3C99A

Structural basis of histone h4 recognition by p55
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
405
structure length
380
Chain Sequence
SFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPCQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor
molecule keywords Chromatin assembly factor 1 p55 subunit
publication title Structural basis of histone H4 recognition by p55.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 88
structure length 380
sequence length 405
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c99A00
2AGLA 4GQ2P 4QL1A 2G9AA 5IC7A 3J81g 2B4EA 3JZNA 3FGBA 5K1CC 4A09A 3PSLA 1R5MA 3I7NA 2CE8A 2YBAA 1PI6A 5B4WA 3EWEA 3B7FA 4AOWA 5FKSA 4E5ZB 4A7JA 4J0XA 2W18A 3SFZA 3SN6B 4J77A 2B5LA 3BWSA 4E5ZA 4CI8A 5SXMA 2UZYB 2J56H 3C75H 3SWSD 5GMKn 5C2VB 3OKTA 4PSXB 3RN0D 4GGCA 2P9PC 3UR4A 4TZ4A 2IUQA 3DXMC 2H6NA 2HJBA 5GSAA 3IIYA 4O45A 4CY5A 4PBZA 2HXCA 5FXYA 4ESGA 3EG6A 4OWRA 2EBSA 5CXCB 2CE9A 1K32A 5TEEA 3W15A 1N6EA 3SLED 3V5WB 1XIPA 5EARA 5CXCA 2H9PA 4JT6C 4GGDA 5EAPA 3EI3B 3SJLD 3K27A 3JB9L 1MDAH 5I5MA 3EI3A 5FKRA 3VGZA 2H14A 2O9KA 1JJUB 3EMHA 3SBQA 2OJYA 4J78A 2QXVA 4PNKB 3EI2B 3PVWB 2XU7A 2YNOA 4MK0B 4NSXA 2AGZA 3OW8A 1OMWB 3DXKC 4U1EI 3EI4B 3FM0A 3HFQA 3EI2A 2AGYA 5HQGA 2HYEA 5K19A 5TEFA 3SBPA 3KRWB 4A11B 4EWRA 3EI4A 4LG8A 3J80g 2Z2PA 4O9DA 3BG0A 3SCYA 2J55H 2P9LC 4I79A 5AFU3 1Q47A 4JSXC 3V9FA 5IJ7E 1B9XA 4U7AA 3OKWA 5HYNB 2YB8B 5KDOB 4LG9A 4FAVD 2OK6A 2AH0A 2PM6B 2IWFA 2GC7A 4XYIA 1GP2B 4FA4D 1PEVA 2J57G 3SHFA 4JT5C 4PC0A 2H6KA 1L0QA 4QQEA 4L3HD 3RFHA 4BH6A 3IJ0A 5AMSA 2I0TA 4CC9A 3DSMA 3EU7A 4D0KA 4Y5RD 1U4CA 4J8BA 3C5MA 3IJ1A 3UVOA 1K8KC 3JAMg 3OTTA 4A0BB 4Y7RA 4JD2C 3I89A 5FKTA 3MKSB 4FA9D 2HJ4A 4O3UB 4KFMB 1FWXA 2YNNA 2PM9B 4A0BA 3VA6A 3I7OA 3L4OD 1XKSA 5H1MA 4LGNA 4X61B 3PVUB 4GQBB 1PGUA 5H14A 4E54B 5GXIA 3L4MD 5CYKB 2CO0A 2H9LA 3U4YA 1YFQA 3JRPA 2YNPA 5EMLB 4ERQA 4L1QD 1JOFA 3RSEC 3NVQA 4YVDA 4E54A 5FKQA 3PXSD 5C9ZB 5CYKA 2B5MA 3UVMA 3C9CA 4IMMA 3V7DB 4ERYA 3IKOA 2IUPA 4CI2A 3NVNA 4GQ1A 5JWZA 4FWWA 2QC5A 5TDHB 4ZOZA 3DWLC 4X60B 2OK4A 4PBYA 4CI3A 1NR0A 1VYHC 3MZLA 2Z2NA 4J87A 3I7PA 4QT8A 1PBYB 2GNQA 1NEXB 1OLZA 4CY3A 5CXBB 4L9OA 4PXWA 3CFVA 2P9SC 1SQ9A 3F3GA 2GC4A 4FA5D 2OVRB 2OVQB 2AQ5A 5CXBA 3NVXA 4A0AB 4FHLA 4J73A 4N14A 2PBIB 2OVPB 3N0DA 2IAAA 3PXWD 4JSPC 5IT9g 4CZXA 3SBRA 4XYHA 4K3JB 5C2WB 4A0AA 3N0EA 3P4FA 4A11A 4J86A 3CIKB 4BL0A 2YMUA 5HE2B 2TRCB 5HE1B 1RI6A 4CZYA 2IWKA 3OL2B 2P9IC 3AFCA 3PSCB 3UVLA 2I3TA 2CN2A 3C99A 2XL2A 2B5NA 1SHYB 4ZOVA 3CFSB 4JXMA 3OL2A 4J82A 1QNIA 5GXHA 4HDJA 5FA5B 3UVNA 4J81A 4Z8LA 2AH1A 4UI9R 4BUJC 4ES0A 1GG2B 2I0RA 3AH8B 4CY2A 4CI1A 5THAA 2PM7B 2MTAH 3I2NA 4ERZA 4JSNC 4D6VA 3AL8B 4ZOYA 3MZKA 2XL3A 2H3XA 2H9NA 5I5IA 5TF2A 4GMBA 1B9YA 1SQJA 3AL8A 5HE3B 4GM3A 1XHMA 3KRXB 3ODTA 4FAND 4JSVC 3UVKA 3I7HA 4GM8A 4ZN4A 4A2LA 3JZGA 3RRMC 3SXTD 3OKYB 5I5JA 2OIZA 2H47A 2H68A 4GM9A 2PM9A 4G56B 4J8GA 1S4UX 2CN3A 4O1QD 5IGQA 3E0CA 4L3GD 3OKYA 3UKRC 2CO0C 3DM0A 4CZVA 4XEIC 2XYIA 3IIWA 3SVWD 3ULEC 2HESX 2BCJB 3GFCA 3BG1A 4J0WA 2AGWA 5FLXg 2P9UC 3F3FA 2BBKH 5EMKB 2P9NC 2I3SA 3K26A 2HKRA 4AEZA 4ZOXA 1N6DA 3GREA 3FRXA 1TBGA 5IJ8E 4K3ID 5HE0B 3UKUC 3I8CA 3JZHA 4A2MA 1ERJA 3RN1D 5H17A 4J84A 3RMZD 2HKMA 5A2Qg 2IURA 4FA1D 3MXXA 5EM2B 4X3EA 2Z2OA 3JROA 5EMMB 3PE7A 4FB1D 3MMYA 1GXRA 3I7KA 3VH0A 3SMRA 1MG2A 4H5IA 5EM2A 3RFGA 1JMZB 2Q7QA 5FQDA 4A08B 1MG3A 2H9MA 3JPXA 3A0FA 4X63B 4H5JA 2AGXA 2UZXB 1P22A 5AJAA 4R7AB 3I8EA 4GZ8A 4A08A 3ZWLB 1U2VC 1N6FA 3EI1B 2G99A 4IA9A 3AL9A 4OZUA 3RLMD 4J79A 2I0SA 4CY1A 4GGAA 1A0RB 3I7LA 2CNXA 2P9KC 3F3PA 5EAMA 3EI1A 5IGOA 3MKQA 4O3TB 2IUVA 3PXTD 1JMXB 1TYQC 4QRJA 4PSWB 5EMJB 3IJCA 5EALA 3ORVD 2H6QA 2H13A 1GOTB 4A09B
