3C99A

Structural basis of histone h4 recognition by p55
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
405
structure length
380
Chain Sequence
b'SFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPCQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin assembly factor 1 p55 subunit
publication title Structural basis of histone H4 recognition by p55.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repressor
total genus 88
structure length 380
sequence length 405
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c99A00
3MMYA 2OJYA 3SFZA 3OKTA 3HFQA 4GZ8A 5AJAA 3F3GA 4AOWA 3VGZA 3EI4B 5IGOA 3VH0A 5C2WB 4CY5A 4A2LA 1QNIA 5EMJB 3C99A 4JSVC 2B5LA 5HE0B 4L9OA 5K19A 4J0WA 4KFMB 4A2MA 4A11A 2CO0C 4J82A 4CI3A 4K3ID 3SBPA 3B7FA 2J55H 2H9MA 3UKUC 2IAAA 1MG2A 2PBIB 3PVWB 1ERJA 1NEXB 5CXCA 4JSXC 5TDHB 3SHFA 4A0BA 4FAND 4L3GD 3PXWD 2AGZA 3SVWD 5H17A 2PM7B 1PEVA 2XYIA 4L3HD 4PNKB 4FA9D 3KRWB 4ZOVA 3I2NA 2IWKA 4XEIC 2I0SA 4D0KA 4EWRA 4J77A 3ORVD 2AGYA 2B5MA 4E5ZA 5IC7A 4ERQA 3MKSB 3RN1D 2CN2A 2O9KA 3F3FA 4G56B 2OK4A 3UVKA 2H47A 2OVPB 4J84A 2XL2A 3EI3B 3NVXA 3FRXA 2PM9A 2QXVA 3UKRC 5FLXg 1Q47A 2H68A 2IUQA 4CZVA 3FM0A 1U4CA 2HKMA 4PSWB 4ZOZA 2MTAH 3DM0A 4J86A 3JPXA 5THAA 2XL3A 4J78A 5CYKB 4GGCA 1FWXA 5IT9g 2P9IC 4Y7RA 2UZYB 4O3UB 4CI2A 1SQJA 3SJLD 4BUJC 3SN6B 3PSCB 4E54A 3NVQA 3OKYA 2GC4A 2I3SA 3V9FA 3C75H 5GSAA 2YNOA 3JZNA 3UVMA 3OTTA 1GXRA 2H9PA 3EI4A 3PE7A 5FKQA 3EI2A 4NSXA 3RN0D 4J8GA 4Z8LA 2I3TA 3OW8A 4JSNC 4FA4D 2IWFA 3DSMA 3EI1A 3MKQA 2Z2PA 1OLZA 2YB8B 5TEFA 1U2VC 3IJ1A 4FB1D 4GQ2P 3BWSA 3A0FA 3AH8B 5JWZA 1N6FA 4O9DA 3KRXB 2CN3A 3SMRA 2CE9A 2AH0A 2H13A 1GP2B 2P9KC 3MZKA 4ES0A 1JMZB 4PBZA 3OL2A 1SHYB 2I0RA 2B4EA 2J57G 5EARA 4QL1A 2H6QA 3J81g 3DXMC 3V5WB 4J79A 1RI6A 4PSXB 4BH6A 1TYQC 4H5JA 4A0AA 2I0TA 2H9LA 2HJ4A 5EALA 4N14A 4U1EI 3CFSB 4D6VA 4FAVD 1YFQA 3L4OD 2IURA 3CFVA 4ERZA 5AFU3 3I7LA 2HESX 5HE1B 2YNNA 3I7PA 4UI9R 5FKSA 3SXTD 1B9XA 2CO0A 4X61B 3IIWA 3I7KA 5A2Qg 3DWLC 5HYNB 4A08B 2HXCA 5GXIA 3SLED 3RFGA 1XIPA 2HKRA 2XU7A 5HE3B 3P4FA 4JT5C 1XKSA 4I79A 4O1QD 3SBRA 3I7NA 1PGUA 4ESGA 1P22A 2H14A 5CYKA 3AL9A 1R5MA 5B4WA 2P9NC 5EM2B 4CI8A 4CY1A 1JOFA 3EU7A 1VYHC 3C5MA 2YBAA 2P9UC 2YMUA 2AQ5A 4QRJA 2PM6B 4PBYA 3U4YA 2H6KA 4FA1D 3UR4A 4J87A 5CXBB 5TEEA 1GG2B 3IKOA 5CXCB 4YVDA 2P9SC 5SXMA 4GM3A 5K1CC 2GNQA 5AMSA 4BL0A 3ZWLB 5FKRA 4X3EA 3L4MD 4FHLA 3I89A 3GREA 4X63B 4OZUA 3RSEC 4X60B 5IJ7E 3PVUB 4A09B 3BG1A 2YNPA 3I7HA 4TZ4A 3MXXA 4J0XA 4ERYA 4QT8A 4ZOXA 4ZOYA 5EAMA 4A7JA 4J81A 3AL8B 2P9LC 5FQDA 3SCYA 3ODTA 1N6EA 4R7AB 4XYIA 2B5NA 5IGQA 5EMKB 1PBYB 2OK6A 4CZYA 1SQ9A 4ZN4A 3EMHA 3SWSD 4LGNA 4JSPC 2Z2OA 5EMLB 4PC0A 2Q7QA 3F3PA 2GC7A 4HDJA 4GQBB 5FXYA 2CNXA 5H1MA 4GGAA 4CC9A 4IMMA 3NVNA 3OKYB 3UVNA 2BBKH 4A08A 4FA5D 4J8BA 3JAMg 1TBGA 5I5JA 4H5IA 3K26A 3I8EA 3EI2B 1K8KC 5C2VB 2G9AA 4O45A 1N6DA 3I7OA 4L1QD 4CI1A 2H9NA 4Y5RD 5I5IA 3EI1B 5C9ZB 2H6NA 5TF2A 4O3TB 2P9PC 4GM9A 5EAPA 5EM2A 3EG6A 3EI3A 3CIKB 1NR0A 5EMMB 2BCJB 3V7DB 5HQGA 1MG3A 4LG9A 5GXHA 1JJUB 3RLMD 5CXBA 1B9YA 2H3XA 1PI6A 3OL2B 2AGXA 2EBSA 3MZLA 4A11B 2IUPA 4CY2A 2QC5A 4A0AB 4GM8A 3W15A 1JMXB 4PXWA 2J56H 4K3JB 3I8CA 4IA9A 3FGBA 3UVLA 4XYHA 5IJ8E 3JB9L 4GGDA 3UVOA 2IUVA 4FWWA 3RRMC 2AGWA 2CE8A 2UZXB 3JRPA 3C9CA 4A09A 4A0BB 3K27A 1MDAH 3AFCA 2W18A 4U7AA 3RMZD 1K32A 5HE2B 4CZXA 2TRCB 3OKWA 3AL8A 3IJCA 1XHMA 4AEZA 2HJBA 4LG8A 3DXKC 5I5MA 4E5ZB 3E0CA 4JT6C 3PSLA 3PXTD 5KDOB 3J80g 3ULEC 3EWEA 5FA5B 1S4UX 3RFHA 3PXSD 5H14A 2OIZA 2G99A 4QQEA 1L0QA 2AH1A 3IIYA 4JXMA 2PM9B 1A0RB 3N0DA 5FKTA 3VA6A 2OVRB 2HYEA 3JZHA 2Z2NA 4JD2C 4MK0B 5GMKn 2AGLA 4GMBA 1OMWB 3IJ0A 1GOTB 3SBQA 4CY3A 4GQ1A 3N0EA 2OVQB 3JROA 4J73A 4OWRA 3GFCA 3BG0A 3JZGA 4E54B
