3C99A

Structural basis of histone h4 recognition by p55
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
405
structure length
380
Chain Sequence
SFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPCQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of histone H4 recognition by p55.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repressor
molecule keywords Chromatin assembly factor 1 p55 subunit
total genus 88
structure length 380
sequence length 405
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c99A00
3RN1D 2I0SA 4J84A 3V9FA 4JSVC 3I2NA 4CC9A 4JSNC 2YMUA 4GGAA 5GXIA 2Z2PA 1ERJA 3I7HA 1XHMA 2H9MA 1XKSA 4O1QD 2H9LA 1SQ9A 5THAA 1YFQA 4J78A 4X61B 1JOFA 2P9NC 4CZVA 2IUVA 4FWWA 4GQ1A 3UVOA 2HJ4A 3GREA 3C9CA 4KFMB 4J0WA 4R7AB 3MKQA 4H5IA 3EI3B 3ZWLB 1R5MA 1SHYB 2OVPB 5I5MA 4ZOZA 4BL0A 2B5MA 5K1CC 1B9XA 2QXVA 3CFVA 4EWRA 2PM9A 5C2VB 5HE3B 2J56H 2HKRA 4O45A 4J73A 3FGBA 4QT8A 4A08B 2IAAA 3RSEC 1JMXB 1RI6A 3UVNA 2H68A 4E54B 1FWXA 1K8KC 2AGLA 2IUQA 2AH1A 3ODTA 2OVQB 1OLZA 2O9KA 3C75H 4ERZA 3OL2B 4O9DA 3F3FA 4A7JA 2HYEA 2J55H 3U4YA 4FA9D 3PSLA 3FM0A 3I7NA 2I3SA 4GM3A 3HFQA 5AJAA 4JXMA 4J0XA 2IUPA 5TEFA 1JMZB 2PM7B 5JWZA 1S4UX 4A08A 4FAVD 3VH0A 4J79A 2CN3A 5CYKA 3K27A 4FHLA 5IJ8E 3E0CA 2UZXB 3JZGA 4BH6A 3SBPA 4E5ZA 4G56B 4CI2A 5FKRA 4A2LA 4H5JA 4A11A 4A0BA 3OTTA 2AGZA 3OKYA 3ULEC 2H3XA 1P22A 4J77A 2P9PC 5H17A 3DXMC 3NVNA 3SN6B 5EMMB 3I8CA 5FKSA 4JSXC 1N6EA 4CY3A 4L1QD 4D6VA 5FKQA 3PXSD 4FA1D 4X60B 4J82A 5CXBB 1PBYB 3BG0A 5I5JA 1N6DA 2B4EA 4PSWB 3EI1A 4ZOVA 3DM0A 4GM8A 4TZ4A 4GZ8A 4HDJA 2P9SC 5EMJB 4YVDA 5FA5B 3IIYA 5A2Qg 1A0RB 4A09B 2CE8A 4CY2A 3VGZA 5CXBA 4U1EI 3IJ0A 1MG3A 1VYHC 1GOTB 1NEXB 3EU7A 4BUJC 3IKOA 4A0AA 2H9NA 3FRXA 4LG8A 4JT6C 5EMKB 4GGDA 5IT9g 4IMMA 2H6NA 3NVXA 3RLMD 5CXCA 4IA9A 3SHFA 2UZYB 3JZHA 4N14A 2H6QA 2AGXA 2IURA 1MDAH 3OW8A 2YNPA 4UI9R 2H13A 3EI4B 3B7FA 3BWSA 3I7PA 3MZKA 3KRWB 5HYNB 5SXMA 5EM2B 3OKTA 4J87A 3JAMg 3SVWD 5I5IA 4FAND 1PI6A 3I7KA 2H47A 4U7AA 2I0TA 2YBAA 2EBSA 3N0EA 1GG2B 5AFU3 2H9PA 3UVKA 5IGQA 2P9IC 4PNKB 3EI2A 3W15A 4XEIC 5CYKB 5HE1B 3NVQA 4ZN4A 2GC7A 4GMBA 2BCJB 3EG6A 4PBZA 4CI3A 2H6KA 4GQBB 2CO0C 2G99A 3C99A 3JZNA 4OZUA 4GGCA 3MXXA 5TEEA 3SLED 3EI3A 3UR4A 2BBKH 2OIZA 3L4MD 2PM6B 1TBGA 4PXWA 4ERQA 3EI1B 2OJYA 4E54A 1GP2B 4X3EA 2YB8B 2HKMA 4CY1A 2IWKA 4ZOXA 2TRCB 3DWLC 3V7DB 4A2MA 4QQEA 3AL8A 5EAMA 4L3GD 3EWEA 4CI8A 2HXCA 4CZYA 4J8GA 2QC5A 2CN2A 4A0AB 2XL2A 3OL2A 3RFGA 3EI2B 1MG2A 3I89A 1GXRA 5C2WB 2YNNA 2I3TA 4GM9A 3SMRA 5IGOA 4J86A 3SFZA 2XYIA 4ES0A 4FB1D 2AQ5A 4L9OA 2H14A 1JJUB 3P4FA 3IJCA 3RN0D 1Q47A 5FKTA 4ESGA 4AOWA 4J8BA 3K26A 5FQDA 2XL3A 4GQ2P 3V5WB 3I7LA 3UVLA 1XIPA 3AL8B 5AMSA 5EMLB 3L4OD 3C5MA 5TF2A 3JB9L 3AFCA 3PVUB 2B5LA 5HE2B 3AH8B 1K32A 2CE9A 3I8EA 2B5NA 3J80g 2PBIB 3JRPA 4I79A 1U4CA 1B9YA 4NSXA 5GMKn 5IJ7E 2P9UC 3DSMA 3EMHA 2YNOA 4PBYA 4AEZA 5K19A 3F3PA 3F3GA 3KRXB 2Z2OA 4OWRA 3VA6A 3JROA 4ERYA 2GNQA 4E5ZB 3DXKC 4Y5RD 3IIWA 3IJ1A 4JD2C 3RFHA 3N0DA 2HJBA 3OKYB 5B4WA 5EM2A 3MKSB 5H1MA 4D0KA 2J57G 4O3TB 2OK6A 1PGUA 3CIKB 4JSPC 3PE7A 3PSCB 2HESX 5IC7A 3GFCA 1N6FA 1PEVA 4J81A 4CZXA 4LGNA 1TYQC 4PC0A 3BG1A 4MK0B 3SWSD 2AGYA 4LG9A 3AL9A 5C9ZB 4A09A 3MZLA 1OMWB 2PM9B 2XU7A 3UKUC 5HE0B 4K3JB 4XYIA 5GXHA 2AGWA 1U2VC 4L3HD 2G9AA 4PSXB 1SQJA 3MMYA 3RMZD 3PXTD 3RRMC 4QRJA 3I7OA 4Z8LA 5EALA 5GSAA 3EI4A 4XYHA 5FXYA 4QL1A 3SXTD 5TDHB 4A11B 4A0BB 1L0QA 5H14A 4CI1A 5KDOB 3CFSB 4ZOYA 5HQGA 3SCYA 2IWFA 4X63B 3SBRA 2OVRB 2I0RA 3JPXA 3SJLD 4JT5C 4Y7RA 2Z2NA 4O3UB 5EARA 2CO0A 2MTAH 2W18A 2P9KC 4FA4D 5CXCB 1QNIA 3PVWB 2AH0A 3UKRC 3A0FA 3J81g 2Q7QA 5FLXg 1NR0A 3UVMA 4FA5D 4K3ID 2P9LC 2OK4A 5EAPA 3ORVD 3SBQA 2GC4A 3OKWA 3PXWD 4CY5A 2CNXA
