4G56B

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
303
structure length
292
Chain Sequence
CMEVQIGAVRYRRDGALLLAASSLSSRTWGGSIWVFKDPENESLCTAGVQTEAGVTDVAWVSEKGILVASDSGAVELWLVNKFAKYEHDDIVKTLSVFSDGTQAVSGGKDFSVKVWDLSQKAVLKSYNAHSSEVNCVAACPGKDTIFLSCGEDGRILLWDTRKPKPATRIDFCASDTIPTSVTWHPEKDDTFACGDETGNVSLVNIKNPDSAQTSAVHSQNITGLAYSYHSSPFLASISEDCTVAVLDADFSEVFRDLSHRDFVTGVAWSPLDHSKFTTVGWDHKVLHHHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hsl7 protein
publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transferase
total genus 59
structure length 292
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4g56B00
5EMJB 2I0TA 4FB1D 5TDHB 3NVNA 5K1CC 3ZWLB 5HE3B 5EM2A 3E0CA 3P4FA 3OKWA 3VA6A 5AJAA 4JT6C 3I89A 2OK6A 4J73A 3ULEC 3SBPA 4GQ2P 1B9XA 4J87A 3PXWD 1NR0A 5EALA 5FKTA 2HXCA 4L3HD 3IIWA 4D6VA 4A0BA 2AH1A 4A0AB 3ODTA 2Z2PA 1GXRA 4PXWA 3EI4A 3I7PA 3OW8A 3C9CA 3I7NA 2H6NA 2W18A 4LG9A 2H68A 5HE1B 1PBYB 2IURA 2QXVA 3N0DA 3DM0A 3K27A 5FLXg 2OVPB 3SFZA 3OKTA 2H9NA 5H14A 2CE8A 3CFSB 2Q7QA 4J8BA 4CI1A 3EG6A 3JZNA 1JMZB 1MG2A 3PSCB 2Z2NA 2PM9A 3GREA 2XL3A 4MK0B 1XIPA 4CZYA 3OKYA 4I79A 4CY2A 2AH0A 3AFCA 3MZKA 4O3UB 3PE7A 2HJ4A 1L0QA 2CO0C 4J0WA 4ES0A 2AGWA 3EI1A 3OL2B 2UZYB 2UZXB 3W15A 4FA4D 1P22A 4CY3A 4J82A 4JT5C 3JB9L 3V7DB 3MZLA 3UVOA 4X63B 4L3GD 3MXXA 3RMZD 3NVXA 4JSVC 5EM2B 4D0KA 1R5MA 4E54B 3AL9A 4E5ZA 4ESGA 3EI2B 5CXCA 3N0EA 5SXMA 3J80g 2PBIB 4ZOVA 3SHFA 3DXMC 5IJ7E 3PVUB 3OTTA 2HYEA 4EWRA 3I8CA 3PXTD 3I7KA 1OMWB 4A0BB 2OJYA 3MKQA 2O9KA 3JROA 3DWLC 3EI4B 4XYHA 4H5JA 3F3GA 4U7AA 4PSWB 2AGZA 5C9ZB 4QRJA 2YNOA 1FWXA 2HJBA 4J77A 5EAMA 1SHYB 2IUVA 4OZUA 5AFU3 3I7HA 4IA9A 5C2WB 3A0FA 2TRCB 4J84A 2H9MA 4FA9D 4U1EI 4A2LA 3RRMC 3JZHA 5TEFA 4ERYA 4ZN4A 2PM9B 4ERZA 3GFCA 2PM7B 2AGLA 5THAA 4CZVA 3K26A 4L9OA 2B5MA 4QQEA 5HYNB 2YMUA 2OVQB 4GQBB 3JAMg 5CYKA 4JD2C 3IKOA 4PBZA 3EI1B 4FA5D 4IMMA 3B7FA 4PNKB 3AL8B 5CXBB 3UKRC 4A11B 4AEZA 2H14A 2YBAA 5GXIA 3SN6B 2H9PA 3RN1D 4O45A 1MDAH 2YNNA 3C99A 1K32A 4O3TB 3IJCA 2P9UC 4PC0A 4X3EA 4Z8LA 3I7OA 3UVMA 4CY1A 4CI8A 4CI2A 1U4CA 2OVRB 3RFHA 1N6EA 3L4MD 5GSAA 4J86A 3EU7A 4ZOXA 3UVLA 5FKSA 4NSXA 2QC5A 4QT8A 2P9NC 3SCYA 2P9PC 4FAND 4A09B 2BCJB 4AOWA 2OIZA 5IC7A 1K8KC 3F3FA 3IJ0A 2IAAA 3VGZA 1MG3A 5B4WA 3SJLD 3UKUC 3AH8B 1OLZA 2IUPA 4JSNC 1JMXB 4GM9A 5I5MA 1SQJA 4ZOZA 5C2VB 3MMYA 3FRXA 4A0AA 3CIKB 4H5IA 4GM8A 1S4UX 4BL0A 2IUQA 4GGAA 4R7AB 4O1QD 2IWKA 2CN2A 2H3XA 3KRXB 5FA5B 1TBGA 3L4OD 4PBYA 3IJ1A 3I7LA 3I8EA 1PGUA 3VH0A 1PI6A 1QNIA 5EMMB 3ORVD 1JOFA 1PEVA 4CC9A 4J0XA 3BG1A 3SXTD 3IIYA 3SVWD 3EWEA 3V5WB 3KRWB 4GMBA 1GG2B 1TYQC 2GC7A 3PXSD 4Y7RA 5H1MA 1Q47A 4CI3A 4O9DA 2H13A 5TF2A 2Z2OA 2AGYA 2GNQA 3OKYB 2I3SA 2XU7A 5FKQA 1RI6A 2HESX 2MTAH 2H6KA 4A7JA 5GMKn 2H47A 3HFQA 5FQDA 5H17A 1YFQA 2J56H 1JJUB 4X60B 4GGDA 5A2Qg 3C5MA 4E54A 1SQ9A 3EI2A 2P9LC 4FAVD 4J79A 3FGBA 4J8GA 3SWSD 4GM3A 2GC4A 1U2VC 4A08A 5HE0B 3SBQA 4E5ZB 4YVDA 2YNPA 3C75H 3JRPA 5CXCB 3SLED 3EI3A 3U4YA 2AQ5A 3RLMD 1A0RB 2H9LA 2CE9A 1XHMA 4Y5RD 4OWRA 2PM6B 4FWWA 2P9IC 5EARA 2AGXA 4BH6A 2G9AA 2P9SC 3UR4A 5FXYA 5IGOA 4GGCA 4QL1A 1GP2B 3FM0A 5IGQA 5AMSA 4LGNA 3DSMA 2HKRA 1VYHC 2XYIA 2B4EA 5I5JA 5GXHA 3PSLA 5HQGA 3RSEC 4A2MA 2CNXA 2IWFA 1XKSA 4XYIA 1B9YA 5EMKB 4GZ8A 4J81A 3BG0A 2B5NA 4FA1D 2I0RA 4FHLA 3AL8A 4XEIC 5CXBA 4UI9R 3BWSA 2XL2A 4A11A 2OK4A 5CYKB 5EAPA 3PVWB 2CO0A 4JSPC 3EMHA 4K3JB 4CZXA 3V9FA 3RN0D 3J81g 2BBKH 4N14A 5HE2B 2HKMA 4HDJA 3UVNA 3SMRA 2G99A 2YB8B 2I3TA 2CN3A 3I2NA 3JZGA 1ERJA 4JSXC 1N6FA 3NVQA 4K3ID 4BUJC 2B5LA 4CY5A 2J57G 4G56B 3SBRA 3JPXA 4A08B 4ZOYA 4X61B 4GQ1A 3F3PA 5KDOB 3DXKC 2P9KC 4J78A 5K19A 5TEEA 5JWZA 4LG8A 3OL2A 4KFMB 4L1QD 3UVKA 3CFVA 3EI3B 4PSXB 3RFGA 1N6DA 2H6QA 4TZ4A 3MKSB 4ERQA 1NEXB 5IJ8E 4A09A 2EBSA 5FKRA 1GOTB 5IT9g 4JXMA 5I5IA 2J55H 2I0SA 5EMLB