chains in the Genus database with same CATH superfamily
3MMYA 2OJYA 2QZPA 3SFZA 3VI3A 3K6SA 3OKTA 3HFQA 4GZ8A 5AJAA 3F3GA 4AOWA 3VGZA 3EI4B 1VZ2A 5IGOA 3VH0A 5C2WB 4CY5A 4A2LA 1QNIA 5EMJB 3C99A 1M1XA 1JV2A 2B5LA 4JSVC 5HE0B 4L9OA 5K19A 4J0WA 4KFMB 4A2MA 4AMZA 4A11A 2CO0C 4J82A 4CI3A 4K3ID 3SBPA 3V4VA 3V4PA 3B7FA 2J55H 2H9MA 1BPOA 3UKUC 2IAAA 1GOFA 1MG2A 2PBIB 4Z7QA 3PVWB 1ERJA 1I2MB 1NEXB 5CXCA 4JSXC 5TDHB 3SHFA 4A0BA 4FAND 4L3GD 3PXWD 2AGZA 3SVWD 5H17A 2PM7B 1PEVA 3IULA 2XYIA 4L3HD 1QFSA 4PNKB 4FA9D 3KRWB 4ZOVA 3I2NA 2IWKA 3O4GA 4XEIC 2I0SA 4D0KA 2VDLA 4EWRA 3O4IA 2VDPA 4J77A 3ORVD 2AGYA 2B5MA 4E5ZA 4QAMA 2VC2A 5IC7A 4ERQA 3MKSB 4WJKA 3RN1D 4G1MA 2CN2A 2O9KA 3F3FA 4G56B 2VZ1A 2OK4A 3UVKA 2H47A 2OVPB 3GC3B 2XL2A 3EI3B 1T2XA 3NVXA 3FRXA 4J84A 4MMYA 4D9SA 2PM9A 2QXVA 1O6FA 3T3PA 3UKRC 5FLXg 1Q47A 2H68A 2IUQA 4CZVA 1QFMA 3FM0A 1U4CA 2HKMA 3NIDA 4PSWB 4ZOZA 2MTAH 3DM0A 4J86A 3JPXA 1TYEA 5THAA 2XL3A 4J78A 5CYKB 4GGCA 1FWXA 5IT9g 2P9IC 4Y7RA 2UZYB 4O3UB 4CI2A 1SQJA 3SJLD 4BUJC 3SN6B 3PSCB 4E54A 3NVQA 3OKYA 2GC4A 2I3SA 3FCSA 5E6UA 3V9FA 3C75H 5M5RA 5GSAA 2YNOA 3JZNA 3UVMA 5M5UA 3OTTA 5M61A 1GXRA 2H9PA 1GOGA 3EI4A 4O02A 3PE7A 4MMZA 5FKQA 3EI2A 4NSXA 3RN0D 4J8GA 4Z8LA 2I3TA 2VDQA 3OW8A 4JSNC 1UOPA 2IWFA 4FA4D 3DSMA 3EI1A 3MKQA 2Z2PA 1OLZA 1VE7A 1C9IA 2YB8B 5TEFA 1U2VC 5M5TA 3IJ1A 4FB1D 5E6RA 4GQ2P 3BWSA 3A0FA 3AH8B 2EICA 5JWZA 1N6FA 4O2WA 4O9DA 3KRXB 2CN3A 3SMRA 2CE9A 2AH0A 5M5SA 2H13A 1E8NA 1GP2B 2P9KC 3MZKA 4ES0A 1JMZB 4PBZA 4BCBA 3OL2A 1SHYB 2I0RA 2B4EA 2J57G 1H2ZA 4QL1A 5EARA 2H6QA 3J81g 3DXMC 3V5WB 4J79A 1RI6A 4PSXB 4BH6A 5FFGA 1TYQC 3IUMA 4H5JA 2VZ3A 4A0AA 2XDWA 2I0TA 2H9LA 2HJ4A 5EALA 4N14A 4U1EI 3CFSB 4D6VA 4FAVD 1YFQA 3L4OD 2IURA 3CFVA 4ERZA 5AFU3 3I7LA 2HESX 2VDMA 5HE1B 2YNNA 3I7PA 4BCDA 4UI9R 2XZGA 5FKSA 3SXTD 1B9XA 2CO0A 4X61B 3IIWA 3I7KA 5A2Qg 3DWLC 1UTCA 1A12A 5HYNB 4DNUA 4A08B 2HXCA 5E6SA 5GXIA 3SLED 3RFGA 1XIPA 2HKRA 2XU7A 5HE3B 3P4FA 4JT5C 1XKSA 4I79A 4O1QD 3SBRA 3I7NA 3MUNA 1PGUA 4ESGA 1O6GA 1P22A 2H14A 3O4JA 5CYKA 3AL9A 3IJEA 1R5MA 5B4WA 2P9NC 5EM2B 4CI8A 4CY1A 1JOFA 3EU7A 1VYHC 3C5MA 2YBAA 2P9UC 2YMUA 2AQ5A 3IUNA 4L1MA 4QRJA 2PM6B 4PBYA 3U4YA 4AN0A 5FFOA 2H6KA 4FA1D 3UR4A 4J87A 2EIBA 5CXBB 4G55A 5TEEA 1GG2B 3IKOA 3EQ8A 5CXCB 4BP8A 4YVDA 2P9SC 5SXMA 1UOQA 2EIEA 4GM3A 4UM8A 4JHPC 5K1CC 1JTDB 2GNQA 5AMSA 4BL0A 1H2YA 3ZWLB 5FKRA 5HDBA 4X3EA 3ZDYA 3K72A 3L4MD 4FHLA 3I89A 3GREA 4WK0A 3IUQA 4X63B 3ZE1A 4OZUA 3RSEC 4X60B 3QHYB 3MUOA 3ZDZA 5IJ7E 3PVUB 4A09B 3BG1A 2YNPA 3DDUA 1K3IA 2VDOA 3I7HA 4Z7NA 1UOOA 4TZ4A 3MXXA 3ZE2A 3IUJA 4J0XA 4ERYA 4QT8A 4ZOXA 4ZOYA 5EAMA 4A7JA 4J81A 2EIDA 3AL8B 2P9LC 2VDNA 5FQDA 3SCYA 3ODTA 1N6EA 4R7AB 4XYIA 3EQ7A 2B5NA 5IGQA 2BKLA 5EMKB 1PBYB 3QI0A 2OK6A 4IRZA 4CZYA 1SQ9A 4ZN4A 3EMHA 3VI4A 3SWSD 4LGNA 2VDKA 4JSPC 2Z2OA 3IURA 5EMLB 4PC0A 2Q7QA 3F3PA 2GC7A 4HDJA 1C9LA 4GQBB 5FXYA 2CNXA 5H1MA 4GGAA 4CC9A 4IMMA 3NVNA 4Z7OA 1H2WA 3OKYB 3UVNA 2BBKH 4A08A 4FA5D 4J8BA 4NAAA 3FCUA 4BCCA 3JAMg 5C86A 3T3MA 1TBGA 5I5JA 2QR5A 3K26A 4H5IA 1E8MA 