chains in the Genus database with same CATH superfamily
3RN1D 2I0SA 4J84A 3V9FA 2VDQA 4JSVC 1GOGA 3I2NA 4CC9A 4JSNC 3T3MA 2YMUA 4GGAA 5GXIA 2Z2PA 1ERJA 3I7HA 3IUJA 1XHMA 1O6GA 2H9MA 1XKSA 4O1QD 2H9LA 3KCIA 3ZE0A 1SQ9A 2BKLA 3K72A 4QAMA 5THAA 1YFQA 4AN0A 4J78A 4X61B 1JOFA 2P9NC 4CZVA 2IUVA 4FWWA 4GQ1A 3UVOA 2HJ4A 3GREA 5E6UA 4Z7QA 5M5TA 3EQ9A 3C9CA 4KFMB 4Z7NA 4J0WA 4R7AB 3MKQA 3NIGA 4H5IA 3EI3B 3ZWLB 3GC3B 1R5MA 2EICA 1SHYB 2OVPB 5I5MA 4ZOZA 4BL0A 2B5MA 4AMZA 5K1CC 1B9XA 2QXVA 3CFVA 4EWRA 2PM9A 5C2VB 5HE3B 2J56H 2HKRA 4O45A 4J73A 3FGBA 4QT8A 4A08B 2IAAA 3RSEC 1JMXB 1RI6A 4WK0A 3UVNA 2H68A 4E54B 1FWXA 1K8KC 1JTDB 2AGLA 2VDOA 2EIEA 1C9LA 2IUQA 1JV2A 2AH1A 3ODTA 3ZDXA 2OVQB 4MMZA 1OLZA 2O9KA 3C75H 4ERZA 1UTCA 3OL2B 4O9DA 3ZE1A 3F3FA 3EQ7A 1L5GA 4L1MA 4A7JA 2HYEA 2J55H 5M61A 3U4YA 4FA9D 3PSLA 3FM0A 3I7NA 2I3SA 4GM3A 3HFQA 5AJAA 4JXMA 4NBMA 4J0XA 2IUPA 5TEFA 1JMZB 4G1EA 2PM7B 3VI3A 5JWZA 2EIDA 1S4UX 2WQ8A 4A08A 4FAVD 3VH0A 4J79A 2CN3A 5CYKA 1VE6A 3K27A 4FHLA 3IUMA 5IJ8E 3E0CA 2UZXB 1VZ3A 1BPOA 2VDPA 2VDLA 3JZGA 4BH6A 5C92A 3SBPA 4E5ZA 4G56B 3DDUA 4CI2A 5FKRA 4WK4A 4A2LA 1VE7A 4H5JA 3IVMA 4A11A 4A0BA 3OTTA 2AGZA 3OKYA 3T3PA 3ULEC 2H3XA 1P22A 3NIDA 4J77A 2P9PC 5H17A 4BCBA 3DXMC 3NVNA 3SN6B 5EMMB 4AN1A 3I8CA 5FKSA 4JSXC 1I2MB 1N6EA 1UOOA 4CY3A 4L1QD 3K6SA 4NAAA 4D6VA 5FKQA 3PXSD 2VC2A 4FA1D 4X60B 4J82A 5CXBB 1PBYB 3BG0A 5I5JA 4G1MA 5E6SA 1N6DA 2B4EA 4MMYA 4PSWB 3EI1A 4ZOVA 3DM0A 4GM8A 4IRZA 1YR2A 5E6RA 4TZ4A 4GZ8A 4HDJA 2VDKA 2P9SC 5M5RA 5EMJB 3EQ8A 4YVDA 3IIYA 5FA5B 5A2Qg 1A0RB 4A09B 2CE8A 3V4VA 4CY2A 3VGZA 5CXBA 4U1EI 3IJ0A 1MG3A 1VYHC 1GOTB 1NEXB 3EU7A 4BUJC 3IKOA 4A0AA 2H9NA 3FRXA 4LG8A 4JT6C 5EMKB 4GGDA 5IT9g 4IMMA 2H6NA 3OF7A 3NVXA 3ZDZA 3RLMD 5CXCA 4IA9A 3SHFA 3IJEA 5C86A 2UZYB 3JZHA 4N14A 2H6QA 2AGXA 2IURA 1MDAH 3OW8A 2YNPA 3QHYB 4UI9R 2H13A 3EI4B 5M5VA 3IUNA 1E8MA 4DNVA 3GD1I 3B7FA 3BWSA 2XE4A 3I7PA 3MZKA 3KRWB 2XZGA 5HYNB 3VI4A 5SXMA 5EM2B 3OKTA 4J87A 3JAMg 4AMYA 3SVWD 5I5IA 4FAND 1PI6A 1H2ZA 3FCUA 4BCCA 2HU8A 3I7KA 3IULA 2H47A 4U7AA 3NIFA 5M5UA 5FFGA 2I0TA 4DNUA 2YBAA 4O02A 2EBSA 3N0EA 1GG2B 5AFU3 3IUQA 4MMXA 3MVDK 2H9PA 3UVKA 5IGQA 2P9IC 4PNKB 3V4PA 3EI2A 3W15A 4XEIC 5CYKB 5HE1B 3NVQA 4ZN4A 2GC7A 4D9SA 4GMBA 2BCJB 3EG6A 4PBZA 2QZPA 4CI3A 2H6KA 4GQBB 2CO0C 2G99A 4RE6A 3C99A 4WK2A 4Z7OA 3JZNA 4OZUA 4GGCA 3MXXA 5TEEA 3SLED 3EI3A 4O2WA 3UR4A 2BBKH 2OIZA 3L4MD 2PM6B 1TBGA 4PXWA 1M1XA 4ERQA 3EI1B 2OJYA 4E54A 1GP2B 4X3EA 2YB8B 2HKMA 4CY1A 3QI0A 2IWKA 4ZOXA 2TRCB 3DWLC 3V7DB 4A2MA 1UOPA 4QQEA 3AL8A 5EAMA 4L3GD 2VDNA 3EWEA 4CI8A 2HXCA 4CZYA 4J8GA 2QC5A 2CN2A 4A0AB 2XL2A 3OL2A 3RFGA 3EI2B 1MG2A 3I89A 1GXRA 4BP8A 1GOHA 5C2WB 2YNNA 2I3TA 4GM9A 3SMRA 5IGOA 3O4HA 4J86A 3SFZA 2XYIA 4ES0A 4FB1D 2AQ5A 1O6FA 2H14A 1JJUB 3IURA 3P4FA 4L9OA 3IJCA 3RN0D 1Q47A 5FKTA 4ESGA 4AOWA 4J8BA 3K26A 5FQDA 2XL3A 4GQ2P 3V5WB 3I7LA 3UVLA 1XIPA 3AL8B 5AMSA 5EMLB 3L4OD 3C5MA 5TF2A 4BP9A 3JB9L 3K71A 2VDRA 3AFCA 3PVUB 2B5LA 5HE2B 3AH8B 1K32A 2CE9A 1E8NA 3I8EA 2B5NA 1H2XA 3J80g 2PBIB 3JRPA 4I79A 1U4CA 1B9YA 