3FCUA

Structure of headpiece of integrin aiibb3 in open conformation
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
457
structure length
457
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin, alpha 2b
publication title Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 108
structure length 457
sequence length 457
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2008-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3fcuA00
3ZE1A 2VDPA 4UM8A 4WJKA 2VDLA 4Z7QA 4NENA 3K71A 3VI3A 2VC2A 3T3PA 4G1MA 4G1EA 3NIDA 3FCUA 4WK2A 3ZE0A 1TYEA 2VDRA 3ZDZA 4MMZA 3ZDXA 5E6SA 4MMYA 1M1XA 2VDNA 3V4PA 3ZDYA 4Z7OA 3V4VA 3FCSA 5E6RA 4UM9A 3T3MA 2VDOA 4IRZA 1L5GA 5FFOA 5FFGA 5HDBA 1U8CA 3ZE2A 2VDMA 4WK4A 4WK0A 4Z7NA 3K72A 5E6UA 3NIFA 3VI4A 4O02A 3K6SA 2VDKA 4MMXA 1JV2A 2VDQA 3IJEA 3NIGA
chains in the Genus database with same CATH superfamily
4Z7QA 4QL1A 5EM2B 3VI3A 3F3PA 3I89A 2Z2NA 1E8MA 2I0RA 1P22A 4GGAA 2VDRA 2AGWA 4K3ID 1YR2A 2AQ5A 1M1XA 4JHPC 3SBRA 3C99A 5K1CC 4ZOXA 4XEIC 3DXMC 3JZNA 1QFSA 2HU8A 2PBIB 3MMYA 2MTAH 1JTDB 4FA4D 2H68A 5CXBA 4ERZA 4AX4A 5JWZA 4CY5A 1T2XA 1U4CA 2VZ1A 4LG9A 4JSPC 2G99A 3DM0A 2I0SA 5IT9g 3DWLC 5C86A 4X60B 5EMKB 2AGLA 4Z7OA 4IRZA 4J81A 3DDUA 4JSVC 3EQ7A 5HDBA 3UKUC 3OKYA 2EIEA 4GQ1A 4WK4A 1UOQA 2I3SA 4RE5A 3EI2B 4A08A 4GM8A 3PXWD 4A2MA 4O02A 4CY1A 4H5JA 2IAAA 1K3IA 4UM8A 1C9IA 3PXTD 5FXYA 3ORVD 3EQ9A 4G55A 3NIDA 4A11B 5EAPA 4BP8A 3P4FA 3PVWB 3SCYA 3AL8B 5M5TA 3GC3B 1B9XA 4A2LA 3AH8B 1A0RB 1JJUB 3J81g 3EMHA 3JPXA 4QRJA 3SFZA 2P9KC 3RSEC 1GOTB 3FM0A 1SHYB 3DXKC 2H6NA 5K19A 1H2XA 3ODTA 3JB9L 1GOHA 2H14A 2HJ4A 3I7PA 2VDKA 5FKTA 4AN1A 5FKRA 2YB8B 2J56H 4FA1D 4FAND 3RN0D 3JRPA 2Z2OA 3MVDK 1XKSA 4A0AB 2AGYA 1TYEA 2B5MA 2XYIA 3O4HA 3V9FA 4AMZA 4H5IA 2H13A 4FWWA 1Q47A 2CE8A 1U8CA 3VI4A 3K6SA 3FRXA 4MMXA 4BH6A 2B5NA 2IWKA 3JROA 1XIPA 2YNPA 4CY2A 3O4GA 1GG2B 5M5VA 4JXMA 5CYKA 4NENA 4I79A 4E5ZA 5GXHA 4IMMA 3ZE0A 2QZPA 2EIDA 3E0CA 1GP2B 2VDNA 1PEVA 5HE1B 1E8NA 4G56B 3EG6A 4J8GA 5H17A 2BBKH 1PI6A 2OVRB 5EMLB 3ZE2A 1FWXA 3OKWA 5CXBB 1N6DA 2J57G 3I8CA 4GM3A 3IIYA 3IULA 2O9KA 4FA9D 2I3TA 1OLZA 3MKSB 4L1QD 3AFCA 2VC2A 3CIKB 5FLXg 