3C99A

Structural basis of histone h4 recognition by p55
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
405
structure length
380
Chain Sequence
SFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPCQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin assembly factor 1 p55 subunit
publication title Structural basis of histone H4 recognition by p55.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repressor
total genus 88
structure length 380
sequence length 405
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c99A00
4TZ4A 4GMBA 3EI2B 5B4WA 4CY5A 2YNNA 4FAND 5I5MA 5H17A 4QT8A 2P9PC 3BWSA 5C9ZB 2J55H 5HQGA 2H9NA 4ZOVA 2PM6B 3IJCA 4JT6C 5THAA 3I8CA 1U2VC 4I79A 4X61B 5K1CC 4FA9D 2H14A 3OL2B 5EARA 4ERYA 4A08A 5EMLB 2AQ5A 4J86A 3SVWD 1YFQA 3PVWB 4E5ZA 1N6EA 3MMYA 1GOTB 4O1QD 1L0QA 4XYHA 4A11B 4PSXB 4Y7RA 2AH0A 2I3SA 3SXTD 1NR0A 4ZOXA 5EMKB 4GQ1A 4FHLA 2CE9A 4BUJC 4LG9A 1XHMA 3OKTA 2J56H 2OVPB 4PBZA 4PC0A 5FQDA 4PNKB 3UVMA 3PSLA 3UVOA 1SQ9A 3JZGA 2IWFA 4IMMA 4CZYA 5GXIA 1FWXA 3I7NA 4OZUA 4ESGA 3DM0A 2H9PA 2AGWA 4G56B 1K32A 4AOWA 2YMUA 2TRCB 2P9KC 3JPXA 1N6DA 4J73A 4ERZA 4A0BB 4R7AB 3RN0D 5EMMB 1K8KC 3AH8B 2G9AA 4CZVA 1GXRA 3ULEC 1B9YA 4QRJA 1PBYB 4QL1A 2P9SC 5C2VB 2XU7A 3PXTD 3EU7A 5CXCB 4FA1D 3MXXA 4KFMB 3JB9L 3B7FA 4K3ID 3UVLA 4BL0A 2OIZA 4CZXA 3MKSB 4PBYA 2H3XA 3MZKA 2CNXA 2PM9A 2PM7B 5IGOA 2CO0C 4JXMA 5CYKA 3RN1D 2Z2NA 4UI9R 4E54A 3SLED 3RRMC 1PEVA 2AGYA 3IIWA 4H5JA 4O9DA 2H6NA 2I0RA 3C99A 3OKYB 4JT5C 4J8GA 1U4CA 5EM2A 4JD2C 4A09A 3IJ0A 5TEFA 2P9NC 4GZ8A 2QXVA 4ZOYA 3EI4A 2IUQA 4GM8A 1JOFA 3I89A 3EG6A 3JZHA 1OMWB 3EI2A 2BBKH 2CN2A 2OVQB 1JMZB 1Q47A 2HKRA 2OVRB 5A2Qg 5FKTA 3N0DA 2UZYB 2I0TA 1SQJA 5K19A 4J0WA 3I7PA 2OK6A 4LGNA 5AJAA 5GXHA 2AH1A 4PXWA 5EMJB 2IUPA 2YBAA 2YNPA 4CI2A 4CI1A 2YB8B 3OL2A 5IT9g 3U4YA 3C9CA 3FRXA 4L3GD 5C2WB 2H47A 4U7AA 3NVQA 3FGBA 2B5MA 4XEIC 4X3EA 4A11A 5I5IA 2P9IC 4JSVC 3UKRC 1MG3A 2HYEA 4NSXA 2PBIB 3P4FA 4J82A 4GGDA 2CE8A 4J81A 3AL9A 1MG2A 2BCJB 3K27A 2OJYA 3SHFA 1RI6A 4CY3A 4YVDA 3MZLA 3J80g 5AMSA 2Z2OA 5I5JA 2P9UC 4ES0A 1R5MA 4CC9A 2Z2PA 4FWWA 5FLXg 3A0FA 4A7JA 4A0AB 2XYIA 5IGQA 4J8BA 4GQ2P 4A0BA 4FA5D 1S4UX 5TDHB 4O3UB 4J77A 3JAMg 3OTTA 3ORVD 4L1QD 2IAAA 2YNOA 4PSWB 4X63B 4L3HD 4BH6A 5CXCA 5TEEA 1GG2B 3J81g 1XKSA 5CXBB 4GM9A 3RMZD 3OKWA 5GMKn 3F3PA 3L4OD 5HE1B 4J0XA 4OWRA 3I2NA 3PE7A 3V7DB 3SWSD 2H68A 2CN3A 3I7KA 3IJ1A 5FKRA 3I7HA 3F3FA 3L4MD 3ZWLB 3EI3B 3K26A 5HE3B 5HE2B 3SN6B 3UR4A 1XIPA 4ZN4A 3HFQA 3SMRA 2IURA 5JWZA 3JROA 4X60B 3OKYA 3UVNA 3I7LA 3PVUB 3EI3A 4CI3A 3CIKB 3JZNA 2B4EA 2O9KA 5EAPA 4JSPC 2HJBA 3AL8B 4GGCA 3NVXA 2GNQA 2Q7QA 3UKUC 2AGZA 3CFSB 5AFU3 3RFGA 4L9OA 2IUVA 1TYQC 4O45A 5EAMA 5FKQA 3AL8A 2H9LA 3RLMD 4MK0B 3OW8A 4H5IA 4A08B 4A2MA 5HE0B 1A0RB 5IJ8E 3C75H 2J57G 4E5ZB 3PXSD 2H6QA 3DSMA 4AEZA 3V9FA 4GQBB 4JSXC 4D0KA 2UZXB 3KRXB 3DXKC 4Z8LA 1SHYB 2H6KA 3F3GA 3SBQA 3KRWB 3VH0A 3BG0A 3EWEA 3W15A 1B9XA 2HJ4A 4JSNC 5IC7A 3SFZA 3DWLC 3SCYA 5IJ7E 2W18A 4LG8A 2I3TA 5H1MA 5HYNB 3UVKA 2CO0A 4J84A 1TBGA 4GGAA 4HDJA 5KDOB 3DXMC 1VYHC 5EALA 2EBSA 3SJLD 3CFVA 2IWKA 4ERQA 2B5NA 3BG1A 5SXMA 3C5MA 2QC5A 2AGXA 2HESX 2XL3A 3EI1B 2GC4A 1OLZA 4ZOZA 5FKSA 1N6FA 4IA9A 4D6VA 3AFCA 2AGLA 4CI8A 2HKMA 4J79A 1P22A 1JJUB 4A0AA 3EI1A 2MTAH 2G99A 2GC7A 4A2LA 5H14A 1MDAH 3SBRA 4K3JB 1ERJA 4N14A 3V5WB 2I0SA 3SBPA 4U1EI 3ODTA 4FAVD 4O3TB 2XL2A 2P9LC 5GSAA 1NEXB 3I7OA 3GREA 3VA6A 4EWRA 3PXWD 3IIYA 5CXBA 2OK4A 1QNIA 2PM9B 5FXYA 3E0CA 5CYKB 3N0EA 3JRPA 4E54B 2B5LA 4CY1A 3FM0A 1PI6A 2H13A 2HXCA 4CY2A 1JMXB 3RSEC 3MKQA 4FB1D 4Y5RD 4XYIA 4QQEA 4J78A 1PGUA 5EM2B 3GFCA 2H9MA 3EMHA 4A09B 3VGZA 1GP2B 4GM3A 3RFHA 3NVNA 4FA4D 3IKOA 3PSCB 4J87A 3I8EA 3EI4B 5FA5B 5TF2A
