH A;  4BH6 A;  2PM9 B;  2IUP A;  3UVM A;  4CI3 A;  1Q47 A;  1PBY B;  2H6Q A;  5EM2 B;  2VDK A;  3PXS D;  3OF7 A;  4ZOY A;  2BBK H;  4AMZ A;  3CIK B;  3BWS A;  3SMR A;  3JB9 L;  3PE7 A;  4GQB B;  4WK0 A;  3I7P A;  2H6K A;  4J8B A;  2W18 A;  1VZ2 A;  2OVP B;  4ZN4 A;  3NVQ A;  4CC9 A;  2CN3 A;  4J78 A;  5SXM A;  1MDA H;  3UVL A;  4CY1 A; 
#chains in the Genus database with same CATH homology
 3I8E A;  4MK0 B;  5CXC B;  2P9P C;  3GFC A;  4I79 A;  4LG8 A;  4Y5R D;  2HKM A;  4E5Z B;  3JAM g;  2AGZ A;  3VGZ A;  5FKS A;  4KFM B;  4CY5 A;  3F3G A;  2BCJ B;  2IUR A;  3DXK C;  4ESG A;  2HXC A;  5JWZ A;  2GC4 A;  2XYI A;  3MMY A;  4J79 A;  3SN6 B;  4FHL A;  4H5J A;  5HE1 B;  3SJL D;  3I7N A;  3UVN A;  5I5J A;  1FWX A;  3BG1 A;  5IGO A;  1GXR A;  4PBZ A;  2MTA H;  1ERJ A;  4JSN C;  4FA5 D;  4L3G D;  1GP2 B;  2AGX A;  3DSM A;  3UR4 A;  3ORV D;  2H14 A;  3I2N A;  3I7O A;  1SQJ A;  4A2L A;  3IKO A;  4U7A A;  5K1C C;  3EU7 A;  4GM3 A;  2AQ5 A;  4A0A B;  2CNX A;  3IIW A;  2Z2P A;  1GOT B;  2XL2 A;  2I0S A;  5EMK B;  5H14 A;  3RMZ D;  3N0D A;  2B5M A;  3SWS D;  3UKU C;  2I3S A;  3AL8 A;  4CZV A;  2CN2 A;  1GG2 B;  1QNI A;  2OIZ A;  3DWL C;  4FA9 D;  5GSA A;  3K26 A;  3RFG A;  2H9L A;  3EG6 A;  3JZN A;  4J8G A;  3IJ0 A;  5IC7 A;  1B9Y A;  5CYK B;  5EMJ B;  4A0B B;  4CY3 A;  4PC0 A;  4J0X A;  3ULE C;  2HES X;  4K3J B;  4J86 A;  4XYI A;  4GQ1 A;  4JD2 C;  4AOW A;  2CO0 C;  3RFH A;  4A7J A;  3RN1 D;  3EI4 A;  2UZX B;  3MXX A;  2XU7 A;  2J56 H;  3C75 H;  1N6D A;  2Q7Q A;  3PVU B;  2AGL A;  2PM7 B;  2OK4 A;  2QXV A;  4GM9 A;  2IWK A;  5FQD A;  2IUQ A;  1B9X A;  3KRX B;  3V7D B;  4J73 A;  4EWR A;  5IJ8 E;  1R5M A;  5KDO B;  3OL2 B;  4JSV C;  3F3F A;  1S4U X;  3AH8 B;  5FKR A;  2OK6 A;  4ERQ A;  3PXW D;  2YMU A;  4D6V A;  1JOF A;  3SBR A;  3W15 A;  3PSC B;  3E0C A;  3B7F A;  4A11 B;  2PM9 A;  3IIY A;  4J84 A;  4N14 A;  5EM2 A;  1JMZ B;  1OLZ A;  3IJC A;  1JJU B;  3IJ1 A;  5B4W A;  3F3P A;  3EI3 B;  2AH1 A;  3SVW D;  5IJ7 E;  2G9A A;  3RN0 D;  2CE9 A;  4K3I D;  5HQG A;  1OMW B;  1P22 A;  3EI1 B;  3ZWL B;  2EBS A;  3A0F A;  2OVR B;  5I5I A;  5EAP A;  3J81 g;  3KRW B;  5CXC A;  2I3T A;  4CI2 A;  3UVO A;  3I8C A;  3V5W B;  4E5Z A;  3I7H A;  3BG0 A;  3AFC A;  3MZL A;  3L4O D;  5FA5 B;  4GGD A;  1N6F A;  4ZOX A;  4QQE A;  4A08 B;  3SXT D;  4GQ2 P;  2HJ4 A;  3GRE A;  4E54 B;  2P9U C;  3SCY A;  4X61 B;  2B4E A;  2YNO A;  2I0T A;  3EI2 B;  3I7L A;  2QC5 A;  1N6E A;  4CZY A;  2P9K C;  4NSX A;  1RI6 A;  2YNP A;  3OKW A;  4XYH A;  1XHM A;  4J0W A;  1XIP A;  4L1Q D;  4X60 B;  4QL1 A;  1TBG A;  1XKS A;  2PBI B;  3C9C A;  3RSE C;  3MKQ A;  4LGN A;  2AH0 A;  3NVN A;  4A0A A;  3CFS B;  3DM0 A;  2GNQ A;  3SFZ A;  3JRO A;  3OKY B;  4PXW A;  4CZX A;  3VH0 A;  5HYN B;  5C2V B;  3OKT A;  2OVQ B;  1PGU A;  3PXT D;  3VA6 A;  1U2V C;  3RLM D;  4O9D A;  2GC7 A;  5H17 A;  2AGW A;  3MKS B;  5FKQ A;  5CYK A;  4A0B A;  4R7A B;  5C2W B;  5TEF A;  4BL0 A;  3PVW B;  1MG3 A;  4A09 B;  4O3T B;  1VYH C;  2P9S C;  2TRC B;  3JZG A;  1U4C A;  4JXM A;  3PSL A;  3SHF A;  2HYE A;  2Z2O A;  3FM0 A;  4J87 A;  5TEE A;  4O1Q D;  4CY2 A;  1SQ9 A;  3K27 A;  5CXB B;  4CI1 A;  4J77 A;  2G99 A;  5GXI A;  4O45 A;  3UVK A;  4JT6 C;  3AL9 A;  4JSX C;  4CI8 A;  2H68 A;  3OL2 A;  2YB8 B;  1YFQ A;  4FA1 D;  4GGA A;  4ZOZ A;  4PSW B;  5FXY A;  4FB1 D;  3C99 A;  5TF2 A;  5C9Z B;  1A0R B;  5EAM A;  4A11 A;  5HE0 B;  4FA4 D;  5HE3 B;  4JT5 C;  2AGY A;  4GM8 A;  4YVD A;  4G56 B;  4FAV D;  4J82 A;  3SBP A;  2PM6 B;  2H9P A;  2XL3 A;  4IA9 A;  5GMK n;  3EI3 A;  2O9K A;  5EML B;  4D0K A;  2YBA A;  1SHY B;  5I5M A;  3MZK A;  4Y7R A;  2J57 G;  3N0E A;  4U1E I;  3EI1 A;  3JPX A;  3HFQ A;  3EWE A;  2HKR A;  4XEI C;  2P9N C;  3J80 g;  4OWR A;  5K19 A;  3JRP A;  5THA A;  1NR0 A;  4O3U B;  5IT9 g;  5AMS A;  4PBY A;  4X63 B;  3FRX A;  5GXH A;  4FWW A;  1K32 A;  2HJB A;  2YNN A;  3U4Y A;  4A08 A;  4A2M A;  1L0Q A;  2Z2N A;  4E54 A;  4PSX B;  2P9I C;  5H1M A;  2IWF A;  1NEX B;  3EI2 A;  2B5L A;  4ZOV A;  4L3H D;  3EMH A;  2I0R A;  1PEV A;  1K8K C;  3SBQ A;  3L4M D;  3AL8 B;  3I7K A;  4QRJ A;  4UI9 R;  3C5M A;  3ODT A;  4PNK B;  3UKR C;  5FKT A;  3V9F A;  4JSP C;  5IGQ A;  4QT8 A;  4HDJ A;  2H13 A;  5A2Q g;  4OZU A;  3OTT A;  5AFU 3;  3I89 A;  3P4F A;  3OKY A;  5FLX g;  2OJY A;  3FGB A;  5EAL A;  2P9L C;  4LG9 A;  4ES0 A;  2H9N A;  3EI4 B;  1MG2 A;  5EMM B;  4ERZ A;  4J81 A;  2CE8 A;  4TZ4 A;  5HE2 B;  3RRM C;  2J55 H;  4FAN D;  4X3E A;  4BUJ C;  4A09 A;  4AEZ A;  1JMX B;  2B5N A;  2H3X A;  1PI6 A;  3NVX A;  4Z8L A;  2H47 A;  2UZY B;  3CFV A;  4GGC A;  5TDH B;  2IAA A;  2CO0 A;  2H9M A;  3DXM C;  4IMM A;  4GZ8 A;  2IUV A;  1TYQ C;  2H6N A;  5CXB A;  3OW8 A;  4GMB A;  5AJA A;  5EAR A;  3SLE D;  4H5I A;  4L9O A;  4ERY A;  3JZH A;  4BH6 A;  2PM9 B;  2IUP A;  3UVM A;  4CI3 A;  1Q47 A;  1PBY B;  2H6Q A;  5EM2 B;  3PXS D;  4ZOY A;  2BBK H;  3CIK B;  3BWS A;  3SMR A;  3JB9 L;  3PE7 A;  4GQB B;  3I7P A;  2H6K A;  4J8B A;  2W18 A;  2OVP B;  4ZN4 A;  3NVQ A;  4CC9 A;  2CN3 A;  4J78 A;  5SXM A;  1MDA H;  3UVL A;  4CY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...