4JSXC 5M5SA 2YNOA 4MMYA 1U2VC 3OKYB 2HU7A 4KFMB 3J80g 1PGUA 4QT8A 1L5GA 2XU7A 2HJBA 3UKRC 5HYNB 2UZYB 1VZ2A 5IJ8E 1TBGA 3GFCA 3PSCB 5EMMB 2P9UC 3C9CA 2P9IC 5M61A 2AGXA 2BKLA 4BUJC 4A09A 2HKMA 1JV2A 2OK6A 5GXIA 2J55H 2VDPA 2BCJB 4CZXA 3IJ1A 3B7FA 3SBPA 5HE3B 4G1EA 3ULEC 4DNUA 1UOOA 5FQDA 1UOPA 4ESGA 4QAMA 4D9SA 1R5MA 2GNQA 3L4OD 3SXTD 3NVXA 3ZWLB 3OW8A 2YNNA 3T3MA 1N6EA 4UI9R 5FKQA 5TDHB 2P9LC 4PNKB 3IUMA 3K72A 4L9OA 4DNWA 1RI6A 4NC4A 3IUNA 4LG8A 3RRMC 2P9NC 3IJ0A 3BWSA 4CZVA 5C92A 3IUJA 3A0FA 2PM9A 4K3JB 2Z2PA 1GOGA 3MZLA 4OZUA 1PBYB 2EICA 2G9AA 1I2MB 5THAA 3MKQA 2TRCB 2XZGA 4J87A 2P9SC 5HQGA 1VE6A 3SWSD 1NR0A 1BPOA 3C5MA 3JAMg 4U1EI 5AFU3 3AL9A 4BL0A 2CO0C 5CXCA 2Q7QA 4PXWA 3I7OA 2OVQB 3EI1A 3O4IA 5CYKB 4J79A 3KCIA 3QHYB 5EAMA 4GM9A 4E5ZB 3RMZD 4X61B 4ZOYA 3W15A 4BCCA 1H2WA 3SJLD 3PVUB 1OMWB 4AN0A 3SBQA 3V4PA 4GQBB 4A0BB 2IUQA 2YMUA 3K26A 4CI8A 3IVMA 1K8KC 4BP9A 3I2NA 4GMBA 4O45A 2OJYA 4O3TB 3RFGA 5A2Qg 5KDOB 1NEXB 1TYQC 1O6GA 4JSNC 4UM9A 2XL3A 3FCUA 4PC0A 3ZE1A 2I0TA 4CZYA 1N6FA 4JT6C 2IUVA 3O4JA 4J77A 5AMSA 3T3PA 3EWEA 1K32A 2CN3A 4BCDA 2OIZA 2PM7B 5E6SA 1H2YA 4GGCA 5B4WA 5TF2A 2W18A 3GD1I 4QQEA 3V4VA 4XYIA 3FCSA 4O1QD 1JOFA 1QFMA 4PSXB 5IGOA 3CFSB 3FGBA 1GOFA 4A09B 3I7HA 5E6UA 1SQJA 4E54A 3DSMA 5HE2B 4J8BA 1O6FA 3KRWB 4L3HD 4J82A 4WJKA 3VGZA 3BG1A 4LGNA 2EIBA 4GGDA 4GZ8A 4MMZA 5GSAA 2HESX 3UVLA 3ZDYA 3UVKA 4A0AA 2HKRA 4NAAA 4Y5RD 5C2VB 3IIWA 2XDWA 2VDOA 2PM6B 4JD2C 3IJCA 5SXMA 4A08B 4CC9A 3RN1D 2B5LA 4ZN4A 3N0EA 4Z8LA 2PM9B 4GQ2P 5EALA 3RLMD 3OKTA 4U7AA 3EI4A 5HE0B 3MZKA 2YBAA 3EQ8A 2AH1A 5I5JA 2HU5A 3IKOA 3SVWD 4G1MA 1VYHC 2GC7A 5I5MA 1VZ3A 3ZDZA 3ZDXA 4N14A 3IUQA 2HYEA 1C9LA 3BG0A 3OTTA 3EI3A 3PXSD 4RE6A 5CXCB 3OL2A 5E6RA 2GC4A 3K27A 4PSWB 4BCBA 3EI1B 4O9DA 3NVNA 2VDMA 4WK0A 4AMYA 4EWRA 3U4YA 2IWFA 3UVMA 3I7KA 4ERQA 5FA5B 2OVPB 4J0XA 2VDQA 4O2WA 2QXVA 5EMJB 4DNVA 4FAVD 4L1MA 1ERJA 3K71A 1XHMA 2B4EA 4WK2A 3RFHA 3SLED 4D6VA 5EM2A 5C2WB 5IJ7E 1VE7A 2H9NA 3HFQA 3VH0A 5FKSA 2H6QA 3C75H 5IC7A 5FFGA 4A7JA 1L0QA 3MUNA 4J73A 5TEFA 2IURA 2CN2A 2H9LA 3NIFA 3KRXB 1UTCA 4MK0B 5I5IA 4PBZA 2HXCA 3UR4A 4X3EA 3F3GA 4R7AB 5TEEA 4XYHA 3IURA 4HDJA 2JKXA 