chains in the Genus database with same CATH superfamily
2AGLA 1E8MA 4GQ2P 4O02A 4QL1A 2G9AA 5IC7A 3J81g 2B4EA 4NBMA 3JZNA 3FGBA 5K1CC 4A09A 3PSLA 1R5MA 3I7NA 2CE8A 2YBAA 1QFSA 4NENA 1PI6A 5B4WA 3EWEA 3B7FA 4AOWA 5FKSA 4E5ZB 4A7JA 1I2MB 4J0XA 4D9SA 2W18A 2XE4A 3SFZA 3SN6B 4J77A 2B5LA 3BWSA 2EICA 1JV2A 4E5ZA 4CI8A 5SXMA 2QZPA 2UZYB 3K72A 2J56H 3C75H 3SWSD 3IVMA 5GMKn 2VC2A 5C2VB 3OKTA 4PSXB 5HDBA 3RN0D 4GGCA 2P9PC 3UR4A 3QHYB 4TZ4A 2IUQA 3DXMC 2H6NA 4MMZA 2HJBA 3NIGA 3IIYA 4O45A 2JKXA 5GSAA 1UOPA 4CY5A 4PBZA 2HXCA 5FXYA 4ESGA 1QFMA 3GD1I 4WK0A 3EG6A 4OWRA 2EBSA 4G1EA 5CXCB 5M5SA 2CE9A 1K32A 5TEEA 3W15A 1N6EA 3SLED 3V5WB 1XIPA 3T3PA 5EARA 5CXCA 4AMZA 2H9PA 4JT6C 4GGDA 5EAPA 3EI3B 3NIDA 3SJLD 3MVDK 3K27A 3JB9L 1MDAH 5I5MA 3EI3A 5FKRA 3VGZA 2H14A 1L5GA 2O9KA 1JJUB 2VZ1A 1UOOA 3EMHA 3SBQA 2OJYA 4J78A 3K71A 2QXVA 2VDPA 4PNKB 3EI2B 3QI0A 1BPOA 3PVWB 2XU7A 2YNOA 4MK0B 4NSXA 2AGZA 4IRZA 3OW8A 1OMWB 3DXKC 4U1EI 3EI4B 4O2WA 3FM0A 3HFQA 3EI2A 2AGYA 5HQGA 5E6RA 2EIEA 2VZ3A 2HYEA 5K19A 5TEFA 3SBPA 4DNWA 3KRWB 4DNVA 1VE7A 4A11B 4EWRA 3EI4A 4LG8A 3J80g 2Z2PA 4O9DA 5FFGA 3BG0A 3SCYA 2J55H 2P9LC 1E5TA 4I79A 5AFU3 1Q47A 4JSXC 3V9FA 5IJ7E 1B9XA 5M5RA 4U7AA 3OKWA 3K6SA 5HYNB 2YB8B 5KDOB 4LG9A 4FAVD 2OK6A 2AH0A 3IULA 2QR5A 5C86A 2PM6B 2IWFA 2GC7A 4XYIA 1GP2B 4FA4D 1PEVA 2J57G 3SHFA 4JT5C 3EQ9A 4PC0A 2H6KA 1L0QA 3FCSA 4QQEA 4L3HD 3RFHA 3VI4A 4BCDA 4BH6A 3IJ0A 5AMSA 4Z7NA 2I0TA 2HU8A 3ZE2A 2VDQA 4CC9A 3DSMA 3EU7A 4D0KA 3MUOA 4Y5RD 1U4CA 4J8BA 1UTCA 3C5MA 3IJ1A 3UVOA 1K8KC 1T2XA 3OTTA 3JAMg 4A0BB 4Y7RA 4JD2C 3I89A 4DNUA 5FKTA 3MKSB 4FA9D 2HJ4A 4O3UB 4KFMB 4AN0A 2HU5A 2VDOA 2EIBA 1FWXA 2VDKA 2YNNA 2PM9B 4Z7OA 4A0BA 4JHPC 3VA6A 3I7OA 3L4OD 1XKSA 5H1MA 4LGNA 4X61B 3PVUB 3ZDYA 4GQBB 1PGUA 5H14A 4E54B 5GXIA 3L4MD 5CYKB 2CO0A 2H9LA 2BKLA 3U4YA 4UM8A 1YFQA 3JRPA 3IUNA 2YNPA 1C9IA 3EQ7A 5EMLB 4MMYA 4L1QD 1JOFA 1GOGA 3RSEC 4ERQA 3NVQA 4YVDA 5M61A 4E54A 5FKQA 3PXSD 5C9ZB 5CYKA 3ZDZA 1U8CA 2B5MA 3UVMA 2EIDA 3C9CA 4IMMA 3V7DB 1M1XA 3V4PA 3FCUA 5M5TA 4ERYA 3O4HA 3IKOA 2IUPA 4CI2A 3NVNA 4GQ1A 5JWZA 4FWWA 2QC5A 5TDHB 4ZOZA 3DWLC 4X60B 1VZ3A 2OK4A 4PBYA 4UM9A 2VDRA 4CI3A 1NR0A 1VYHC 3MZLA 2Z2NA 4J87A 4NC4A 3I7PA 4QT8A 3GC3B 3ZE0A 1PBYB 4AX4A 2GNQA 1NEXB 1OLZA 4CY3A 5CXBB 3O4JA 4L9OA 4PXWA 3CFVA 4RE6A 2P9SC 1SQ9A 1A12A 3F3GA 1VZ2A 2GC4A 4FA5D 2OVRB 2OVQB 2AQ5A 5CXBA 3NVXA 4A0AB 4FHLA 1TYEA 4J73A 4N14A 2PBIB 2OVPB 3N0DA 2IAAA 3PXWD 3IUJA 4JSPC 4QAMA 5IT9g 3NIFA 2WQ8A 4CZXA 3SBRA 4XYHA 4K3JB 4BP9A 5C2WB 4A0AA 3N0EA 3P4FA 5E6UA 4A11A 4J86A 3CIKB 4BL0A 2YMUA 5HE2B 2TRCB 5HE1B 1RI6A 4G55A 2IWKA 3OL2B 2P9IC 3AFCA 3PSCB 4CZYA 4G1MA 1O6GA 3UVLA 2I3TA 2CN2A 3C99A 2XL2A 2B5NA 1SHYB 1H2ZA 3DDUA 4ZOVA 3CFSB 4JXMA 3OL2A 4J82A 1QNIA 3VI3A 5GXHA 4HDJA 5FA5B 3UVNA 4J81A 4Z8LA 2AH1A 4UI9R 4BUJC 1JTDB 4ES0A 4WJKA 1GG2B 2I0RA 3AH8B 4CY2A 4CI1A 4AN1A 5M5UA 5THAA 1H2XA 4NAAA 2PM7B 2MTAH 3IUQA 3I2NA 4ERZA 4JSNC 4D6VA 3AL8B 4ZOYA 3EQ8A 3MZKA 2XL3A 4BCBA 2H3XA 2VDLA 2H9NA 2VDNA 3MUNA 5I5IA 3ZDXA 5TF2A 3IJEA 4GMBA 1B9YA 1SQJA 