chains in the Genus database with same CATH superfamily
1A12A 5EMJB 3EQ7A 2I0TA 4FB1D 5TDHB 3NVNA 3ZDZA 5K1CC 3ZWLB 5HE3B 5EM2A 3E0CA 3P4FA 3OKWA 1E8NA 3VA6A 5AJAA 4JT6C 2VDKA 3ZE2A 3I89A 2OK6A 4J73A 3ULEC 3SBPA 4GQ2P 1B9XA 5M5RA 4J87A 3PXWD 4NAAA 1NR0A 5EALA 5FKTA 2HXCA 4L3HD 3IIWA 4D6VA 4A0BA 2AH1A 1QFSA 4A0AB 3ODTA 1E5TA 2Z2PA 4G55A 1GXRA 4PXWA 3EI4A 4BCDA 3I7PA 3OW8A 3C9CA 3I7NA 3ZE1A 2H6NA 2W18A 4Z7QA 4LG9A 2H68A 5HE1B 1PBYB 4BP8A 2IURA 2QXVA 2BKLA 3N0DA 3DM0A 3K27A 1K3IA 5FLXg 2OVPB 3SFZA 3OKTA 1BPOA 2H9NA 5H14A 2VDLA 2CE8A 3CFSB 3EQ8A 1VE7A 4WJKA 2Q7QA 4J8BA 4CI1A 2HU7A 3EG6A 3JZNA 1JMZB 1MG2A 3PSCB 2Z2NA 2PM9A 3GREA 2XL3A 4MK0B 1XIPA 4CZYA 3OKYA 4I79A 4CY2A 2AH0A 3AFCA 4DNWA 3MZKA 4O3UB 3PE7A 2HJ4A 1L0QA 1YR2A 2CO0C 4J0WA 3K6SA 5E6RA 4ES0A 2AGWA 4D9SA 3EI1A 3OL2B 2UZYB 5M5TA 2UZXB 5FFOA 2XZGA 1VZ2A 3W15A 4FA4D 3O4HA 1P22A 4G1MA 4CY3A 4J82A 4JT5C 3JB9L 3ZE0A 3V7DB 3K72A 3MZLA 3UVOA 4X63B 4L3GD 3MXXA 3RMZD 1VE6A 3NIFA 3NVXA 2VDOA 4JSVC 5EM2B 4D0KA 4IRZA 3IUJA 3QHYB 1R5MA 4E54B 3AL9A 4E5ZA 4ESGA 3EI2B 5CXCA 3N0EA 5SXMA 3J80g 2PBIB 4ZOVA 3SHFA 3DXMC 4AX4A 5IJ7E 3PVUB 3OTTA 2HYEA 4EWRA 3I8CA 3PXTD 3I7KA 4NENA 1OMWB 4A0BB 2OJYA 3MKQA 3O4GA 2O9KA 3JROA 3DWLC 3EI4B 4XYHA 4H5JA 3F3GA 4U7AA 4PSWB 2AGZA 5C9ZB 3IUQA 4MMYA 4QRJA 2YNOA 1FWXA 2HJBA 4J77A 5EAMA 4AMZA 1SHYB 2VZ1A 2VZ3A 2IUVA 4OZUA 3IUMA 5AFU3 3I7HA 2VDNA 4IA9A 4G1EA 1GOFA 4NBMA 5M5UA 3VI3A 5C2WB 3A0FA 2TRCB 4J84A 2H9MA 4FA9D 4U1EI 4A2LA 3RRMC 3JZHA 1GOGA 5TEFA 4ERYA 4ZN4A 2PM9B 4ERZA 3GFCA 2PM7B 2AGLA 5THAA 4CZVA 3K26A 4L9OA 2B5MA 4QQEA 5HYNB 2YMUA 4Z7NA 2OVQB 4GQBB 3JAMg 5CYKA 4JD2C 3IKOA 4PBZA 3EI1B 4FA5D 4IMMA 3B7FA 4PNKB 3AL8B 5CXBB 3UKRC 3V4VA 5E6UA 4A11B 4AEZA 2H14A 2YBAA 4DNVA 5GXIA 1M1XA 3SN6B 2QR5A 2H9PA 3RN1D 4WK4A 1H2YA 4O45A 1MDAH 2YNNA 3C99A 1K32A 4L1MA 4O3TB 3IJCA 2P9UC 1VZ3A 4PC0A 4X3EA 4Z8LA 3I7OA 4QAMA 4JHPC 3UVMA 4CY1A 2VC2A 4CI8A 2VDRA 4CI2A 1U4CA 2OVRB 3RFHA 1N6EA 3L4MD 5FFGA 5GSAA 4J86A 3EU7A 4ZOXA 3UVLA 5FKSA 1TYEA 4NSXA 2QC5A 4QT8A 2P9NC 3SCYA 2P9PC 4FAND 4A09B 2BCJB 4AOWA 2OIZA 5IC7A 1K8KC 2JKXA 3F3FA 3IJ0A 2IAAA 5M5SA 3MVDK 3VGZA 1UOQA 1MG3A 5B4WA 1H2XA 3SJLD 1H2ZA 3UKUC 3AH8B 1OLZA 2IUPA 4JSNC 1JMXB 4GM9A 5I5MA 2EICA 1SQJA 4ZOZA 5C2VB 3MMYA 1I2MB 3FRXA 4A0AA 3CIKB 4H5IA 4GM8A 1S4UX 4RE5A 4BL0A 2IUQA 4GGAA 4R7AB 3FCSA 4O1QD 2IWKA 2CN2A 5M61A 4O2WA 4AN0A 2H3XA 4WK0A 3QI0A 1U8CA 3K71A 3KRXB 5FA5B 1TBGA 3L4OD 4PBYA 3IJ1A 3I7LA 3I8EA 1PGUA 2EIEA 3VH0A 1PI6A 1QNIA 5EMMB 3MUNA 3ORVD 1JOFA 1PEVA 4CC9A 4J0XA 3BG1A 3SXTD 4MMXA 3IIYA 3NIDA 3SVWD 3EWEA 3V5WB 3KRWB 4GMBA 1GG2B 1TYQC 2GC7A 3PXSD 4Y7RA 5H1MA 1Q47A 4CI3A 1UTCA 2XDWA 4O9DA 2H13A 5TF2A 2Z2OA 3IVMA 2AGYA 2GNQA 3OKYB 3O4IA 2I3SA 2XU7A 5FKQA 1RI6A 4Z7OA 2HESX 3MUOA 2MTAH 2H6KA 4A7JA 5GMKn 2H47A 3HFQA 5FQDA 5H17A 1YFQA 2J56H 4NC4A 1JJUB 4X60B 1O6FA 4GGDA 5A2Qg 3C5MA 4E54A 3IUNA 2HU5A 4O02A 1SQ9A 3EI2A 2P9LC 4FAVD 5C92A 4J79A 3FGBA 4J8GA 3SWSD 1UOPA 2VDMA 3O4JA 4GM3A 2GC4A 