chains in the Genus database with same CATH superfamily
2EIBA 4TZ4A 4GMBA 3QHYB 3EI2B 5B4WA 4CY5A 5M5UA 2VC2A 3T3MA 5FFOA 2YNNA 3ZE1A 4FAND 5I5MA 5H17A 4QT8A 2P9PC 3BWSA 5C9ZB 2J55H 5HQGA 2H9NA 4ZOVA 2PM6B 3IJCA 4JT6C 3MVDK 5THAA 3I8CA 1U2VC 4I79A 4Z7OA 1UOPA 4X61B 5K1CC 4FA9D 1U8CA 2H14A 4WK0A 3OL2B 2VZ1A 5EARA 4ERYA 4A08A 5EMLB 4Z7QA 2AQ5A 4IRZA 2QZPA 4J86A 3EQ7A 4MMXA 1YFQA 3SVWD 3PVWB 4E5ZA 1N6EA 3MMYA 1GOTB 4O1QD 1L0QA 4XYHA 4A11B 4PSXB 4Y7RA 2AH0A 4NBMA 2I3SA 3SXTD 1NR0A 4ZOXA 3IUNA 5EMKB 4GQ1A 4FHLA 4UM8A 2CE9A 4BUJC 4LG9A 1XHMA 3OKTA 2J56H 2OVPB 4PBZA 4PC0A 5FQDA 4PNKB 3UVMA 3PSLA 3UVOA 1SQ9A 3JZGA 2IWFA 1K3IA 1JV2A 4IMMA 3EQ8A 4CZYA 5GXIA 4WK2A 1FWXA 3I7NA 4OZUA 4ESGA 3DM0A 2H9PA 2AGWA 4G56B 1K32A 4AOWA 2YMUA 2TRCB 2P9KC 1O6GA 3JPXA 1N6DA 4J73A 4ERZA 4A0BB 5C92A 4DNWA 4L1MA 4R7AB 3RN0D 5EMMB 1K8KC 3AH8B 3IVMA 2G9AA 1C9LA 4CZVA 1GXRA 3ULEC 4MMYA 1B9YA 4QRJA 1PBYB 4QL1A 2P9SC 5C2VB 2XU7A 3PXTD 3T3PA 3EU7A 4QAMA 5CXCB 4FA1D 3K6SA 3FCUA 3MXXA 4KFMB 3JB9L 4G1EA 3B7FA 4K3ID 3UVLA 1E5TA 1YR2A 4BL0A 4BCBA 2OIZA 4CZXA 3MKSB 4PBYA 4RE5A 1QFMA 4BP9A 2H3XA 2HU8A 3MZKA 1UOQA 2CNXA 4NENA 1C9IA 2PM9A 2PM7B 4WK4A 5IGOA 2CO0C 2VDOA 4JXMA 5CYKA 3RN1D 2Z2NA 4UI9R 4E54A 3SLED 3RRMC 4Z7NA 3O4IA 1PEVA 2AGYA 3IIWA 4H5JA 4O9DA 2H6NA 2I0RA 3C99A 3OKYB 4JT5C 4AMZA 4J8GA 1U4CA 5EM2A 4JD2C 4G55A 4A09A 3IJ0A 5TEFA 2P9NC 2QR5A 2HU5A 4GZ8A 2QXVA 4ZOYA 3EI4A 2IUQA 4GM8A 1VE6A 1JOFA 2VDKA 3I89A 3EG6A 3JZHA 1OMWB 3EI2A 4NC4A 2BBKH 2CN2A 5E6SA 2OVQB 3MUNA 1JMZB 1Q47A 2HKRA 2OVRB 5A2Qg 3DDUA 3ZE0A 3O4JA 3IUQA 1M1XA 5FKTA 3N0DA 2UZYB 2I0TA 1SQJA 5K19A 5M5TA 3ZDYA 4J0WA 1GOGA 3I7PA 2OK6A 4LGNA 5AJAA 5GXHA 4MMZA 2AH1A 4PXWA 5EMJB 2IUPA 2YBAA 2YNPA 4CI2A 4CI1A 3IJEA 2YB8B 3OL2A 5IT9g 3U4YA 3C9CA 1H2XA 3FRXA 1L5GA 4L3GD 1E8MA 5C2WB 1T2XA 2H47A 2VDRA 4RE6A 4U7AA 3NVQA 3FGBA 3IUMA 2B5MA 4XEIC 4X3EA 4A11A 5I5IA 2P9IC 4JSVC 3UKRC 1MG3A 2HYEA 3GD1I 4NSXA 2PBIB 3MUOA 3P4FA 4J82A 1GOFA 4GGDA 2CE8A 4J81A 3AL9A 2VDMA 1MG2A 1UOOA 2BCJB 3K27A 2OJYA 3SHFA 1RI6A 3GC3B 4CY3A 4YVDA 3IUJA 3MZLA 3J80g 4D9SA 5AMSA 2Z2OA 5I5JA 5E6RA 2P9UC 5FFGA 4ES0A 3O4GA 1R5MA 4CC9A 2Z2PA 4FWWA 5FLXg 2XDWA 3A0FA 4A7JA 4A0AB 2XYIA 2XZGA 5IGQA 4J8BA 2EICA 2JKXA 1VZ3A 3NIGA 4GQ2P 5M5SA 4A0BA 3O4HA 1S4UX 4FA5D 5TDHB 4O3UB 2XE4A 4J77A 3JAMg 3OTTA 3ORVD 4L1QD 2IAAA 2YNOA 4PSWB 4X63B 1QFSA 4L3HD 3QI0A 3VI3A 4BH6A 3K71A 5CXCA 5TEEA 1GG2B 3J81g 1XKSA 5CXBB 4GM9A 3RMZD 3OKWA 3ZE2A 5GMKn 3F3PA 3L4OD 5HE1B 4J0XA 4OWRA 3I2NA 3PE7A 3V7DB 3SWSD 2H68A 2CN3A 3I7KA 3IJ1A 3FCSA 3IURA 5FKRA 1A12A 3I7HA 3F3FA 3L4MD 3ZWLB 4O2WA 3EI3B 3K26A 5HE3B 5HE2B 1VZ2A 3SN6B 3UR4A 1XIPA 4ZN4A 3HFQA 3SMRA 2IURA 5JWZA 3JROA 4X60B 3OKYA 2VDPA 3UVNA 3I7LA 5C86A 3PVUB 3EI3A 2VZ3A 4CI3A 3CIKB 3JZNA 2B4EA 2O9KA 5EAPA 4JSPC 4BP8A 2HJBA 3AL8B 4GGCA 3NVXA 2GNQA 2Q7QA 5M5VA 3UKUC 2AGZA 3CFSB 5AFU3 3RFGA 4L9OA 2IUVA 1TYQC 4O45A 5EAMA 4AN0A 5FKQA 3AL8A 4DNUA 2H9LA 3RLMD 4MK0B 1JTDB 3OW8A 1O6FA 2VDNA 4H5IA 4A08B 4A2MA 5HE0B 1A0RB 5IJ8E 3C75H 2J57G 4E5ZB 3PXSD 2H6QA 3DSMA 