3AL8A 5HE3B 1H2WA 4GM3A 1XHMA 3KRXB 3ODTA 4FAND 4JSVC 3UVKA 3V4VA 3I7HA 4GM8A 4ZN4A 4A2LA 3JZGA 3RRMC 3SXTD 3OKYB 5I5JA 2OIZA 2H47A 2H68A 4GM9A 3T3MA 2PM9A 4G56B 4J8GA 2XZGA 1S4UX 2CN3A 4O1QD 5IGQA 3E0CA 4L3GD 3OKYA 3UKRC 2CO0C 3DM0A 4CZVA 4XEIC 2XYIA 2VDMA 3IIWA 4BP8A 3SVWD 3ULEC 4AMYA 2HESX 2BCJB 3GFCA 3BG1A 4J0WA 2AGWA 5FLXg 2P9UC 3F3FA 5C92A 2BBKH 5EMKB 2P9NC 2I3SA 3K26A 1C9LA 2HKRA 5M5VA 4AEZA 4ZOXA 1N6DA 3GREA 3FRXA 3ZE1A 1K3IA 1TBGA 5IJ8E 4K3ID 5HE0B 2HU7A 3UKUC 3I8CA 3JZHA 4A2MA 1ERJA 3RN1D 5H17A 4J84A 3OF7A 3RMZD 1H2YA 4RE5A 2HKMA 3IUMA 5A2Qg 2IURA 2XDWA 4FA1D 3MXXA 5EM2B 4X3EA 2Z2OA 3JROA 5EMMB 3PE7A 4FB1D 3MMYA 1GXRA 1GOFA 3KCIA 3I7KA 1UOQA 1GOHA 3VH0A 3SMRA 1MG2A 4H5IA 5EM2A 3RFGA 1JMZB 2Q7QA 5FQDA 4A08B 1VE6A 1MG3A 2H9MA 5E6SA 3JPXA 3A0FA 4X63B 4H5JA 1E8NA 2AGXA 2UZXB 1P22A 1YR2A 5AJAA 4R7AB 3I8EA 3IURA 4BCCA 4GZ8A 3O4GA 4A08A 3ZWLB 5FFOA 1U2VC 1N6FA 3EI1B 2G99A 4IA9A 3AL9A 4MMXA 4OZUA 3RLMD 4J79A 2I0SA 4CY1A 4GGAA 1A0RB 3I7LA 2CNXA 2P9KC 3F3PA 5EAMA 3EI1A 5IGOA 4Z7QA 3MKQA 4O3TB 4WK2A 2IUVA 3PXTD 1JMXB 4WK4A 1TYQC 4L1MA 4QRJA 4PSWB 3O4IA 5EMJB 3IJCA 4JHNA 3ORVD 5EALA 2H6QA 1O6FA 2H13A 1GOTB 4A09B
chains in the Genus database with same CATH topology
2AGLA 4GQ2P 4QL1A 2G9AA 5IC7A 3J81g 2B4EA 3JZNA 3FGBA 5K1CC 4A09A 3PSLA 1R5MA 3I7NA 2CE8A 2YBAA 1PI6A 5B4WA 3EWEA 3B7FA 4AOWA 5FKSA 4E5ZB 4A7JA 4J0XA 2W18A 3SFZA 3SN6B 4J77A 2B5LA 3BWSA 4E5ZA 4CI8A 5SXMA 2UZYB 2J56H 3C75H 3SWSD 5GMKn 5C2VB 3OKTA 4PSXB 3RN0D 4GGCA 2P9PC 3UR4A 4TZ4A 2IUQA 3DXMC 2H6NA 2HJBA 5GSAA 3IIYA 4O45A 4CY5A 4PBZA 2HXCA 5FXYA 4ESGA 3EG6A 4OWRA 2EBSA 5CXCB 2CE9A 1K32A 5TEEA 3W15A 1N6EA 3SLED 3V5WB 1XIPA 5EARA 5CXCA 2H9PA 4JT6C 4GGDA 5EAPA 3EI3B 3SJLD 3K27A 3JB9L 1MDAH 5I5MA 3EI3A 5FKRA 3VGZA 2H14A 2O9KA 1JJUB 3EMHA 3SBQA 2OJYA 4J78A 2QXVA 4PNKB 3EI2B 3PVWB 2XU7A 2YNOA 4MK0B 4NSXA 2AGZA 3OW8A 1OMWB 3DXKC 4U1EI 3EI4B 3FM0A 3HFQA 3EI2A 2AGYA 5HQGA 2HYEA 5K19A 5TEFA 3SBPA 3KRWB 4A11B 4EWRA 3EI4A 4LG8A 3J80g 2Z2PA 4O9DA 3BG0A 3SCYA 2J55H 2P9LC 4I79A 5AFU3 1Q47A 4JSXC 3V9FA 5IJ7E 1B9XA 4U7AA 3OKWA 5HYNB 2YB8B 5KDOB 4LG9A 4FAVD 2OK6A 2AH0A 2PM6B 2IWFA 2GC7A 4XYIA 1GP2B 4FA4D 1PEVA 2J57G 3SHFA 4JT5C 4PC0A 2H6KA 1L0QA 4QQEA 4L3HD 3RFHA 4BH6A 3IJ0A 5AMSA 2I0TA 4CC9A 3DSMA 3EU7A 4D0KA 4Y5RD 1U4CA 4J8BA 3C5MA 3IJ1A 3UVOA 1K8KC 3JAMg 3OTTA 4A0BB 4Y7RA 4JD2C 3I89A 5FKTA 3MKSB 4FA9D 2HJ4A 4O3UB 4KFMB 1FWXA 2YNNA 2PM9B 4A0BA 3VA6A 3I7OA 3L4OD 1XKSA 5H1MA 4LGNA 4X61B 3PVUB 4GQBB 1PGUA 5H14A 4E54B 5GXIA 3L4MD 5CYKB 2CO0A 2H9LA 3U4YA 1YFQA 3JRPA 2YNPA 5EMLB 4ERQA 4L1QD 1JOFA 3RSEC 3NVQA 4YVDA 4E54A 5FKQA 3PXSD 5C9ZB 5CYKA 2B5MA 3UVMA 3C9CA 4IMMA 3V7DB 4ERYA 3IKOA 2IUPA 4CI2A 3NVNA 4GQ1A 5JWZA 4FWWA 2QC5A 5TDHB 4ZOZA 3DWLC 4X60B 2OK4A 4PBYA 4CI3A 1NR0A 1VYHC 3MZLA 2Z2NA 4J87A 3I7PA 4QT8A 1PBYB 2GNQA 1NEXB 1OLZA 4CY3A 5CXBB 4L9OA 4PXWA 3CFVA 2P9SC 1SQ9A 3F3GA 2GC4A 4FA5D 2OVRB 2OVQB 2AQ5A 5CXBA 3NVXA 4A0AB 4FHLA 4J73A 4N14A 2PBIB 2OVPB 3N0DA 2IAAA 3PXWD 4JSPC 5IT9g 4CZXA 3SBRA 4XYHA 4K3JB 5C2WB 4A0AA 3N0EA 3P4FA 4A11A 4J86A 3CIKB 4BL0A 2YMUA 5HE2B 2TRCB 5HE1B 1RI6A 4CZYA 2IWKA 3OL2B 2P9IC 3AFCA 3PSCB 3UVLA 2I3TA 2CN2A 3C99A 2XL2A 2B5NA 1SHYB 4ZOVA 3CFSB 4JXMA 3OL2A 4J82A 1QNIA 5GXHA 4HDJA 5FA5B 3UVNA 4J81A 4Z8LA 2AH1A 4UI9R 4BUJC 4ES0A 1GG2B 2I0RA 3AH8B 4CY2A 4CI1A 5THAA 2PM7B 2MTAH 3I2NA 4ERZA 4JSNC 4D6VA 3AL8B 4ZOYA 