4NSXA 1K3IA 5GMKn 5IJ7E 2P9UC 4JHPC 3DSMA 3EMHA 2YNOA 4PBYA 4AEZA 5K19A 3F3PA 3F3GA 3KRXB 3MUNA 2Z2OA 4OWRA 3VA6A 3JROA 3O4IA 5FFOA 2GNQA 4ERYA 4JHNA 4E5ZB 3DXKC 4Y5RD 4RE5A 3IIWA 1VZ2A 3ZDYA 3IJ1A 4JD2C 3RFHA 3FCSA 3N0DA 2HJBA 3OKYB 2EIBA 5B4WA 5EM2A 3MKSB 5H1MA 4D0KA 2J57G 1H2WA 3O4JA 5M5SA 1TYEA 4O3TB 2OK6A 1PGUA 3CIKB 4NENA 4JSPC 3PE7A 3PSCB 2HESX 1GOFA 2VZ1A 5IC7A 3GFCA 1N6FA 1PEVA 4J81A 4CZXA 4LGNA 1TYQC 4PC0A 3BG1A 4MK0B 3SWSD 2AGYA 1UOQA 4LG9A 3AL9A 4UM9A 5C9ZB 4A09A 3MZLA 1H2YA 1A12A 1OMWB 2PM9B 2XU7A 4WJKA 5HE0B 3UKUC 4K3JB 4XYIA 3O4GA 5GXHA 4DNWA 2AGWA 4AX4A 1T2XA 1U2VC 2JKXA 4L3HD 2G9AA 4PSXB 1SQJA 1E5TA 3MMYA 3PXTD 3RMZD 3RRMC 4G55A 4QRJA 3I7OA 4Z8LA 5EALA 5GSAA 2XDWA 3EI4A 4XYHA 5FXYA 4QL1A 3SXTD 5TDHB 4BCDA 4A11B 3MUOA 4A0BB 1L0QA 5H14A 1C9IA 4CI1A 3CFSB 2QR5A 5KDOB 4ZOYA 5HQGA 3SCYA 2VZ3A 2IWFA 2HU7A 4X63B 3SBRA 5HDBA 2OVRB 2I0RA 3JPXA 3SJLD 3ZE2A 4JT5C 4Y7RA 2Z2NA 4O3UB 5EARA 2CO0A 4NC4A 2MTAH 2W18A 2P9KC 2HU5A 4FA4D 5CXCB 1QNIA 1QFMA 3PVWB 2AH0A 3UKRC 3A0FA 3J81g 2Q7QA 4UM8A 5FLXg 1NR0A 2VDMA 3UVMA 4FA5D 4K3ID 2P9LC 2OK4A 5EAPA 3ORVD 1QFSA 3SBQA 2GC4A 3OKWA 3PXWD 4CY5A 1U8CA 2CNXA
chains in the Genus database with same CATH topology
3RN1D 2I0SA 4J84A 3V9FA 4JSVC 3I2NA 4CC9A 4JSNC 2YMUA 4GGAA 5GXIA 2Z2PA 1ERJA 3I7HA 1XHMA 2H9MA 1XKSA 4O1QD 2H9LA 1SQ9A 5THAA 1YFQA 4J78A 4X61B 1JOFA 2P9NC 4CZVA 2IUVA 4FWWA 4GQ1A 3UVOA 2HJ4A 3GREA 3C9CA 4KFMB 4J0WA 4R7AB 3MKQA 4H5IA 3EI3B 3ZWLB 1R5MA 1SHYB 2OVPB 5I5MA 4ZOZA 4BL0A 2B5MA 5K1CC 1B9XA 2QXVA 3CFVA 4EWRA 2PM9A 5C2VB 5HE3B 2J56H 2HKRA 4O45A 4J73A 3FGBA 4QT8A 4A08B 2IAAA 3RSEC 1JMXB 1RI6A 3UVNA 2H68A 4E54B 1FWXA 1K8KC 2AGLA 2IUQA 2AH1A 3ODTA 2OVQB 1OLZA 2O9KA 3C75H 4ERZA 3OL2B 4O9DA 3F3FA 4A7JA 2HYEA 2J55H 3U4YA 4FA9D 3PSLA 3FM0A 3I7NA 2I3SA 4GM3A 3HFQA 5AJAA 4JXMA 4J0XA 2IUPA 5TEFA 1JMZB 2PM7B 5JWZA 1S4UX 4A08A 4FAVD 3VH0A 4J79A 2CN3A 5CYKA 3K27A 4FHLA 5IJ8E 3E0CA 2UZXB 3JZGA 4BH6A 3SBPA 4E5ZA 4G56B 4CI2A 5FKRA 4A2LA 4H5JA 4A11A 4A0BA 3OTTA 2AGZA 3OKYA 3ULEC 2H3XA 1P22A 4J77A 2P9PC 5H17A 3DXMC 3NVNA 3SN6B 5EMMB 3I8CA 5FKSA 4JSXC 1N6EA 4CY3A 4L1QD 4D6VA 5FKQA 3PXSD 4FA1D 4X60B 4J82A 5CXBB 1PBYB 3BG0A 5I5JA 1N6DA 2B4EA 4PSWB 3EI1A 4ZOVA 3DM0A 4GM8A 4TZ4A 4GZ8A 4HDJA 2P9SC 5EMJB 4YVDA 5FA5B 3IIYA 5A2Qg 1A0RB 4A09B 2CE8A 4CY2A 3VGZA 5CXBA 4U1EI 3IJ0A 1MG3A 1VYHC 1GOTB 1NEXB 3EU7A 4BUJC 3IKOA 4A0AA 2H9NA 3FRXA 4LG8A 4JT6C 5EMKB 4GGDA 5IT9g 4IMMA 2H6NA 3NVXA 3RLMD 5CXCA 4IA9A 3SHFA 2UZYB 3JZHA 4N14A 2H6QA 2AGXA 2IURA 1MDAH 3OW8A 2YNPA 4UI9R 2H13A 3EI4B 3B7FA 3BWSA 3I7PA 3MZKA 3KRWB 5HYNB 5SXMA 5EM2B 3OKTA 4J87A 3JAMg 3SVWD 5I5IA 4FAND 1PI6A 3I7KA 2H47A 4U7AA 2I0TA 2YBAA 2EBSA 3N0EA 1GG2B 5AFU3 2H9PA 3UVKA 5IGQA 2P9IC 4PNKB 3EI2A 3W15A 4XEIC 5CYKB 5HE1B 3NVQA 4ZN4A 2GC7A 4GMBA 2BCJB 3EG6A 4PBZA 4CI3A 2H6KA 4GQBB 2CO0C 2G99A 3C99A 3JZNA 4OZUA 4GGCA 3MXXA 5TEEA 3SLED 3EI3A 3UR4A 2BBKH 2OIZA 3L4MD 2PM6B 1TBGA 4PXWA 4ERQA 3EI1B 2OJYA 4E54A 1GP2B 4X3EA 2YB8B 2HKMA 4CY1A 2IWKA 4ZOXA 2TRCB 3DWLC 3V7DB 4A2MA 4QQEA 3AL8A 5EAMA 4L3GD 3EWEA 4CI8A 2HXCA 4CZYA 4J8GA 2QC5A 2CN2A 4A0AB 2XL2A 3OL2A 3RFGA 3EI2B 1MG2A 3I89A 1GXRA 5C2WB 2YNNA 2I3TA 4GM9A 3SMRA 5IGOA 4J86A 3SFZA 2XYIA 4ES0A 4FB1D 2AQ5A 4L9OA 2H14A 1JJUB 3P4FA 3IJCA 3RN0D 1Q47A 5FKTA 4ESGA 4AOWA 4J8BA 3K26A 5FQDA 2XL3A 4GQ2P 3V5WB 3I7LA 3UVLA 1XIPA 3AL8B 5AMSA 5EMLB 3L4OD 