3I8EA 4AN1A 3EI2B 1K8KC 5C2VB 2G9AA 1H2XA 4O45A 4DNWA 1N6DA 3I7OA 1E5TA 4L1QD 4CI1A 2H9NA 4Y5RD 5I5IA 3EI1B 5C9ZB 2HU8A 2H6NA 5C92A 5TF2A 4O3TB 4RE6A 3NIFA 2P9PC 4GM9A 5EAPA 5EM2A 3EG6A 3EI3A 3CIKB 1VZ3A 1NR0A 5EMMB 2BCJB 3V7DB 5HQGA 1MG3A 4LG9A 3ZDXA 5GXHA 1JJUB 3RLMD 5CXBA 1B9YA 4AMYA 2H3XA 5M5VA 1PI6A 3OL2B 2AGXA 1YR2A 1L5GA 2EBSA 3MZLA 4A11B 2IUPA 4CY2A 2QC5A 4A0AB 4GM8A 3W15A 1JMXB 4PXWA 2J56H 4K3JB 3MVDK 2JKXA 3I8CA 3K71A 4IA9A 3FGBA 3UVLA 4XYHA 3EQ9A 1GOHA 5IJ8E 3JB9L 4GGDA 3UVOA 2IUVA 4FWWA 3ZE0A 3RRMC 4G1EA 2AGWA 2CE8A 2UZXB 3JRPA 3C9CA 4A09A 2VDRA 4AX4A 4A0BB 3K27A 2HU5A 1MDAH 3AFCA 4JHNA 2W18A 4U7AA 3RMZD 1K32A 4DNVA 5HE2B 4RE5A 4CZXA 2TRCB 3OKWA 3AL8A 4NENA 3IJCA 1XHMA 4AEZA 3IVMA 1U8CA 2HJBA 4LG8A 3DXKC 4UM9A 5I5MA 4E5ZB 3E0CA 4JT6C 3PSLA 3PXTD 5KDOB 3J80g 3ULEC 3EWEA 5FA5B 4NC4A 1S4UX 3RFHA 3PXSD 5H14A 4NBMA 2OIZA 2G99A 4QQEA 1L0QA 2AH1A 3IIYA 4JXMA 2PM9B 1A0RB 4MMXA 3N0DA 5FKTA 3OF7A 3VA6A 2OVRB 2HYEA 3JZHA 2Z2NA 4JD2C 4MK0B 5GMKn 2AGLA 4GMBA 1OMWB 3GD1I 3IJ0A 1GOTB 3SBQA 2XE4A 4CY3A 3NIGA 4WK2A 3O4HA 2HU7A 4WK4A 4GQ1A 2WQ8A 3N0EA 2OVQB 3JROA 4J73A 4BP9A 4OWRA 3GFCA 3BG0A 1VE6A 3JZGA 3KCIA 4E54B
chains in the Genus database with same CATH topology
3MMYA 2OJYA 3SFZA 3OKTA 3HFQA 4GZ8A 5AJAA 3F3GA 4AOWA 3VGZA 3EI4B 5IGOA 3VH0A 5C2WB 4CY5A 4A2LA 1QNIA 5EMJB 3C99A 4JSVC 2B5LA 5HE0B 4L9OA 5K19A 4J0WA 4KFMB 4A2MA 4A11A 2CO0C 4J82A 4CI3A 4K3ID 3SBPA 3B7FA 2J55H 2H9MA 3UKUC 2IAAA 1MG2A 2PBIB 3PVWB 1ERJA 1NEXB 5CXCA 4JSXC 5TDHB 3SHFA 4A0BA 4FAND 4L3GD 3PXWD 2AGZA 3SVWD 5H17A 2PM7B 1PEVA 2XYIA 4L3HD 4PNKB 4FA9D 3KRWB 4ZOVA 3I2NA 2IWKA 4XEIC 2I0SA 4D0KA 4EWRA 4J77A 3ORVD 2AGYA 2B5MA 4E5ZA 5IC7A 4ERQA 3MKSB 3RN1D 2CN2A 2O9KA 3F3FA 4G56B 2OK4A 3UVKA 2H47A 2OVPB 4J84A 2XL2A 3EI3B 3NVXA 3FRXA 2PM9A 2QXVA 3UKRC 5FLXg 1Q47A 2H68A 2IUQA 4CZVA 3FM0A 1U4CA 2HKMA 4PSWB 4ZOZA 2MTAH 3DM0A 4J86A 3JPXA 5THAA 2XL3A 4J78A 5CYKB 4GGCA 1FWXA 5IT9g 2P9IC 4Y7RA 2UZYB 4O3UB 4CI2A 1SQJA 3SJLD 4BUJC 3SN6B 3PSCB 4E54A 3NVQA 3OKYA 2GC4A 2I3SA 3V9FA 3C75H 5GSAA 2YNOA 3JZNA 3UVMA 3OTTA 1GXRA 2H9PA 3EI4A 3PE7A 5FKQA 3EI2A 4NSXA 3RN0D 4J8GA 4Z8LA 2I3TA 3OW8A 4JSNC 4FA4D 2IWFA 3DSMA 3EI1A 3MKQA 2Z2PA 1OLZA 2YB8B 5TEFA 1U2VC 3IJ1A 4FB1D 4GQ2P 3BWSA 3A0FA 3AH8B 5JWZA 1N6FA 4O9DA 3KRXB 2CN3A 3SMRA 2CE9A 2AH0A 2H13A 1GP2B 2P9KC 3MZKA 4ES0A 1JMZB 4PBZA 3OL2A 1SHYB 2I0RA 2B4EA 2J57G 5EARA 4QL1A 2H6QA 3J81g 3DXMC 3V5WB 4J79A 1RI6A 4PSXB 4BH6A 1TYQC 4H5JA 4A0AA 2I0TA 2H9LA 2HJ4A 5EALA 4N14A 4U1EI 3CFSB 4D6VA 4FAVD 1YFQA 3L4OD 2IURA 3CFVA 4ERZA 5AFU3 3I7LA 2HESX 5HE1B 2YNNA 3I7PA 4UI9R 5FKSA 3SXTD 1B9XA 2CO0A 4X61B 3IIWA 3I7KA 5A2Qg 3DWLC 5HYNB 4A08B 2HXCA 5GXIA 3SLED 3RFGA 1XIPA 2HKRA 2XU7A 5HE3B 3P4FA 4JT5C 1XKSA 4I79A 4O1QD 3SBRA 3I7NA 1PGUA 4ESGA 1P22A 2H14A 5CYKA 3AL9A 1R5MA 5B4WA 2P9NC 5EM2B 4CI8A 4CY1A 1JOFA 3EU7A 1VYHC 3C5MA 2YBAA 2P9UC 2YMUA 2AQ5A 4QRJA 2PM6B 4PBYA 3U4YA 2H6KA 4FA1D 3UR4A 4J87A 5CXBB 5TEEA 1GG2B 3IKOA 5CXCB 4YVDA 2P9SC 5SXMA 4GM3A 5K1CC 2GNQA 5AMSA 4BL0A 3ZWLB 5FKRA 4X3EA 3L4MD 4FHLA 3I89A 3GREA 4X63B 4OZUA 3RSEC 4X60B 5IJ7E 3PVUB 4A09B 3BG1A 2YNPA 3I7HA 4TZ4A 3MXXA 4J0XA 4ERYA 4QT8A 4ZOXA 4ZOYA 5EAMA 4A7JA 4J81A 3AL8B 2P9LC 5FQDA 3SCYA 3ODTA 1N6EA 4R7AB 4XYIA 2B5NA 5IGQA 5EMKB 1PBYB 2OK6A 4CZYA 1SQ9A 4ZN4A 3EMHA 3SWSD 4LGNA 4JSPC 2Z2OA 5EMLB 4PC0A 2Q7QA 3F3PA 2GC7A 4HDJA 4GQBB 5FXYA 