3C99A

Structural basis of histone h4 recognition by p55
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
405
structure length
380
Chain Sequence
SFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPCQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of histone H4 recognition by p55.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repressor
molecule keywords Chromatin assembly factor 1 p55 subunit
total genus 88
structure length 380
sequence length 405
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c99A00
2IURA 4L3HD 4Z8LA 2HKMA 3FGBA 2IUPA 3NVQA 4FHLA 4OWRA 4FA4D 5JWZA 5EMMB 1PI6A 3E0CA 1PEVA 4AOWA 2H68A 3CFSB 5CXCB 4CY2A 1P22A 3JZNA 2OJYA 3W15A 2IWKA 1SHYB 4QL1A 3CIKB 5HE3B 4ZN4A 2AGXA 4X3EA 2CO0A 4A0AB 3NVXA 4R7AB 2H3XA 5CYKA 1ERJA 3I7PA 3UVLA 5IT9g 4A0BA 3EWEA 4BUJC 2Z2NA 4PXWA 5EARA 3SHFA 4X60B 3I7OA 5I5JA 5A2Qg 1NR0A 4JXMA 1YFQA 3GREA 4LGNA 3C75H 3EI2A 2I0SA 4FA5D 3I8CA 2PBIB 5I5IA 1OMWB 5HYNB 4ES0A 4PC0A 4X63B 5FA5B 2J57G 2H13A 3NVNA 3L4MD 2CNXA 2J56H 2H6NA 2P9UC 4A2LA 3KRXB 1N6DA 2Z2OA 3ORVD 5K19A 3OTTA 2AH0A 3SN6B 3RLMD 2I0TA 2G9AA 5EAMA 2P9SC 3SJLD 4BH6A 2OK4A 3SVWD 3UVNA 4O3UB 3BG1A 4A7JA 5IC7A 4CI1A 3EG6A 3IJCA 4J77A 4FWWA 2H47A 5KDOB 2HYEA 2G99A 3JZHA 2H9LA 4PSXB 2HESX 3EI1A 4N14A 3MXXA 4X61B 3I7LA 3SBRA 3KRWB 1OLZA 3JB9L 4CC9A 3ODTA 4L9OA 5EMKB 4E54B 4CI3A 4GMBA 4IMMA 5TDHB 5AFU3 4A11A 2YBAA 3P4FA 3RSEC 2XL2A 3PXTD 2XYIA 3MKQA 5TEEA 5IGQA 2BBKH 3J81g 1A0RB 2B5LA 1RI6A 3FRXA 3N0EA 2AH1A 3ULEC 2AGYA 2QXVA 4MK0B 3IJ0A 2IUVA 3EMHA 3C99A 4H5IA 2P9KC 5CXBB 4ZOVA 4FA1D 5FXYA 4E5ZA 5CXBA 4Y5RD 2CN3A 3I7HA 4UI9R 4J87A 2W18A 4J8BA 5EM2A 4GGDA 4G56B 4JSXC 2OVPB 3PSCB 3SFZA 4GQBB 3I2NA 3JZGA 4CZYA 4LG9A 5EMJB 3SBQA 2PM9B 4J8GA 5TF2A 4QRJA 2YB8B 3DWLC 3RMZD 3SBPA 4XYIA 4CZXA 3B7FA 2YNNA 3SCYA 2HJ4A 2H9NA 2GC4A 3DM0A 5IJ7E 1NEXB 3JROA 2CE8A 4K3JB 4Y7RA 4J84A 4FA9D 5HE2B 1L0QA 2PM6B 4A0BB 3J80g 3AL8B 3IJ1A 4J81A 5FLXg 3JPXA 4IA9A 3PXWD 4TZ4A 3AFCA 1U2VC 4EWRA 5K1CC 3RRMC 2HJBA 2AGZA 4CY1A 4E5ZB 3I7KA 4ZOXA 3I8EA 5EMLB 5HE1B 3K26A 1U4CA 2IUQA 2I0RA 3OKYB 3PE7A 1GP2B 3RN0D 4PBYA 2XL3A 5H17A 1MG2A 4O9DA 1JJUB 3L4OD 4ZOYA 2O9KA 2CE9A 2B4EA 2B5MA 3AH8B 3DXMC 3CFVA 1PBYB 3DXKC 3EU7A 1GXRA 2H9MA 2OIZA 2CO0C 4JSPC 5EAPA 1JMZB 2I3SA 2EBSA 2MTAH 1B9XA 5I5MA 3F3FA 5FKTA 5TEFA 4OZUA 4GZ8A 3C5MA 3UVOA 4A09A 4KFMB 4D6VA 3C9CA 2J55H 3UKRC 4A11B 2OK6A 4BL0A 4J73A 2AGWA 5IGOA 2P9NC 3F3GA 4JD2C 3AL9A 3OW8A 5B4WA 5FQDA 3IIYA 4J0WA 3PVUB 1MG3A 1JMXB 1JOFA 1XIPA 2IWFA 2GNQA 3BWSA 4ERQA 1PGUA 4GQ2P 1K8KC 2OVRB 4XYHA 3I89A 5GXHA 3VH0A 4J78A 3N0DA 3SLED 3K27A 4U1EI 5GSAA 2P9IC 4L3GD 4FB1D 5IJ8E 3UKUC 5CXCA 4XEIC 4AEZA 2HXCA 4L1QD 4JSNC 4HDJA 3MZLA 4ESGA 3BG0A 3U4YA 2QC5A 1FWXA 4GQ1A 4GM3A 1N6FA 2YMUA 4QQEA 4YVDA 3V9FA 2Z2PA 3F3PA 3V5WB 2BCJB 2UZXB 4GGAA 3EI3A 4A08B 3PXSD 4JT6C 4PNKB 1Q47A 4A09B 3V7DB 4PSWB 4ZOZA 4J82A 1S4UX 1R5MA 5CYKB 3OKWA 2Q7QA 3AL8A 4A2MA 4QT8A 3IKOA 4JSVC 4H5JA 4ERZA 1GG2B 4O3TB 5SXMA 4GM8A 3I7NA 4D0KA 5GXIA 1B9YA 2P9PC 3VA6A 5C9ZB 4I79A 2H6KA 1MDAH 2H6QA 2TRCB 2IAAA 2YNPA 4J0XA 4A0AA 3GFCA 2AGLA 3OKYA 1VYHC 3HFQA 4J79A 4O45A 2H14A 5EM2B 4FAVD 3OL2A 2CN2A 1N6EA 3MZKA 5H14A 4CY3A 5GMKn 3OL2B 3SXTD 4PBZA 1TYQC 2UZYB 5FKRA 4O1QD 2B5NA 4CY5A 5HQGA 3ZWLB 5FKQA 4K3ID 3SWSD 4E54A 4U7AA 1GOTB 5AJAA 1XKSA 3EI2B 3A0FA 3UVKA 3JRPA 3UR4A 1SQ9A 4CZVA 5HE0B 5C2VB 1QNIA 2HKRA 3SMRA 2OVQB 3EI4B 4CI8A 2H9PA 3EI1B 1XHMA 5FKSA 2YNOA 4FAND 3PSLA 4NSXA 3VGZA 5H1MA 2GC7A 3EI4A 3MKSB 3OKTA 1TBGA 4J86A 3JAMg 3IIWA 2XU7A 1K32A 2PM9A 4GM9A 5AMSA 3EI3B 3UVMA 2AQ5A 5THAA 4A08A 3PVWB 4GGCA 3RFGA 3FM0A 4LG8A 2I3TA 3MMYA 4ERYA 5EALA 4JT5C 3RFHA 5C2WB 2PM7B 3RN1D 4CI2A 1SQJA 3DSMA 2P9LC