3C5MA 5TF2A 3JB9L 3AFCA 3PVUB 2B5LA 5HE2B 3AH8B 1K32A 2CE9A 3I8EA 2B5NA 3J80g 2PBIB 3JRPA 4I79A 1U4CA 1B9YA 4NSXA 5GMKn 5IJ7E 2P9UC 3DSMA 3EMHA 2YNOA 4PBYA 4AEZA 5K19A 3F3PA 3F3GA 3KRXB 2Z2OA 4OWRA 3VA6A 3JROA 4ERYA 2GNQA 4E5ZB 3DXKC 4Y5RD 3IIWA 3IJ1A 4JD2C 3RFHA 3N0DA 2HJBA 3OKYB 5B4WA 5EM2A 3MKSB 5H1MA 4D0KA 2J57G 4O3TB 2OK6A 1PGUA 3CIKB 4JSPC 3PE7A 3PSCB 2HESX 5IC7A 3GFCA 1N6FA 1PEVA 4J81A 4CZXA 4LGNA 1TYQC 4PC0A 3BG1A 4MK0B 3SWSD 2AGYA 4LG9A 3AL9A 5C9ZB 4A09A 3MZLA 1OMWB 2PM9B 2XU7A 3UKUC 5HE0B 4K3JB 4XYIA 5GXHA 2AGWA 1U2VC 4L3HD 2G9AA 4PSXB 1SQJA 3MMYA 3RMZD 3PXTD 3RRMC 4QRJA 3I7OA 4Z8LA 5EALA 5GSAA 3EI4A 4XYHA 5FXYA 4QL1A 3SXTD 5TDHB 4A11B 4A0BB 1L0QA 5H14A 4CI1A 5KDOB 3CFSB 4ZOYA 5HQGA 3SCYA 2IWFA 4X63B 3SBRA 2OVRB 2I0RA 3JPXA 3SJLD 4JT5C 4Y7RA 2Z2NA 4O3UB 5EARA 2CO0A 2MTAH 2W18A 2P9KC 4FA4D 5CXCB 1QNIA 3PVWB 2AH0A 3UKRC 3A0FA 3J81g 2Q7QA 5FLXg 1NR0A 3UVMA 4FA5D 4K3ID 2P9LC 2OK4A 5EAPA 3ORVD 3SBQA 2GC4A 3OKWA 3PXWD 4CY5A 2CNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN1 D;  2I0S A;  4J84 A;  3V9F A;  4JSV C;  3I2N A;  4CC9 A;  4JSN C;  2YMU A;  4GGA A;  5GXI A;  2Z2P A;  1ERJ A;  3I7H A;  1XHM A;  2H9M A;  1XKS A;  4O1Q D;  2H9L A;  1SQ9 A;  5THA A;  1YFQ A;  4J78 A;  4X61 B;  1JOF A;  2P9N C;  4CZV A;  2IUV A;  4FWW A;  4GQ1 A;  3UVO A;  2HJ4 A;  3GRE A;  3C9C A;  4KFM B;  4J0W A;  4R7A B;  3MKQ A;  4H5I A;  3EI3 B;  3ZWL B;  1R5M A;  1SHY B;  2OVP B;  5I5M A;  4ZOZ A;  4BL0 A;  2B5M A;  5K1C C;  1B9X A;  2QXV A;  3CFV A;  4EWR A;  2PM9 A;  5C2V B;  5HE3 B;  2J56 H;  2HKR A;  4O45 A;  4J73 A;  3FGB A;  4QT8 A;  4A08 B;  2IAA A;  3RSE C;  1JMX B;  1RI6 A;  3UVN A;  2H68 A;  4E54 B;  1FWX A;  1K8K C;  2AGL A;  2IUQ A;  2AH1 A;  3ODT A;  2OVQ B;  1OLZ A;  2O9K A;  3C75 H;  4ERZ A;  3OL2 B;  4O9D A;  3F3F A;  4A7J A;  2HYE A;  2J55 H;  3U4Y A;  4FA9 D;  3PSL A;  3FM0 A;  3I7N A;  2I3S A;  4GM3 A;  3HFQ A;  5AJA A;  4JXM A;  4J0X A;  2IUP A;  5TEF A;  1JMZ B;  2PM7 B;  5JWZ A;  1S4U X;  4A08 A;  4FAV D;  3VH0 A;  4J79 A;  2CN3 A;  5CYK A;  3K27 A;  4FHL A;  5IJ8 E;  3E0C A;  2UZX B;  3JZG A;  4BH6 A;  3SBP A;  4E5Z A;  4G56 B;  4CI2 A;  5FKR A;  4A2L A;  4H5J A;  4A11 A;  4A0B A;  3OTT A;  2AGZ A;  3OKY A;  3ULE C;  2H3X A;  1P22 A;  4J77 A;  2P9P C;  5H17 A;  3DXM C;  3NVN A;  3SN6 B;  5EMM B;  3I8C A;  5FKS A;  4JSX C;  1N6E A;  4CY3 A;  4L1Q D;  4D6V A;  5FKQ A;  3PXS D;  4FA1 D;  4X60 B;  4J82 A;  5CXB B;  1PBY B;  3BG0 A;  5I5J A;  1N6D A;  2B4E A;  4PSW B;  3EI1 A;  4ZOV A;  3DM0 A;  4GM8 A;  4TZ4 A;  4GZ8 A;  4HDJ A;  2P9S C;  5EMJ B;  4YVD A;  5FA5 B;  3IIY A;  5A2Q g;  1A0R B;  4A09 B;  2CE8 A;  4CY2 A;  3VGZ A;  5CXB A;  4U1E I;  3IJ0 A;  1MG3 A;  1VYH C;  1GOT B;  1NEX B;  3EU7 A;  4BUJ C;  3IKO A;  4A0A A;  2H9N A;  3FRX A;  4LG8 A;  4JT6 C;  5EMK B;  4GGD A;  5IT9 g;  4IMM A;  2H6N A;  3NVX A;  3RLM D;  5CXC A;  4IA9 A;  3SHF A;  2UZY B;  3JZH A;  4N14 A;  2H6Q A;  2AGX A;  2IUR A;  1MDA H;  3OW8 A;  2YNP A;  4UI9 R;  2H13 A;  3EI4 B;  3B7F A;  3BWS A;  3I7P A;  3MZK A;  3KRW B;  5HYN B;  5SXM A;  5EM2 B;  3OKT A;  4J87 A;  3JAM g;  3SVW D;  5I5I A;  4FAN D;  1PI6 A;  3I7K A;  2H47 A;  4U7A A;  2I0T A;  2YBA A;  2EBS A;  3N0E A;  1GG2 B;  5AFU 3;  2H9P A;  3UVK A;  5IGQ A;  2P9I C;  4PNK B;  3EI2 A;  3W15 A;  4XEI C;  5CYK B;  5HE1 B;  3NVQ A;  