4AEZA 3V9FA 4GQBB 4JSXC 4D0KA 4JHNA 2UZXB 3KRXB 3DXKC 4Z8LA 3V4PA 1SHYB 2H6KA 1VE7A 3F3GA 3SBQA 3KRWB 3V4VA 3VH0A 3BG0A 4O02A 3EWEA 3W15A 1B9XA 2HJ4A 4JSNC 5IC7A 3SFZA 1TYEA 3DWLC 3SCYA 1H2YA 5IJ7E 2W18A 4LG8A 2I3TA 5H1MA 5HDBA 5HYNB 2WQ8A 4NAAA 3UVKA 2CO0A 4J84A 1E8NA 1TBGA 4GGAA 4BCDA 4HDJA 5KDOB 3DXMC 1VYHC 3IULA 2EBSA 5EALA 3SJLD 3CFVA 2IWKA 2EIDA 3K72A 3KCIA 4ERQA 2B5NA 5M5RA 1I2MB 4JHPC 3BG1A 1H2ZA 5SXMA 3C5MA 2QC5A 2AGXA 2HESX 2XL3A 2VDQA 3EI1B 2GC4A 1OLZA 4ZOZA 5FKSA 3OF7A 1N6FA 4IA9A 3NIFA 3AFCA 4D6VA 2AGLA 4CI8A 2HKMA 4J79A 1P22A 1JJUB 4A0AA 3EI1A 2MTAH 4AMYA 2G99A 2GC7A 4A2LA 5H14A 1MDAH 3SBRA 1GOHA 2VDLA 4K3JB 3VI4A 1ERJA 4N14A 3V5WB 2I0SA 3SBPA 1UTCA 4U1EI 4AX4A 3ODTA 4FAVD 4AN1A 4BCCA 5E6UA 4O3TB 4UM9A 2XL2A 2P9LC 5GSAA 1NEXB 3I7OA 3GREA 3VA6A 4EWRA 3PXWD 3IIYA 5CXBA 5M61A 2BKLA 2OK4A 1QNIA 3ZDXA 2PM9B 2EIEA 3EQ9A 3NIDA 5FXYA 3E0CA 5CYKB 1BPOA 3N0EA 3JRPA 4E54B 2B5LA 4CY1A 3FM0A 1PI6A 2H13A 2HXCA 4CY2A 1JMXB 3RSEC 3MKQA 2HU7A 4Y5RD 4FB1D 4XYIA 4QQEA 4J78A 1PGUA 3ZDZA 5EM2B 3GFCA 2H9MA 3EMHA 4A09B 3VGZA 1GP2B 4GM3A 3RFHA 3NVNA 4FA4D 4DNVA 3IKOA 3PSCB 4J87A 3I8EA 3EI4B 4WJKA 4G1MA 5FA5B 5TF2A 1H2WA
chains in the Genus database with same CATH topology
4TZ4A 4GMBA 3EI2B 5B4WA 4CY5A 2YNNA 4FAND 5I5MA 5H17A 4QT8A 2P9PC 3BWSA 5C9ZB 2J55H 5HQGA 2H9NA 4ZOVA 2PM6B 3IJCA 4JT6C 5THAA 3I8CA 1U2VC 4I79A 4X61B 5K1CC 4FA9D 2H14A 3OL2B 5EARA 4ERYA 4A08A 5EMLB 2AQ5A 4J86A 3SVWD 1YFQA 3PVWB 4E5ZA 1N6EA 3MMYA 1GOTB 4O1QD 1L0QA 4XYHA 4A11B 4PSXB 4Y7RA 2AH0A 2I3SA 3SXTD 1NR0A 4ZOXA 5EMKB 4GQ1A 4FHLA 2CE9A 4BUJC 4LG9A 1XHMA 3OKTA 2J56H 2OVPB 4PBZA 4PC0A 5FQDA 4PNKB 3UVMA 3PSLA 3UVOA 1SQ9A 3JZGA 2IWFA 4IMMA 4CZYA 5GXIA 1FWXA 3I7NA 4OZUA 4ESGA 3DM0A 2H9PA 2AGWA 4G56B 1K32A 4AOWA 2YMUA 2TRCB 2P9KC 3JPXA 1N6DA 4J73A 4ERZA 4A0BB 4R7AB 3RN0D 5EMMB 1K8KC 3AH8B 2G9AA 4CZVA 1GXRA 3ULEC 1B9YA 4QRJA 1PBYB 4QL1A 2P9SC 5C2VB 2XU7A 3PXTD 3EU7A 5CXCB 4FA1D 3MXXA 4KFMB 3JB9L 3B7FA 4K3ID 3UVLA 4BL0A 2OIZA 4CZXA 3MKSB 4PBYA 2H3XA 3MZKA 2CNXA 2PM9A 2PM7B 5IGOA 2CO0C 4JXMA 5CYKA 3RN1D 2Z2NA 4UI9R 4E54A 3SLED 3RRMC 1PEVA 2AGYA 3IIWA 4H5JA 4O9DA 2H6NA 2I0RA 3C99A 3OKYB 4JT5C 4J8GA 1U4CA 5EM2A 4JD2C 4A09A 3IJ0A 5TEFA 2P9NC 4GZ8A 2QXVA 4ZOYA 3EI4A 2IUQA 4GM8A 1JOFA 3I89A 3EG6A 3JZHA 1OMWB 3EI2A 2BBKH 2CN2A 2OVQB 1JMZB 1Q47A 2HKRA 2OVRB 5A2Qg 5FKTA 3N0DA 2UZYB 2I0TA 1SQJA 5K19A 4J0WA 3I7PA 2OK6A 4LGNA 5AJAA 5GXHA 2AH1A 4PXWA 5EMJB 2IUPA 2YBAA 2YNPA 4CI2A 4CI1A 2YB8B 3OL2A 5IT9g 3U4YA 3C9CA 3FRXA 4L3GD 5C2WB 2H47A 4U7AA 3NVQA 3FGBA 2B5MA 4XEIC 4X3EA 4A11A 5I5IA 2P9IC 4JSVC 3UKRC 1MG3A 2HYEA 4NSXA 2PBIB 3P4FA 4J82A 4GGDA 2CE8A 4J81A 3AL9A 1MG2A 2BCJB 3K27A 2OJYA 3SHFA 1RI6A 4CY3A 4YVDA 3MZLA 3J80g 5AMSA 2Z2OA 5I5JA 2P9UC 4ES0A 1R5MA 4CC9A 2Z2PA 4FWWA 5FLXg 3A0FA 4A7JA 4A0AB 2XYIA 5IGQA 4J8BA 4GQ2P 4A0BA 4FA5D 1S4UX 5TDHB 4O3UB 4J77A 3JAMg 3OTTA 3ORVD 4L1QD 2IAAA 2YNOA 4PSWB 4X63B 4L3HD 4BH6A 5CXCA 5TEEA 1GG2B 3J81g 1XKSA 5CXBB 4GM9A 3RMZD 3OKWA 5GMKn 3F3PA 3L4OD 5HE1B 4J0XA 4OWRA 3I2NA 3PE7A 3V7DB 3SWSD 2H68A 2CN3A 3I7KA 3IJ1A 5FKRA 3I7HA 3F3FA 3L4MD 3ZWLB 3EI3B 3K26A 5HE3B 5HE2B 3SN6B 3UR4A 1XIPA 4ZN4A 3HFQA 3SMRA 2IURA 5JWZA 3JROA 4X60B 3OKYA 3UVNA 3I7LA 3PVUB 3EI3A 4CI3A 3CIKB 3JZNA 2B4EA 2O9KA 5EAPA 4JSPC 2HJBA 3AL8B 4GGCA 3NVXA 2GNQA 2Q7QA 3UKUC 2AGZA 3CFSB 5AFU3 3RFGA 4L9OA 2IUVA 1TYQC 4O45A 5EAMA 5FKQA 