3MZKA 2XL3A 2H3XA 2H9NA 5I5IA 5TF2A 4GMBA 1B9YA 1SQJA 3AL8A 5HE3B 4GM3A 1XHMA 3KRXB 3ODTA 4FAND 4JSVC 3UVKA 3I7HA 4GM8A 4ZN4A 4A2LA 3JZGA 3RRMC 3SXTD 3OKYB 5I5JA 2OIZA 2H47A 2H68A 4GM9A 2PM9A 4G56B 4J8GA 1S4UX 2CN3A 4O1QD 5IGQA 3E0CA 4L3GD 3OKYA 3UKRC 2CO0C 3DM0A 4CZVA 4XEIC 2XYIA 3IIWA 3SVWD 3ULEC 2HESX 2BCJB 3GFCA 3BG1A 4J0WA 2AGWA 5FLXg 2P9UC 3F3FA 2BBKH 5EMKB 2P9NC 2I3SA 3K26A 2HKRA 4AEZA 4ZOXA 1N6DA 3GREA 3FRXA 1TBGA 5IJ8E 4K3ID 5HE0B 3UKUC 3I8CA 3JZHA 4A2MA 1ERJA 3RN1D 5H17A 4J84A 3RMZD 2HKMA 5A2Qg 2IURA 4FA1D 3MXXA 5EM2B 4X3EA 2Z2OA 3JROA 5EMMB 3PE7A 4FB1D 3MMYA 1GXRA 3I7KA 3VH0A 3SMRA 1MG2A 4H5IA 5EM2A 3RFGA 1JMZB 2Q7QA 5FQDA 4A08B 1MG3A 2H9MA 3JPXA 3A0FA 4X63B 4H5JA 2AGXA 2UZXB 1P22A 5AJAA 4R7AB 3I8EA 4GZ8A 4A08A 3ZWLB 1U2VC 1N6FA 3EI1B 2G99A 4IA9A 3AL9A 4OZUA 3RLMD 4J79A 2I0SA 4CY1A 4GGAA 1A0RB 3I7LA 2CNXA 2P9KC 3F3PA 5EAMA 3EI1A 5IGOA 3MKQA 4O3TB 2IUVA 3PXTD 1JMXB 1TYQC 4QRJA 4PSWB 5EMJB 3IJCA 5EALA 3ORVD 2H6QA 2H13A 1GOTB 4A09B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGL A;  4GQ2 P;  4QL1 A;  2G9A A;  5IC7 A;  3J81 g;  2B4E A;  3JZN A;  3FGB A;  5K1C C;  4A09 A;  3PSL A;  1R5M A;  3I7N A;  2CE8 A;  2YBA A;  1PI6 A;  5B4W A;  3EWE A;  3B7F A;  4AOW A;  5FKS A;  4E5Z B;  4A7J A;  4J0X A;  2W18 A;  3SFZ A;  3SN6 B;  4J77 A;  2B5L A;  3BWS A;  4E5Z A;  4CI8 A;  5SXM A;  2UZY B;  2J56 H;  3C75 H;  3SWS D;  5GMK n;  5C2V B;  3OKT A;  4PSX B;  3RN0 D;  4GGC A;  2P9P C;  3UR4 A;  4TZ4 A;  2IUQ A;  3DXM C;  2H6N A;  2HJB A;  5GSA A;  3IIY A;  4O45 A;  4CY5 A;  4PBZ A;  2HXC A;  5FXY A;  4ESG A;  3EG6 A;  4OWR A;  2EBS A;  5CXC B;  2CE9 A;  1K32 A;  5TEE A;  3W15 A;  1N6E A;  3SLE D;  3V5W B;  1XIP A;  5EAR A;  5CXC A;  2H9P A;  4JT6 C;  4GGD A;  5EAP A;  3EI3 B;  3SJL D;  3K27 A;  3JB9 L;  1MDA H;  5I5M A;  3EI3 A;  5FKR A;  3VGZ A;  2H14 A;  2O9K A;  1JJU B;  3EMH A;  3SBQ A;  2OJY A;  4J78 A;  2QXV A;  4PNK B;  3EI2 B;  3PVW B;  2XU7 A;  2YNO A;  4MK0 B;  4NSX A;  2AGZ A;  3OW8 A;  1OMW B;  3DXK C;  4U1E I;  3EI4 B;  3FM0 A;  3HFQ A;  3EI2 A;  2AGY A;  5HQG A;  2HYE A;  5K19 A;  5TEF A;  3SBP A;  3KRW B;  4A11 B;  4EWR A;  3EI4 A;  4LG8 A;  3J80 g;  2Z2P A;  4O9D A;  3BG0 A;  3SCY A;  2J55 H;  2P9L C;  4I79 A;  5AFU 3;  1Q47 A;  4JSX C;  3V9F A;  5IJ7 E;  1B9X A;  4U7A A;  3OKW A;  5HYN B;  2YB8 B;  5KDO B;  4LG9 A;  4FAV D;  2OK6 A;  2AH0 A;  2PM6 B;  2IWF A;  2GC7 A;  4XYI A;  1GP2 B;  4FA4 D;  1PEV A;  2J57 G;  3SHF A;  4JT5 C;  4PC0 A;  2H6K A;  1L0Q A;  4QQE A;  4L3H D;  3RFH A;  4BH6 A;  3IJ0 A;  5AMS A;  2I0T A;  4CC9 A;  3DSM A;  3EU7 A;  4D0K A;  4Y5R D;  1U4C A;  4J8B A;  3C5M A;  3IJ1 A;  3UVO A;  1K8K C;  3JAM g;  3OTT A;  4A0B B;  4Y7R A;  4JD2 C;  3I89 A;  5FKT A;  3MKS B;  4FA9 D;  2HJ4 A;  4O3U B;  4KFM B;  1FWX A;  2YNN A;  2PM9 B;  4A0B A;  3VA6 A;  3I7O A;  3L4O D;  1XKS A;  5H1M A;  4LGN A;  4X61 B;  3PVU B;  4GQB B;  1PGU A;  5H14 A;  4E54 B;  5GXI A;  3L4M D;  5CYK B;  2CO0 A;  2H9L A;  3U4Y A;  1YFQ A;  3JRP A;  2YNP A;  5EML B;  4ERQ A;  4L1Q D;  1JOF A;  3RSE C;  3NVQ A;  4YVD A;  4E54 A;  5FKQ A;  3PXS D;  5C9Z B;  5CYK A;  2B5M A;  3UVM A;  3C9C A;  4IMM A;  3V7D B;  4ERY A;  3IKO A;  2IUP A;  4CI2 A;  3NVN A;  4GQ1 A;  5JWZ A;  4FWW A;  2QC5 A;  5TDH B;  4ZOZ A;  3DWL C;  4X60 B;  2OK4 A;  4PBY A;  4CI3 A;  1NR0 A;  1VYH C;  3MZL