1U2VC 5C86A 4A08A 5HE0B 3OF7A 4AN1A 2VDPA 3SBQA 4BCCA 5M5VA 4E5ZB 4YVDA 2YNPA 3C75H 3JRPA 5CXCB 3SLED 3EI3A 3U4YA 2AQ5A 3RLMD 1A0RB 4DNUA 2H9LA 2CE9A 1XHMA 4Y5RD 4OWRA 3EQ9A 2PM6B 4FWWA 2P9IC 5EARA 3VI4A 2AGXA 4BH6A 2G9AA 2P9SC 3UR4A 5FXYA 3V4PA 1JV2A 5IGOA 3IURA 4GGCA 2EIBA 4BCBA 3IJEA 4UM8A 1GOHA 4QL1A 1GP2B 3FM0A 5IGQA 5AMSA 4LGNA 1L5GA 3DSMA 2HKRA 1VYHC 2EIDA 2XYIA 2B4EA 3DDUA 4JHNA 5I5JA 5GXHA 3PSLA 5HQGA 3RSEC 4A2MA 2CNXA 2IWFA 1XKSA 2XE4A 3KCIA 4XYIA 1B9YA 5EMKB 3GD1I 4GZ8A 4J81A 3BG0A 2B5NA 3T3MA 4UM9A 4FA1D 2I0RA 4FHLA 3AL8A 4XEIC 5CXBA 4UI9R 1E8MA 3BWSA 2XL2A 3IULA 1C9IA 1UOOA 4A11A 3ZDXA 2OK4A 5CYKB 5EAPA 3PVWB 5HDBA 2CO0A 4JSPC 3EMHA 4K3JB 4CZXA 3FCUA 1H2WA 1JTDB 3V9FA 3RN0D 4BP9A 3J81g 3NIGA 2BBKH 1O6GA 4N14A 5HE2B 2HKMA 4HDJA 3UVNA 1QFMA 3SMRA 3T3PA 3ZDYA 2G99A 2YB8B 4MMZA 2I3TA 2CN3A 3I2NA 3JZGA 1ERJA 4JSXC 1N6FA 3NVQA 4K3ID 4BUJC 2B5LA 4CY5A 2J57G 4G56B 3SBRA 3JPXA 2QZPA 4A08B 2VDQA 4ZOYA 4X61B 4GQ1A 3F3PA 4RE6A 5KDOB 3DXKC 2P9KC 4J78A 5K19A 4AMYA 5TEEA 5JWZA 4LG8A 3OL2A 4KFMB 4L1QD 5E6SA 3UVKA 1C9LA 3CFVA 3EI3B 4PSXB 3RFGA 1N6DA 2H6QA 4TZ4A 3MKSB 4ERQA 1NEXB 5IJ8E 3GC3B 4A09A 2HU8A 1T2XA 2EBSA 5FKRA 4WK2A 1GOTB 5IT9g 4JXMA 5I5IA 2J55H 2I0SA 5EMLB 2WQ8A
chains in the Genus database with same CATH topology
5EMJB 2I0TA 4FB1D 5TDHB 3NVNA 5K1CC 3ZWLB 5HE3B 5EM2A 3E0CA 3P4FA 3OKWA 3VA6A 5AJAA 4JT6C 3I89A 2OK6A 4J73A 3ULEC 3SBPA 4GQ2P 1B9XA 4J87A 3PXWD 1NR0A 5EALA 5FKTA 2HXCA 4L3HD 3IIWA 4D6VA 4A0BA 2AH1A 4A0AB 3ODTA 2Z2PA 1GXRA 4PXWA 3EI4A 3I7PA 3OW8A 3C9CA 3I7NA 2H6NA 2W18A 4LG9A 2H68A 5HE1B 1PBYB 2IURA 2QXVA 3N0DA 3DM0A 3K27A 5FLXg 2OVPB 3SFZA 3OKTA 2H9NA 5H14A 2CE8A 3CFSB 2Q7QA 4J8BA 4CI1A 3EG6A 3JZNA 1JMZB 1MG2A 3PSCB 2Z2NA 2PM9A 3GREA 2XL3A 4MK0B 1XIPA 4CZYA 3OKYA 4I79A 4CY2A 2AH0A 3AFCA 3MZKA 4O3UB 3PE7A 2HJ4A 1L0QA 2CO0C 4J0WA 4ES0A 2AGWA 3EI1A 3OL2B 2UZYB 2UZXB 3W15A 4FA4D 1P22A 4CY3A 4J82A 4JT5C 3JB9L 3V7DB 3MZLA 3UVOA 4X63B 4L3GD 3MXXA 3RMZD 3NVXA 4JSVC 5EM2B 4D0KA 1R5MA 4E54B 3AL9A 4E5ZA 4ESGA 3EI2B 5CXCA 3N0EA 5SXMA 3J80g 2PBIB 4ZOVA 3SHFA 3DXMC 5IJ7E 3PVUB 3OTTA 2HYEA 4EWRA 3I8CA 3PXTD 3I7KA 1OMWB 4A0BB 2OJYA 3MKQA 2O9KA 3JROA 3DWLC 3EI4B 4XYHA 4H5JA 3F3GA 4U7AA 4PSWB 2AGZA 5C9ZB 4QRJA 2YNOA 1FWXA 2HJBA 4J77A 5EAMA 1SHYB 2IUVA 4OZUA 5AFU3 3I7HA 4IA9A 5C2WB 3A0FA 2TRCB 4J84A 2H9MA 4FA9D 4U1EI 4A2LA 3RRMC 3JZHA 5TEFA 4ERYA 4ZN4A 2PM9B 4ERZA 3GFCA 2PM7B 2AGLA 5THAA 4CZVA 3K26A 4L9OA 2B5MA 4QQEA 5HYNB 2YMUA 2OVQB 4GQBB 3JAMg 5CYKA 4JD2C 3IKOA 4PBZA 3EI1B 4FA5D 4IMMA 3B7FA 4PNKB 3AL8B 5CXBB 3UKRC 4A11B 4AEZA 2H14A 2YBAA 5GXIA 3SN6B 2H9PA 3RN1D 4O45A 1MDAH 2YNNA 3C99A 1K32A 4O3TB 3IJCA 2P9UC 4PC0A 4X3EA 4Z8LA 3I7OA 3UVMA 4CY1A 4CI8A 4CI2A 1U4CA 2OVRB 3RFHA 1N6EA 3L4MD 5GSAA 4J86A 3EU7A 4ZOXA 3UVLA 5FKSA 4NSXA 2QC5A 4QT8A 2P9NC 3SCYA 2P9PC 4FAND 4A09B 2BCJB 4AOWA 2OIZA 5IC7A 1K8KC 3F3FA 3IJ0A 2IAAA 3VGZA 1MG3A 5B4WA 3SJLD 3UKUC 3AH8B 1OLZA 2IUPA 4JSNC 1JMXB 4GM9A 5I5MA 1SQJA 4ZOZA 5C2VB 3MMYA 3FRXA 4A0AA 3CIKB 4H5IA 4GM8A 1S4UX 4BL0A 2IUQA 4GGAA 4R7AB 4O1QD 2IWKA 2CN2A 2H3XA 3KRXB 5FA5B 1TBGA 3L4OD 4PBYA 3IJ1A 3I7LA 3I8EA 1PGUA 3VH0A 1PI6A 1QNIA 5EMMB 3ORVD 1JOFA 1PEVA 4CC9A 4J0XA 3BG1A 3SXTD 3IIYA 3SVWD 3EWEA 3V5WB 3KRWB 4GMBA 1GG2B 1TYQC 2GC7A 3PXSD 4Y7RA 5H1MA 1Q47A 4CI3A 4O9DA 2H13A 5TF2A 2Z2OA 2AGYA 2GNQA 3OKYB 2I3SA 2XU7A 5FKQA 1RI6A 2HESX 2MTAH 2H6KA 4A7JA 5GMKn 