2CNXA 5H1MA 4GGAA 4CC9A 4IMMA 3NVNA 3OKYB 3UVNA 2BBKH 4A08A 4FA5D 4J8BA 3JAMg 1TBGA 5I5JA 4H5IA 3K26A 3I8EA 3EI2B 1K8KC 5C2VB 2G9AA 4O45A 1N6DA 3I7OA 4L1QD 4CI1A 2H9NA 4Y5RD 5I5IA 3EI1B 5C9ZB 2H6NA 5TF2A 4O3TB 2P9PC 4GM9A 5EAPA 5EM2A 3EG6A 3EI3A 3CIKB 1NR0A 5EMMB 2BCJB 3V7DB 5HQGA 1MG3A 4LG9A 5GXHA 1JJUB 3RLMD 5CXBA 1B9YA 2H3XA 1PI6A 3OL2B 2AGXA 2EBSA 3MZLA 4A11B 2IUPA 4CY2A 2QC5A 4A0AB 4GM8A 3W15A 1JMXB 4PXWA 2J56H 4K3JB 3I8CA 4IA9A 3FGBA 3UVLA 4XYHA 5IJ8E 3JB9L 4GGDA 3UVOA 2IUVA 4FWWA 3RRMC 2AGWA 2CE8A 2UZXB 3JRPA 3C9CA 4A09A 4A0BB 3K27A 1MDAH 3AFCA 2W18A 4U7AA 3RMZD 1K32A 5HE2B 4CZXA 2TRCB 3OKWA 3AL8A 3IJCA 1XHMA 4AEZA 2HJBA 4LG8A 3DXKC 5I5MA 4E5ZB 3E0CA 4JT6C 3PSLA 3PXTD 5KDOB 3J80g 3ULEC 3EWEA 5FA5B 1S4UX 3RFHA 3PXSD 5H14A 2OIZA 2G99A 4QQEA 1L0QA 2AH1A 3IIYA 4JXMA 2PM9B 1A0RB 3N0DA 5FKTA 3VA6A 2OVRB 2HYEA 3JZHA 2Z2NA 4JD2C 4MK0B 5GMKn 2AGLA 4GMBA 1OMWB 3IJ0A 1GOTB 3SBQA 4CY3A 4GQ1A 3N0EA 2OVQB 3JROA 4J73A 4OWRA 3GFCA 3BG0A 3JZGA 4E54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMY A;  2OJY A;  3SFZ A;  3OKT A;  3HFQ A;  4GZ8 A;  5AJA A;  3F3G A;  4AOW A;  3VGZ A;  3EI4 B;  5IGO A;  3VH0 A;  5C2W B;  4CY5 A;  4A2L A;  1QNI A;  5EMJ B;  3C99 A;  4JSV C;  2B5L A;  5HE0 B;  4L9O A;  5K19 A;  4J0W A;  4KFM B;  4A2M A;  4A11 A;  2CO0 C;  4J82 A;  4CI3 A;  4K3I D;  3SBP A;  3B7F A;  2J55 H;  2H9M A;  3UKU C;  2IAA A;  1MG2 A;  2PBI B;  3PVW B;  1ERJ A;  1NEX B;  5CXC A;  4JSX C;  5TDH B;  3SHF A;  4A0B A;  4FAN D;  4L3G D;  3PXW D;  2AGZ A;  3SVW D;  5H17 A;  2PM7 B;  1PEV A;  2XYI A;  4L3H D;  4PNK B;  4FA9 D;  3KRW B;  4ZOV A;  3I2N A;  2IWK A;  4XEI C;  2I0S A;  4D0K A;  4EWR A;  4J77 A;  3ORV D;  2AGY A;  2B5M A;  4E5Z A;  5IC7 A;  4ERQ A;  3MKS B;  3RN1 D;  2CN2 A;  2O9K A;  3F3F A;  4G56 B;  2OK4 A;  3UVK A;  2H47 A;  2OVP B;  4J84 A;  2XL2 A;  3EI3 B;  3NVX A;  3FRX A;  2PM9 A;  2QXV A;  3UKR C;  5FLX g;  1Q47 A;  2H68 A;  2IUQ A;  4CZV A;  3FM0 A;  1U4C A;  2HKM A;  4PSW B;  4ZOZ A;  2MTA H;  3DM0 A;  4J86 A;  3JPX A;  5THA A;  2XL3 A;  4J78 A;  5CYK B;  4GGC A;  1FWX A;  5IT9 g;  2P9I C;  4Y7R A;  2UZY B;  4O3U B;  4CI2 A;  1SQJ A;  3SJL D;  4BUJ C;  3SN6 B;  3PSC B;  4E54 A;  3NVQ A;  3OKY A;  2GC4 A;  2I3S A;  3V9F A;  3C75 H;  5GSA A;  2YNO A;  3JZN A;  3UVM A;  3OTT A;  1GXR A;  2H9P A;  3EI4 A;  3PE7 A;  5FKQ A;  3EI2 A;  4NSX A;  3RN0 D;  4J8G A;  4Z8L A;  2I3T A;  3OW8 A;  4JSN C;  4FA4 D;  2IWF A;  3DSM A;  3EI1 A;  3MKQ A;  2Z2P A;  1OLZ A;  2YB8 B;  5TEF A;  1U2V C;  3IJ1 A;  4FB1 D;  4GQ2 P;  3BWS A;  3A0F A;  3AH8 B;  5JWZ A;  1N6F A;  4O9D A;  3KRX B;  2CN3 A;  3SMR A;  2CE9 A;  2AH0 A;  2H13 A;  1GP2 B;  2P9K C;  3MZK A;  4ES0 A;  1JMZ B;  4PBZ A;  3OL2 A;  1SHY B;  2I0R A;  2B4E A;  2J57 G;  5EAR A;  4QL1 A;  2H6Q A;  3J81 g;  3DXM C;  3V5W B;  4J79 A;  1RI6 A;  4PSX B;  4BH6 A;  1TYQ C;  4H5J A;  4A0A A;  2I0T A;  2H9L A;  2HJ4 A;  5EAL A;  4N14 A;  4U1E I;  3CFS B;  4D6V A;  4FAV D;  1YFQ A;  3L4O D;  2IUR A;  3CFV A;  4ERZ A;  5AFU 3;  3I7L A;  2HES X;  5HE1 B;  2YNN A;  3I7P A;  4UI9 R;  5FKS A;  3SXT D;  1B9X A;  2CO0 A;  4X61 B;  3IIW A;  3I7K A;  5A2Q g;  3DWL C;  5HYN B;  4A08 B;  2HXC A;  5GXI A;  3SLE D;  3RFG A;  1XIP A;  2HKR A;  2XU7 A;  5HE3 B;  3P4F A;  4JT5 C;  1XKS A;  4I79 A;  4O1Q D;  3SBR A;  3I7N A;  1PGU A;  4ESG A;  1P22 