A;  2Z2N A;  4J87 A;  3I7P A;  4QT8 A;  1PBY B;  2GNQ A;  1NEX B;  1OLZ A;  4CY3 A;  5CXB B;  4L9O A;  4PXW A;  3CFV A;  2P9S C;  1SQ9 A;  3F3G A;  2GC4 A;  4FA5 D;  2OVR B;  2OVQ B;  2AQ5 A;  5CXB A;  3NVX A;  4A0A B;  4FHL A;  4J73 A;  4N14 A;  2PBI B;  2OVP B;  3N0D A;  2IAA A;  3PXW D;  4JSP C;  5IT9 g;  4CZX A;  3SBR A;  4XYH A;  4K3J B;  5C2W B;  4A0A A;  3N0E A;  3P4F A;  4A11 A;  4J86 A;  3CIK B;  4BL0 A;  2YMU A;  5HE2 B;  2TRC B;  5HE1 B;  1RI6 A;  4CZY A;  2IWK A;  3OL2 B;  2P9I C;  3AFC A;  3PSC B;  3UVL A;  2I3T A;  2CN2 A;  3C99 A;  2XL2 A;  2B5N A;  1SHY B;  4ZOV A;  3CFS B;  4JXM A;  3OL2 A;  4J82 A;  1QNI A;  5GXH A;  4HDJ A;  5FA5 B;  3UVN A;  4J81 A;  4Z8L A;  2AH1 A;  4UI9 R;  4BUJ C;  4ES0 A;  1GG2 B;  2I0R A;  3AH8 B;  4CY2 A;  4CI1 A;  5THA A;  2PM7 B;  2MTA H;  3I2N A;  4ERZ A;  4JSN C;  4D6V A;  3AL8 B;  4ZOY A;  3MZK A;  2XL3 A;  2H3X A;  2H9N A;  5I5I A;  5TF2 A;  4GMB A;  1B9Y A;  1SQJ A;  3AL8 A;  5HE3 B;  4GM3 A;  1XHM A;  3KRX B;  3ODT A;  4FAN D;  4JSV C;  3UVK A;  3I7H A;  4GM8 A;  4ZN4 A;  4A2L A;  3JZG A;  3RRM C;  3SXT D;  3OKY B;  5I5J A;  2OIZ A;  2H47 A;  2H68 A;  4GM9 A;  2PM9 A;  4G56 B;  4J8G A;  1S4U X;  2CN3 A;  4O1Q D;  5IGQ A;  3E0C A;  4L3G D;  3OKY A;  3UKR C;  2CO0 C;  3DM0 A;  4CZV A;  4XEI C;  2XYI A;  3IIW A;  3SVW D;  3ULE C;  2HES X;  2BCJ B;  3GFC A;  3BG1 A;  4J0W A;  2AGW A;  5FLX g;  2P9U C;  3F3F A;  2BBK H;  5EMK B;  2P9N C;  2I3S A;  3K26 A;  2HKR A;  4AEZ A;  4ZOX A;  1N6D A;  3GRE A;  3FRX A;  1TBG A;  5IJ8 E;  4K3I D;  5HE0 B;  3UKU C;  3I8C A;  3JZH A;  4A2M A;  1ERJ A;  3RN1 D;  5H17 A;  4J84 A;  3RMZ D;  2HKM A;  5A2Q g;  2IUR A;  4FA1 D;  3MXX A;  5EM2 B;  4X3E A;  2Z2O A;  3JRO A;  5EMM B;  3PE7 A;  4FB1 D;  3MMY A;  1GXR A;  3I7K A;  3VH0 A;  3SMR A;  1MG2 A;  4H5I A;  5EM2 A;  3RFG A;  1JMZ B;  2Q7Q A;  5FQD A;  4A08 B;  1MG3 A;  2H9M A;  3JPX A;  3A0F A;  4X63 B;  4H5J A;  2AGX A;  2UZX B;  1P22 A;  5AJA A;  4R7A B;  3I8E A;  4GZ8 A;  4A08 A;  3ZWL B;  1U2V C;  1N6F A;  3EI1 B;  2G99 A;  4IA9 A;  3AL9 A;  4OZU A;  3RLM D;  4J79 A;  2I0S A;  4CY1 A;  4GGA A;  1A0R B;  3I7L A;  2CNX A;  2P9K C;  3F3P A;  5EAM A;  3EI1 A;  5IGO A;  3MKQ A;  4O3T B;  2IUV A;  3PXT D;  1JMX B;  1TYQ C;  4QRJ A;  4PSW B;  5EMJ B;  3IJC A;  5EAL A;  3ORV D;  2H6Q A;  2H13 A;  1GOT B;  4A09 B; 
#chains in the Genus database with same CATH topology
 2AGL A;  1E8M A;  4GQ2 P;  4O02 A;  4QL1 A;  2G9A A;  5IC7 A;  3J81 g;  2B4E A;  4NBM A;  3JZN A;  3FGB A;  5K1C C;  4A09 A;  3PSL A;  1R5M A;  3I7N A;  2CE8 A;  2YBA A;  1QFS A;  4NEN A;  1PI6 A;  5B4W A;  3EWE A;  3B7F A;  4AOW A;  5FKS A;  4E5Z B;  4A7J A;  1I2M B;  4J0X A;  4D9S A;  2W18 A;  2XE4 A;  3SFZ A;  3SN6 B;  4J77 A;  2B5L A;  3BWS A;  2EIC A;  1JV2 A;  4E5Z A;  4CI8 A;  5SXM A;  2QZP A;  2UZY B;  3K72 A;  2J56 H;  3C75 H;  3SWS D;  3IVM A;  5GMK n;  2VC2 A;  5C2V B;  3OKT A;  4PSX B;  5HDB A;  3RN0 D;  4GGC A;  2P9P C;  3UR4 A;  3QHY B;  4TZ4 A;  2IUQ A;  3DXM C;  2H6N A;  4MMZ A;  2HJB A;  3NIG A;  3IIY A;  4O45 A;  2JKX A;  5GSA A;  1UOP A;  4CY5 A;  4PBZ A;  2HXC A;  5FXY A;  4ESG A;  1QFM A;  3GD1 I;  4WK0 A;  3EG6 A;  4OWR A;  2EBS A;  4G1E A;  5CXC B;  5M5S A;  2CE9 A;  1K32 A;  5TEE A;  3W15 A;  1N6E A;  3SLE D;  3V5W B;  1XIP A;  3T3P A;  5EAR A;  5CXC A;  4AMZ A;  2H9P A;  4JT6 C;  4GGD A;  5EAP A;  3EI3 B;  3NID A;  3SJL D;  3MVD K;  3K27 A;  3JB9 L;  1MDA H;  5I5M A;  3EI3 A;  5FKR A;  3VGZ A;  2H14 A;  1L5G A;  2O9K A;  1JJU B;  2VZ1 A;  1UOO A;  3EMH A;  3SBQ A;  2OJY A;  4J78 A;  3K71 A;  2QXV A;  2VDP A;  4PNK B;  3EI2 B;  3QI0 A;  1BPO A;  3PVW B;  2XU7 A;  2YNO A;  4MK0 B;  4NSX A;  2AGZ A;  4IRZ A;  3OW8 A;  1OMW B;  3DXK C;  4U1E I;  3EI4 B;  4O2W A;  3FM0 A;  3HFQ A;  3EI2 A;  2AGY A;  5HQG A;  5E6R A;  2EIE A;  2VZ3 A;  2HYE A;  5K19 A;  5TEF A;  3SBP A;  4DNW A;  3KRW B;  4DNV A;  1VE7 A;  4A11 B;  4EWR A;  3EI4 A;  4LG8 A;  3J80 g;  2Z2P A;  4O9D A;  5FFG A;  3BG0 A;  3SCY A;  2J55 H;  2P9L C;  1E5T A;  4I79 A;  5AFU 3;  1Q47 A;  4JSX C;  3V9F A;  5IJ7 E;  1B9X A;  5M5R A;  4U7A A;  3OKW A;  3K6S A;  5HYN B;  2YB8 B;  5KDO B;  4LG9 A;  4FAV D;  2OK6 A;  2AH0 A;  3IUL A;  2QR5 A;  5C86 A;  2PM6 B;  2IWF A;  2GC7 A;  4XYI A;  1GP2 B;  4FA4 D;  1PEV A;  2J57 G;  3SHF A;  4JT5 C;  3EQ9 A;  4PC0 A;  2H6K A;  1L0Q A;  3FCS A;  4QQE A;  4L3H D;  3RFH A;  3VI4 A;  4BCD A;  4BH6 A;  3IJ0 A;  5AMS A;  4Z7N A;  2I0T A;  2HU8 A;  3ZE2 A;  2VDQ A;  4CC9 A;  3DSM A;  3EU7 A;  4D0K A;  3MUO A;  4Y5R D;  1U4C A;  4J8B A;  1UTC A;  3C5M A;  3IJ1 A;  3UVO A;  1K8K C;  1T2X A;  3OTT A;  3JAM g;  4A0B B;  4Y7R A;  4JD2 C;  3I89 A;  4DNU A;  5FKT A;  3MKS B;  4FA9 D;  2HJ4 A;  4O3U B;  4KFM B;  4AN0 A;  2HU5 A;  2VDO A;  2EIB A;  1FWX A;  2VDK A;  2YNN A;  2PM9 B;  4Z7O A;  4A0B A;  4JHP C;  3VA6 A;  3I7O A;  3L4O D;  1XKS A;  5H1M A;  4LGN A;  4X61 B;  3PVU B;  3ZDY A;  4GQB B;  1PGU A;  5H14 A;  4E54 B;  5GXI A;  3L4M D;  5CYK B;  2CO0 A;  2H9L A;  2BKL A;  3U4Y A;  4UM8 A;  1YFQ A;  3JRP A;  3IUN A;  2YNP A;  1C9I A;  3EQ7 A;  5EML B;  4MMY A;  4L1Q D;  1JOF A;  1GOG A;  3RSE C;  4ERQ A;  3NVQ A;  4YVD A;  5M61 A;  4E54 A;  5FKQ A;  3PXS D;  5C9Z B;  5CYK A;  3ZDZ A;  1U8C A;  2B5M A;  3UVM A;  2EID A;  3C9C A;  4IMM A;  3V7D B;  1M1X A;  3V4P A;  3FCU A;  5M5T A;  4ERY A;  3O4H A;  3IKO A;  2IUP A;  4CI2 A;  3NVN A;  4GQ1 A;  5JWZ A;  4FWW A;  2QC5 A;  5TDH B;  4ZOZ A;  3DWL C;  4X60 B;  1VZ3 A;  2OK4 A;  4PBY A;  4UM9 A;  2VDR A;  4CI3 A;  1NR0 A;  1VYH C;  3MZL A;  2Z2N A;  4J87 A;  4NC4 A;  3I7P A;  4QT8 A;  3GC3 B;  3ZE0 A;  1PBY B;  4AX4 A;  2GNQ A;  1NEX B;  1OLZ A;  4CY3 A;  5CXB B;  3O4J A;  4L9O A;  4PXW A;  3CFV A;  4RE6 A;  2P9S C;  1SQ9 A;  1A12 A;  3F3G A;  1VZ2 A;  2GC4 A;  4FA5 D;  2OVR B;  2OVQ B;  2AQ5 A;  5CXB A;  3NVX A;  4A0A B;  4FHL A;  1TYE A;  4J73 A;  4N14 A;  2PBI B;  2OVP B;  3N0D A;  2IAA A;  3PXW D;  3IUJ A;  4JSP C;  4QAM A;  5IT9 g;  3NIF A;  2WQ8 A;  4CZX A;  3SBR A;  4XYH A;  4K3J B;  4BP9 A;  5C2W B;  4A0A A;  3N0E A;  3P4F A;  5E6U A;  4A11 A;  4J86 A;  3CIK B;  4BL0 A;  2YMU A;  5HE2 B;  2TRC B;  5HE1 B;  1RI6 A;  4G55 A;  2IWK A;  3OL2 B;  2P9I C;  3AFC A;  3PSC B;  4CZY A;  4G1M A;  1O6G A;  3UVL A;  2I3T A;  2CN2 A;  3C99 A;  2XL2 A;  2B5N A;  1SHY B;  1H2Z A;  3DDU A;  4ZOV A;  3CFS B;  4JXM A;  3OL2 A;  4J82 A;  1QNI A;  3VI3 A;  5GXH A;  4HDJ A;  5FA5 B;  3UVN A;  4J81 A;  4Z8L A;  2AH1 A;  4UI9 R;  4BUJ C;  1JTD B;  4ES0 A;  4WJK A;  1GG2 B;  2I0R A;  3AH8 B;  4CY2 A;  4CI1 A;  4AN1 A;  5M5U A;  5THA A;  1H2X A;  4NAA A;  2PM7 B;  2MTA H;  3IUQ A;  3I2N A;  4ERZ A;  4JSN C;  4D6V A;  3AL8 