chains in the Genus database with same CATH superfamily
3EQ8A 2IURA 4L3HD 4MMYA 4JHPC 4Z8LA 3V4PA 2HKMA 3FGBA 2IUPA 3NVQA 1K3IA 4FHLA 1YR2A 4OWRA 4FA4D 5JWZA 3IUQA 5EMMB 1VE7A 1PI6A 3E0CA 1PEVA 4AOWA 5M5SA 2H68A 5M5TA 3IJEA 3CFSB 2VC2A 4BCCA 5CXCB 3O4JA 4CY2A 4BCBA 1P22A 3JZNA 2OJYA 3W15A 2IWKA 1SHYB 4QL1A 3CIKB 5HE3B 4ZN4A 2AGXA 4X3EA 2QZPA 2CO0A 4A0AB 3NVXA 4R7AB 2VDLA 2H3XA 3GD1I 3K72A 1ERJA 3I7PA 5CYKA 3UVLA 4D9SA 5IT9g 5E6SA 4A0BA 1VZ3A 3EWEA 4BUJC 2Z2NA 4PXWA 5EARA 1E5TA 1O6FA 3SHFA 4JHNA 4X60B 3I7OA 5I5JA 5A2Qg 1BPOA 1NR0A 4JXMA 1YFQA 3GREA 4LGNA 4RE6A 3C75H 3EI2A 2I0SA 4FA5D 3I8CA 2PBIB 4WK0A 5I5IA 1OMWB 5HYNB 4ES0A 4PC0A 4X63B 5FA5B 2J57G 4NC4A 3NIDA 2H13A 3NVNA 3L4MD 2CNXA 2J56H 2H6NA 2P9UC 4DNUA 4A2LA 3KRXB 4UM8A 1N6DA 2Z2OA 3ORVD 5K19A 3OTTA 2AH0A 3SN6B 3RLMD 2I0TA 2EIBA 5E6RA 2G9AA 5EAMA 2P9SC 5HDBA 3SJLD 4BP9A 1C9IA 4BH6A 2OK4A 3SVWD 3UVNA 1H2ZA 4O3UB 3BG1A 2VDQA 4A7JA 4O2WA 1A12A 3IUJA 5IC7A 4NBMA 4CI1A 3V4VA 3EG6A 3T3PA 3IJCA 4J77A 4FWWA 2H47A 5KDOB 1GOHA 2HYEA 2G99A 3JZHA 2H9LA 4PSXB 2HESX 1I2MB 3EI1A 3MVDK 4N14A 3MXXA 4X61B 3I7LA 3SBRA 2HU7A 3KRWB 1OLZA 2VDNA 3JB9L 4G1MA 4CC9A 3ODTA 4L9OA 5EMKB 4E54B 4CI3A 4GMBA 4IMMA 5TDHB 5AFU3 4A11A 2YBAA 3P4FA 3RSEC 1H2WA 2XL2A 3PXTD 2XYIA 3MKQA 5TEEA 5IGQA 2BBKH 3J81g 1A0RB 2B5LA 1RI6A 3FRXA 3N0EA 2AH1A 1QFMA 3ULEC 2AGYA 2QXVA 4MK0B 3IJ0A 2IUVA 3EMHA 3C99A 3QHYB 4H5IA 2P9KC 5CXBB 4ZOVA 4FA1D 5FXYA 4E5ZA 4DNVA 3K6SA 5CXBA 4Y5RD 2CN3A 3I7HA 3ZDZA 2EICA 4UI9R 3EQ9A 4J87A 2W18A 4J8BA 5EM2A 3ZE0A 1H2YA 4GGDA 4G56B 4JSXC 2OVPB 3PSCB 5E6UA 3SFZA 4GQBB 5M61A 3I2NA 3JZGA 4RE5A 4CZYA 3FCSA 4LG9A 5EMJB 3SBQA 2PM9B 4AMZA 5C86A 1UOPA 3IULA 4J8GA 5TF2A 4QRJA 2YB8B 3DWLC 4WK4A 3RMZD 3SBPA 4XYIA 4AMYA 4CZXA 3B7FA 2YNNA 3SCYA 2HJ4A 2H9NA 3GC3B 2GC4A 3DM0A 5IJ7E 1VE6A 1NEXB 1GOFA 3JROA 2CE8A 4K3JB 4Y7RA 3IURA 4J84A 4FA9D 5HE2B 1L0QA 2PM6B 3VI3A 4A0BB 3J80g 4L1MA 3AL8B 3IJ1A 4J81A 5FLXg 5FFGA 3JPXA 4IA9A 3PXWD 4MMZA 4TZ4A 3AFCA 1U2VC 2JKXA 4EWRA 3IVMA 5K1CC 3RRMC 2HJBA 2VDMA 2AGZA 2VZ3A 4CY1A 4E5ZB 4WK2A 3I7KA 4ZOXA 3I8EA 5EMLB 5HE1B 3K26A 1U4CA 3ZE2A 2IUQA 2HU5A 2I0RA 3OKYB 3PE7A 1GP2B 3RN0D 4PBYA 2XL3A 5H17A 1MG2A 4O9DA 1JJUB 3L4OD 1TYEA 4UM9A 4ZOYA 4NENA 3NIGA 2O9KA 2CE9A 3DDUA 2B4EA 2B5MA 3AH8B 3DXMC 3CFVA 2VZ1A 1PBYB 3DXKC 3EU7A 1GXRA 2H9MA 3ZDXA 2OIZA 2CO0C 4JSPC 5EAPA 1JMZB 2I3SA 4AN1A 2EBSA 2MTAH 1B9XA 5I5MA 1E8NA 3F3FA 5FKTA 5TEFA 5M5RA 4OZUA 4GZ8A 3C5MA 3UVOA 4A09A 4KFMB 2VDKA 4D6VA 3C9CA 2J55H 3UKRC 4A11B 2OK6A 4BL0A 4J73A 2AGWA 3FCUA 5IGOA 2P9NC 3F3GA 4JD2C 3AL9A 2HU8A 3OW8A 5B4WA 1M1XA 5FQDA 3IIYA 4J0WA 3PVUB 4Z7QA 3IUMA 1MG3A 1JMXB 3T3MA 1JOFA 1XIPA 2IWFA 2GNQA 3BWSA 1JTDB 4ERQA 1C9LA 1PGUA 4GQ2P 1K8KC 2OVRB 4XYHA 3I89A 5GXHA 3EQ7A 3VH0A 2EIEA 1VZ2A 4J78A 3ZDYA 3N0DA 3SLED 3K27A 4U1EI 5GSAA 1UTCA 2P9IC 4L3GD 4FB1D 5IJ8E 3UKUC 1GOGA 1UOOA 5CXCA 4AN0A 4XEIC 4AEZA 2HXCA 4L1QD 4JSNC 4BCDA 4HDJA 3OF7A 2XDWA 3MZLA 4ESGA 3BG0A 5M5UA 3U4YA 2QC5A 1FWXA 4GQ1A 4GM3A 1N6FA 2YMUA 4QQEA 4YVDA 3O4HA 2Z2PA 3V9FA 3F3PA 3V5WB 2BCJB 2UZXB 