A;  2H14 A;  5CYK A;  3AL9 A;  1R5M A;  5B4W A;  2P9N C;  5EM2 B;  4CI8 A;  4CY1 A;  1JOF A;  3EU7 A;  1VYH C;  3C5M A;  2YBA A;  2P9U C;  2YMU A;  2AQ5 A;  4QRJ A;  2PM6 B;  4PBY A;  3U4Y A;  2H6K A;  4FA1 D;  3UR4 A;  4J87 A;  5CXB B;  5TEE A;  1GG2 B;  3IKO A;  5CXC B;  4YVD A;  2P9S C;  5SXM A;  4GM3 A;  5K1C C;  2GNQ A;  5AMS A;  4BL0 A;  3ZWL B;  5FKR A;  4X3E A;  3L4M D;  4FHL A;  3I89 A;  3GRE A;  4X63 B;  4OZU A;  3RSE C;  4X60 B;  5IJ7 E;  3PVU B;  4A09 B;  3BG1 A;  2YNP A;  3I7H A;  4TZ4 A;  3MXX A;  4J0X A;  4ERY A;  4QT8 A;  4ZOX A;  4ZOY A;  5EAM A;  4A7J A;  4J81 A;  3AL8 B;  2P9L C;  5FQD A;  3SCY A;  3ODT A;  1N6E A;  4R7A B;  4XYI A;  2B5N A;  5IGQ A;  5EMK B;  1PBY B;  2OK6 A;  4CZY A;  1SQ9 A;  4ZN4 A;  3EMH A;  3SWS D;  4LGN A;  4JSP C;  2Z2O A;  5EML B;  4PC0 A;  2Q7Q A;  3F3P A;  2GC7 A;  4HDJ A;  4GQB B;  5FXY A;  2CNX A;  5H1M A;  4GGA A;  4CC9 A;  4IMM A;  3NVN A;  3OKY B;  3UVN A;  2BBK H;  4A08 A;  4FA5 D;  4J8B A;  3JAM g;  1TBG A;  5I5J A;  4H5I A;  3K26 A;  3I8E A;  3EI2 B;  1K8K C;  5C2V B;  2G9A A;  4O45 A;  1N6D A;  3I7O A;  4L1Q D;  4CI1 A;  2H9N A;  4Y5R D;  5I5I A;  3EI1 B;  5C9Z B;  2H6N A;  5TF2 A;  4O3T B;  2P9P C;  4GM9 A;  5EAP A;  5EM2 A;  3EG6 A;  3EI3 A;  3CIK B;  1NR0 A;  5EMM B;  2BCJ B;  3V7D B;  5HQG A;  1MG3 A;  4LG9 A;  5GXH A;  1JJU B;  3RLM D;  5CXB A;  1B9Y A;  2H3X A;  1PI6 A;  3OL2 B;  2AGX A;  2EBS A;  3MZL A;  4A11 B;  2IUP A;  4CY2 A;  2QC5 A;  4A0A B;  4GM8 A;  3W15 A;  1JMX B;  4PXW A;  2J56 H;  4K3J B;  3I8C A;  4IA9 A;  3FGB A;  3UVL A;  4XYH A;  5IJ8 E;  3JB9 L;  4GGD A;  3UVO A;  2IUV A;  4FWW A;  3RRM C;  2AGW A;  2CE8 A;  2UZX B;  3JRP A;  3C9C A;  4A09 A;  4A0B B;  3K27 A;  1MDA H;  3AFC A;  2W18 A;  4U7A A;  3RMZ D;  1K32 A;  5HE2 B;  4CZX A;  2TRC B;  3OKW A;  3AL8 A;  3IJC A;  1XHM A;  4AEZ A;  2HJB A;  4LG8 A;  3DXK C;  5I5M A;  4E5Z B;  3E0C A;  4JT6 C;  3PSL A;  3PXT D;  5KDO B;  3J80 g;  3ULE C;  3EWE A;  5FA5 B;  1S4U X;  3RFH A;  3PXS D;  5H14 A;  2OIZ A;  2G99 A;  4QQE A;  1L0Q A;  2AH1 A;  3IIY A;  4JXM A;  2PM9 B;  1A0R B;  3N0D A;  5FKT A;  3VA6 A;  2OVR B;  2HYE A;  3JZH A;  2Z2N A;  4JD2 C;  4MK0 B;  5GMK n;  2AGL A;  4GMB A;  1OMW B;  3IJ0 A;  1GOT B;  3SBQ A;  4CY3 A;  4GQ1 A;  3N0E A;  2OVQ B;  3JRO A;  4J73 A;  4OWR A;  3GFC A;  3BG0 A;  3JZG A;  4E54 B; 
#chains in the Genus database with same CATH topology
 3MMY A;  2OJY A;  2QZP A;  3SFZ A;  3VI3 A;  3K6S A;  3OKT A;  3HFQ A;  4GZ8 A;  5AJA A;  3F3G A;  4AOW A;  3VGZ A;  3EI4 B;  1VZ2 A;  5IGO A;  3VH0 A;  5C2W B;  4CY5 A;  4A2L A;  1QNI A;  5EMJ B;  3C99 A;  1M1X A;  1JV2 A;  2B5L A;  4JSV C;  5HE0 B;  4L9O A;  5K19 A;  4J0W A;  4KFM B;  4A2M A;  4AMZ A;  4A11 A;  2CO0 C;  4J82 A;  4CI3 A;  4K3I D;  3SBP A;  3V4V A;  3V4P A;  3B7F A;  2J55 H;  2H9M A;  1BPO A;  3UKU C;  2IAA A;  1GOF A;  1MG2 A;  2PBI B;  4Z7Q A;  3PVW B;  1ERJ A;  1I2M B;  1NEX B;  5CXC A;  4JSX C;  5TDH B;  3SHF A;  4A0B A;  4FAN D;  4L3G D;  3PXW D;  2AGZ A;  3SVW D;  5H17 A;  2PM7 B;  1PEV A;  3IUL A;  2XYI A;  4L3H D;  1QFS A;  4PNK B;  4FA9 D;  3KRW B;  4ZOV A;  3I2N A;  2IWK A;  3O4G A;  4XEI C;  2I0S A;  4D0K A;  2VDL A;  4EWR A;  3O4I A;  2VDP A;  4J77 A;  3ORV D;  2AGY A;  2B5M A;  4E5Z A;  4QAM A;  2VC2 A;  5IC7 A;  4ERQ A;  3MKS B;  4WJK A;  3RN1 D;  4G1M