4ZN4 A;  2GC7 A;  4GMB A;  2BCJ B;  3EG6 A;  4PBZ A;  4CI3 A;  2H6K A;  4GQB B;  2CO0 C;  2G99 A;  3C99 A;  3JZN A;  4OZU A;  4GGC A;  3MXX A;  5TEE A;  3SLE D;  3EI3 A;  3UR4 A;  2BBK H;  2OIZ A;  3L4M D;  2PM6 B;  1TBG A;  4PXW A;  4ERQ A;  3EI1 B;  2OJY A;  4E54 A;  1GP2 B;  4X3E A;  2YB8 B;  2HKM A;  4CY1 A;  2IWK A;  4ZOX A;  2TRC B;  3DWL C;  3V7D B;  4A2M A;  4QQE A;  3AL8 A;  5EAM A;  4L3G D;  3EWE A;  4CI8 A;  2HXC A;  4CZY A;  4J8G A;  2QC5 A;  2CN2 A;  4A0A B;  2XL2 A;  3OL2 A;  3RFG A;  3EI2 B;  1MG2 A;  3I89 A;  1GXR A;  5C2W B;  2YNN A;  2I3T A;  4GM9 A;  3SMR A;  5IGO A;  4J86 A;  3SFZ A;  2XYI A;  4ES0 A;  4FB1 D;  2AQ5 A;  4L9O A;  2H14 A;  1JJU B;  3P4F A;  3IJC A;  3RN0 D;  1Q47 A;  5FKT A;  4ESG A;  4AOW A;  4J8B A;  3K26 A;  5FQD A;  2XL3 A;  4GQ2 P;  3V5W B;  3I7L A;  3UVL A;  1XIP A;  3AL8 B;  5AMS A;  5EML B;  3L4O D;  3C5M A;  5TF2 A;  3JB9 L;  3AFC A;  3PVU B;  2B5L A;  5HE2 B;  3AH8 B;  1K32 A;  2CE9 A;  3I8E A;  2B5N A;  3J80 g;  2PBI B;  3JRP A;  4I79 A;  1U4C A;  1B9Y A;  4NSX A;  5GMK n;  5IJ7 E;  2P9U C;  3DSM A;  3EMH A;  2YNO A;  4PBY A;  4AEZ A;  5K19 A;  3F3P A;  3F3G A;  3KRX B;  2Z2O A;  4OWR A;  3VA6 A;  3JRO A;  4ERY A;  2GNQ A;  4E5Z B;  3DXK C;  4Y5R D;  3IIW A;  3IJ1 A;  4JD2 C;  3RFH A;  3N0D A;  2HJB A;  3OKY B;  5B4W A;  5EM2 A;  3MKS B;  5H1M A;  4D0K A;  2J57 G;  4O3T B;  2OK6 A;  1PGU A;  3CIK B;  4JSP C;  3PE7 A;  3PSC B;  2HES X;  5IC7 A;  3GFC A;  1N6F A;  1PEV A;  4J81 A;  4CZX A;  4LGN A;  1TYQ C;  4PC0 A;  3BG1 A;  4MK0 B;  3SWS D;  2AGY A;  4LG9 A;  3AL9 A;  5C9Z B;  4A09 A;  3MZL A;  1OMW B;  2PM9 B;  2XU7 A;  3UKU C;  5HE0 B;  4K3J B;  4XYI A;  5GXH A;  2AGW A;  1U2V C;  4L3H D;  2G9A A;  4PSX B;  1SQJ A;  3MMY A;  3RMZ D;  3PXT D;  3RRM C;  4QRJ A;  3I7O A;  4Z8L A;  5EAL A;  5GSA A;  3EI4 A;  4XYH A;  5FXY A;  4QL1 A;  3SXT D;  5TDH B;  4A11 B;  4A0B B;  1L0Q A;  5H14 A;  4CI1 A;  5KDO B;  3CFS B;  4ZOY A;  5HQG A;  3SCY A;  2IWF A;  4X63 B;  3SBR A;  2OVR B;  2I0R A;  3JPX A;  3SJL D;  4JT5 C;  4Y7R A;  2Z2N A;  4O3U B;  5EAR A;  2CO0 A;  2MTA H;  2W18 A;  2P9K C;  4FA4 D;  5CXC B;  1QNI A;  3PVW B;  2AH0 A;  3UKR C;  3A0F A;  3J81 g;  2Q7Q A;  5FLX g;  1NR0 A;  3UVM A;  4FA5 D;  4K3I D;  2P9L C;  2OK4 A;  5EAP A;  3ORV D;  3SBQ A;  2GC4 A;  3OKW A;  3PXW D;  4CY5 A;  2CNX A; 
#chains in the Genus database with same CATH topology
 3RN1 D;  2I0S A;  4J84 A;  3V9F A;  2VDQ A;  4JSV C;  1GOG A;  3I2N A;  4CC9 A;  4JSN C;  3T3M A;  2YMU A;  4GGA A;  5GXI A;  2Z2P A;  1ERJ A;  3I7H A;  3IUJ A;  1XHM A;  1O6G A;  2H9M A;  1XKS A;  4O1Q D;  2H9L A;  3KCI A;  3ZE0 A;  1SQ9 A;  2BKL A;  3K72 A;  4QAM A;  5THA A;  1YFQ A;  4AN0 A;  4J78 A;  4X61 B;  1JOF A;  2P9N C;  4CZV A;  2IUV A;  4FWW A;  4GQ1 A;  3UVO A;  2HJ4 A;  3GRE A;  5E6U A;  4Z7Q A;  5M5T A;  3EQ9 A;  3C9C A;  4KFM B;  4Z7N A;  4J0W A;  4R7A B;  3MKQ A;  3NIG A;  4H5I A;  3EI3 B;  3ZWL B;  3GC3 B;  1R5M A;  2EIC A;  1SHY B;  2OVP B;  5I5M A;  4ZOZ A;  4BL0 A;  2B5M A;  4AMZ A;  5K1C C;  1B9X A;  2QXV A;  3CFV A;  4EWR A;  2PM9 A;  5C2V B;  5HE3 B;  2J56 H;  2HKR A;  4O45 A;  4J73 A;  3FGB A;  4QT8 A;  4A08 B;  2IAA A;  3RSE C;  1JMX B;  1RI6 A;  4WK0 A;  3UVN A;  2H68 A;  4E54 B;  1FWX A;  1K8K C;  1JTD B;  2AGL A;  2VDO A;  2EIE A;  1C9L A;  2IUQ A;  1JV2 A;  