4GGAA 3EI3A 4A08B 3ZE1A 3PXSD 1UOQA 4JT6C 4PNKB 1Q47A 4A09B 3NIFA 4WJKA 3V7DB 4PSWB 4ZOZA 4J82A 1S4UX 3MUOA 1R5MA 5CYKB 3OKWA 2Q7QA 3AL8A 4A2MA 4QT8A 3IKOA 4JSVC 4H5JA 4ERZA 1GG2B 4O3TB 5SXMA 4GM8A 2VDPA 3I7NA 4D0KA 5GXIA 1B9YA 2P9PC 3VA6A 2QR5A 5C9ZB 1L5GA 4I79A 2XZGA 2WQ8A 2H6KA 1MDAH 1QFSA 2H6QA 2TRCB 2IAAA 2YNPA 4J0XA 2VDRA 1H2XA 4A0AA 3GFCA 2AGLA 3OKYA 2EIDA 1VYHC 3HFQA 4J79A 4O45A 2H14A 1E8MA 4G55A 4QAMA 4MMXA 4FAVD 5EM2B 3OL2A 2BKLA 3O4GA 2CN2A 1N6EA 5C92A 3MZKA 5H14A 4CY3A 5GMKn 3OL2B 3SXTD 3IUNA 4PBZA 1TYQC 2UZYB 5FKRA 4DNWA 4O1QD 2B5NA 4CY5A 5HQGA 3ZWLB 5FKQA 4K3ID 3SWSD 4E54A 4U7AA 1GOTB 5AJAA 1JV2A 1XKSA 3EI2B 1O6GA 2XE4A 5M5VA 3A0FA 3UVKA 3JRPA 3UR4A 1SQ9A 4CZVA 5HE0B 5C2VB 1QNIA 2HKRA 3SMRA 2OVQB 3EI4B 4Z7NA 4CI8A 2H9PA 3EI1B 1XHMA 5FFOA 5FKSA 4BP8A 2YNOA 4FAND 3PSLA 4NSXA 3VGZA 3K71A 5H1MA 4AX4A 2GC7A 3EI4A 3MKSB 3KCIA 3OKTA 4NAAA 1TBGA 3VI4A 4J86A 4O02A 3JAMg 3QI0A 3IIWA 2XU7A 1K32A 2PM9A 4GM9A 5AMSA 3EI3B 3UVMA 2AQ5A 5THAA 1T2XA 4A08A 3PVWB 4GGCA 3RFGA 3FM0A 4LG8A 3O4IA 1U8CA 4Z7OA 2I3TA 3MMYA 4ERYA 4IRZA 3MUNA 5EALA 4JT5C 3RFHA 5C2WB 2PM7B 3RN1D 4CI2A 4G1EA 2VDOA 1SQJA 3DSMA 2P9LC
chains in the Genus database with same CATH topology
2IURA 4L3HD 4Z8LA 2HKMA 3FGBA 2IUPA 3NVQA 4FHLA 4OWRA 4FA4D 5JWZA 5EMMB 1PI6A 3E0CA 1PEVA 4AOWA 2H68A 3CFSB 5CXCB 4CY2A 1P22A 3JZNA 2OJYA 3W15A 2IWKA 1SHYB 4QL1A 3CIKB 5HE3B 4ZN4A 2AGXA 4X3EA 2CO0A 4A0AB 3NVXA 4R7AB 2H3XA 5CYKA 1ERJA 3I7PA 3UVLA 5IT9g 4A0BA 3EWEA 4BUJC 2Z2NA 4PXWA 5EARA 3SHFA 4X60B 3I7OA 5I5JA 5A2Qg 1NR0A 4JXMA 1YFQA 3GREA 4LGNA 3C75H 3EI2A 2I0SA 4FA5D 3I8CA 2PBIB 5I5IA 1OMWB 5HYNB 4ES0A 4PC0A 4X63B 5FA5B 2J57G 2H13A 3NVNA 3L4MD 2CNXA 2J56H 2H6NA 2P9UC 4A2LA 3KRXB 1N6DA 2Z2OA 3ORVD 5K19A 3OTTA 2AH0A 3SN6B 3RLMD 2I0TA 2G9AA 5EAMA 2P9SC 3SJLD 4BH6A 2OK4A 3SVWD 3UVNA 4O3UB 3BG1A 4A7JA 5IC7A 4CI1A 3EG6A 3IJCA 4J77A 4FWWA 2H47A 5KDOB 2HYEA 2G99A 3JZHA 2H9LA 4PSXB 2HESX 3EI1A 4N14A 3MXXA 4X61B 3I7LA 3SBRA 3KRWB 1OLZA 3JB9L 4CC9A 3ODTA 4L9OA 5EMKB 4E54B 4CI3A 4GMBA 4IMMA 5TDHB 5AFU3 4A11A 2YBAA 3P4FA 3RSEC 2XL2A 3PXTD 2XYIA 3MKQA 5TEEA 5IGQA 2BBKH 3J81g 1A0RB 2B5LA 1RI6A 3FRXA 3N0EA 2AH1A 3ULEC 2AGYA 2QXVA 4MK0B 3IJ0A 2IUVA 3EMHA 3C99A 4H5IA 2P9KC 5CXBB 4ZOVA 4FA1D 5FXYA 4E5ZA 5CXBA 4Y5RD 2CN3A 3I7HA 4UI9R 4J87A 2W18A 4J8BA 5EM2A 4GGDA 4G56B 4JSXC 2OVPB 3PSCB 3SFZA 4GQBB 3I2NA 3JZGA 4CZYA 4LG9A 5EMJB 3SBQA 2PM9B 4J8GA 5TF2A 4QRJA 2YB8B 3DWLC 3RMZD 3SBPA 4XYIA 4CZXA 3B7FA 2YNNA 3SCYA 2HJ4A 2H9NA 2GC4A 3DM0A 5IJ7E 1NEXB 3JROA 2CE8A 4K3JB 4Y7RA 4J84A 4FA9D 5HE2B 1L0QA 2PM6B 4A0BB 3J80g 3AL8B 3IJ1A 4J81A 5FLXg 3JPXA 4IA9A 3PXWD 4TZ4A 3AFCA 1U2VC 4EWRA 5K1CC 3RRMC 2HJBA 2AGZA 4CY1A 4E5ZB 3I7KA 4ZOXA 3I8EA 5EMLB 5HE1B 3K26A 1U4CA 2IUQA 2I0RA 3OKYB 3PE7A 1GP2B 3RN0D 4PBYA 2XL3A 5H17A 1MG2A 4O9DA 1JJUB 3L4OD 4ZOYA 2O9KA 2CE9A 2B4EA 2B5MA 3AH8B 3DXMC 3CFVA 1PBYB 3DXKC 3EU7A 1GXRA 2H9MA 2OIZA 2CO0C 4JSPC 5EAPA 1JMZB 2I3SA 2EBSA 2MTAH 1B9XA 5I5MA 3F3FA 5FKTA 5TEFA 4OZUA 4GZ8A 3C5MA 3UVOA 4A09A 4KFMB 4D6VA 3C9CA 2J55H 3UKRC 4A11B 2OK6A 4BL0A 4J73A 2AGWA 5IGOA 2P9NC 3F3GA 4JD2C 3AL9A 3OW8A 5B4WA 5FQDA 3IIYA 4J0WA 3PVUB 1MG3A 1JMXB 1JOFA 1XIPA 2IWFA 2GNQA 3BWSA 4ERQA 1PGUA 4GQ2P 1K8KC 2OVRB 4XYHA 3I89A 5GXHA 3VH0A 4J78A 3N0DA 3SLED 3K27A 4U1EI 5GSAA 2P9IC 4L3GD 4FB1D 5IJ8E 3UKUC 5CXCA 4XEIC 4AEZA 2HXCA 4L1QD 4JSNC 4HDJA 3MZLA 