A;  2CN2 A;  2O9K A;  3F3F A;  4G56 B;  2VZ1 A;  2OK4 A;  3UVK A;  2H47 A;  2OVP B;  3GC3 B;  2XL2 A;  3EI3 B;  1T2X A;  3NVX A;  3FRX A;  4J84 A;  4MMY A;  4D9S A;  2PM9 A;  2QXV A;  1O6F A;  3T3P A;  3UKR C;  5FLX g;  1Q47 A;  2H68 A;  2IUQ A;  4CZV A;  1QFM A;  3FM0 A;  1U4C A;  2HKM A;  3NID A;  4PSW B;  4ZOZ A;  2MTA H;  3DM0 A;  4J86 A;  3JPX A;  1TYE A;  5THA A;  2XL3 A;  4J78 A;  5CYK B;  4GGC A;  1FWX A;  5IT9 g;  2P9I C;  4Y7R A;  2UZY B;  4O3U B;  4CI2 A;  1SQJ A;  3SJL D;  4BUJ C;  3SN6 B;  3PSC B;  4E54 A;  3NVQ A;  3OKY A;  2GC4 A;  2I3S A;  3FCS A;  5E6U A;  3V9F A;  3C75 H;  5M5R A;  5GSA A;  2YNO A;  3JZN A;  3UVM A;  5M5U A;  3OTT A;  5M61 A;  1GXR A;  2H9P A;  1GOG A;  3EI4 A;  4O02 A;  3PE7 A;  4MMZ A;  5FKQ A;  3EI2 A;  4NSX A;  3RN0 D;  4J8G A;  4Z8L A;  2I3T A;  2VDQ A;  3OW8 A;  4JSN C;  1UOP A;  2IWF A;  4FA4 D;  3DSM A;  3EI1 A;  3MKQ A;  2Z2P A;  1OLZ A;  1VE7 A;  1C9I A;  2YB8 B;  5TEF A;  1U2V C;  5M5T A;  3IJ1 A;  4FB1 D;  5E6R A;  4GQ2 P;  3BWS A;  3A0F A;  3AH8 B;  2EIC A;  5JWZ A;  1N6F A;  4O2W A;  4O9D A;  3KRX B;  2CN3 A;  3SMR A;  2CE9 A;  2AH0 A;  5M5S A;  2H13 A;  1E8N A;  1GP2 B;  2P9K C;  3MZK A;  4ES0 A;  1JMZ B;  4PBZ A;  4BCB A;  3OL2 A;  1SHY B;  2I0R A;  2B4E A;  2J57 G;  1H2Z A;  4QL1 A;  5EAR A;  2H6Q A;  3J81 g;  3DXM C;  3V5W B;  4J79 A;  1RI6 A;  4PSX B;  4BH6 A;  5FFG A;  1TYQ C;  3IUM A;  4H5J A;  2VZ3 A;  4A0A A;  2XDW A;  2I0T A;  2H9L A;  2HJ4 A;  5EAL A;  4N14 A;  4U1E I;  3CFS B;  4D6V A;  4FAV D;  1YFQ A;  3L4O D;  2IUR A;  3CFV A;  4ERZ A;  5AFU 3;  3I7L A;  2HES X;  2VDM A;  5HE1 B;  2YNN A;  3I7P A;  4BCD A;  4UI9 R;  2XZG A;  5FKS A;  3SXT D;  1B9X A;  2CO0 A;  4X61 B;  3IIW A;  3I7K A;  5A2Q g;  3DWL C;  1UTC A;  1A12 A;  5HYN B;  4DNU A;  4A08 B;  2HXC A;  5E6S A;  5GXI A;  3SLE D;  3RFG A;  1XIP A;  2HKR A;  2XU7 A;  5HE3 B;  3P4F A;  4JT5 C;  1XKS A;  4I79 A;  4O1Q D;  3SBR A;  3I7N A;  3MUN A;  1PGU A;  4ESG A;  1O6G A;  1P22 A;  2H14 A;  3O4J A;  5CYK A;  3AL9 A;  3IJE A;  1R5M A;  5B4W A;  2P9N C;  5EM2 B;  4CI8 A;  4CY1 A;  1JOF A;  3EU7 A;  1VYH C;  3C5M A;  2YBA A;  2P9U C;  2YMU A;  2AQ5 A;  3IUN A;  4L1M A;  4QRJ A;  2PM6 B;  4PBY A;  3U4Y A;  4AN0 A;  5FFO A;  2H6K A;  4FA1 D;  3UR4 A;  4J87 A;  2EIB A;  5CXB B;  4G55 A;  5TEE A;  1GG2 B;  3IKO A;  3EQ8 A;  5CXC B;  4BP8 A;  4YVD A;  2P9S C;  5SXM A;  1UOQ A;  2EIE A;  4GM3 A;  4UM8 A;  4JHP C;  5K1C C;  1JTD B;  2GNQ A;  5AMS A;  4BL0 A;  1H2Y A;  3ZWL B;  5FKR A;  5HDB A;  4X3E A;  3ZDY A;  3K72 A;  3L4M D;  4FHL A;  3I89 A;  3GRE A;  4WK0 A;  3IUQ A;  4X63 B;  3ZE1 A;  4OZU A;  3RSE C;  4X60 B;  3QHY B;  3MUO A;  3ZDZ A;  5IJ7 E;  3PVU B;  4A09 B;  3BG1 A;  2YNP A;  3DDU A;  1K3I A;  2VDO A;  3I7H A;  4Z7N A;  1UOO A;  4TZ4 A;  3MXX A;  3ZE2 A;  3IUJ A;  4J0X A;  4ERY A;  4QT8 A;  4ZOX A;  4ZOY A;  5EAM A;  4A7J A;  4J81 A;  2EID A;  3AL8 B;  2P9L C;  2VDN A;  5FQD A;  3SCY A;  3ODT A;  1N6E A;  4R7A B;  4XYI A;  3EQ7 A;  2B5N A;  5IGQ A;  2BKL A;  5EMK B;  1PBY B;  3QI0 A;  2OK6 A;  4IRZ A;  4CZY A;  1SQ9 A;  4ZN4 A;  3EMH A;  3VI4 A;  3SWS D;  4LGN A;  2VDK A;  4JSP C;  2Z2O A;  3IUR A;  5EML B;  4PC0 A;  2Q7Q A;  3F3P A;  2GC7 A;  4HDJ A;  1C9L A;  4GQB B;  5FXY A;  2CNX A;  5H1M A;  4GGA A;  4CC9 A;  4IMM A;  3NVN A;  4Z7O A;  1H2W A;  3OKY B;  3UVN A;  2BBK H;  4A08 A;  4FA5 D;  4J8B A;  4NAA A;  3FCU A;  4BCC A;  3JAM g;  5C86 A;  3T3M A;  1TBG A;  5I5J A;  2QR5 A;  3K26 A;  4H5I A;  1E8M A;  3I8E A;  4AN1 A;  3EI2 B;  1K8K C;  5C2V B;  2G9A A;  1H2X A;  4O45 A;  4DNW A;  1N6D A;  3I7O A;  1E5T A;  4L1Q D;  4CI1 A;  2H9N A;  4Y5R D;  5I5I A;  3EI1 B;  5C9Z B;  2HU8 A;  2H6N A;  5C92 A;  5TF2 A;  4O3T B;  4RE6 A;  3NIF A;  2P9P C;  4GM9 A;  5EAP A;  5EM2 A;  3EG6 A;  3EI3 A;  3CIK B;  1VZ3 A;  1NR0 A;  5EMM B;  2BCJ B;  3V7D B;  5HQG A;  1MG3 A;  4LG9 A;  3ZDX A;  5GXH A;  1JJU B;  3RLM D;  5CXB A;  1B9Y A;  4AMY A;  2H3X A;  5M5V A;  1PI6 A;  3OL2 B;  2AGX A;  1YR2 A;  1L5G A;  2EBS A;  3MZL A;  4A11 B;  2IUP A;  4CY2 A;  2QC5 A;  4A0A B;  4GM8 A;  3W15 A;  1JMX B;  4PXW A;  2J56 H;  4K3J B;  3MVD K;  2JKX A;  3I8C A;  3K71 A;  4IA9 A;  3FGB A;  3UVL A;  4XYH A;  3EQ9 A;  1GOH A;  5IJ8 E;  3JB9 L;  4GGD A;  3UVO A;  2IUV A;  4FWW A;  3ZE0 A;  3RRM C;  4G1E A;  2AGW A;  2CE8 A;  2UZX B;  3JRP A;  3C9C A;  4A09 A;  2VDR A;  4AX4 A;  4A0B B;  3K27 A;  2HU5 A;  1MDA H;  3AFC A;  4JHN A;  2W18 A;  4U7A A;  3RMZ D;  1K32 A;  4DNV A;  5HE2 B;  4RE5 A;  4CZX A;  2TRC B;  3OKW A;  3AL8 A;  4NEN A;  3IJC A;  1XHM A;  4AEZ A;  3IVM A;  1U8C A;  2HJB A;  4LG8 A;  3DXK C;  4UM9 A;  5I5M A;  4E5Z B;  3E0C A;  4JT6 C;  3PSL A;  3PXT D;  5KDO B;  3J80 g;  3ULE C;  3EWE A;  5FA5 B;  4NC4 A;  1S4U X;  3RFH A;  3PXS D;  5H14 A;  4NBM A;  2OIZ A;  2G99 A;  4QQE A;  1L0Q A;  2AH1 A;  3IIY A;  4JXM A;  2PM9 B;  1A0R B;  4MMX A;  3N0D A;  5FKT A;  3OF7 A;  3VA6 A;  2OVR B;  2HYE A;  3JZH A;  2Z2N A;  4JD2 C;  4MK0 B;  5GMK n;  2AGL A;  4GMB A;  1OMW B;  3GD1 I;  3IJ0 A;  1GOT B;  3SBQ A;  2XE4 A;  4CY3 A;  3NIG A;  4WK2 A;  3O4H A;  2HU7 A;  4WK4 A;  4GQ1 A;  2WQ8 A;  3N0E A;  2OVQ B;  3JRO A;  4J73 A;  4BP9 A;  4OWR A;  3GFC A;  3BG0 A;  1VE6 A;  3JZG A;  3KCI A;  4E54 B; 
#chains in the Genus database with same CATH homology
 3MMY A;  2OJY A;  3SFZ A;  3OKT A;  3HFQ A;  4GZ8 A;  5AJA A;  3F3G A;  4AOW A;  3VGZ A;  3EI4 B;  5IGO A;  3VH0 A;  5C2W B;  4CY5 A;  4A2L A;  1QNI A;  5EMJ B;  3C99 A;  4JSV C;  2B5L A;  5HE0 B;  4L9O A;  5K19 A;  4J0W A;  4KFM B;  4A2M A;  4A11 A;  2CO0 C;  4J82 A;  4CI3 A;  4K3I D;  3SBP A;  3B7F A;  2J55 H;  2H9M A;  3UKU C;  2IAA A;  1MG2 A;  2PBI B;  3PVW B;  1ERJ A;  1NEX B;  5CXC A;  4JSX C;  5TDH B;  3SHF A;  4A0B A;  4FAN D;  4L3G D;  3PXW D;  2AGZ A;  3SVW D;  5H17 A;  2PM7 B;  1PEV A;  2XYI A;  4L3H D;  4PNK B;  4FA9 D;  3KRW B;  4ZOV A;  3I2N A;  2IWK A;  4XEI C;  2I0S A;  4D0K A;  4EWR A;  4J77 A;  3ORV D;  2AGY A;  2B5M A;  4E5Z A;  5IC7 A;  4ERQ A;  3MKS B;  3RN1 D;  2CN2 A;  2O9K A;  3F3F A;  4G56 B;  2OK4 A;  3UVK A;  2H47 A;  2OVP B;  4J84 A;  2XL2 A;  3EI3 B;  3NVX A;  3FRX A;  2PM9 A;  2QXV A;  3UKR C;  5FLX g;  1Q47 A;  2H68 A;  2IUQ A;  4CZV A;  3FM0 A;  1U4C A;  2HKM A;  4PSW B;  4ZOZ A;  2MTA H;  3DM0 A;  4J86 A;  3JPX A;  5THA A;  2XL3 A;  4J78 A;  5CYK B;  4GGC A;  1FWX A;  5IT9 g;  2P9I C;  4Y7R A;  2UZY B;  4O3U B;  4CI2 A;  1SQJ A;  3SJL D;  4BUJ C;  3SN6 B;  3PSC B;  4E54 A;  3NVQ A;  3OKY A;  2GC4 A;  2I3S A;  3V9F A;  3C75 H;  5GSA A;  2YNO A;  3JZN A;  3UVM A;  3OTT A;  1GXR A;  2H9P A;  3EI4 A;  3PE7 A;  5FKQ A;  3EI2 A;  4NSX A;  3RN0 D;  4J8G A;  4Z8L A;  2I3T A;  3OW8 