2AH1 A;  3ODT A;  3ZDX A;  2OVQ B;  4MMZ A;  1OLZ A;  2O9K A;  3C75 H;  4ERZ A;  1UTC A;  3OL2 B;  4O9D A;  3ZE1 A;  3F3F A;  3EQ7 A;  1L5G A;  4L1M A;  4A7J A;  2HYE A;  2J55 H;  5M61 A;  3U4Y A;  4FA9 D;  3PSL A;  3FM0 A;  3I7N A;  2I3S A;  4GM3 A;  3HFQ A;  5AJA A;  4JXM A;  4NBM A;  4J0X A;  2IUP A;  5TEF A;  1JMZ B;  4G1E A;  2PM7 B;  3VI3 A;  5JWZ A;  2EID A;  1S4U X;  2WQ8 A;  4A08 A;  4FAV D;  3VH0 A;  4J79 A;  2CN3 A;  5CYK A;  1VE6 A;  3K27 A;  4FHL A;  3IUM A;  5IJ8 E;  3E0C A;  2UZX B;  1VZ3 A;  1BPO A;  2VDP A;  2VDL A;  3JZG A;  4BH6 A;  5C92 A;  3SBP A;  4E5Z A;  4G56 B;  3DDU A;  4CI2 A;  5FKR A;  4WK4 A;  4A2L A;  1VE7 A;  4H5J A;  3IVM A;  4A11 A;  4A0B A;  3OTT A;  2AGZ A;  3OKY A;  3T3P A;  3ULE C;  2H3X A;  1P22 A;  3NID A;  4J77 A;  2P9P C;  5H17 A;  4BCB A;  3DXM C;  3NVN A;  3SN6 B;  5EMM B;  4AN1 A;  3I8C A;  5FKS A;  4JSX C;  1I2M B;  1N6E A;  1UOO A;  4CY3 A;  4L1Q D;  3K6S A;  4NAA A;  4D6V A;  5FKQ A;  3PXS D;  2VC2 A;  4FA1 D;  4X60 B;  4J82 A;  5CXB B;  1PBY B;  3BG0 A;  5I5J A;  4G1M A;  5E6S A;  1N6D A;  2B4E A;  4MMY A;  4PSW B;  3EI1 A;  4ZOV A;  3DM0 A;  4GM8 A;  4IRZ A;  1YR2 A;  5E6R A;  4TZ4 A;  4GZ8 A;  4HDJ A;  2VDK A;  2P9S C;  5M5R A;  5EMJ B;  3EQ8 A;  4YVD A;  3IIY A;  5FA5 B;  5A2Q g;  1A0R B;  4A09 B;  2CE8 A;  3V4V A;  4CY2 A;  3VGZ A;  5CXB A;  4U1E I;  3IJ0 A;  1MG3 A;  1VYH C;  1GOT B;  1NEX B;  3EU7 A;  4BUJ C;  3IKO A;  4A0A A;  2H9N A;  3FRX A;  4LG8 A;  4JT6 C;  5EMK B;  4GGD A;  5IT9 g;  4IMM A;  2H6N A;  3OF7 A;  3NVX A;  3ZDZ A;  3RLM D;  5CXC A;  4IA9 A;  3SHF A;  3IJE A;  5C86 A;  2UZY B;  3JZH A;  4N14 A;  2H6Q A;  2AGX A;  2IUR A;  1MDA H;  3OW8 A;  2YNP A;  3QHY B;  4UI9 R;  2H13 A;  3EI4 B;  5M5V A;  3IUN A;  1E8M A;  4DNV A;  3GD1 I;  3B7F A;  3BWS A;  2XE4 A;  3I7P A;  3MZK A;  3KRW B;  2XZG A;  5HYN B;  3VI4 A;  5SXM A;  5EM2 B;  3OKT A;  4J87 A;  3JAM g;  4AMY A;  3SVW D;  5I5I A;  4FAN D;  1PI6 A;  1H2Z A;  3FCU A;  4BCC A;  2HU8 A;  3I7K A;  3IUL A;  2H47 A;  4U7A A;  3NIF A;  5M5U A;  5FFG A;  2I0T A;  4DNU A;  2YBA A;  4O02 A;  2EBS A;  3N0E A;  1GG2 B;  5AFU 3;  3IUQ A;  4MMX A;  3MVD K;  2H9P A;  3UVK A;  5IGQ A;  2P9I C;  4PNK B;  3V4P A;  3EI2 A;  3W15 A;  4XEI C;  5CYK B;  5HE1 B;  3NVQ A;  4ZN4 A;  2GC7 A;  4D9S A;  4GMB A;  2BCJ B;  3EG6 A;  4PBZ A;  2QZP A;  4CI3 A;  2H6K A;  4GQB B;  2CO0 C;  2G99 A;  4RE6 A;  3C99 A;  4WK2 A;  4Z7O A;  3JZN A;  4OZU A;  4GGC A;  3MXX A;  5TEE A;  3SLE D;  3EI3 A;  4O2W A;  3UR4 A;  2BBK H;  2OIZ A;  3L4M D;  2PM6 B;  1TBG A;  4PXW A;  1M1X A;  4ERQ A;  3EI1 B;  2OJY A;  4E54 A;  1GP2 B;  4X3E A;  2YB8 B;  2HKM A;  4CY1 A;  3QI0 A;  2IWK A;  4ZOX A;  2TRC B;  3DWL C;  3V7D B;  4A2M A;  1UOP A;  4QQE A;  3AL8 A;  5EAM A;  4L3G D;  2VDN A;  3EWE A;  4CI8 A;  2HXC A;  4CZY A;  4J8G A;  2QC5 A;  2CN2 A;  4A0A B;  2XL2 A;  3OL2 A;  3RFG A;  3EI2 B;  1MG2 A;  3I89 A;  1GXR A;  4BP8 A;  1GOH A;  5C2W B;  2YNN A;  2I3T A;  4GM9 A;  3SMR A;  5IGO A;  3O4H A;  4J86 A;  3SFZ A;  2XYI A;  4ES0 A;  4FB1 D;  2AQ5 A;  1O6F A;  2H14 A;  1JJU B;  3IUR A;  3P4F A;  4L9O A;  3IJC A;  3RN0 D;  1Q47 A;  5FKT A;  4ESG A;  4AOW A;  4J8B A;  3K26 A;  5FQD A;  2XL3 A;  4GQ2 P;  3V5W B;  3I7L A;  3UVL A;  1XIP A;  3AL8 B;  5AMS A;  5EML B;  3L4O D;  3C5M A;  5TF2 A;  4BP9 A;  3JB9 L;  