4ESGA 3BG0A 3U4YA 2QC5A 1FWXA 4GQ1A 4GM3A 1N6FA 2YMUA 4QQEA 4YVDA 3V9FA 2Z2PA 3F3PA 3V5WB 2BCJB 2UZXB 4GGAA 3EI3A 4A08B 3PXSD 4JT6C 4PNKB 1Q47A 4A09B 3V7DB 4PSWB 4ZOZA 4J82A 1S4UX 1R5MA 5CYKB 3OKWA 2Q7QA 3AL8A 4A2MA 4QT8A 3IKOA 4JSVC 4H5JA 4ERZA 1GG2B 4O3TB 5SXMA 4GM8A 3I7NA 4D0KA 5GXIA 1B9YA 2P9PC 3VA6A 5C9ZB 4I79A 2H6KA 1MDAH 2H6QA 2TRCB 2IAAA 2YNPA 4J0XA 4A0AA 3GFCA 2AGLA 3OKYA 1VYHC 3HFQA 4J79A 4O45A 2H14A 5EM2B 4FAVD 3OL2A 2CN2A 1N6EA 3MZKA 5H14A 4CY3A 5GMKn 3OL2B 3SXTD 4PBZA 1TYQC 2UZYB 5FKRA 4O1QD 2B5NA 4CY5A 5HQGA 3ZWLB 5FKQA 4K3ID 3SWSD 4E54A 4U7AA 1GOTB 5AJAA 1XKSA 3EI2B 3A0FA 3UVKA 3JRPA 3UR4A 1SQ9A 4CZVA 5HE0B 5C2VB 1QNIA 2HKRA 3SMRA 2OVQB 3EI4B 4CI8A 2H9PA 3EI1B 1XHMA 5FKSA 2YNOA 4FAND 3PSLA 4NSXA 3VGZA 5H1MA 2GC7A 3EI4A 3MKSB 3OKTA 1TBGA 4J86A 3JAMg 3IIWA 2XU7A 1K32A 2PM9A 4GM9A 5AMSA 3EI3B 3UVMA 2AQ5A 5THAA 4A08A 3PVWB 4GGCA 3RFGA 3FM0A 4LG8A 2I3TA 3MMYA 4ERYA 5EALA 4JT5C 3RFHA 5C2WB 2PM7B 3RN1D 4CI2A 1SQJA 3DSMA 2P9LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUR A;  4L3H D;  4Z8L A;  2HKM A;  3FGB A;  2IUP A;  3NVQ A;  4FHL A;  4OWR A;  4FA4 D;  5JWZ A;  5EMM B;  1PI6 A;  3E0C A;  1PEV A;  4AOW A;  2H68 A;  3CFS B;  5CXC B;  4CY2 A;  1P22 A;  3JZN A;  2OJY A;  3W15 A;  2IWK A;  1SHY B;  4QL1 A;  3CIK B;  5HE3 B;  4ZN4 A;  2AGX A;  4X3E A;  2CO0 A;  4A0A B;  3NVX A;  4R7A B;  2H3X A;  5CYK A;  1ERJ A;  3I7P A;  3UVL A;  5IT9 g;  4A0B A;  3EWE A;  4BUJ C;  2Z2N A;  4PXW A;  5EAR A;  3SHF A;  4X60 B;  3I7O A;  5I5J A;  5A2Q g;  1NR0 A;  4JXM A;  1YFQ A;  3GRE A;  4LGN A;  3C75 H;  3EI2 A;  2I0S A;  4FA5 D;  3I8C A;  2PBI B;  5I5I A;  1OMW B;  5HYN B;  4ES0 A;  4PC0 A;  4X63 B;  5FA5 B;  2J57 G;  2H13 A;  3NVN A;  3L4M D;  2CNX A;  2J56 H;  2H6N A;  2P9U C;  4A2L A;  3KRX B;  1N6D A;  2Z2O A;  3ORV D;  5K19 A;  3OTT A;  2AH0 A;  3SN6 B;  3RLM D;  2I0T A;  2G9A A;  5EAM A;  2P9S C;  3SJL D;  4BH6 A;  2OK4 A;  3SVW D;  3UVN A;  4O3U B;  3BG1 A;  4A7J A;  5IC7 A;  4CI1 A;  3EG6 A;  3IJC A;  4J77 A;  4FWW A;  2H47 A;  5KDO B;  2HYE A;  2G99 A;  3JZH A;  2H9L A;  4PSX B;  2HES X;  3EI1 A;  4N14 A;  3MXX A;  4X61 B;  3I7L A;  3SBR A;  3KRW B;  1OLZ A;  3JB9 L;  4CC9 A;  3ODT A;  4L9O A;  5EMK B;  4E54 B;  4CI3 A;  4GMB A;  4IMM A;  5TDH B;  5AFU 3;  4A11 A;  2YBA A;  3P4F A;  3RSE C;  2XL2 A;  3PXT D;  2XYI A;  3MKQ A;  5TEE A;  5IGQ A;  2BBK H;  3J81 g;  1A0R B;  2B5L A;  1RI6 A;  3FRX A;  3N0E A;  2AH1 A;  3ULE C;  2AGY A;  2QXV A;  4MK0 B;  3IJ0 A;  2IUV A;  3EMH A;  3C99 A;  4H5I A;  2P9K C;  5CXB B;  4ZOV A;  4FA1 D;  5FXY A;  4E5Z A;  5CXB A;  4Y5R D;  2CN3 A;  3I7H A;  4UI9 R;  4J87 A;  2W18 A;  4J8B A;  5EM2 A;  4GGD A;  4G56 B;  4JSX C;  2OVP B;  3PSC B;  3SFZ A;  4GQB B;  3I2N A;  3JZG A;  4CZY A;  4LG9 A;  5EMJ B;  3SBQ A;  2PM9 B;  4J8G A;  5TF2 A;  4QRJ A;  2YB8 B;  3DWL C;  3RMZ D;  3SBP A;  4XYI A;  4CZX A;  3B7F A;  2YNN A;  3SCY A;  2HJ4 A;  2H9N A;  2GC4 A;  3DM0 A;  5IJ7 E;  1NEX B;  3JRO A;  2CE8 A;  4K3J B;  4Y7R A;  4J84 A;  4FA9 D;  5HE2 B;  1L0Q A;  2PM6 B;  4A0B B;  3J80 g;  3AL8 B;  3IJ1 A;  4J81 A;  5FLX g;  3JPX A;  4IA9 A;  3PXW D;  4TZ4 A;  3AFC A;  1U2V C;  4EWR A;  5K1C C;  3RRM C;  2HJB A;  2AGZ A;  4CY1 A;  4E5Z B;  3I7K A;  4ZOX A;  3I8E A;  5EML B;  5HE1 B;  3K26 A;  1U4C A;  2IUQ A;  2I0R A;  3OKY B;  3PE7 A;  1GP2 B;  