3AL8A 2H9LA 3RLMD 4MK0B 3OW8A 4H5IA 4A08B 4A2MA 5HE0B 1A0RB 5IJ8E 3C75H 2J57G 4E5ZB 3PXSD 2H6QA 3DSMA 4AEZA 3V9FA 4GQBB 4JSXC 4D0KA 2UZXB 3KRXB 3DXKC 4Z8LA 1SHYB 2H6KA 3F3GA 3SBQA 3KRWB 3VH0A 3BG0A 3EWEA 3W15A 1B9XA 2HJ4A 4JSNC 5IC7A 3SFZA 3DWLC 3SCYA 5IJ7E 2W18A 4LG8A 2I3TA 5H1MA 5HYNB 3UVKA 2CO0A 4J84A 1TBGA 4GGAA 4HDJA 5KDOB 3DXMC 1VYHC 5EALA 2EBSA 3SJLD 3CFVA 2IWKA 4ERQA 2B5NA 3BG1A 5SXMA 3C5MA 2QC5A 2AGXA 2HESX 2XL3A 3EI1B 2GC4A 1OLZA 4ZOZA 5FKSA 1N6FA 4IA9A 4D6VA 3AFCA 2AGLA 4CI8A 2HKMA 4J79A 1P22A 1JJUB 4A0AA 3EI1A 2MTAH 2G99A 2GC7A 4A2LA 5H14A 1MDAH 3SBRA 4K3JB 1ERJA 4N14A 3V5WB 2I0SA 3SBPA 4U1EI 3ODTA 4FAVD 4O3TB 2XL2A 2P9LC 5GSAA 1NEXB 3I7OA 3GREA 3VA6A 4EWRA 3PXWD 3IIYA 5CXBA 2OK4A 1QNIA 2PM9B 5FXYA 3E0CA 5CYKB 3N0EA 3JRPA 4E54B 2B5LA 4CY1A 3FM0A 1PI6A 2H13A 2HXCA 4CY2A 1JMXB 3RSEC 3MKQA 4FB1D 4Y5RD 4XYIA 4QQEA 4J78A 1PGUA 5EM2B 3GFCA 2H9MA 3EMHA 4A09B 3VGZA 1GP2B 4GM3A 3RFHA 3NVNA 4FA4D 3IKOA 3PSCB 4J87A 3I8EA 3EI4B 5FA5B 5TF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZ4 A;  4GMB A;  3EI2 B;  5B4W A;  4CY5 A;  2YNN A;  4FAN D;  5I5M A;  5H17 A;  4QT8 A;  2P9P C;  3BWS A;  5C9Z B;  2J55 H;  5HQG A;  2H9N A;  4ZOV A;  2PM6 B;  3IJC A;  4JT6 C;  5THA A;  3I8C A;  1U2V C;  4I79 A;  4X61 B;  5K1C C;  4FA9 D;  2H14 A;  3OL2 B;  5EAR A;  4ERY A;  4A08 A;  5EML B;  2AQ5 A;  4J86 A;  3SVW D;  1YFQ A;  3PVW B;  4E5Z A;  1N6E A;  3MMY A;  1GOT B;  4O1Q D;  1L0Q A;  4XYH A;  4A11 B;  4PSX B;  4Y7R A;  2AH0 A;  2I3S A;  3SXT D;  1NR0 A;  4ZOX A;  5EMK B;  4GQ1 A;  4FHL A;  2CE9 A;  4BUJ C;  4LG9 A;  1XHM A;  3OKT A;  2J56 H;  2OVP B;  4PBZ A;  4PC0 A;  5FQD A;  4PNK B;  3UVM A;  3PSL A;  3UVO A;  1SQ9 A;  3JZG A;  2IWF A;  4IMM A;  4CZY A;  5GXI A;  1FWX A;  3I7N A;  4OZU A;  4ESG A;  3DM0 A;  2H9P A;  2AGW A;  4G56 B;  1K32 A;  4AOW A;  2YMU A;  2TRC B;  2P9K C;  3JPX A;  1N6D A;  4J73 A;  4ERZ A;  4A0B B;  4R7A B;  3RN0 D;  5EMM B;  1K8K C;  3AH8 B;  2G9A A;  4CZV A;  1GXR A;  3ULE C;  1B9Y A;  4QRJ A;  1PBY B;  4QL1 A;  2P9S C;  5C2V B;  2XU7 A;  3PXT D;  3EU7 A;  5CXC B;  4FA1 D;  3MXX A;  4KFM B;  3JB9 L;  3B7F A;  4K3I D;  3UVL A;  4BL0 A;  2OIZ A;  4CZX A;  3MKS B;  4PBY A;  2H3X A;  3MZK A;  2CNX A;  2PM9 A;  2PM7 B;  5IGO A;  2CO0 C;  4JXM A;  5CYK A;  3RN1 D;  2Z2N A;  4UI9 R;  4E54 A;  3SLE D;  3RRM C;  1PEV A;  2AGY A;  3IIW A;  4H5J A;  4O9D A;  2H6N A;  2I0R A;  3C99 A;  3OKY B;  4JT5 C;  4J8G A;  1U4C A;  5EM2 A;  4JD2 C;  4A09 A;  3IJ0 A;  5TEF A;  2P9N C;  4GZ8 A;  2QXV A;  4ZOY A;  3EI4 A;  2IUQ A;  4GM8 A;  1JOF A;  3I89 A;  3EG6 A;  3JZH A;  1OMW B;  3EI2 A;  2BBK H;  2CN2 A;  2OVQ B;  1JMZ B;  1Q47 A;  2HKR A;  2OVR B;  5A2Q g;  5FKT A;  3N0D A;  2UZY B;  2I0T A;  1SQJ A;  5K19 A;  4J0W A;  3I7P A;  2OK6 A;  4LGN A;  5AJA A;  5GXH A;  2AH1 A;  4PXW A;  5EMJ B;  2IUP A;  2YBA A;  2YNP A;  4CI2 A;  4CI1 A;  2YB8 B;  3OL2 A;  5IT9 g;  3U4Y A;  3C9C A;  3FRX A;  4L3G D;  5C2W B;  2H47 A;  4U7A A;  3NVQ A;  3FGB A;  2B5M A;  4XEI C;  4X3E A;  4A11 A;  5I5I A;  2P9I C;  4JSV C;  3UKR C;  1MG3 A;  2HYE A;  4NSX A;  2PBI B;  3P4F A;  4J82 A;  4GGD A;  2CE8 A;  4J81 A;  3AL9 A;  1MG2 A;  2BCJ B;  3K27 A;  2OJY A;  3SHF A;  1RI6 A;  4CY3 A;  4YVD A;  3MZL A;  3J80 g;  5AMS A;  2Z2O A;  5I5J A;  2P9U C;  4ES0 A;  1R5M A;  4CC9 A;  2Z2P A;  4FWW A;  5FLX