2H47A 3HFQA 5FQDA 5H17A 1YFQA 2J56H 1JJUB 4X60B 4GGDA 5A2Qg 3C5MA 4E54A 1SQ9A 3EI2A 2P9LC 4FAVD 4J79A 3FGBA 4J8GA 3SWSD 4GM3A 2GC4A 1U2VC 4A08A 5HE0B 3SBQA 4E5ZB 4YVDA 2YNPA 3C75H 3JRPA 5CXCB 3SLED 3EI3A 3U4YA 2AQ5A 3RLMD 1A0RB 2H9LA 2CE9A 1XHMA 4Y5RD 4OWRA 2PM6B 4FWWA 2P9IC 5EARA 2AGXA 4BH6A 2G9AA 2P9SC 3UR4A 5FXYA 5IGOA 4GGCA 4QL1A 1GP2B 3FM0A 5IGQA 5AMSA 4LGNA 3DSMA 2HKRA 1VYHC 2XYIA 2B4EA 5I5JA 5GXHA 3PSLA 5HQGA 3RSEC 4A2MA 2CNXA 2IWFA 1XKSA 4XYIA 1B9YA 5EMKB 4GZ8A 4J81A 3BG0A 2B5NA 4FA1D 2I0RA 4FHLA 3AL8A 4XEIC 5CXBA 4UI9R 3BWSA 2XL2A 4A11A 2OK4A 5CYKB 5EAPA 3PVWB 2CO0A 4JSPC 3EMHA 4K3JB 4CZXA 3V9FA 3RN0D 3J81g 2BBKH 4N14A 5HE2B 2HKMA 4HDJA 3UVNA 3SMRA 2G99A 2YB8B 2I3TA 2CN3A 3I2NA 3JZGA 1ERJA 4JSXC 1N6FA 3NVQA 4K3ID 4BUJC 2B5LA 4CY5A 2J57G 4G56B 3SBRA 3JPXA 4A08B 4ZOYA 4X61B 4GQ1A 3F3PA 5KDOB 3DXKC 2P9KC 4J78A 5K19A 5TEEA 5JWZA 4LG8A 3OL2A 4KFMB 4L1QD 3UVKA 3CFVA 3EI3B 4PSXB 3RFGA 1N6DA 2H6QA 4TZ4A 3MKSB 4ERQA 1NEXB 5IJ8E 4A09A 2EBSA 5FKRA 1GOTB 5IT9g 4JXMA 5I5IA 2J55H 2I0SA 5EMLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EMJ B;  2I0T A;  4FB1 D;  5TDH B;  3NVN A;  5K1C C;  3ZWL B;  5HE3 B;  5EM2 A;  3E0C A;  3P4F A;  3OKW A;  3VA6 A;  5AJA A;  4JT6 C;  3I89 A;  2OK6 A;  4J73 A;  3ULE C;  3SBP A;  4GQ2 P;  1B9X A;  4J87 A;  3PXW D;  1NR0 A;  5EAL A;  5FKT A;  2HXC A;  4L3H D;  3IIW A;  4D6V A;  4A0B A;  2AH1 A;  4A0A B;  3ODT A;  2Z2P A;  1GXR A;  4PXW A;  3EI4 A;  3I7P A;  3OW8 A;  3C9C A;  3I7N A;  2H6N A;  2W18 A;  4LG9 A;  2H68 A;  5HE1 B;  1PBY B;  2IUR A;  2QXV A;  3N0D A;  3DM0 A;  3K27 A;  5FLX g;  2OVP B;  3SFZ A;  3OKT A;  2H9N A;  5H14 A;  2CE8 A;  3CFS B;  2Q7Q A;  4J8B A;  4CI1 A;  3EG6 A;  3JZN A;  1JMZ B;  1MG2 A;  3PSC B;  2Z2N A;  2PM9 A;  3GRE A;  2XL3 A;  4MK0 B;  1XIP A;  4CZY A;  3OKY A;  4I79 A;  4CY2 A;  2AH0 A;  3AFC A;  3MZK A;  4O3U B;  3PE7 A;  2HJ4 A;  1L0Q A;  2CO0 C;  4J0W A;  4ES0 A;  2AGW A;  3EI1 A;  3OL2 B;  2UZY B;  2UZX B;  3W15 A;  4FA4 D;  1P22 A;  4CY3 A;  4J82 A;  4JT5 C;  3JB9 L;  3V7D B;  3MZL A;  3UVO A;  4X63 B;  4L3G D;  3MXX A;  3RMZ D;  3NVX A;  4JSV C;  5EM2 B;  4D0K A;  1R5M A;  4E54 B;  3AL9 A;  4E5Z A;  4ESG A;  3EI2 B;  5CXC A;  3N0E A;  5SXM A;  3J80 g;  2PBI B;  4ZOV A;  3SHF A;  3DXM C;  5IJ7 E;  3PVU B;  3OTT A;  2HYE A;  4EWR A;  3I8C A;  3PXT D;  3I7K A;  1OMW B;  4A0B B;  2OJY A;  3MKQ A;  2O9K A;  3JRO A;  3DWL C;  3EI4 B;  4XYH A;  4H5J A;  3F3G A;  4U7A A;  4PSW B;  2AGZ A;  5C9Z B;  4QRJ A;  2YNO A;  1FWX A;  2HJB A;  4J77 A;  5EAM A;  1SHY B;  2IUV A;  4OZU A;  5AFU 3;  3I7H A;  4IA9 A;  5C2W B;  3A0F A;  2TRC B;  4J84 A;  2H9M A;  4FA9 D;  4U1E I;  4A2L A;  3RRM C;  3JZH A;  5TEF A;  4ERY A;  4ZN4 A;  2PM9 B;  4ERZ A;  3GFC A;  2PM7 B;  2AGL A;  5THA A;  4CZV A;  3K26 A;  4L9O A;  2B5M A;  4QQE A;  5HYN B;  2YMU A;  2OVQ B;  4GQB B;  3JAM g;  5CYK A;  4JD2 C;  3IKO A;  4PBZ A;  3EI1 B;  4FA5 D;  4IMM A;  3B7F A;  4PNK B;  3AL8 B;  5CXB B;  3UKR C;  4A11 B;  4AEZ A;  2H14 A;  2YBA A;  5GXI A;  3SN6 B;  2H9P A;  3RN1 D;  4O45 A;  1MDA H;  2YNN A;  3C99 A;  1K32 A;  4O3T B;  3IJC A;  2P9U C;  4PC0 A;  4X3E A;  4Z8L A;  3I7O A;  3UVM A;  4CY1 A;  4CI8 A;  4CI2 A;  1U4C A;  2OVR B;  3RFH A;  1N6E A;  3L4M D;  5GSA A;  4J86 A;  3EU7 A;  4ZOX A;  3UVL A;  5FKS A;  4NSX A;  2QC5 A;  4QT8 A;  2P9N C;  3SCY A;  