3RN0 D;  4PBY A;  2XL3 A;  5H17 A;  1MG2 A;  4O9D A;  1JJU B;  3L4O D;  4ZOY A;  2O9K A;  2CE9 A;  2B4E A;  2B5M A;  3AH8 B;  3DXM C;  3CFV A;  1PBY B;  3DXK C;  3EU7 A;  1GXR A;  2H9M A;  2OIZ A;  2CO0 C;  4JSP C;  5EAP A;  1JMZ B;  2I3S A;  2EBS A;  2MTA H;  1B9X A;  5I5M A;  3F3F A;  5FKT A;  5TEF A;  4OZU A;  4GZ8 A;  3C5M A;  3UVO A;  4A09 A;  4KFM B;  4D6V A;  3C9C A;  2J55 H;  3UKR C;  4A11 B;  2OK6 A;  4BL0 A;  4J73 A;  2AGW A;  5IGO A;  2P9N C;  3F3G A;  4JD2 C;  3AL9 A;  3OW8 A;  5B4W A;  5FQD A;  3IIY A;  4J0W A;  3PVU B;  1MG3 A;  1JMX B;  1JOF A;  1XIP A;  2IWF A;  2GNQ A;  3BWS A;  4ERQ A;  1PGU A;  4GQ2 P;  1K8K C;  2OVR B;  4XYH A;  3I89 A;  5GXH A;  3VH0 A;  4J78 A;  3N0D A;  3SLE D;  3K27 A;  4U1E I;  5GSA A;  2P9I C;  4L3G D;  4FB1 D;  5IJ8 E;  3UKU C;  5CXC A;  4XEI C;  4AEZ A;  2HXC A;  4L1Q D;  4JSN C;  4HDJ A;  3MZL A;  4ESG A;  3BG0 A;  3U4Y A;  2QC5 A;  1FWX A;  4GQ1 A;  4GM3 A;  1N6F A;  2YMU A;  4QQE A;  4YVD A;  3V9F A;  2Z2P A;  3F3P A;  3V5W B;  2BCJ B;  2UZX B;  4GGA A;  3EI3 A;  4A08 B;  3PXS D;  4JT6 C;  4PNK B;  1Q47 A;  4A09 B;  3V7D B;  4PSW B;  4ZOZ A;  4J82 A;  1S4U X;  1R5M A;  5CYK B;  3OKW A;  2Q7Q A;  3AL8 A;  4A2M A;  4QT8 A;  3IKO A;  4JSV C;  4H5J A;  4ERZ A;  1GG2 B;  4O3T B;  5SXM A;  4GM8 A;  3I7N A;  4D0K A;  5GXI A;  1B9Y A;  2P9P C;  3VA6 A;  5C9Z B;  4I79 A;  2H6K A;  1MDA H;  2H6Q A;  2TRC B;  2IAA A;  2YNP A;  4J0X A;  4A0A A;  3GFC A;  2AGL A;  3OKY A;  1VYH C;  3HFQ A;  4J79 A;  4O45 A;  2H14 A;  5EM2 B;  4FAV D;  3OL2 A;  2CN2 A;  1N6E A;  3MZK A;  5H14 A;  4CY3 A;  5GMK n;  3OL2 B;  3SXT D;  4PBZ A;  1TYQ C;  2UZY B;  5FKR A;  4O1Q D;  2B5N A;  4CY5 A;  5HQG A;  3ZWL B;  5FKQ A;  4K3I D;  3SWS D;  4E54 A;  4U7A A;  1GOT B;  5AJA A;  1XKS A;  3EI2 B;  3A0F A;  3UVK A;  3JRP A;  3UR4 A;  1SQ9 A;  4CZV A;  5HE0 B;  5C2V B;  1QNI A;  2HKR A;  3SMR A;  2OVQ B;  3EI4 B;  4CI8 A;  2H9P A;  3EI1 B;  1XHM A;  5FKS A;  2YNO A;  4FAN D;  3PSL A;  4NSX A;  3VGZ A;  5H1M A;  2GC7 A;  3EI4 A;  3MKS B;  3OKT A;  1TBG A;  4J86 A;  3JAM g;  3IIW A;  2XU7 A;  1K32 A;  2PM9 A;  4GM9 A;  5AMS A;  3EI3 B;  3UVM A;  2AQ5 A;  5THA A;  4A08 A;  3PVW B;  4GGC A;  3RFG A;  3FM0 A;  4LG8 A;  2I3T A;  3MMY A;  4ERY A;  5EAL A;  4JT5 C;  3RFH A;  5C2W B;  2PM7 B;  3RN1 D;  4CI2 A;  1SQJ A;  3DSM A;  2P9L C; 
#chains in the Genus database with same CATH topology
 3EQ8 A;  2IUR A;  4L3H D;  4MMY A;  4JHP C;  4Z8L A;  3V4P A;  2HKM A;  3FGB A;  2IUP A;  3NVQ A;  1K3I A;  4FHL A;  1YR2 A;  4OWR A;  4FA4 D;  5JWZ A;  3IUQ A;  5EMM B;  1VE7 A;  1PI6 A;  3E0C A;  1PEV A;  4AOW A;  5M5S A;  2H68 A;  5M5T A;  3IJE A;  3CFS B;  2VC2 A;  4BCC A;  5CXC B;  3O4J A;  4CY2 A;  4BCB A;  1P22 A;  3JZN A;  2OJY A;  3W15 A;  2IWK A;  1SHY B;  4QL1 A;  3CIK B;  5HE3 B;  4ZN4 A;  2AGX A;  4X3E A;  2QZP A;  2CO0 A;  4A0A B;  3NVX A;  4R7A B;  2VDL A;  2H3X A;  3GD1 I;  3K72 A;  1ERJ A;  3I7P A;  5CYK A;  3UVL A;  4D9S A;  5IT9 g;  5E6S A;  4A0B A;  1VZ3 A;  3EWE A;  4BUJ C;  2Z2N A;  4PXW A;  5EAR A;  1E5T A;  1O6F A;  3SHF A;  4JHN A;  4X60 B;  3I7O A;  5I5J A;  5A2Q g;  1BPO A;  1NR0 A;  4JXM A;  1YFQ A;  3GRE A;  4LGN A;  4RE6 A;  3C75 H;  3EI2 A;  2I0S A;  4FA5 D;  3I8C A;  2PBI B;  4WK0 A;  5I5I A;  1OMW B;  5HYN B;  4ES0 A;  4PC0 A;  4X63 B;  5FA5 B;  2J57 G;  