3K71 A;  2VDR A;  3AFC A;  3PVU B;  2B5L A;  5HE2 B;  3AH8 B;  1K32 A;  2CE9 A;  1E8N A;  3I8E A;  2B5N A;  1H2X A;  3J80 g;  2PBI B;  3JRP A;  4I79 A;  1U4C A;  1B9Y A;  4NSX A;  1K3I A;  5GMK n;  5IJ7 E;  2P9U C;  4JHP C;  3DSM A;  3EMH A;  2YNO A;  4PBY A;  4AEZ A;  5K19 A;  3F3P A;  3F3G A;  3KRX B;  3MUN A;  2Z2O A;  4OWR A;  3VA6 A;  3JRO A;  3O4I A;  5FFO A;  2GNQ A;  4ERY A;  4JHN A;  4E5Z B;  3DXK C;  4Y5R D;  4RE5 A;  3IIW A;  1VZ2 A;  3ZDY A;  3IJ1 A;  4JD2 C;  3RFH A;  3FCS A;  3N0D A;  2HJB A;  3OKY B;  2EIB A;  5B4W A;  5EM2 A;  3MKS B;  5H1M A;  4D0K A;  2J57 G;  1H2W A;  3O4J A;  5M5S A;  1TYE A;  4O3T B;  2OK6 A;  1PGU A;  3CIK B;  4NEN A;  4JSP C;  3PE7 A;  3PSC B;  2HES X;  1GOF A;  2VZ1 A;  5IC7 A;  3GFC A;  1N6F A;  1PEV A;  4J81 A;  4CZX A;  4LGN A;  1TYQ C;  4PC0 A;  3BG1 A;  4MK0 B;  3SWS D;  2AGY A;  1UOQ A;  4LG9 A;  3AL9 A;  4UM9 A;  5C9Z B;  4A09 A;  3MZL A;  1H2Y A;  1A12 A;  1OMW B;  2PM9 B;  2XU7 A;  4WJK A;  5HE0 B;  3UKU C;  4K3J B;  4XYI A;  3O4G A;  5GXH A;  4DNW A;  2AGW A;  4AX4 A;  1T2X A;  1U2V C;  2JKX A;  4L3H D;  2G9A A;  4PSX B;  1SQJ A;  1E5T A;  3MMY A;  3PXT D;  3RMZ D;  3RRM C;  4G55 A;  4QRJ A;  3I7O A;  4Z8L A;  5EAL A;  5GSA A;  2XDW A;  3EI4 A;  4XYH A;  5FXY A;  4QL1 A;  3SXT D;  5TDH B;  4BCD A;  4A11 B;  3MUO A;  4A0B B;  1L0Q A;  5H14 A;  1C9I A;  4CI1 A;  3CFS B;  2QR5 A;  5KDO B;  4ZOY A;  5HQG A;  3SCY A;  2VZ3 A;  2IWF A;  2HU7 A;  4X63 B;  3SBR A;  5HDB A;  2OVR B;  2I0R A;  3JPX A;  3SJL D;  3ZE2 A;  4JT5 C;  4Y7R A;  2Z2N A;  4O3U B;  5EAR A;  2CO0 A;  4NC4 A;  2MTA H;  2W18 A;  2P9K C;  2HU5 A;  4FA4 D;  5CXC B;  1QNI A;  1QFM A;  3PVW B;  2AH0 A;  3UKR C;  3A0F A;  3J81 g;  2Q7Q A;  4UM8 A;  5FLX g;  1NR0 A;  2VDM A;  3UVM A;  4FA5 D;  4K3I D;  2P9L C;  2OK4 A;  5EAP A;  3ORV D;  1QFS A;  3SBQ A;  2GC4 A;  3OKW A;  3PXW D;  4CY5 A;  1U8C A;  2CNX A; 
#chains in the Genus database with same CATH homology
 3RN1 D;  2I0S A;  4J84 A;  3V9F A;  4JSV C;  3I2N A;  4CC9 A;  4JSN C;  2YMU A;  4GGA A;  5GXI A;  2Z2P A;  1ERJ A;  3I7H A;  1XHM A;  2H9M A;  1XKS A;  4O1Q D;  2H9L A;  1SQ9 A;  5THA A;  1YFQ A;  4J78 A;  4X61 B;  1JOF A;  2P9N C;  4CZV A;  2IUV A;  4FWW A;  4GQ1 A;  3UVO A;  2HJ4 A;  3GRE A;  3C9C A;  4KFM B;  4J0W A;  4R7A B;  3MKQ A;  4H5I A;  3EI3 B;  3ZWL B;  1R5M A;  1SHY B;  2OVP B;  5I5M A;  4ZOZ A;  4BL0 A;  2B5M A;  5K1C C;  1B9X A;  2QXV A;  3CFV A;  4EWR A;  2PM9 A;  5C2V B;  5HE3 B;  2J56 H;  2HKR A;  4O45 A;  4J73 A;  3FGB A;  4QT8 A;  4A08 B;  2IAA A;  3RSE C;  1JMX B;  1RI6 A;  3UVN A;  2H68 A;  4E54 B;  1FWX A;  1K8K C;  2AGL A;  2IUQ A;  2AH1 A;  3ODT A;  2OVQ B;  1OLZ A;  2O9K A;  3C75 H;  4ERZ A;  3OL2 B;  4O9D A;  3F3F A;  4A7J A;  2HYE A;  2J55 H;  3U4Y A;  4FA9 D;  3PSL A;  3FM0 A;  3I7N A;  2I3S A;  4GM3 A;  3HFQ A;  5AJA A;  4JXM A;  4J0X A;  2IUP A;  5TEF A;  1JMZ B;  2PM7 B;  5JWZ A;  1S4U X;  4A08 A;  4FAV D;  3VH0 A;  4J79 A;  2CN3 A;  5CYK A;  3K27 A;  4FHL A;  5IJ8 E;  3E0C A;  2UZX B;  3JZG A;  4BH6 A;  3SBP A;  4E5Z A;  4G56 B;  4CI2 A;  5FKR A;  4A2L A;  4H5J A;  4A11 A;  4A0B A;  3OTT A;  2AGZ A;  3OKY A;  3ULE C;  2H3X A;  1P22 A;  4J77 A;  2P9P C;  5H17 A;  3DXM C;  3NVN A;  3SN6 B;  5EMM B;  3I8C A;  5FKS A;  4JSX C;  1N6E A;  4CY3 A;  4L1Q D;  4D6V A;  5FKQ A;  3PXS