4J0WA 5EARA 3PE7A 4JHNA 4OWRA 4PBYA 1MG3A 5IGQA 2H9PA 3I7NA 4CI1A 4NBMA 1QNIA 3N0DA 2H9MA 4E54B 1B9YA 1H2ZA 4J86A 4CY3A 3F3FA 5C9ZB 3JZGA 4NSXA 1MDAH 4Z7NA 2CNXA 4J78A 2EBSA 4D0KA 4X63B 4O3UB 3VA6A 1JMZB 1JMXB 3EI2A 1YFQA 4Y7RA 4AOWA 2VDLA 5H14A 3UVOA 2IUPA 4ES0A 2VZ3A 2XL2A 1E5TA 2H47A 2CE9A 4ZOZA 3QI0A 3SN6B 4A11A 3I8EA 5FFOA 2QC5A 1MG2A 3AL8A 3NVQA 2AGZA 3EU7A 1SQ9A 4CI2A 5GMKn 3SMRA 3V5WB 3EI4B 2P9PC 2AH0A 4ZOVA 3IJEA 3NIGA 2H6KA 3V7DB 4L3GD 4JT5C 5AJAA 4TZ4A 3UVNA 4ERYA 4IA9A 4AEZA 3EI3B 4FB1D 1GXRA 2WQ8A 3OL2B 3OF7A 4FA5D 2CO0A 3JZHA 2QR5A 2XE4A 3MXXA 1A12A 3SHFA 4CI3A 4A0BA 5H1MA 3L4MD 2H3XA 4FHLA 4YVDA 3GREA 3CFVA 3MUOA 2OK4A 3I7LA 5M5RA 1S4UX 3PSLA 4J84A 2UZXB 5M5UA
chains in the Genus database with same CATH topology
3ZE1A 2VDPA 4UM8A 4WJKA 2VDLA 4Z7QA 4NENA 3K71A 3VI3A 2VC2A 3T3PA 4G1MA 4G1EA 3NIDA 3FCUA 4WK2A 3ZE0A 1TYEA 2VDRA 3ZDZA 4MMZA 3ZDXA 5E6SA 4MMYA 1M1XA 2VDNA 3V4PA 3ZDYA 4Z7OA 3V4VA 3FCSA 5E6RA 4UM9A 3T3MA 2VDOA 4IRZA 1L5GA 5FFOA 5FFGA 5HDBA 1U8CA 3ZE2A 2VDMA 4WK4A 4WK0A 4Z7NA 3K72A 5E6UA 3NIFA 3VI4A 4O02A 3K6SA 2VDKA 4MMXA 1JV2A 2VDQA 3IJEA 3NIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZE1 A;  2VDP A;  4UM8 A;  4WJK A;  2VDL A;  4Z7Q A;  4NEN A;  3K71 A;  3VI3 A;  2VC2 A;  3T3P A;  4G1M A;  4G1E A;  3NID A;  3FCU A;  4WK2 A;  3ZE0 A;  1TYE A;  2VDR A;  3ZDZ A;  4MMZ A;  3ZDX A;  5E6S A;  4MMY A;  1M1X A;  2VDN A;  3V4P A;  3ZDY A;  4Z7O A;  3V4V A;  3FCS A;  5E6R A;  4UM9 A;  3T3M A;  2VDO A;  4IRZ A;  1L5G A;  5FFO A;  5FFG A;  5HDB A;  1U8C A;  3ZE2 A;  2VDM A;  4WK4 A;  4WK0 A;  4Z7N A;  3K72 A;  5E6U A;  3NIF A;  3VI4 A;  4O02 A;  3K6S A;  2VDK A;  4MMX A;  1JV2 A;  2VDQ A;  3IJE A;  3NIG A; 
#chains in the Genus database with same CATH topology
 4Z7Q A;  4QL1 A;  5EM2 B;  3VI3 A;  3F3P A;  3I89 A;  2Z2N A;  1E8M A;  2I0R A;  1P22 A;  4GGA A;  2VDR A;  2AGW A;  4K3I D;  1YR2 A;  2AQ5 A;  1M1X A;  4JHP C;  3SBR A;  3C99 A;  5K1C C;  4ZOX A;  4XEI C;  3DXM C;  3JZN A;  1QFS A;  2HU8 A;  2PBI B;  3MMY A;  2MTA H;  1JTD B;  4FA4 D;  2H68 A;  5CXB A;  4ERZ A;  4AX4 A;  5JWZ A;  4CY5 A;  1T2X A;  1U4C A;  2VZ1 A;  