2P9P C;  4FAN D;  4A09 B;  2BCJ B;  4AOW A;  2OIZ A;  5IC7 A;  1K8K C;  3F3F A;  3IJ0 A;  2IAA A;  3VGZ A;  1MG3 A;  5B4W A;  3SJL D;  3UKU C;  3AH8 B;  1OLZ A;  2IUP A;  4JSN C;  1JMX B;  4GM9 A;  5I5M A;  1SQJ A;  4ZOZ A;  5C2V B;  3MMY A;  3FRX A;  4A0A A;  3CIK B;  4H5I A;  4GM8 A;  1S4U X;  4BL0 A;  2IUQ A;  4GGA A;  4R7A B;  4O1Q D;  2IWK A;  2CN2 A;  2H3X A;  3KRX B;  5FA5 B;  1TBG A;  3L4O D;  4PBY A;  3IJ1 A;  3I7L A;  3I8E A;  1PGU A;  3VH0 A;  1PI6 A;  1QNI A;  5EMM B;  3ORV D;  1JOF A;  1PEV A;  4CC9 A;  4J0X A;  3BG1 A;  3SXT D;  3IIY A;  3SVW D;  3EWE A;  3V5W B;  3KRW B;  4GMB A;  1GG2 B;  1TYQ C;  2GC7 A;  3PXS D;  4Y7R A;  5H1M A;  1Q47 A;  4CI3 A;  4O9D A;  2H13 A;  5TF2 A;  2Z2O A;  2AGY A;  2GNQ A;  3OKY B;  2I3S A;  2XU7 A;  5FKQ A;  1RI6 A;  2HES X;  2MTA H;  2H6K A;  4A7J A;  5GMK n;  2H47 A;  3HFQ A;  5FQD A;  5H17 A;  1YFQ A;  2J56 H;  1JJU B;  4X60 B;  4GGD A;  5A2Q g;  3C5M A;  4E54 A;  1SQ9 A;  3EI2 A;  2P9L C;  4FAV D;  4J79 A;  3FGB A;  4J8G A;  3SWS D;  4GM3 A;  2GC4 A;  1U2V C;  4A08 A;  5HE0 B;  3SBQ A;  4E5Z B;  4YVD A;  2YNP A;  3C75 H;  3JRP A;  5CXC B;  3SLE D;  3EI3 A;  3U4Y A;  2AQ5 A;  3RLM D;  1A0R B;  2H9L A;  2CE9 A;  1XHM A;  4Y5R D;  4OWR A;  2PM6 B;  4FWW A;  2P9I C;  5EAR A;  2AGX A;  4BH6 A;  2G9A A;  2P9S C;  3UR4 A;  5FXY A;  5IGO A;  4GGC A;  4QL1 A;  1GP2 B;  3FM0 A;  5IGQ A;  5AMS A;  4LGN A;  3DSM A;  2HKR A;  1VYH C;  2XYI A;  2B4E A;  5I5J A;  5GXH A;  3PSL A;  5HQG A;  3RSE C;  4A2M A;  2CNX A;  2IWF A;  1XKS A;  4XYI A;  1B9Y A;  5EMK B;  4GZ8 A;  4J81 A;  3BG0 A;  2B5N A;  4FA1 D;  2I0R A;  4FHL A;  3AL8 A;  4XEI C;  5CXB A;  4UI9 R;  3BWS A;  2XL2 A;  4A11 A;  2OK4 A;  5CYK B;  5EAP A;  3PVW B;  2CO0 A;  4JSP C;  3EMH A;  4K3J B;  4CZX A;  3V9F A;  3RN0 D;  3J81 g;  2BBK H;  4N14 A;  5HE2 B;  2HKM A;  4HDJ A;  3UVN A;  3SMR A;  2G99 A;  2YB8 B;  2I3T A;  2CN3 A;  3I2N A;  3JZG A;  1ERJ A;  4JSX C;  1N6F A;  3NVQ A;  4K3I D;  4BUJ C;  2B5L A;  4CY5 A;  2J57 G;  4G56 B;  3SBR A;  3JPX A;  4A08 B;  4ZOY A;  4X61 B;  4GQ1 A;  3F3P A;  5KDO B;  3DXK C;  2P9K C;  4J78 A;  5K19 A;  5TEE A;  5JWZ A;  4LG8 A;  3OL2 A;  4KFM B;  4L1Q D;  3UVK A;  3CFV A;  3EI3 B;  4PSX B;  3RFG A;  1N6D A;  2H6Q A;  4TZ4 A;  3MKS B;  4ERQ A;  1NEX B;  5IJ8 E;  4A09 A;  2EBS A;  5FKR A;  1GOT B;  5IT9 g;  4JXM A;  5I5I A;  2J55 H;  2I0S A;  5EML B; 
#chains in the Genus database with same CATH topology
 1A12 A;  5EMJ B;  3EQ7 A;  2I0T A;  4FB1 D;  5TDH B;  3NVN A;  3ZDZ A;  5K1C C;  3ZWL B;  5HE3 B;  5EM2 A;  3E0C A;  3P4F A;  3OKW A;  1E8N A;  3VA6 A;  5AJA A;  4JT6 C;  2VDK A;  3ZE2 A;  3I89 A;  2OK6 A;  4J73 A;  3ULE C;  3SBP A;  4GQ2 P;  1B9X A;  5M5R A;  4J87 A;  3PXW D;  4NAA A;  1NR0 A;  5EAL A;  5FKT A;  2HXC A;  4L3H D;  3IIW A;  4D6V A;  4A0B A;  2AH1 A;  1QFS A;  4A0A B;  3ODT A;  1E5T A;  2Z2P A;  4G55 A;  1GXR A;  4PXW A;  3EI4 A;  4BCD A;  3I7P A;  3OW8 A;  3C9C A;  3I7N A;  3ZE1 A;  2H6N A;  2W18 A;  4Z7Q A;  4LG9 A;  2H68 A;  5HE1 B;  1PBY B;  4BP8 A;  2IUR A;  2QXV A;  2BKL A;  3N0D A;  3DM0 A;  3K27 A;  1K3I A;  5FLX g;  2OVP B;  3SFZ A;  3OKT A;  1BPO A;  2H9N A;  5H14 A;  2VDL A;  2CE8 A;  3CFS B;  3EQ8 A;  1VE7 A;  4WJK A;  2Q7Q A;  4J8B A;  4CI1 A;  2HU7 A;  3EG6 A;  3JZN A;  1JMZ B;  1MG2 A;  3PSC B;  2Z2N A;  2PM9 A;  3GRE A;  2XL3 