D;  4FA1 D;  4X60 B;  4J82 A;  5CXB B;  1PBY B;  3BG0 A;  5I5J A;  1N6D A;  2B4E A;  4PSW B;  3EI1 A;  4ZOV A;  3DM0 A;  4GM8 A;  4TZ4 A;  4GZ8 A;  4HDJ A;  2P9S C;  5EMJ B;  4YVD A;  5FA5 B;  3IIY A;  5A2Q g;  1A0R B;  4A09 B;  2CE8 A;  4CY2 A;  3VGZ A;  5CXB A;  4U1E I;  3IJ0 A;  1MG3 A;  1VYH C;  1GOT B;  1NEX B;  3EU7 A;  4BUJ C;  3IKO A;  4A0A A;  2H9N A;  3FRX A;  4LG8 A;  4JT6 C;  5EMK B;  4GGD A;  5IT9 g;  4IMM A;  2H6N A;  3NVX A;  3RLM D;  5CXC A;  4IA9 A;  3SHF A;  2UZY B;  3JZH A;  4N14 A;  2H6Q A;  2AGX A;  2IUR A;  1MDA H;  3OW8 A;  2YNP A;  4UI9 R;  2H13 A;  3EI4 B;  3B7F A;  3BWS A;  3I7P A;  3MZK A;  3KRW B;  5HYN B;  5SXM A;  5EM2 B;  3OKT A;  4J87 A;  3JAM g;  3SVW D;  5I5I A;  4FAN D;  1PI6 A;  3I7K A;  2H47 A;  4U7A A;  2I0T A;  2YBA A;  2EBS A;  3N0E A;  1GG2 B;  5AFU 3;  2H9P A;  3UVK A;  5IGQ A;  2P9I C;  4PNK B;  3EI2 A;  3W15 A;  4XEI C;  5CYK B;  5HE1 B;  3NVQ A;  4ZN4 A;  2GC7 A;  4GMB A;  2BCJ B;  3EG6 A;  4PBZ A;  4CI3 A;  2H6K A;  4GQB B;  2CO0 C;  2G99 A;  3C99 A;  3JZN A;  4OZU A;  4GGC A;  3MXX A;  5TEE A;  3SLE D;  3EI3 A;  3UR4 A;  2BBK H;  2OIZ A;  3L4M D;  2PM6 B;  1TBG A;  4PXW A;  4ERQ A;  3EI1 B;  2OJY A;  4E54 A;  1GP2 B;  4X3E A;  2YB8 B;  2HKM A;  4CY1 A;  2IWK A;  4ZOX A;  2TRC B;  3DWL C;  3V7D B;  4A2M A;  4QQE A;  3AL8 A;  5EAM A;  4L3G D;  3EWE A;  4CI8 A;  2HXC A;  4CZY A;  4J8G A;  2QC5 A;  2CN2 A;  4A0A B;  2XL2 A;  3OL2 A;  3RFG A;  3EI2 B;  1MG2 A;  3I89 A;  1GXR A;  5C2W B;  2YNN A;  2I3T A;  4GM9 A;  3SMR A;  5IGO A;  4J86 A;  3SFZ A;  2XYI A;  4ES0 A;  4FB1 D;  2AQ5 A;  4L9O A;  2H14 A;  1JJU B;  3P4F A;  3IJC A;  3RN0 D;  1Q47 A;  5FKT A;  4ESG A;  4AOW A;  4J8B A;  3K26 A;  5FQD A;  2XL3 A;  4GQ2 P;  3V5W B;  3I7L A;  3UVL A;  1XIP A;  3AL8 B;  5AMS A;  5EML B;  3L4O D;  3C5M A;  5TF2 A;  3JB9 L;  3AFC A;  3PVU B;  2B5L A;  5HE2 B;  3AH8 B;  1K32 A;  2CE9 A;  3I8E A;  2B5N A;  3J80 g;  2PBI B;  3JRP A;  4I79 A;  1U4C A;  1B9Y A;  4NSX A;  5GMK n;  5IJ7 E;  2P9U C;  3DSM A;  3EMH A;  2YNO A;  4PBY A;  4AEZ A;  5K19 A;  3F3P A;  3F3G A;  3KRX B;  2Z2O A;  4OWR A;  3VA6 A;  3JRO A;  4ERY A;  2GNQ A;  4E5Z B;  3DXK C;  4Y5R D;  3IIW A;  3IJ1 A;  4JD2 C;  3RFH A;  3N0D A;  2HJB A;  3OKY B;  5B4W A;  5EM2 A;  3MKS B;  5H1M A;  4D0K A;  2J57 G;  4O3T B;  2OK6 A;  1PGU A;  3CIK B;  4JSP C;  3PE7 A;  3PSC B;  2HES X;  5IC7 A;  3GFC A;  1N6F A;  1PEV A;  4J81 A;  4CZX A;  4LGN A;  1TYQ C;  4PC0 A;  3BG1 A;  4MK0 B;  3SWS D;  2AGY A;  4LG9 A;  3AL9 A;  5C9Z B;  4A09 A;  3MZL A;  1OMW B;  2PM9 B;  2XU7 A;  3UKU C;  5HE0 B;  4K3J B;  4XYI A;  5GXH A;  2AGW A;  1U2V C;  4L3H D;  2G9A A;  4PSX B;  1SQJ A;  3MMY A;  3RMZ D;  3PXT D;  3RRM C;  4QRJ A;  3I7O A;  4Z8L A;  5EAL A;  5GSA A;  3EI4 A;  4XYH A;  5FXY A;  4QL1 A;  3SXT D;  5TDH B;  4A11 B;  4A0B B;  1L0Q A;  5H14 A;  4CI1 A;  5KDO B;  3CFS B;  4ZOY A;  5HQG A;  3SCY A;  2IWF A;  4X63 B;  3SBR A;  2OVR B;  2I0R A;  3JPX A;  3SJL D;  4JT5 C;  4Y7R A;  2Z2N A;  4O3U B;  5EAR A;  2CO0 A;  2MTA H;  2W18 A;  2P9K C;  4FA4 D;  5CXC B;  1QNI A;  3PVW B;  2AH0 A;  3UKR C;  3A0F A;  3J81 g;  2Q7Q A;  5FLX g;  1NR0 A;  3UVM A;  4FA5 D;  4K3I D;  2P9L C;  2OK4 A;  5EAP A;  3ORV D;  3SBQ A;  2GC4 A;  3OKW A;  3PXW D;  4CY5 A;  2CNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...