4LG9 A;  4JSP C;  2G99 A;  3DM0 A;  2I0S A;  5IT9 g;  3DWL C;  5C86 A;  4X60 B;  5EMK B;  2AGL A;  4Z7O A;  4IRZ A;  4J81 A;  3DDU A;  4JSV C;  3EQ7 A;  5HDB A;  3UKU C;  3OKY A;  2EIE A;  4GQ1 A;  4WK4 A;  1UOQ A;  2I3S A;  4RE5 A;  3EI2 B;  4A08 A;  4GM8 A;  3PXW D;  4A2M A;  4O02 A;  4CY1 A;  4H5J A;  2IAA A;  1K3I A;  4UM8 A;  1C9I A;  3PXT D;  5FXY A;  3ORV D;  3EQ9 A;  4G55 A;  3NID A;  4A11 B;  5EAP A;  4BP8 A;  3P4F A;  3PVW B;  3SCY A;  3AL8 B;  5M5T A;  3GC3 B;  1B9X A;  4A2L A;  3AH8 B;  1A0R B;  1JJU B;  3J81 g;  3EMH A;  3JPX A;  4QRJ A;  3SFZ A;  2P9K C;  3RSE C;  1GOT B;  3FM0 A;  1SHY B;  3DXK C;  2H6N A;  5K19 A;  1H2X A;  3ODT A;  3JB9 L;  1GOH A;  2H14 A;  2HJ4 A;  3I7P A;  2VDK A;  5FKT A;  4AN1 A;  5FKR A;  2YB8 B;  2J56 H;  4FA1 D;  4FAN D;  3RN0 D;  3JRP A;  2Z2O A;  3MVD K;  1XKS A;  4A0A B;  2AGY A;  1TYE A;  2B5M A;  2XYI A;  3O4H A;  3V9F A;  4AMZ A;  4H5I A;  2H13 A;  4FWW A;  1Q47 A;  2CE8 A;  1U8C A;  3VI4 A;  3K6S A;  3FRX A;  4MMX A;  4BH6 A;  2B5N A;  2IWK A;  3JRO A;  1XIP A;  2YNP A;  4CY2 A;  3O4G A;  1GG2 B;  5M5V A;  4JXM A;  5CYK A;  4NEN A;  4I79 A;  4E5Z A;  5GXH A;  4IMM A;  3ZE0 A;  2QZP A;  2EID A;  3E0C A;  1GP2 B;  2VDN A;  1PEV A;  5HE1 B;  1E8N A;  4G56 B;  3EG6 A;  4J8G A;  5H17 A;  2BBK H;  1PI6 A;  2OVR B;  5EML B;  3ZE2 A;  1FWX A;  3OKW A;  5CXB B;  1N6D A;  2J57 G;  3I8C A;  4GM3 A;  3IIY A;  3IUL A;  2O9K A;  4FA9 D;  2I3T A;  1OLZ A;  3MKS B;  4L1Q D;  3AFC A;  2VC2 A;  3CIK B;  5FLX g;  4JSX C;  5M5S A;  2YNO A;  4MMY A;  1U2V C;  3OKY B;  2HU7 A;  4KFM B;  3J80 g;  1PGU A;  4QT8 A;  1L5G A;  2XU7 A;  2HJB A;  3UKR C;  5HYN B;  2UZY B;  1VZ2 A;  5IJ8 E;  1TBG A;  3GFC A;  3PSC B;  5EMM B;  2P9U C;  3C9C A;  2P9I C;  5M61 A;  2AGX A;  2BKL A;  4BUJ C;  4A09 A;  2HKM A;  1JV2 A;  2OK6 A;  5GXI A;  2J55 H;  2VDP A;  2BCJ B;  4CZX A;  3IJ1 A;  3B7F A;  3SBP A;  5HE3 B;  4G1E A;  3ULE C;  4DNU A;  1UOO A;  5FQD A;  1UOP A;  4ESG A;  4QAM A;  4D9S A;  1R5M A;  2GNQ A;  3L4O D;  3SXT D;  3NVX A;  3ZWL B;  3OW8 A;  2YNN A;  3T3M A;  1N6E A;  4UI9 R;  5FKQ A;  5TDH B;  2P9L C;  4PNK B;  3IUM A;  