B;  4ZOY A;  3EQ8 A;  3MZK A;  2XL3 A;  4BCB A;  2H3X A;  2VDL A;  2H9N A;  2VDN A;  3MUN A;  5I5I A;  3ZDX A;  5TF2 A;  3IJE A;  4GMB A;  1B9Y A;  1SQJ A;  3AL8 A;  5HE3 B;  1H2W A;  4GM3 A;  1XHM A;  3KRX B;  3ODT A;  4FAN D;  4JSV C;  3UVK A;  3V4V A;  3I7H A;  4GM8 A;  4ZN4 A;  4A2L A;  3JZG A;  3RRM C;  3SXT D;  3OKY B;  5I5J A;  2OIZ A;  2H47 A;  2H68 A;  4GM9 A;  3T3M A;  2PM9 A;  4G56 B;  4J8G A;  2XZG A;  1S4U X;  2CN3 A;  4O1Q D;  5IGQ A;  3E0C A;  4L3G D;  3OKY A;  3UKR C;  2CO0 C;  3DM0 A;  4CZV A;  4XEI C;  2XYI A;  2VDM A;  3IIW A;  4BP8 A;  3SVW D;  3ULE C;  4AMY A;  2HES X;  2BCJ B;  3GFC A;  3BG1 A;  4J0W A;  2AGW A;  5FLX g;  2P9U C;  3F3F A;  5C92 A;  2BBK H;  5EMK B;  2P9N C;  2I3S A;  3K26 A;  1C9L A;  2HKR A;  5M5V A;  4AEZ A;  4ZOX A;  1N6D A;  3GRE A;  3FRX A;  3ZE1 A;  1K3I A;  1TBG A;  5IJ8 E;  4K3I D;  5HE0 B;  2HU7 A;  3UKU C;  3I8C A;  3JZH A;  4A2M A;  1ERJ A;  3RN1 D;  5H17 A;  4J84 A;  3OF7 A;  3RMZ D;  1H2Y A;  4RE5 A;  2HKM A;  3IUM A;  5A2Q g;  2IUR A;  2XDW A;  4FA1 D;  3MXX A;  5EM2 B;  4X3E A;  2Z2O A;  3JRO A;  5EMM B;  3PE7 A;  4FB1 D;  3MMY A;  1GXR A;  1GOF A;  3KCI A;  3I7K A;  1UOQ A;  1GOH A;  3VH0 A;  3SMR A;  1MG2 A;  4H5I A;  5EM2 A;  3RFG A;  1JMZ B;  2Q7Q A;  5FQD A;  4A08 B;  1VE6 A;  1MG3 A;  2H9M A;  5E6S A;  3JPX A;  3A0F A;  4X63 B;  4H5J A;  1E8N A;  2AGX A;  2UZX B;  1P22 A;  1YR2 A;  5AJA A;  4R7A B;  3I8E A;  3IUR A;  4BCC A;  4GZ8 A;  3O4G A;  4A08 A;  3ZWL B;  5FFO A;  1U2V C;  1N6F A;  3EI1 B;  2G99 A;  4IA9 A;  3AL9 A;  4MMX A;  4OZU A;  3RLM D;  4J79 A;  2I0S A;  4CY1 A;  4GGA A;  1A0R B;  3I7L A;  2CNX A;  2P9K C;  3F3P A;  5EAM A;  3EI1 A;  5IGO A;  4Z7Q A;  3MKQ A;  4O3T B;  4WK2 A;  2IUV A;  3PXT D;  1JMX B;  4WK4 A;  1TYQ C;  4L1M A;  4QRJ A;  4PSW B;  3O4I A;  5EMJ B;  3IJC A;  4JHN A;  3ORV D;  5EAL A;  2H6Q A;  1O6F A;  2H13 A;  1GOT B;  4A09 B; 
#chains in the Genus database with same CATH homology
 2AGL A;  4GQ2 P;  4QL1 A;  2G9A A;  5IC7 A;  3J81 g;  2B4E A;  3JZN A;  3FGB A;  5K1C C;  4A09 A;  3PSL A;  1R5M A;  3I7N A;  2CE8 A;  2YBA A;  1PI6 A;  5B4W A;  3EWE A;  3B7F A;  4AOW A;  5FKS A;  4E5Z B;  4A7J A;  4J0X A;  2W18 A;  3SFZ A;  3SN6 B;  4J77 A;  2B5L A;  3BWS A;  4E5Z A;  4CI8 A;  5SXM A;  2UZY B;  2J56 H;  3C75 H;  3SWS D;  5GMK n;  5C2V B;  3OKT A;  4PSX B;  3RN0 D;  4GGC A;  2P9P C;  3UR4 A;  4TZ4 A;  2IUQ A;  3DXM C;  2H6N A;  2HJB A;  5GSA A;  3IIY A;  4O45 A;  4CY5 A;  4PBZ A;  2HXC A;  5FXY A;  4ESG A;  3EG6 A;  4OWR A;  2EBS A;  5CXC B;  2CE9 A;  1K32 A;  5TEE A;  3W15 A;  1N6E A;  3SLE D;  3V5W B;  1XIP A;  5EAR A;  5CXC A;  2H9P A;  4JT6 C;  4GGD A;  5EAP A;  3EI3 B;  3SJL D;  3K27 A;  3JB9 L;  1MDA H;  5I5M A;  3EI3 A;  5FKR A;  3VGZ A;  2H14 A;  2O9K A;  1JJU B;  3EMH A;  3SBQ A;  2OJY A;  4J78 A;  2QXV A;  4PNK B;  3EI2 B;  3PVW B;  2XU7 A;  2YNO A;  4MK0 B;  4NSX A;  2AGZ A;  3OW8 A;  1OMW B;  3DXK C;  4U1E I;  3EI4 B;  3FM0 A;  3HFQ A;  3EI2 A;  2AGY A;  5HQG A;  2HYE A;  5K19 A;  5TEF A;  3SBP A;  3KRW B;  4A11 B;  4EWR A;  3EI4 A;  4LG8 A;  3J80 g;  2Z2P A;  4O9D A;  3BG0 A;  3SCY A;  2J55 H;  2P9L C;  4I79 A;  5AFU 3;  1Q47 A;  4JSX C;  3V9F A;  5IJ7 E;  1B9X A;  4U7A A;  3OKW A;  5HYN B;  2YB8 B;  5KDO B;  4LG9 A;  4FAV D;  2OK6 A;  2AH0 A;  2PM6 B;  2IWF A;  2GC7 A;  4XYI