4NC4 A;  3NID A;  2H13 A;  3NVN A;  3L4M D;  2CNX A;  2J56 H;  2H6N A;  2P9U C;  4DNU A;  4A2L A;  3KRX B;  4UM8 A;  1N6D A;  2Z2O A;  3ORV D;  5K19 A;  3OTT A;  2AH0 A;  3SN6 B;  3RLM D;  2I0T A;  2EIB A;  5E6R A;  2G9A A;  5EAM A;  2P9S C;  5HDB A;  3SJL D;  4BP9 A;  1C9I A;  4BH6 A;  2OK4 A;  3SVW D;  3UVN A;  1H2Z A;  4O3U B;  3BG1 A;  2VDQ A;  4A7J A;  4O2W A;  1A12 A;  3IUJ A;  5IC7 A;  4NBM A;  4CI1 A;  3V4V A;  3EG6 A;  3T3P A;  3IJC A;  4J77 A;  4FWW A;  2H47 A;  5KDO B;  1GOH A;  2HYE A;  2G99 A;  3JZH A;  2H9L A;  4PSX B;  2HES X;  1I2M B;  3EI1 A;  3MVD K;  4N14 A;  3MXX A;  4X61 B;  3I7L A;  3SBR A;  2HU7 A;  3KRW B;  1OLZ A;  2VDN A;  3JB9 L;  4G1M A;  4CC9 A;  3ODT A;  4L9O A;  5EMK B;  4E54 B;  4CI3 A;  4GMB A;  4IMM A;  5TDH B;  5AFU 3;  4A11 A;  2YBA A;  3P4F A;  3RSE C;  1H2W A;  2XL2 A;  3PXT D;  2XYI A;  3MKQ A;  5TEE A;  5IGQ A;  2BBK H;  3J81 g;  1A0R B;  2B5L A;  1RI6 A;  3FRX A;  3N0E A;  2AH1 A;  1QFM A;  3ULE C;  2AGY A;  2QXV A;  4MK0 B;  3IJ0 A;  2IUV A;  3EMH A;  3C99 A;  3QHY B;  4H5I A;  2P9K C;  5CXB B;  4ZOV A;  4FA1 D;  5FXY A;  4E5Z A;  4DNV A;  3K6S A;  5CXB A;  4Y5R D;  2CN3 A;  3I7H A;  3ZDZ A;  2EIC A;  4UI9 R;  3EQ9 A;  4J87 A;  2W18 A;  4J8B A;  5EM2 A;  3ZE0 A;  1H2Y A;  4GGD A;  4G56 B;  4JSX C;  2OVP B;  3PSC B;  5E6U A;  3SFZ A;  4GQB B;  5M61 A;  3I2N A;  3JZG A;  4RE5 A;  4CZY A;  3FCS A;  4LG9 A;  5EMJ B;  3SBQ A;  2PM9 B;  4AMZ A;  5C86 A;  1UOP A;  3IUL A;  4J8G A;  5TF2 A;  4QRJ A;  2YB8 B;  3DWL C;  4WK4 A;  3RMZ D;  3SBP A;  4XYI A;  4AMY A;  4CZX A;  3B7F A;  2YNN A;  3SCY A;  2HJ4 A;  2H9N A;  3GC3 B;  2GC4 A;  3DM0 A;  5IJ7 E;  1VE6 A;  1NEX B;  1GOF A;  3JRO A;  2CE8 A;  4K3J B;  4Y7R A;  3IUR A;  4J84 A;  4FA9 D;  5HE2 B;  1L0Q A;  2PM6 B;  3VI3 A;  4A0B B;  3J80 g;  4L1M A;  3AL8 B;  3IJ1 A;  4J81 A;  5FLX g;  5FFG A;  3JPX A;  4IA9 A;  3PXW D;  4MMZ A;  4TZ4 A;  3AFC A;  1U2V C;  2JKX A;  4EWR A;  3IVM A;  5K1C C;  3RRM C;  2HJB A;  2VDM A;  2AGZ A;  2VZ3 A;  4CY1 A;  4E5Z B;  4WK2 A;  3I7K A;  4ZOX A;  3I8E A;  5EML B;  5HE1 B;  3K26 A;  1U4C A;  3ZE2 A;  2IUQ A;  2HU5 A;  2I0R A;  3OKY B;  3PE7 A;  1GP2 B;  3RN0 D;  4PBY A;  2XL3 A;  5H17 A;  1MG2 A;  4O9D A;  1JJU B;  3L4O D;  1TYE A;  4UM9 A;  4ZOY A;  4NEN A;  3NIG A;  2O9K A;  2CE9 A;  3DDU A;  2B4E A;  2B5M A;  3AH8 B;  3DXM C;  3CFV A;  2VZ1 A;  1PBY B;  3DXK C;  3EU7 A;  1GXR A;  2H9M A;  3ZDX A;  2OIZ A;  2CO0 C;  4JSP C;  5EAP A;  1JMZ B;  2I3S A;  4AN1 A;  2EBS A;  2MTA H;  1B9X A;  5I5M A;  1E8N A;  3F3F A;  5FKT A;  5TEF A;  5M5R A;  4OZU A;  4GZ8 A;  3C5M A;  3UVO A;  4A09 A;  4KFM B;  2VDK A;  4D6V A;  3C9C A;  2J55 H;  3UKR C;  4A11 B;  2OK6 A;  4BL0 A;  4J73 A;  2AGW A;  3FCU A;  5IGO A;  2P9N C;  3F3G A;  4JD2 C;  3AL9 A;  2HU8 A;  3OW8 A;  5B4W A;  1M1X A;  5FQD A;  3IIY A;  4J0W A;  3PVU B;  4Z7Q A;  3IUM A;  1MG3 A;  1JMX B;  3T3M A;  1JOF A;  1XIP A;  2IWF A;  2GNQ A;  3BWS A;  1JTD B;  4ERQ A;  1C9L A;  1PGU A;  4GQ2 P;  1K8K C;  2OVR B;  4XYH A;  3I89 A;  5GXH A;  3EQ7 A;  3VH0 A;  2EIE A;  1VZ2 A;  4J78 A;  3ZDY A;  3N0D A;  3SLE D;  3K27 A;  4U1E I;  5GSA A;  1UTC A;  2P9I C;  4L3G D;  4FB1 D;  5IJ8 E;  3UKU C;  1GOG A;  1UOO A;  5CXC A;  4AN0 A;  4XEI C;  4AEZ A;  2HXC A;  4L1Q D;  4JSN C;  4BCD A;  4HDJ A;  3OF7 A;  2XDW A;  3MZL A;  