g;  3A0F A;  4A7J A;  4A0A B;  2XYI A;  5IGQ A;  4J8B A;  4GQ2 P;  4A0B A;  4FA5 D;  1S4U X;  5TDH B;  4O3U B;  4J77 A;  3JAM g;  3OTT A;  3ORV D;  4L1Q D;  2IAA A;  2YNO A;  4PSW B;  4X63 B;  4L3H D;  4BH6 A;  5CXC A;  5TEE A;  1GG2 B;  3J81 g;  1XKS A;  5CXB B;  4GM9 A;  3RMZ D;  3OKW A;  5GMK n;  3F3P A;  3L4O D;  5HE1 B;  4J0X A;  4OWR A;  3I2N A;  3PE7 A;  3V7D B;  3SWS D;  2H68 A;  2CN3 A;  3I7K A;  3IJ1 A;  5FKR A;  3I7H A;  3F3F A;  3L4M D;  3ZWL B;  3EI3 B;  3K26 A;  5HE3 B;  5HE2 B;  3SN6 B;  3UR4 A;  1XIP A;  4ZN4 A;  3HFQ A;  3SMR A;  2IUR A;  5JWZ A;  3JRO A;  4X60 B;  3OKY A;  3UVN A;  3I7L A;  3PVU B;  3EI3 A;  4CI3 A;  3CIK B;  3JZN A;  2B4E A;  2O9K A;  5EAP A;  4JSP C;  2HJB A;  3AL8 B;  4GGC A;  3NVX A;  2GNQ A;  2Q7Q A;  3UKU C;  2AGZ A;  3CFS B;  5AFU 3;  3RFG A;  4L9O A;  2IUV A;  1TYQ C;  4O45 A;  5EAM A;  5FKQ A;  3AL8 A;  2H9L A;  3RLM D;  4MK0 B;  3OW8 A;  4H5I A;  4A08 B;  4A2M A;  5HE0 B;  1A0R B;  5IJ8 E;  3C75 H;  2J57 G;  4E5Z B;  3PXS D;  2H6Q A;  3DSM A;  4AEZ A;  3V9F A;  4GQB B;  4JSX C;  4D0K A;  2UZX B;  3KRX B;  3DXK C;  4Z8L A;  1SHY B;  2H6K A;  3F3G A;  3SBQ A;  3KRW B;  3VH0 A;  3BG0 A;  3EWE A;  3W15 A;  1B9X A;  2HJ4 A;  4JSN C;  5IC7 A;  3SFZ A;  3DWL C;  3SCY A;  5IJ7 E;  2W18 A;  4LG8 A;  2I3T A;  5H1M A;  5HYN B;  3UVK A;  2CO0 A;  4J84 A;  1TBG A;  4GGA A;  4HDJ A;  5KDO B;  3DXM C;  1VYH C;  5EAL A;  2EBS A;  3SJL D;  3CFV A;  2IWK A;  4ERQ A;  2B5N A;  3BG1 A;  5SXM A;  3C5M A;  2QC5 A;  2AGX A;  2HES X;  2XL3 A;  3EI1 B;  2GC4 A;  1OLZ A;  4ZOZ A;  5FKS A;  1N6F A;  4IA9 A;  4D6V A;  3AFC A;  2AGL A;  4CI8 A;  2HKM A;  4J79 A;  1P22 A;  1JJU B;  4A0A A;  3EI1 A;  2MTA H;  2G99 A;  2GC7 A;  4A2L A;  5H14 A;  1MDA H;  3SBR A;  4K3J B;  1ERJ A;  4N14 A;  3V5W B;  2I0S A;  3SBP A;  4U1E I;  3ODT A;  4FAV D;  4O3T B;  2XL2 A;  2P9L C;  5GSA A;  1NEX B;  3I7O A;  3GRE A;  3VA6 A;  4EWR A;  3PXW D;  3IIY A;  5CXB A;  2OK4 A;  1QNI A;  2PM9 B;  5FXY A;  3E0C A;  5CYK B;  3N0E A;  3JRP A;  4E54 B;  2B5L A;  4CY1 A;  3FM0 A;  1PI6 A;  2H13 A;  2HXC A;  4CY2 A;  1JMX B;  3RSE C;  3MKQ A;  4FB1 D;  4Y5R D;  4XYI A;  4QQE A;  4J78 A;  1PGU A;  5EM2 B;  3GFC A;  2H9M A;  3EMH A;  4A09 B;  3VGZ A;  1GP2 B;  4GM3 A;  3RFH A;  3NVN A;  4FA4 D;  3IKO A;  3PSC B;  4J87 A;  3I8E A;  3EI4 B;  5FA5 B;  5TF2 A; 
#chains in the Genus database with same CATH topology
 2EIB A;  4TZ4 A;  4GMB A;  3QHY B;  3EI2 B;  5B4W A;  4CY5 A;  5M5U A;  2VC2 A;  3T3M A;  5FFO A;  2YNN A;  3ZE1 A;  4FAN D;  5I5M A;  5H17 A;  4QT8 A;  2P9P C;  3BWS A;  5C9Z B;  2J55 H;  5HQG A;  2H9N A;  4ZOV A;  2PM6 B;  3IJC A;  4JT6 C;  3MVD K;  5THA A;  3I8C A;  1U2V C;  4I79 A;  4Z7O A;  1UOP A;  4X61 B;  5K1C C;  4FA9 D;  1U8C A;  2H14 A;  4WK0 A;  3OL2 B;  2VZ1 A;  5EAR A;  4ERY A;  4A08 A;  5EML B;  4Z7Q A;  2AQ5 A;  4IRZ A;  2QZP A;  4J86 A;  3EQ7 A;  4MMX A;  1YFQ A;  3SVW D;  3PVW B;  4E5Z A;  1N6E A;  3MMY A;  1GOT B;  4O1Q D;  1L0Q A;  4XYH A;  4A11 B;  4PSX B;  4Y7R A;  2AH0 A;  4NBM A;  2I3S A;  3SXT D;  1NR0 A;  4ZOX A;  3IUN A;  5EMK B;  4GQ1 A;  4FHL A;  4UM8 A;  2CE9 A;  4BUJ C;  4LG9 A;  1XHM A;  3OKT A;  2J56 H;  2OVP B;  4PBZ A;  4PC0 A;  5FQD A;  4PNK B;  3UVM A;  3PSL A;  3UVO A;  1SQ9 A;  3JZG A;  2IWF A;  1K3I A;  1JV2 A;  4IMM A;  3EQ8 A;  4CZY A;  5GXI