A;  4MK0 B;  1XIP A;  4CZY A;  3OKY A;  4I79 A;  4CY2 A;  2AH0 A;  3AFC A;  4DNW A;  3MZK A;  4O3U B;  3PE7 A;  2HJ4 A;  1L0Q A;  1YR2 A;  2CO0 C;  4J0W A;  3K6S A;  5E6R A;  4ES0 A;  2AGW A;  4D9S A;  3EI1 A;  3OL2 B;  2UZY B;  5M5T A;  2UZX B;  5FFO A;  2XZG A;  1VZ2 A;  3W15 A;  4FA4 D;  3O4H A;  1P22 A;  4G1M A;  4CY3 A;  4J82 A;  4JT5 C;  3JB9 L;  3ZE0 A;  3V7D B;  3K72 A;  3MZL A;  3UVO A;  4X63 B;  4L3G D;  3MXX A;  3RMZ D;  1VE6 A;  3NIF A;  3NVX A;  2VDO A;  4JSV C;  5EM2 B;  4D0K A;  4IRZ A;  3IUJ A;  3QHY B;  1R5M A;  4E54 B;  3AL9 A;  4E5Z A;  4ESG A;  3EI2 B;  5CXC A;  3N0E A;  5SXM A;  3J80 g;  2PBI B;  4ZOV A;  3SHF A;  3DXM C;  4AX4 A;  5IJ7 E;  3PVU B;  3OTT A;  2HYE A;  4EWR A;  3I8C A;  3PXT D;  3I7K A;  4NEN A;  1OMW B;  4A0B B;  2OJY A;  3MKQ A;  3O4G A;  2O9K A;  3JRO A;  3DWL C;  3EI4 B;  4XYH A;  4H5J A;  3F3G A;  4U7A A;  4PSW B;  2AGZ A;  5C9Z B;  3IUQ A;  4MMY A;  4QRJ A;  2YNO A;  1FWX A;  2HJB A;  4J77 A;  5EAM A;  4AMZ A;  1SHY B;  2VZ1 A;  2VZ3 A;  2IUV A;  4OZU A;  3IUM A;  5AFU 3;  3I7H A;  2VDN A;  4IA9 A;  4G1E A;  1GOF A;  4NBM A;  5M5U A;  3VI3 A;  5C2W B;  3A0F A;  2TRC B;  4J84 A;  2H9M A;  4FA9 D;  4U1E I;  4A2L A;  3RRM C;  3JZH A;  1GOG A;  5TEF A;  4ERY A;  4ZN4 A;  2PM9 B;  4ERZ A;  3GFC A;  2PM7 B;  2AGL A;  5THA A;  4CZV A;  3K26 A;  4L9O A;  2B5M A;  4QQE A;  5HYN B;  2YMU A;  4Z7N A;  2OVQ B;  4GQB B;  3JAM g;  5CYK A;  4JD2 C;  3IKO A;  4PBZ A;  3EI1 B;  4FA5 D;  4IMM A;  3B7F A;  4PNK B;  3AL8 B;  5CXB B;  3UKR C;  3V4V A;  5E6U A;  4A11 B;  4AEZ A;  2H14 A;  2YBA A;  4DNV A;  5GXI A;  1M1X A;  3SN6 B;  2QR5 A;  2H9P A;  3RN1 D;  4WK4 A;  1H2Y A;  4O45 A;  1MDA H;  2YNN A;  3C99 A;  1K32 A;  4L1M A;  4O3T B;  3IJC A;  2P9U C;  1VZ3 A;  4PC0 A;  4X3E A;  4Z8L A;  3I7O A;  4QAM A;  4JHP C;  3UVM A;  4CY1 A;  2VC2 A;  4CI8 A;  2VDR A;  4CI2 A;  1U4C A;  2OVR B;  3RFH A;  1N6E A;  3L4M D;  5FFG A;  5GSA A;  4J86 A;  3EU7 A;  4ZOX A;  3UVL A;  5FKS A;  1TYE A;  4NSX A;  2QC5 A;  4QT8 A;  2P9N C;  3SCY A;  2P9P C;  4FAN D;  4A09 B;  2BCJ B;  4AOW A;  2OIZ A;  5IC7 A;  1K8K C;  2JKX A;  3F3F A;  3IJ0 A;  2IAA A;  5M5S A;  3MVD K;  3VGZ A;  1UOQ A;  1MG3 A;  5B4W A;  1H2X A;  3SJL D;  1H2Z A;  3UKU C;  3AH8 B;  1OLZ A;  2IUP A;  4JSN C;  1JMX B;  4GM9 A;  5I5M A;  2EIC A;  1SQJ A;  4ZOZ A;  5C2V B;  3MMY A;  1I2M B;  3FRX A;  4A0A A;  3CIK B;  4H5I A;  4GM8 A;  1S4U X;  4RE5 A;  4BL0 A;  2IUQ A;  4GGA A;  4R7A B;  3FCS A;  4O1Q D;  2IWK A;  2CN2 A;  5M61 A;  4O2W A;  4AN0 A;  2H3X A;  4WK0 A;  3QI0 A;  1U8C A;  3K71 A;  3KRX B;  5FA5 B;  1TBG A;  3L4O D;  4PBY A;  3IJ1 A;  3I7L A;  3I8E A;  1PGU A;  2EIE A;  3VH0 A;  1PI6 A;  1QNI A;  5EMM B;  3MUN A;  3ORV D;  1JOF A;  1PEV A;  4CC9 A;  4J0X A;  3BG1 A;  3SXT D;  4MMX A;  3IIY A;  3NID A;  3SVW D;  3EWE A;  3V5W B;  3KRW B;  4GMB A;  1GG2 B;  1TYQ C;  2GC7 A;  3PXS D;  4Y7R A;  5H1M A;  1Q47 A;  4CI3 A;  1UTC A;  2XDW A;  4O9D A;  2H13 A;  5TF2 A;  2Z2O A;  3IVM A;  2AGY A;  2GNQ A;  3OKY B;  3O4I A;  2I3S A;  2XU7 A;  5FKQ A;  1RI6 A;  4Z7O A;  2HES X;  3MUO A;  2MTA H;  2H6K A;  4A7J A;  5GMK n;  2H47 A;  3HFQ A;  5FQD A;  5H17 A;  1YFQ A;  2J56 H;  4NC4 A;  1JJU B;  4X60 B;  1O6F A;  4GGD A;  5A2Q g;  3C5M A;  4E54 A;  3IUN A;  2HU5 A;  4O02 A;  1SQ9 A;  3EI2 A;  2P9L C;  4FAV D;  5C92 