A;  4JSN C;  4FA4 D;  2IWF A;  3DSM A;  3EI1 A;  3MKQ A;  2Z2P A;  1OLZ A;  2YB8 B;  5TEF A;  1U2V C;  3IJ1 A;  4FB1 D;  4GQ2 P;  3BWS A;  3A0F A;  3AH8 B;  5JWZ A;  1N6F A;  4O9D A;  3KRX B;  2CN3 A;  3SMR A;  2CE9 A;  2AH0 A;  2H13 A;  1GP2 B;  2P9K C;  3MZK A;  4ES0 A;  1JMZ B;  4PBZ A;  3OL2 A;  1SHY B;  2I0R A;  2B4E A;  2J57 G;  5EAR A;  4QL1 A;  2H6Q A;  3J81 g;  3DXM C;  3V5W B;  4J79 A;  1RI6 A;  4PSX B;  4BH6 A;  1TYQ C;  4H5J A;  4A0A A;  2I0T A;  2H9L A;  2HJ4 A;  5EAL A;  4N14 A;  4U1E I;  3CFS B;  4D6V A;  4FAV D;  1YFQ A;  3L4O D;  2IUR A;  3CFV A;  4ERZ A;  5AFU 3;  3I7L A;  2HES X;  5HE1 B;  2YNN A;  3I7P A;  4UI9 R;  5FKS A;  3SXT D;  1B9X A;  2CO0 A;  4X61 B;  3IIW A;  3I7K A;  5A2Q g;  3DWL C;  5HYN B;  4A08 B;  2HXC A;  5GXI A;  3SLE D;  3RFG A;  1XIP A;  2HKR A;  2XU7 A;  5HE3 B;  3P4F A;  4JT5 C;  1XKS A;  4I79 A;  4O1Q D;  3SBR A;  3I7N A;  1PGU A;  4ESG A;  1P22 A;  2H14 A;  5CYK A;  3AL9 A;  1R5M A;  5B4W A;  2P9N C;  5EM2 B;  4CI8 A;  4CY1 A;  1JOF A;  3EU7 A;  1VYH C;  3C5M A;  2YBA A;  2P9U C;  2YMU A;  2AQ5 A;  4QRJ A;  2PM6 B;  4PBY A;  3U4Y A;  2H6K A;  4FA1 D;  3UR4 A;  4J87 A;  5CXB B;  5TEE A;  1GG2 B;  3IKO A;  5CXC B;  4YVD A;  2P9S C;  5SXM A;  4GM3 A;  5K1C C;  2GNQ A;  5AMS A;  4BL0 A;  3ZWL B;  5FKR A;  4X3E A;  3L4M D;  4FHL A;  3I89 A;  3GRE A;  4X63 B;  4OZU A;  3RSE C;  4X60 B;  5IJ7 E;  3PVU B;  4A09 B;  3BG1 A;  2YNP A;  3I7H A;  4TZ4 A;  3MXX A;  4J0X A;  4ERY A;  4QT8 A;  4ZOX A;  4ZOY A;  5EAM A;  4A7J A;  4J81 A;  3AL8 B;  2P9L C;  5FQD A;  3SCY A;  3ODT A;  1N6E A;  4R7A B;  4XYI A;  2B5N A;  5IGQ A;  5EMK B;  1PBY B;  2OK6 A;  4CZY A;  1SQ9 A;  4ZN4 A;  3EMH A;  3SWS D;  4LGN A;  4JSP C;  2Z2O A;  5EML B;  4PC0 A;  2Q7Q A;  3F3P A;  2GC7 A;  4HDJ A;  4GQB B;  5FXY A;  2CNX A;  5H1M A;  4GGA A;  4CC9 A;  4IMM A;  3NVN A;  3OKY B;  3UVN A;  2BBK H;  4A08 A;  4FA5 D;  4J8B A;  3JAM g;  1TBG A;  5I5J A;  4H5I A;  3K26 A;  3I8E A;  3EI2 B;  1K8K C;  5C2V B;  2G9A A;  4O45 A;  1N6D A;  3I7O A;  4L1Q D;  4CI1 A;  2H9N A;  4Y5R D;  5I5I A;  3EI1 B;  5C9Z B;  2H6N A;  5TF2 A;  4O3T B;  2P9P C;  4GM9 A;  5EAP A;  5EM2 A;  3EG6 A;  3EI3 A;  3CIK B;  1NR0 A;  5EMM B;  2BCJ B;  3V7D B;  5HQG A;  1MG3 A;  4LG9 A;  5GXH A;  1JJU B;  3RLM D;  5CXB A;  1B9Y A;  2H3X A;  1PI6 A;  3OL2 B;  2AGX A;  2EBS A;  3MZL A;  4A11 B;  2IUP A;  4CY2 A;  2QC5 A;  4A0A B;  4GM8 A;  3W15 A;  1JMX B;  4PXW A;  2J56 H;  4K3J B;  3I8C A;  4IA9 A;  3FGB A;  3UVL A;  4XYH A;  5IJ8 E;  3JB9 L;  4GGD A;  3UVO A;  2IUV A;  4FWW A;  3RRM C;  2AGW A;  2CE8 A;  2UZX B;  3JRP A;  3C9C A;  4A09 A;  4A0B B;  3K27 A;  1MDA H;  3AFC A;  2W18 A;  4U7A A;  3RMZ D;  1K32 A;  5HE2 B;  4CZX A;  2TRC B;  3OKW A;  3AL8 A;  3IJC A;  1XHM A;  4AEZ A;  2HJB A;  4LG8 A;  3DXK C;  5I5M A;  4E5Z B;  3E0C A;  4JT6 C;  3PSL A;  3PXT D;  5KDO B;  3J80 g;  3ULE C;  3EWE A;  5FA5 B;  1S4U X;  3RFH A;  3PXS D;  5H14 A;  2OIZ A;  2G99 A;  4QQE A;  1L0Q A;  2AH1 A;  3IIY A;  4JXM A;  2PM9 B;  1A0R B;  3N0D A;  5FKT A;  3VA6 A;  2OVR B;  2HYE A;  3JZH A;  2Z2N A;  4JD2 C;  4MK0 B;  5GMK n;  2AGL A;  4GMB A;  1OMW B;  3IJ0 A;  1GOT B;  3SBQ A;  4CY3 A;  4GQ1 A;  3N0E A;  2OVQ B;  3JRO A;  4J73 A;  4OWR A;  3GFC A;  3BG0 A;  3JZG A;  4E54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...