A;  4WK2 A;  1FWX A;  3I7N A;  4OZU A;  4ESG A;  3DM0 A;  2H9P A;  2AGW A;  4G56 B;  1K32 A;  4AOW A;  2YMU A;  2TRC B;  2P9K C;  1O6G A;  3JPX A;  1N6D A;  4J73 A;  4ERZ A;  4A0B B;  5C92 A;  4DNW A;  4L1M A;  4R7A B;  3RN0 D;  5EMM B;  1K8K C;  3AH8 B;  3IVM A;  2G9A A;  1C9L A;  4CZV A;  1GXR A;  3ULE C;  4MMY A;  1B9Y A;  4QRJ A;  1PBY B;  4QL1 A;  2P9S C;  5C2V B;  2XU7 A;  3PXT D;  3T3P A;  3EU7 A;  4QAM A;  5CXC B;  4FA1 D;  3K6S A;  3FCU A;  3MXX A;  4KFM B;  3JB9 L;  4G1E A;  3B7F A;  4K3I D;  3UVL A;  1E5T A;  1YR2 A;  4BL0 A;  4BCB A;  2OIZ A;  4CZX A;  3MKS B;  4PBY A;  4RE5 A;  1QFM A;  4BP9 A;  2H3X A;  2HU8 A;  3MZK A;  1UOQ A;  2CNX A;  4NEN A;  1C9I A;  2PM9 A;  2PM7 B;  4WK4 A;  5IGO A;  2CO0 C;  2VDO A;  4JXM A;  5CYK A;  3RN1 D;  2Z2N A;  4UI9 R;  4E54 A;  3SLE D;  3RRM C;  4Z7N A;  3O4I A;  1PEV A;  2AGY A;  3IIW A;  4H5J A;  4O9D A;  2H6N A;  2I0R A;  3C99 A;  3OKY B;  4JT5 C;  4AMZ A;  4J8G A;  1U4C A;  5EM2 A;  4JD2 C;  4G55 A;  4A09 A;  3IJ0 A;  5TEF A;  2P9N C;  2QR5 A;  2HU5 A;  4GZ8 A;  2QXV A;  4ZOY A;  3EI4 A;  2IUQ A;  4GM8 A;  1VE6 A;  1JOF A;  2VDK A;  3I89 A;  3EG6 A;  3JZH A;  1OMW B;  3EI2 A;  4NC4 A;  2BBK H;  2CN2 A;  5E6S A;  2OVQ B;  3MUN A;  1JMZ B;  1Q47 A;  2HKR A;  2OVR B;  5A2Q g;  3DDU A;  3ZE0 A;  3O4J A;  3IUQ A;  1M1X A;  5FKT A;  3N0D A;  2UZY B;  2I0T A;  1SQJ A;  5K19 A;  5M5T A;  3ZDY A;  4J0W A;  1GOG A;  3I7P A;  2OK6 A;  4LGN A;  5AJA A;  5GXH A;  4MMZ A;  2AH1 A;  4PXW A;  5EMJ B;  2IUP A;  2YBA A;  2YNP A;  4CI2 A;  4CI1 A;  3IJE A;  2YB8 B;  3OL2 A;  5IT9 g;  3U4Y A;  3C9C A;  1H2X A;  3FRX A;  1L5G A;  4L3G D;  1E8M A;  5C2W B;  1T2X A;  2H47 A;  2VDR A;  4RE6 A;  4U7A A;  3NVQ A;  3FGB A;  3IUM A;  2B5M A;  4XEI C;  4X3E A;  4A11 A;  5I5I A;  2P9I C;  4JSV C;  3UKR C;  1MG3 A;  2HYE A;  3GD1 I;  4NSX A;  2PBI B;  3MUO A;  3P4F A;  4J82 A;  1GOF A;  4GGD A;  2CE8 A;  4J81 A;  3AL9 A;  2VDM A;  1MG2 A;  1UOO A;  2BCJ B;  3K27 A;  2OJY A;  3SHF A;  1RI6 A;  3GC3 B;  4CY3 A;  4YVD A;  3IUJ A;  3MZL A;  3J80 g;  4D9S A;  5AMS A;  2Z2O A;  5I5J A;  5E6R A;  2P9U C;  5FFG A;  4ES0 A;  3O4G A;  1R5M A;  4CC9 A;  2Z2P A;  4FWW A;  5FLX g;  2XDW A;  3A0F A;  4A7J A;  4A0A B;  2XYI A;  2XZG A;  5IGQ A;  4J8B A;  2EIC A;  2JKX A;  1VZ3 A;  3NIG A;  4GQ2 P;  5M5S A;  4A0B A;  3O4H A;  1S4U X;  4FA5 D;  5TDH B;  4O3U B;  2XE4 A;  4J77 A;  3JAM g;  3OTT A;  3ORV D;  4L1Q D;  2IAA A;  2YNO A;  4PSW B;  4X63 B;  1QFS A;  4L3H D;  3QI0 A;  3VI3 A;  4BH6 A;  3K71 A;  5CXC A;  5TEE A;  1GG2 B;  3J81 g;  1XKS A;  5CXB B;  4GM9 A;  3RMZ D;  3OKW A;  3ZE2 A;  5GMK n;  3F3P A;  3L4O D;  5HE1 B;  4J0X A;  4OWR A;  3I2N A;  3PE7 A;  3V7D B;  3SWS D;  2H68 A;  2CN3 A;  3I7K A;  3IJ1 A;  3FCS A;  3IUR A;  5FKR A;  1A12 A;  3I7H A;  3F3F A;  3L4M D;  3ZWL B;  4O2W A;  3EI3 B;  3K26 A;  5HE3 B;  5HE2 B;  1VZ2 A;  3SN6 B;  3UR4 A;  1XIP A;  4ZN4 A;  3HFQ A;  3SMR A;  2IUR A;  5JWZ A;  3JRO A;  4X60 B;  3OKY A;  2VDP A;  3UVN A;  3I7L A;  5C86 A;  3PVU B;  3EI3 A;  2VZ3 A;  4CI3 A;  3CIK B;  3JZN A;  2B4E A;  2O9K A;  5EAP A;  4JSP C;  4BP8 A;  2HJB A;  3AL8 B;  4GGC A;  3NVX A;  2GNQ A;  2Q7Q A;  5M5V A;  3UKU C;  2AGZ A;  3CFS B;  5AFU 3;  3RFG A;  4L9O A;  2IUV A;  1TYQ C;  4O45 A;  5EAM A;  4AN0 A;  5FKQ A;  3AL8 A;  4DNU A;  2H9L A;  3RLM