A;  4J79 A;  3FGB A;  4J8G A;  3SWS D;  1UOP A;  2VDM A;  3O4J A;  4GM3 A;  2GC4 A;  1U2V C;  5C86 A;  4A08 A;  5HE0 B;  3OF7 A;  4AN1 A;  2VDP A;  3SBQ A;  4BCC A;  5M5V A;  4E5Z B;  4YVD A;  2YNP A;  3C75 H;  3JRP A;  5CXC B;  3SLE D;  3EI3 A;  3U4Y A;  2AQ5 A;  3RLM D;  1A0R B;  4DNU A;  2H9L A;  2CE9 A;  1XHM A;  4Y5R D;  4OWR A;  3EQ9 A;  2PM6 B;  4FWW A;  2P9I C;  5EAR A;  3VI4 A;  2AGX A;  4BH6 A;  2G9A A;  2P9S C;  3UR4 A;  5FXY A;  3V4P A;  1JV2 A;  5IGO A;  3IUR A;  4GGC A;  2EIB A;  4BCB A;  3IJE A;  4UM8 A;  1GOH A;  4QL1 A;  1GP2 B;  3FM0 A;  5IGQ A;  5AMS A;  4LGN A;  1L5G A;  3DSM A;  2HKR A;  1VYH C;  2EID A;  2XYI A;  2B4E A;  3DDU A;  4JHN A;  5I5J A;  5GXH A;  3PSL A;  5HQG A;  3RSE C;  4A2M A;  2CNX A;  2IWF A;  1XKS A;  2XE4 A;  3KCI A;  4XYI A;  1B9Y A;  5EMK B;  3GD1 I;  4GZ8 A;  4J81 A;  3BG0 A;  2B5N A;  3T3M A;  4UM9 A;  4FA1 D;  2I0R A;  4FHL A;  3AL8 A;  4XEI C;  5CXB A;  4UI9 R;  1E8M A;  3BWS A;  2XL2 A;  3IUL A;  1C9I A;  1UOO A;  4A11 A;  3ZDX A;  2OK4 A;  5CYK B;  5EAP A;  3PVW B;  5HDB A;  2CO0 A;  4JSP C;  3EMH A;  4K3J B;  4CZX A;  3FCU A;  1H2W A;  1JTD B;  3V9F A;  3RN0 D;  4BP9 A;  3J81 g;  3NIG A;  2BBK H;  1O6G A;  4N14 A;  5HE2 B;  2HKM A;  4HDJ A;  3UVN A;  1QFM A;  3SMR A;  3T3P A;  3ZDY A;  2G99 A;  2YB8 B;  4MMZ A;  2I3T A;  2CN3 A;  3I2N A;  3JZG A;  1ERJ A;  4JSX C;  1N6F A;  3NVQ A;  4K3I D;  4BUJ C;  2B5L A;  4CY5 A;  2J57 G;  4G56 B;  3SBR A;  3JPX A;  2QZP A;  4A08 B;  2VDQ A;  4ZOY A;  4X61 B;  4GQ1 A;  3F3P A;  4RE6 A;  5KDO B;  3DXK C;  2P9K C;  4J78 A;  5K19 A;  4AMY A;  5TEE A;  5JWZ A;  4LG8 A;  3OL2 A;  4KFM B;  4L1Q D;  5E6S A;  3UVK A;  1C9L A;  3CFV A;  3EI3 B;  4PSX B;  3RFG A;  1N6D A;  2H6Q A;  4TZ4 A;  3MKS B;  4ERQ A;  1NEX B;  5IJ8 E;  3GC3 B;  4A09 A;  2HU8 A;  1T2X A;  2EBS A;  5FKR A;  4WK2 A;  1GOT B;  5IT9 g;  4JXM A;  5I5I A;  2J55 H;  2I0S A;  5EML B;  2WQ8 A; 
#chains in the Genus database with same CATH homology
 5EMJ B;  2I0T A;  4FB1 D;  5TDH B;  3NVN A;  5K1C C;  3ZWL B;  5HE3 B;  5EM2 A;  3E0C A;  3P4F A;  3OKW A;  3VA6 A;  5AJA A;  4JT6 C;  3I89 A;  2OK6 A;  4J73 A;  3ULE C;  3SBP A;  4GQ2 P;  1B9X A;  4J87 A;  3PXW D;  1NR0 A;  5EAL A;  5FKT A;  2HXC A;  4L3H D;  3IIW A;  4D6V A;  4A0B A;  2AH1 A;  4A0A B;  3ODT A;  2Z2P A;  1GXR A;  4PXW A;  3EI4 A;  3I7P A;  3OW8 A;  3C9C A;  3I7N A;  2H6N A;  2W18 A;  4LG9 A;  2H68 A;  5HE1 B;  1PBY B;  2IUR A;  2QXV A;  3N0D A;  3DM0 A;  3K27 A;  5FLX g;  2OVP B;  3SFZ A;  3OKT A;  2H9N A;  5H14 A;  2CE8 A;  3CFS B;  2Q7Q A;  4J8B A;  4CI1 A;  3EG6 A;  3JZN A;  1JMZ B;  1MG2 A;  3PSC B;  2Z2N A;  2PM9 A;  3GRE A;  2XL3 A;  4MK0 B;  1XIP A;  4CZY A;  3OKY A;  4I79 A;  4CY2 A;  2AH0 A;  3AFC A;  3MZK A;  4O3U B;  3PE7 A;  2HJ4 A;  1L0Q A;  2CO0 C;  4J0W A;  4ES0 A;  2AGW A;  3EI1 A;  3OL2 B;  2UZY B;  2UZX B;  3W15 A;  4FA4 D;  1P22 A;  4CY3 A;  4J82 A;  4JT5 C;  3JB9 L;  3V7D B;  3MZL A;  3UVO A;  4X63 B;  4L3G D;  3MXX A;  3RMZ D;  3NVX A;  4JSV C;  5EM2 B;  4D0K A;  1R5M A;  4E54 B;  3AL9 A;  4E5Z A;  4ESG A;  3EI2 B;  5CXC A;  3N0E A;  5SXM A;  3J80 g;  2PBI B;  4ZOV A;  3SHF A;  3DXM C;  5IJ7 E;  3PVU B;  3OTT A;  2HYE A;  4EWR A;  3I8C A;  3PXT D;  3I7K A;  1OMW B;  4A0B B;  2OJY A;  3MKQ A;  2O9K A;  3JRO A;  3DWL C;  3EI4 B;  4XYH A;  4H5J A;  3F3G A;  4U7A