4ESG A;  3BG0 A;  5M5U A;  3U4Y A;  2QC5 A;  1FWX A;  4GQ1 A;  4GM3 A;  1N6F A;  2YMU A;  4QQE A;  4YVD A;  3O4H A;  2Z2P A;  3V9F A;  3F3P A;  3V5W B;  2BCJ B;  2UZX B;  4GGA A;  3EI3 A;  4A08 B;  3ZE1 A;  3PXS D;  1UOQ A;  4JT6 C;  4PNK B;  1Q47 A;  4A09 B;  3NIF A;  4WJK A;  3V7D B;  4PSW B;  4ZOZ A;  4J82 A;  1S4U X;  3MUO A;  1R5M A;  5CYK B;  3OKW A;  2Q7Q A;  3AL8 A;  4A2M A;  4QT8 A;  3IKO A;  4JSV C;  4H5J A;  4ERZ A;  1GG2 B;  4O3T B;  5SXM A;  4GM8 A;  2VDP A;  3I7N A;  4D0K A;  5GXI A;  1B9Y A;  2P9P C;  3VA6 A;  2QR5 A;  5C9Z B;  1L5G A;  4I79 A;  2XZG A;  2WQ8 A;  2H6K A;  1MDA H;  1QFS A;  2H6Q A;  2TRC B;  2IAA A;  2YNP A;  4J0X A;  2VDR A;  1H2X A;  4A0A A;  3GFC A;  2AGL A;  3OKY A;  2EID A;  1VYH C;  3HFQ A;  4J79 A;  4O45 A;  2H14 A;  1E8M A;  4G55 A;  4QAM A;  4MMX A;  4FAV D;  5EM2 B;  3OL2 A;  2BKL A;  3O4G A;  2CN2 A;  1N6E A;  5C92 A;  3MZK A;  5H14 A;  4CY3 A;  5GMK n;  3OL2 B;  3SXT D;  3IUN A;  4PBZ A;  1TYQ C;  2UZY B;  5FKR A;  4DNW A;  4O1Q D;  2B5N A;  4CY5 A;  5HQG A;  3ZWL B;  5FKQ A;  4K3I D;  3SWS D;  4E54 A;  4U7A A;  1GOT B;  5AJA A;  1JV2 A;  1XKS A;  3EI2 B;  1O6G A;  2XE4 A;  5M5V A;  3A0F A;  3UVK A;  3JRP A;  3UR4 A;  1SQ9 A;  4CZV A;  5HE0 B;  5C2V B;  1QNI A;  2HKR A;  3SMR A;  2OVQ B;  3EI4 B;  4Z7N A;  4CI8 A;  2H9P A;  3EI1 B;  1XHM A;  5FFO A;  5FKS A;  4BP8 A;  2YNO A;  4FAN D;  3PSL A;  4NSX A;  3VGZ A;  3K71 A;  5H1M A;  4AX4 A;  2GC7 A;  3EI4 A;  3MKS B;  3KCI A;  3OKT A;  4NAA A;  1TBG A;  3VI4 A;  4J86 A;  4O02 A;  3JAM g;  3QI0 A;  3IIW A;  2XU7 A;  1K32 A;  2PM9 A;  4GM9 A;  5AMS A;  3EI3 B;  3UVM A;  2AQ5 A;  5THA A;  1T2X A;  4A08 A;  3PVW B;  4GGC A;  3RFG A;  3FM0 A;  4LG8 A;  3O4I A;  1U8C A;  4Z7O A;  2I3T A;  3MMY A;  4ERY A;  4IRZ A;  3MUN A;  5EAL A;  4JT5 C;  3RFH A;  5C2W B;  2PM7 B;  3RN1 D;  4CI2 A;  4G1E A;  2VDO A;  1SQJ A;  3DSM A;  2P9L C; 
#chains in the Genus database with same CATH homology
 2IUR A;  4L3H D;  4Z8L A;  2HKM A;  3FGB A;  2IUP A;  3NVQ A;  4FHL A;  4OWR A;  4FA4 D;  5JWZ A;  5EMM B;  1PI6 A;  3E0C A;  1PEV A;  4AOW A;  2H68 A;  3CFS B;  5CXC B;  4CY2 A;  1P22 A;  3JZN A;  2OJY A;  3W15 A;  2IWK A;  1SHY B;  4QL1 A;  3CIK B;  5HE3 B;  4ZN4 A;  2AGX A;  4X3E A;  2CO0 A;  4A0A B;  3NVX A;  4R7A B;  2H3X A;  5CYK A;  1ERJ A;  3I7P A;  3UVL A;  5IT9 g;  4A0B A;  3EWE A;  4BUJ C;  2Z2N A;  4PXW A;  5EAR A;  3SHF A;  4X60 B;  3I7O A;  5I5J A;  5A2Q g;  1NR0 A;  4JXM A;  1YFQ A;  3GRE A;  4LGN A;  3C75 H;  3EI2 A;  2I0S A;  4FA5 D;  3I8C A;  2PBI B;  5I5I A;  1OMW B;  5HYN B;  4ES0 A;  4PC0 A;  4X63 B;  5FA5 B;  2J57 G;  2H13 A;  3NVN A;  3L4M D;  2CNX A;  2J56 H;  2H6N A;  2P9U C;  4A2L A;  3KRX B;  1N6D A;  2Z2O A;  3ORV D;  5K19 A;  3OTT A;  2AH0 A;  3SN6 B;  3RLM D;  2I0T A;  2G9A A;  5EAM A;  2P9S C;  3SJL D;  4BH6 A;  2OK4 A;  3SVW D;  3UVN A;  4O3U B;  3BG1 A;  4A7J A;  5IC7 A;  4CI1 A;  3EG6 A;  3IJC A;  4J77 A;  4FWW A;  2H47 A;  5KDO B;  2HYE A;  2G99 A;  3JZH A;  2H9L A;  4PSX B;  2HES X;  3EI1 A;  4N14 A;  3MXX A;  4X61 B;  3I7L A;  3SBR A;  3KRW B;  1OLZ A;  3JB9 L;  4CC9 A;  3ODT A;  4L9O A;  5EMK B;  4E54 B;  4CI3 A;  4GMB A;  4IMM A;  5TDH B;  5AFU 3;  4A11 A;  2YBA A;  3P4F A;  3RSE C;  2XL2 A;  3PXT D;  2XYI A;  3MKQ A;  5TEE A;  5IGQ A;  2BBK H;  3J81 g;  1A0R B;  2B5L