D;  4MK0 B;  1JTD B;  3OW8 A;  1O6F A;  2VDN A;  4H5I A;  4A08 B;  4A2M A;  5HE0 B;  1A0R B;  5IJ8 E;  3C75 H;  2J57 G;  4E5Z B;  3PXS D;  2H6Q A;  3DSM A;  4AEZ A;  3V9F A;  4GQB B;  4JSX C;  4D0K A;  4JHN A;  2UZX B;  3KRX B;  3DXK C;  4Z8L A;  3V4P A;  1SHY B;  2H6K A;  1VE7 A;  3F3G A;  3SBQ A;  3KRW B;  3V4V A;  3VH0 A;  3BG0 A;  4O02 A;  3EWE A;  3W15 A;  1B9X A;  2HJ4 A;  4JSN C;  5IC7 A;  3SFZ A;  1TYE A;  3DWL C;  3SCY A;  1H2Y A;  5IJ7 E;  2W18 A;  4LG8 A;  2I3T A;  5H1M A;  5HDB A;  5HYN B;  2WQ8 A;  4NAA A;  3UVK A;  2CO0 A;  4J84 A;  1E8N A;  1TBG A;  4GGA A;  4BCD A;  4HDJ A;  5KDO B;  3DXM C;  1VYH C;  3IUL A;  2EBS A;  5EAL A;  3SJL D;  3CFV A;  2IWK A;  2EID A;  3K72 A;  3KCI A;  4ERQ A;  2B5N A;  5M5R A;  1I2M B;  4JHP C;  3BG1 A;  1H2Z A;  5SXM A;  3C5M A;  2QC5 A;  2AGX A;  2HES X;  2XL3 A;  2VDQ A;  3EI1 B;  2GC4 A;  1OLZ A;  4ZOZ A;  5FKS A;  3OF7 A;  1N6F A;  4IA9 A;  3NIF A;  3AFC A;  4D6V A;  2AGL A;  4CI8 A;  2HKM A;  4J79 A;  1P22 A;  1JJU B;  4A0A A;  3EI1 A;  2MTA H;  4AMY A;  2G99 A;  2GC7 A;  4A2L A;  5H14 A;  1MDA H;  3SBR A;  1GOH A;  2VDL A;  4K3J B;  3VI4 A;  1ERJ A;  4N14 A;  3V5W B;  2I0S A;  3SBP A;  1UTC A;  4U1E I;  4AX4 A;  3ODT A;  4FAV D;  4AN1 A;  4BCC A;  5E6U A;  4O3T B;  4UM9 A;  2XL2 A;  2P9L C;  5GSA A;  1NEX B;  3I7O A;  3GRE A;  3VA6 A;  4EWR A;  3PXW D;  3IIY A;  5CXB A;  5M61 A;  2BKL A;  2OK4 A;  1QNI A;  3ZDX A;  2PM9 B;  2EIE A;  3EQ9 A;  3NID A;  5FXY A;  3E0C A;  5CYK B;  1BPO A;  3N0E A;  3JRP A;  4E54 B;  2B5L A;  4CY1 A;  3FM0 A;  1PI6 A;  2H13 A;  2HXC A;  4CY2 A;  1JMX B;  3RSE C;  3MKQ A;  2HU7 A;  4Y5R D;  4FB1 D;  4XYI A;  4QQE A;  4J78 A;  1PGU A;  3ZDZ A;  5EM2 B;  3GFC A;  2H9M A;  3EMH A;  4A09 B;  3VGZ A;  1GP2 B;  4GM3 A;  3RFH A;  3NVN A;  4FA4 D;  4DNV A;  3IKO A;  3PSC B;  4J87 A;  3I8E A;  3EI4 B;  4WJK A;  4G1M A;  5FA5 B;  5TF2 A;  1H2W A; 
#chains in the Genus database with same CATH homology
 4TZ4 A;  4GMB A;  3EI2 B;  5B4W A;  4CY5 A;  2YNN A;  4FAN D;  5I5M A;  5H17 A;  4QT8 A;  2P9P C;  3BWS A;  5C9Z B;  2J55 H;  5HQG A;  2H9N A;  4ZOV A;  2PM6 B;  3IJC A;  4JT6 C;  5THA A;  3I8C A;  1U2V C;  4I79 A;  4X61 B;  5K1C C;  4FA9 D;  2H14 A;  3OL2 B;  5EAR A;  4ERY A;  4A08 A;  5EML B;  2AQ5 A;  4J86 A;  3SVW D;  1YFQ A;  3PVW B;  4E5Z A;  1N6E A;  3MMY A;  1GOT B;  4O1Q D;  1L0Q A;  4XYH A;  4A11 B;  4PSX B;  4Y7R A;  2AH0 A;  2I3S A;  3SXT D;  1NR0 A;  4ZOX A;  5EMK B;  4GQ1 A;  4FHL A;  2CE9 A;  4BUJ C;  4LG9 A;  1XHM A;  3OKT A;  2J56 H;  2OVP B;  4PBZ A;  4PC0 A;  5FQD A;  4PNK B;  3UVM A;  3PSL A;  3UVO A;  1SQ9 A;  3JZG A;  2IWF A;  4IMM A;  4CZY A;  5GXI A;  1FWX A;  3I7N A;  4OZU A;  4ESG A;  3DM0 A;  2H9P A;  2AGW A;  4G56 B;  1K32 A;  4AOW A;  2YMU A;  2TRC B;  2P9K C;  3JPX A;  1N6D A;  4J73 A;  4ERZ A;  4A0B B;  4R7A B;  3RN0 D;  5EMM B;  1K8K C;  3AH8 B;  2G9A A;  4CZV A;  1GXR A;  3ULE C;  1B9Y A;  4QRJ A;  1PBY B;  4QL1 A;  2P9S C;  5C2V B;  2XU7 A;  3PXT D;  3EU7 A;  5CXC B;  4FA1 D;  3MXX A;  4KFM B;  3JB9 L;  3B7F A;  4K3I D;  3UVL A;  4BL0 A;  2OIZ A;  4CZX A;  3MKS B;  4PBY A;  2H3X A;  3MZK A;  2CNX A;  2PM9 A;  2PM7 B;  5IGO A;  2CO0 C;  4JXM A;  5CYK A;  3RN1 D;  2Z2N A;  4UI9 R;  4E54 A;  3SLE D;  3RRM C;  1PEV A;  2AGY A;  3IIW A;  4H5J A;  4O9D A;  2H6N A;  2I0R A;  3C99 