A;  4PSW B;  2AGZ A;  5C9Z B;  4QRJ A;  2YNO A;  1FWX A;  2HJB A;  4J77 A;  5EAM A;  1SHY B;  2IUV A;  4OZU A;  5AFU 3;  3I7H A;  4IA9 A;  5C2W B;  3A0F A;  2TRC B;  4J84 A;  2H9M A;  4FA9 D;  4U1E I;  4A2L A;  3RRM C;  3JZH A;  5TEF A;  4ERY A;  4ZN4 A;  2PM9 B;  4ERZ A;  3GFC A;  2PM7 B;  2AGL A;  5THA A;  4CZV A;  3K26 A;  4L9O A;  2B5M A;  4QQE A;  5HYN B;  2YMU A;  2OVQ B;  4GQB B;  3JAM g;  5CYK A;  4JD2 C;  3IKO A;  4PBZ A;  3EI1 B;  4FA5 D;  4IMM A;  3B7F A;  4PNK B;  3AL8 B;  5CXB B;  3UKR C;  4A11 B;  4AEZ A;  2H14 A;  2YBA A;  5GXI A;  3SN6 B;  2H9P A;  3RN1 D;  4O45 A;  1MDA H;  2YNN A;  3C99 A;  1K32 A;  4O3T B;  3IJC A;  2P9U C;  4PC0 A;  4X3E A;  4Z8L A;  3I7O A;  3UVM A;  4CY1 A;  4CI8 A;  4CI2 A;  1U4C A;  2OVR B;  3RFH A;  1N6E A;  3L4M D;  5GSA A;  4J86 A;  3EU7 A;  4ZOX A;  3UVL A;  5FKS A;  4NSX A;  2QC5 A;  4QT8 A;  2P9N C;  3SCY A;  2P9P C;  4FAN D;  4A09 B;  2BCJ B;  4AOW A;  2OIZ A;  5IC7 A;  1K8K C;  3F3F A;  3IJ0 A;  2IAA A;  3VGZ A;  1MG3 A;  5B4W A;  3SJL D;  3UKU C;  3AH8 B;  1OLZ A;  2IUP A;  4JSN C;  1JMX B;  4GM9 A;  5I5M A;  1SQJ A;  4ZOZ A;  5C2V B;  3MMY A;  3FRX A;  4A0A A;  3CIK B;  4H5I A;  4GM8 A;  1S4U X;  4BL0 A;  2IUQ A;  4GGA A;  4R7A B;  4O1Q D;  2IWK A;  2CN2 A;  2H3X A;  3KRX B;  5FA5 B;  1TBG A;  3L4O D;  4PBY A;  3IJ1 A;  3I7L A;  3I8E A;  1PGU A;  3VH0 A;  1PI6 A;  1QNI A;  5EMM B;  3ORV D;  1JOF A;  1PEV A;  4CC9 A;  4J0X A;  3BG1 A;  3SXT D;  3IIY A;  3SVW D;  3EWE A;  3V5W B;  3KRW B;  4GMB A;  1GG2 B;  1TYQ C;  2GC7 A;  3PXS D;  4Y7R A;  5H1M A;  1Q47 A;  4CI3 A;  4O9D A;  2H13 A;  5TF2 A;  2Z2O A;  2AGY A;  2GNQ A;  3OKY B;  2I3S A;  2XU7 A;  5FKQ A;  1RI6 A;  2HES X;  2MTA H;  2H6K A;  4A7J A;  5GMK n;  2H47 A;  3HFQ A;  5FQD A;  5H17 A;  1YFQ A;  2J56 H;  1JJU B;  4X60 B;  4GGD A;  5A2Q g;  3C5M A;  4E54 A;  1SQ9 A;  3EI2 A;  2P9L C;  4FAV D;  4J79 A;  3FGB A;  4J8G A;  3SWS D;  4GM3 A;  2GC4 A;  1U2V C;  4A08 A;  5HE0 B;  3SBQ A;  4E5Z B;  4YVD A;  2YNP A;  3C75 H;  3JRP A;  5CXC B;  3SLE D;  3EI3 A;  3U4Y A;  2AQ5 A;  3RLM D;  1A0R B;  2H9L A;  2CE9 A;  1XHM A;  4Y5R D;  4OWR A;  2PM6 B;  4FWW A;  2P9I C;  5EAR A;  2AGX A;  4BH6 A;  2G9A A;  2P9S C;  3UR4 A;  5FXY A;  5IGO A;  4GGC A;  4QL1 A;  1GP2 B;  3FM0 A;  5IGQ A;  5AMS A;  4LGN A;  3DSM A;  2HKR A;  1VYH C;  2XYI A;  2B4E A;  5I5J A;  5GXH A;  3PSL A;  5HQG A;  3RSE C;  4A2M A;  2CNX A;  2IWF A;  1XKS A;  4XYI A;  1B9Y A;  5EMK B;  4GZ8 A;  4J81 A;  3BG0 A;  2B5N A;  4FA1 D;  2I0R A;  4FHL A;  3AL8 A;  4XEI C;  5CXB A;  4UI9 R;  3BWS A;  2XL2 A;  4A11 A;  2OK4 A;  5CYK B;  5EAP A;  3PVW B;  2CO0 A;  4JSP C;  3EMH A;  4K3J B;  4CZX A;  3V9F A;  3RN0 D;  3J81 g;  2BBK H;  4N14 A;  5HE2 B;  2HKM A;  4HDJ A;  3UVN A;  3SMR A;  2G99 A;  2YB8 B;  2I3T A;  2CN3 A;  3I2N A;  3JZG A;  1ERJ A;  4JSX C;  1N6F A;  3NVQ A;  4K3I D;  4BUJ C;  2B5L A;  4CY5 A;  2J57 G;  4G56 B;  3SBR A;  3JPX A;  4A08 B;  4ZOY A;  4X61 B;  4GQ1 A;  3F3P A;  5KDO B;  3DXK C;  2P9K C;  4J78 A;  5K19 A;  5TEE A;  5JWZ A;  4LG8 A;  3OL2 A;  4KFM B;  4L1Q D;  3UVK A;  3CFV A;  3EI3 B;  4PSX B;  3RFG A;  1N6D A;  2H6Q A;  4TZ4 A;  3MKS B;  4ERQ A;  1NEX B;  5IJ8 E;  4A09 A;  2EBS A;  5FKR A;  1GOT B;  5IT9 g;  4JXM A;  5I5I A;  2J55 H;  2I0S A;  5EML B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...