A;  1RI6 A;  3FRX A;  3N0E A;  2AH1 A;  3ULE C;  2AGY A;  2QXV A;  4MK0 B;  3IJ0 A;  2IUV A;  3EMH A;  3C99 A;  4H5I A;  2P9K C;  5CXB B;  4ZOV A;  4FA1 D;  5FXY A;  4E5Z A;  5CXB A;  4Y5R D;  2CN3 A;  3I7H A;  4UI9 R;  4J87 A;  2W18 A;  4J8B A;  5EM2 A;  4GGD A;  4G56 B;  4JSX C;  2OVP B;  3PSC B;  3SFZ A;  4GQB B;  3I2N A;  3JZG A;  4CZY A;  4LG9 A;  5EMJ B;  3SBQ A;  2PM9 B;  4J8G A;  5TF2 A;  4QRJ A;  2YB8 B;  3DWL C;  3RMZ D;  3SBP A;  4XYI A;  4CZX A;  3B7F A;  2YNN A;  3SCY A;  2HJ4 A;  2H9N A;  2GC4 A;  3DM0 A;  5IJ7 E;  1NEX B;  3JRO A;  2CE8 A;  4K3J B;  4Y7R A;  4J84 A;  4FA9 D;  5HE2 B;  1L0Q A;  2PM6 B;  4A0B B;  3J80 g;  3AL8 B;  3IJ1 A;  4J81 A;  5FLX g;  3JPX A;  4IA9 A;  3PXW D;  4TZ4 A;  3AFC A;  1U2V C;  4EWR A;  5K1C C;  3RRM C;  2HJB A;  2AGZ A;  4CY1 A;  4E5Z B;  3I7K A;  4ZOX A;  3I8E A;  5EML B;  5HE1 B;  3K26 A;  1U4C A;  2IUQ A;  2I0R A;  3OKY B;  3PE7 A;  1GP2 B;  3RN0 D;  4PBY A;  2XL3 A;  5H17 A;  1MG2 A;  4O9D A;  1JJU B;  3L4O D;  4ZOY A;  2O9K A;  2CE9 A;  2B4E A;  2B5M A;  3AH8 B;  3DXM C;  3CFV A;  1PBY B;  3DXK C;  3EU7 A;  1GXR A;  2H9M A;  2OIZ A;  2CO0 C;  4JSP C;  5EAP A;  1JMZ B;  2I3S A;  2EBS A;  2MTA H;  1B9X A;  5I5M A;  3F3F A;  5FKT A;  5TEF A;  4OZU A;  4GZ8 A;  3C5M A;  3UVO A;  4A09 A;  4KFM B;  4D6V A;  3C9C A;  2J55 H;  3UKR C;  4A11 B;  2OK6 A;  4BL0 A;  4J73 A;  2AGW A;  5IGO A;  2P9N C;  3F3G A;  4JD2 C;  3AL9 A;  3OW8 A;  5B4W A;  5FQD A;  3IIY A;  4J0W A;  3PVU B;  1MG3 A;  1JMX B;  1JOF A;  1XIP A;  2IWF A;  2GNQ A;  3BWS A;  4ERQ A;  1PGU A;  4GQ2 P;  1K8K C;  2OVR B;  4XYH A;  3I89 A;  5GXH A;  3VH0 A;  4J78 A;  3N0D A;  3SLE D;  3K27 A;  4U1E I;  5GSA A;  2P9I C;  4L3G D;  4FB1 D;  5IJ8 E;  3UKU C;  5CXC A;  4XEI C;  4AEZ A;  2HXC A;  4L1Q D;  4JSN C;  4HDJ A;  3MZL A;  4ESG A;  3BG0 A;  3U4Y A;  2QC5 A;  1FWX A;  4GQ1 A;  4GM3 A;  1N6F A;  2YMU A;  4QQE A;  4YVD A;  3V9F A;  2Z2P A;  3F3P A;  3V5W B;  2BCJ B;  2UZX B;  4GGA A;  3EI3 A;  4A08 B;  3PXS D;  4JT6 C;  4PNK B;  1Q47 A;  4A09 B;  3V7D B;  4PSW B;  4ZOZ A;  4J82 A;  1S4U X;  1R5M A;  5CYK B;  3OKW A;  2Q7Q A;  3AL8 A;  4A2M A;  4QT8 A;  3IKO A;  4JSV C;  4H5J A;  4ERZ A;  1GG2 B;  4O3T B;  5SXM A;  4GM8 A;  3I7N A;  4D0K A;  5GXI A;  1B9Y A;  2P9P C;  3VA6 A;  5C9Z B;  4I79 A;  2H6K A;  1MDA H;  2H6Q A;  2TRC B;  2IAA A;  2YNP A;  4J0X A;  4A0A A;  3GFC A;  2AGL A;  3OKY A;  1VYH C;  3HFQ A;  4J79 A;  4O45 A;  2H14 A;  5EM2 B;  4FAV D;  3OL2 A;  2CN2 A;  1N6E A;  3MZK A;  5H14 A;  4CY3 A;  5GMK n;  3OL2 B;  3SXT D;  4PBZ A;  1TYQ C;  2UZY B;  5FKR A;  4O1Q D;  2B5N A;  4CY5 A;  5HQG A;  3ZWL B;  5FKQ A;  4K3I D;  3SWS D;  4E54 A;  4U7A A;  1GOT B;  5AJA A;  1XKS A;  3EI2 B;  3A0F A;  3UVK A;  3JRP A;  3UR4 A;  1SQ9 A;  4CZV A;  5HE0 B;  5C2V B;  1QNI A;  2HKR A;  3SMR A;  2OVQ B;  3EI4 B;  4CI8 A;  2H9P A;  3EI1 B;  1XHM A;  5FKS A;  2YNO A;  4FAN D;  3PSL A;  4NSX A;  3VGZ A;  5H1M A;  2GC7 A;  3EI4 A;  3MKS B;  3OKT A;  1TBG A;  4J86 A;  3JAM g;  3IIW A;  2XU7 A;  1K32 A;  2PM9 A;  4GM9 A;  5AMS A;  3EI3 B;  3UVM A;  2AQ5 A;  5THA A;  4A08 A;  3PVW B;  4GGC A;  3RFG A;  3FM0 A;  4LG8 A;  2I3T A;  3MMY A;  4ERY A;  5EAL A;  4JT5 C;  3RFH A;  5C2W B;  2PM7 B;  3RN1 D;  4CI2 A;  1SQJ A;  3DSM A;  2P9L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...