A;  3OKY B;  4JT5 C;  4J8G A;  1U4C A;  5EM2 A;  4JD2 C;  4A09 A;  3IJ0 A;  5TEF A;  2P9N C;  4GZ8 A;  2QXV A;  4ZOY A;  3EI4 A;  2IUQ A;  4GM8 A;  1JOF A;  3I89 A;  3EG6 A;  3JZH A;  1OMW B;  3EI2 A;  2BBK H;  2CN2 A;  2OVQ B;  1JMZ B;  1Q47 A;  2HKR A;  2OVR B;  5A2Q g;  5FKT A;  3N0D A;  2UZY B;  2I0T A;  1SQJ A;  5K19 A;  4J0W A;  3I7P A;  2OK6 A;  4LGN A;  5AJA A;  5GXH A;  2AH1 A;  4PXW A;  5EMJ B;  2IUP A;  2YBA A;  2YNP A;  4CI2 A;  4CI1 A;  2YB8 B;  3OL2 A;  5IT9 g;  3U4Y A;  3C9C A;  3FRX A;  4L3G D;  5C2W B;  2H47 A;  4U7A A;  3NVQ A;  3FGB A;  2B5M A;  4XEI C;  4X3E A;  4A11 A;  5I5I A;  2P9I C;  4JSV C;  3UKR C;  1MG3 A;  2HYE A;  4NSX A;  2PBI B;  3P4F A;  4J82 A;  4GGD A;  2CE8 A;  4J81 A;  3AL9 A;  1MG2 A;  2BCJ B;  3K27 A;  2OJY A;  3SHF A;  1RI6 A;  4CY3 A;  4YVD A;  3MZL A;  3J80 g;  5AMS A;  2Z2O A;  5I5J A;  2P9U C;  4ES0 A;  1R5M A;  4CC9 A;  2Z2P A;  4FWW A;  5FLX g;  3A0F A;  4A7J A;  4A0A B;  2XYI A;  5IGQ A;  4J8B A;  4GQ2 P;  4A0B A;  4FA5 D;  1S4U X;  5TDH B;  4O3U B;  4J77 A;  3JAM g;  3OTT A;  3ORV D;  4L1Q D;  2IAA A;  2YNO A;  4PSW B;  4X63 B;  4L3H D;  4BH6 A;  5CXC A;  5TEE A;  1GG2 B;  3J81 g;  1XKS A;  5CXB B;  4GM9 A;  3RMZ D;  3OKW A;  5GMK n;  3F3P A;  3L4O D;  5HE1 B;  4J0X A;  4OWR A;  3I2N A;  3PE7 A;  3V7D B;  3SWS D;  2H68 A;  2CN3 A;  3I7K A;  3IJ1 A;  5FKR A;  3I7H A;  3F3F A;  3L4M D;  3ZWL B;  3EI3 B;  3K26 A;  5HE3 B;  5HE2 B;  3SN6 B;  3UR4 A;  1XIP A;  4ZN4 A;  3HFQ A;  3SMR A;  2IUR A;  5JWZ A;  3JRO A;  4X60 B;  3OKY A;  3UVN A;  3I7L A;  3PVU B;  3EI3 A;  4CI3 A;  3CIK B;  3JZN A;  2B4E A;  2O9K A;  5EAP A;  4JSP C;  2HJB A;  3AL8 B;  4GGC A;  3NVX A;  2GNQ A;  2Q7Q A;  3UKU C;  2AGZ A;  3CFS B;  5AFU 3;  3RFG A;  4L9O A;  2IUV A;  1TYQ C;  4O45 A;  5EAM A;  5FKQ A;  3AL8 A;  2H9L A;  3RLM D;  4MK0 B;  3OW8 A;  4H5I A;  4A08 B;  4A2M A;  5HE0 B;  1A0R B;  5IJ8 E;  3C75 H;  2J57 G;  4E5Z B;  3PXS D;  2H6Q A;  3DSM A;  4AEZ A;  3V9F A;  4GQB B;  4JSX C;  4D0K A;  2UZX B;  3KRX B;  3DXK C;  4Z8L A;  1SHY B;  2H6K A;  3F3G A;  3SBQ A;  3KRW B;  3VH0 A;  3BG0 A;  3EWE A;  3W15 A;  1B9X A;  2HJ4 A;  4JSN C;  5IC7 A;  3SFZ A;  3DWL C;  3SCY A;  5IJ7 E;  2W18 A;  4LG8 A;  2I3T A;  5H1M A;  5HYN B;  3UVK A;  2CO0 A;  4J84 A;  1TBG A;  4GGA A;  4HDJ A;  5KDO B;  3DXM C;  1VYH C;  5EAL A;  2EBS A;  3SJL D;  3CFV A;  2IWK A;  4ERQ A;  2B5N A;  3BG1 A;  5SXM A;  3C5M A;  2QC5 A;  2AGX A;  2HES X;  2XL3 A;  3EI1 B;  2GC4 A;  1OLZ A;  4ZOZ A;  5FKS A;  1N6F A;  4IA9 A;  4D6V A;  3AFC A;  2AGL A;  4CI8 A;  2HKM A;  4J79 A;  1P22 A;  1JJU B;  4A0A A;  3EI1 A;  2MTA H;  2G99 A;  2GC7 A;  4A2L A;  5H14 A;  1MDA H;  3SBR A;  4K3J B;  1ERJ A;  4N14 A;  3V5W B;  2I0S A;  3SBP A;  4U1E I;  3ODT A;  4FAV D;  4O3T B;  2XL2 A;  2P9L C;  5GSA A;  1NEX B;  3I7O A;  3GRE A;  3VA6 A;  4EWR A;  3PXW D;  3IIY A;  5CXB A;  2OK4 A;  1QNI A;  2PM9 B;  5FXY A;  3E0C A;  5CYK B;  3N0E A;  3JRP A;  4E54 B;  2B5L A;  4CY1 A;  3FM0 A;  1PI6 A;  2H13 A;  2HXC A;  4CY2 A;  1JMX B;  3RSE C;  3MKQ A;  4FB1 D;  4Y5R D;  4XYI A;  4QQE A;  4J78 A;  1PGU A;  5EM2 B;  3GFC A;  2H9M A;  3EMH A;  4A09 B;  3VGZ A;  1GP2 B;  4GM3 A;  3RFH A;  3NVN A;  4FA4 D;  3IKO A;  3PSC B;  4J87 A;  3I8E A;  3EI4 B;  5FA5 B;  5TF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...