A;  1GP2 B;  4FA4 D;  1PEV A;  2J57 G;  3SHF A;  4JT5 C;  4PC0 A;  2H6K A;  1L0Q A;  4QQE A;  4L3H D;  3RFH A;  4BH6 A;  3IJ0 A;  5AMS A;  2I0T A;  4CC9 A;  3DSM A;  3EU7 A;  4D0K A;  4Y5R D;  1U4C A;  4J8B A;  3C5M A;  3IJ1 A;  3UVO A;  1K8K C;  3JAM g;  3OTT A;  4A0B B;  4Y7R A;  4JD2 C;  3I89 A;  5FKT A;  3MKS B;  4FA9 D;  2HJ4 A;  4O3U B;  4KFM B;  1FWX A;  2YNN A;  2PM9 B;  4A0B A;  3VA6 A;  3I7O A;  3L4O D;  1XKS A;  5H1M A;  4LGN A;  4X61 B;  3PVU B;  4GQB B;  1PGU A;  5H14 A;  4E54 B;  5GXI A;  3L4M D;  5CYK B;  2CO0 A;  2H9L A;  3U4Y A;  1YFQ A;  3JRP A;  2YNP A;  5EML B;  4ERQ A;  4L1Q D;  1JOF A;  3RSE C;  3NVQ A;  4YVD A;  4E54 A;  5FKQ A;  3PXS D;  5C9Z B;  5CYK A;  2B5M A;  3UVM A;  3C9C A;  4IMM A;  3V7D B;  4ERY A;  3IKO A;  2IUP A;  4CI2 A;  3NVN A;  4GQ1 A;  5JWZ A;  4FWW A;  2QC5 A;  5TDH B;  4ZOZ A;  3DWL C;  4X60 B;  2OK4 A;  4PBY A;  4CI3 A;  1NR0 A;  1VYH C;  3MZL A;  2Z2N A;  4J87 A;  3I7P A;  4QT8 A;  1PBY B;  2GNQ A;  1NEX B;  1OLZ A;  4CY3 A;  5CXB B;  4L9O A;  4PXW A;  3CFV A;  2P9S C;  1SQ9 A;  3F3G A;  2GC4 A;  4FA5 D;  2OVR B;  2OVQ B;  2AQ5 A;  5CXB A;  3NVX A;  4A0A B;  4FHL A;  4J73 A;  4N14 A;  2PBI B;  2OVP B;  3N0D A;  2IAA A;  3PXW D;  4JSP C;  5IT9 g;  4CZX A;  3SBR A;  4XYH A;  4K3J B;  5C2W B;  4A0A A;  3N0E A;  3P4F A;  4A11 A;  4J86 A;  3CIK B;  4BL0 A;  2YMU A;  5HE2 B;  2TRC B;  5HE1 B;  1RI6 A;  4CZY A;  2IWK A;  3OL2 B;  2P9I C;  3AFC A;  3PSC B;  3UVL A;  2I3T A;  2CN2 A;  3C99 A;  2XL2 A;  2B5N A;  1SHY B;  4ZOV A;  3CFS B;  4JXM A;  3OL2 A;  4J82 A;  1QNI A;  5GXH A;  4HDJ A;  5FA5 B;  3UVN A;  4J81 A;  4Z8L A;  2AH1 A;  4UI9 R;  4BUJ C;  4ES0 A;  1GG2 B;  2I0R A;  3AH8 B;  4CY2 A;  4CI1 A;  5THA A;  2PM7 B;  2MTA H;  3I2N A;  4ERZ A;  4JSN C;  4D6V A;  3AL8 B;  4ZOY A;  3MZK A;  2XL3 A;  2H3X A;  2H9N A;  5I5I A;  5TF2 A;  4GMB A;  1B9Y A;  1SQJ A;  3AL8 A;  5HE3 B;  4GM3 A;  1XHM A;  3KRX B;  3ODT A;  4FAN D;  4JSV C;  3UVK A;  3I7H A;  4GM8 A;  4ZN4 A;  4A2L A;  3JZG A;  3RRM C;  3SXT D;  3OKY B;  5I5J A;  2OIZ A;  2H47 A;  2H68 A;  4GM9 A;  2PM9 A;  4G56 B;  4J8G A;  1S4U X;  2CN3 A;  4O1Q D;  5IGQ A;  3E0C A;  4L3G D;  3OKY A;  3UKR C;  2CO0 C;  3DM0 A;  4CZV A;  4XEI C;  2XYI A;  3IIW A;  3SVW D;  3ULE C;  2HES X;  2BCJ B;  3GFC A;  3BG1 A;  4J0W A;  2AGW A;  5FLX g;  2P9U C;  3F3F A;  2BBK H;  5EMK B;  2P9N C;  2I3S A;  3K26 A;  2HKR A;  4AEZ A;  4ZOX A;  1N6D A;  3GRE A;  3FRX A;  1TBG A;  5IJ8 E;  4K3I D;  5HE0 B;  3UKU C;  3I8C A;  3JZH A;  4A2M A;  1ERJ A;  3RN1 D;  5H17 A;  4J84 A;  3RMZ D;  2HKM A;  5A2Q g;  2IUR A;  4FA1 D;  3MXX A;  5EM2 B;  4X3E A;  2Z2O A;  3JRO A;  5EMM B;  3PE7 A;  4FB1 D;  3MMY A;  1GXR A;  3I7K A;  3VH0 A;  3SMR A;  1MG2 A;  4H5I A;  5EM2 A;  3RFG A;  1JMZ B;  2Q7Q A;  5FQD A;  4A08 B;  1MG3 A;  2H9M A;  3JPX A;  3A0F A;  4X63 B;  4H5J A;  2AGX A;  2UZX B;  1P22 A;  5AJA A;  4R7A B;  3I8E A;  4GZ8 A;  4A08 A;  3ZWL B;  1U2V C;  1N6F A;  3EI1 B;  2G99 A;  4IA9 A;  3AL9 A;  4OZU A;  3RLM D;  4J79 A;  2I0S A;  4CY1 A;  4GGA A;  1A0R B;  3I7L A;  2CNX A;  2P9K C;  3F3P A;  5EAM A;  3EI1 A;  5IGO A;  3MKQ A;  4O3T B;  2IUV A;  3PXT D;  1JMX B;  1TYQ C;  4QRJ A;  4PSW B;  5EMJ B;  3IJC A;  5EAL A;  3ORV D;  2H6Q A;  2H13 A;  1GOT B;  4A09 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...