3K72 A;  4L9O A;  4DNW A;  1RI6 A;  4NC4 A;  3IUN A;  4LG8 A;  3RRM C;  2P9N C;  3IJ0 A;  3BWS A;  4CZV A;  5C92 A;  3IUJ A;  3A0F A;  2PM9 A;  4K3J B;  2Z2P A;  1GOG A;  3MZL A;  4OZU A;  1PBY B;  2EIC A;  2G9A A;  1I2M B;  5THA A;  3MKQ A;  2TRC B;  2XZG A;  4J87 A;  2P9S C;  5HQG A;  1VE6 A;  3SWS D;  1NR0 A;  1BPO A;  3C5M A;  3JAM g;  4U1E I;  5AFU 3;  3AL9 A;  4BL0 A;  2CO0 C;  5CXC A;  2Q7Q A;  4PXW A;  3I7O A;  2OVQ B;  3EI1 A;  3O4I A;  5CYK B;  4J79 A;  3KCI A;  3QHY B;  5EAM A;  4GM9 A;  4E5Z B;  3RMZ D;  4X61 B;  4ZOY A;  3W15 A;  4BCC A;  1H2W A;  3SJL D;  3PVU B;  1OMW B;  4AN0 A;  3SBQ A;  3V4P A;  4GQB B;  4A0B B;  2IUQ A;  2YMU A;  3K26 A;  4CI8 A;  3IVM A;  1K8K C;  4BP9 A;  3I2N A;  4GMB A;  4O45 A;  2OJY A;  4O3T B;  3RFG A;  5A2Q g;  5KDO B;  1NEX B;  1TYQ C;  1O6G A;  4JSN C;  4UM9 A;  2XL3 A;  3FCU A;  4PC0 A;  3ZE1 A;  2I0T A;  4CZY A;  1N6F A;  4JT6 C;  2IUV A;  3O4J A;  4J77 A;  5AMS A;  3T3P A;  3EWE A;  1K32 A;  2CN3 A;  4BCD A;  2OIZ A;  2PM7 B;  5E6S A;  1H2Y A;  4GGC A;  5B4W A;  5TF2 A;  2W18 A;  3GD1 I;  4QQE A;  3V4V A;  4XYI A;  3FCS A;  4O1Q D;  1JOF A;  1QFM A;  4PSX B;  5IGO A;  3CFS B;  3FGB A;  1GOF A;  4A09 B;  3I7H A;  5E6U A;  1SQJ A;  4E54 A;  3DSM A;  5HE2 B;  4J8B A;  1O6F A;  3KRW B;  4L3H D;  4J82 A;  4WJK A;  3VGZ A;  3BG1 A;  4LGN A;  2EIB A;  4GGD A;  4GZ8 A;  4MMZ A;  5GSA A;  2HES X;  3UVL A;  3ZDY A;  3UVK A;  4A0A A;  2HKR A;  4NAA A;  4Y5R D;  5C2V B;  3IIW A;  2XDW A;  2VDO A;  2PM6 B;  4JD2 C;  3IJC A;  5SXM A;  4A08 B;  4CC9 A;  3RN1 D;  2B5L A;  4ZN4 A;  3N0E A;  4Z8L A;  2PM9 B;  4GQ2 P;  5EAL A;  3RLM D;  3OKT A;  4U7A A;  3EI4 A;  5HE0 B;  3MZK A;  2YBA A;  3EQ8 A;  2AH1 A;  5I5J A;  2HU5 A;  3IKO A;  3SVW D;  4G1M A;  1VYH C;  2GC7 A;  5I5M A;  1VZ3 A;  3ZDZ A;  3ZDX A;  4N14 A;  3IUQ A;  2HYE A;  1C9L A;  3BG0 A;  3OTT A;  3EI3 A;  3PXS D;  4RE6 A;  5CXC B;  3OL2 A;  5E6R A;  2GC4 A;  3K27 A;  4PSW B;  4BCB A;  3EI1 B;  4O9D A;  3NVN A;  2VDM A;  4WK0 A;  4AMY A;  4EWR A;  3U4Y A;  2IWF A;  3UVM A;  3I7K A;  4ERQ A;  5FA5 B;  2OVP B;  4J0X A;  2VDQ A;  4O2W A;  2QXV A;  5EMJ B;  4DNV A;  4FAV D;  4L1M A;  1ERJ A;  3K71 A;  1XHM A;  2B4E A;  4WK2 A;  3RFH A;  3SLE D;  4D6V A;  5EM2 A;  5C2W B;  5IJ7 E;  1VE7 A;  2H9N A;  3HFQ A;  3VH0 A;  5FKS A;  2H6Q A;  3C75 H;  5IC7 A;  5FFG A;  4A7J A;  1L0Q A;  3MUN A;  4J73 A;  5TEF A;  2IUR A;  2CN2 A;  2H9L A;  3NIF A;  3KRX B;  1UTC A;  4MK0 B;  5I5I A;  4PBZ A;  2HXC A;  3UR4 A;  4X3E A;  3F3G A;  4R7A B;  5TEE A;  4XYH A;  3IUR A;  4HDJ A;  2JKX A;  4J0W A;  5EAR A;  3PE7 A;  4JHN A;  4OWR A;  4PBY A;  1MG3 A;  5IGQ A;  2H9P A;  3I7N A;  4CI1 A;  4NBM A;  1QNI A;  3N0D A;  2H9M A;  4E54 B;  1B9Y A;  1H2Z A;  4J86 A;  4CY3 A;  3F3F A;  5C9Z B;  3JZG A;  4NSX A;  1MDA H;  4Z7N A;  2CNX A;  4J78 A;  2EBS A;  4D0K A;  4X63 B;  4O3U B;  3VA6 A;  1JMZ B;  1JMX B;  3EI2 A;  1YFQ A;  4Y7R A;  4AOW A;  2VDL A;  5H14 A;  3UVO A;  2IUP A;  4ES0 A;  2VZ3 A;  2XL2 A;  1E5T A;  2H47 A;  2CE9 A;  4ZOZ A;  3QI0 A;  3SN6 B;  4A11 A;  3I8E A;  5FFO A;  2QC5 A;  1MG2 A;  3AL8 A;  3NVQ A;  2AGZ A;  3EU7 A;  1SQ9 A;  4CI2 A;  5GMK n;  3SMR A;  3V5W B;  3EI4 B;  2P9P C;  2AH0 A;  4ZOV A;  3IJE A;  3NIG A;  2H6K A;  3V7D B;  4L3G D;  4JT5 C;  5AJA A;  4TZ4 A;  3UVN A;  4ERY A;  4IA9 A;  4AEZ A;  3EI3 B;  4FB1 D;  1GXR A;  2WQ8 A;  3OL2 B;  3OF7 A;  4FA5 D;  2CO0 A;  3JZH A;  2QR5 A;  2XE4 A;  3MXX A;  1A12 A;  3SHF A;  4CI3 A;  4A0B A;  5H1M A;  3L4M D;  2H3X A;  4FHL A;  4YVD A;  3GRE A;  3CFV A;  3MUO A;  2OK4 A;  3I7L A;  5M5R A;  1S4U X;  3PSL A;  4J84 A;  2UZX B;  5M5U A; 
#chains in the Genus database with same CATH homology
 3ZE1 A;  2VDP A;  4UM8 A;  4WJK A;  2VDL A;  4Z7Q A;  4NEN A;  3K71 A;  3VI3 A;  2VC2 A;  3T3P A;  4G1M A;  4G1E A;  3NID A;  3FCU A;  4WK2 A;  3ZE0 A;  1TYE A;  2VDR A;  3ZDZ A;  4MMZ A;  3ZDX A;  5E6S A;  4MMY A;  1M1X A;  2VDN A;  3V4P A;  3ZDY A;  4Z7O A;  3V4V A;  3FCS A;  5E6R A;  4UM9 A;  3T3M A;  2VDO A;  4IRZ A;  1L5G A;  5FFO A;  5FFG A;  5HDB A;  1U8C A;  3ZE2 A;  2VDM A;  4WK4 A;  4WK0 A;  4Z7N A;  3K72 A;  5E6U A;  3NIF A;  3VI4 A;  4O02 A;  3K6S A;  2VDK A;  4MMX A;  1JV2 A;  2VDQ A;  3IJE A;  3NIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...