3FCUA

Structure of headpiece of integrin aiibb3 in open conformation
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
457
structure length
457
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin, alpha 2b
publication title Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 108
structure length 457
sequence length 457
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2008-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3fcuA00
3FCSA 3ZDYA 3VI3A 3K72A 4G1MA 1L5GA 4WK2A 5FFOA 3NIFA 3T3MA 4G1EA 4MMYA 3V4VA 2VDKA 5HDBA 2VDPA 2VDLA 2VDMA 1U8CA 3ZE2A 5E6RA 3V4PA 3K71A 3FCUA 1M1XA 4UM8A 4WJKA 4WK0A 3IJEA 4O02A 5E6SA 2VDQA 3ZE0A 4IRZA 3NIDA 4UM9A 2VDRA 5E6UA 3T3PA 3NIGA 3VI4A 4Z7NA 4NENA 1JV2A 1TYEA 3ZDXA 4MMXA 4Z7OA 3K6SA 4MMZA 2VDNA 4Z7QA 2VDOA 3ZDZA 3ZE1A 2VC2A 4WK4A 5FFGA
chains in the Genus database with same CATH superfamily
3VA6A 2BKLA 3O4HA 4WK2A 3EMHA 3OW8A 3OKTA 4R7AB 4ERYA 4A2LA 3JZHA 1MG3A 4L3GD 4GQBB 3JPXA 1FWXA 3QHYB 2VZ3A 5SXMA 3UVMA 1SQ9A 3ZDXA 2H9LA 1Q47A 4A09A 4CI1A 3ULEC 4AX4A 2OK6A 4KFMB 3IIYA 3HFQA 2VDLA 4L3HD 3SN6B 5HE1B 2XL2A 2GC4A 3RLMD 3O4JA 5EAMA 4CI3A 4U1EI 2CE9A 4YVDA 4BP9A 3JROA 2QXVA 3SVWD 3IJ0A 4FA4D 4AMZA 3L4OD 3AH8B 5JWZA 4JT5C 4A0AB 2OIZA 2YMUA 5CXCB 5FFGA 3AL9A 4GM8A 3MMYA 3I8EA 3MUOA 5GXIA 2HXCA 1M1XA 3OTTA 4O1QD 2XL3A 5CXBB 3KRWB 1VE6A 3NIGA 4O3UB 1TYQC 2VZ1A 4JSNC 3MUNA 2UZXB 1N6FA 3UKUC 2VDOA 2YB8B 1A0RB 2VC2A 4J86A 3JZNA 5C92A 3K72A 4A08A 2B5NA 4FA1D 3V4VA 3VH0A 3JAMg 3AL8B 4E54B 5E6RA 3FCUA 4X60B 1VZ2A 3GD1I 4A0BA 3I7NA 4JT6C 3SWSD 4WK0A 2YBAA 5FXYA 2G9AA 2HJ4A 4NSXA 3UVLA 2AH1A 5HE0B 4PC0A 1H2ZA 2HYEA 1TBGA 3RSEC 5EM2A 5H14A 4RE5A 2P9UC 4DNVA 1TYEA 4PBYA 3NVNA 4MMZA 4CY5A 4EWRA 4XYIA 4JSPC 4PSWB 4BCCA 4QAMA 4ZOZA 5IJ8E 3RN1D 5IGQA 4WK4A 4JHPC 4H5IA 2JKXA 3IUNA 3C9CA 4E5ZA 2AGLA 3EI2A 4GQ1A 5TEEA 2EIDA 3DXMC 5AJAA 5GMKn 2EICA 1OLZA 1K32A 4GZ8A 1XIPA 1C9IA 4N14A 4XEIC 3B7FA 4ERZA 4J77A 4QT8A 3OL2A 5B4WA 2YNNA 4GQ2P 4K3ID 3JB9L 2VDNA 2HU8A 4OWRA 5FKSA 3SBQA 2PM9B 3RFGA 2B5MA 3KCIA 4GGAA 5IT9g 3EI1A 5I5IA 2VDKA 3SFZA 3PE7A 4BCDA 3V4PA 4Y5RD 4LGNA 5CYKA 4Z8LA 2H9PA 1N6DA 4JXMA 4GMBA 3RFHA 1YFQA 3RRMC 3EI4B 3DDUA 4UM9A 3PSLA 3T3PA 3OF7A 1JTDB 2BBKH 2OVPB 2HU7A 2PM6B 3N0EA 5HE2B 2P9NC 3CFSB 2G99A 2Z2NA 1NEXB 3I7KA 3IULA 4J78A 2IWFA 1QNIA 2AGWA 2H13A 1A12A 3RMZD 2XZGA 4CZVA 3IURA 1C9LA 3UKRC 2CO0C 4L1QD 3F3GA 3V5WB 4UM8A 4WJKA 3PXSD 5GXHA 4AN0A 4QQEA 2VDRA 3F3FA 4ERQA 4BH6A 4A09B 3V7DB 1SQJA 3SMRA 4DNWA 4Z7OA 5FQDA 4O2WA 3IJ1A 3SHFA 4G56B 1I2MB 3VI3A 1BPOA 2H68A 5CXCA 3MZKA 3F3PA 4OZUA 4UI9R 4A7JA 4LG9A 2W18A 3DM0A 2AGZA 4A11B 1PGUA 3L4MD 2H9MA 1XHMA 3PVUB 5TF2A 5M5VA 4CY3A 1JJUB 4D6VA 5EMKB 3EQ9A 3C99A 4J0XA 5CXBA 2OVRB 4AMYA 4AN1A 3MKSB 5A2Qg 1O6FA 2TRCB 3QI0A 4XYHA 3JZGA 5M5TA 4O9DA 4J82A 4ES0A 5M5UA 1E5TA 4G1MA 4J0WA 2IUQA 3PXTD 2AGXA 3RN0D 3UVNA 4AOWA 4MMYA 4CY1A 1U8CA 1GOGA 5FLXg 4X3EA 2P9SC 3AL8A 4E54A 2P9IC 4MK0B 2MTAH 4J8GA 1PBYB 3MVDK 4D0KA 3K6SA 2I0SA 5IGOA 4Z7QA 3ZDZA 3IVMA 4A08B 3O4GA 2P9PC 1GOHA 4IMMA 3EI3B 2GC7A 3NIFA 3IKOA 3J80g 2J57G 1ERJA 2VDPA 2EIBA 3MXXA 4DNUA 2AGYA 1SHYB 2H9NA 3CFVA 2H6QA 3DWLC 4CY2A 2P9KC 3I7OA 5HYNB 2BCJB 1XKSA 4D9SA 3I7LA 3UVKA 2CN3A 5M5SA 5FKRA 1YR2A 2WQ8A 1MDAH 4NENA 4X61B 1U4CA 3K27A 3I7PA 2O9KA 2CE8A 2CO0A 1P22A 3ORVD 3E0CA 2HKMA 4O3TB 3I8CA 2PM9A 5EARA 1R5MA 2EIEA 3GREA 1NR0A 4FA9D 3BG1A 2YNOA 3ZE2A 4FHLA 3FRXA 2AH0A 1GOTB 1S4UX 2I3SA 3O4IA 4CI8A 2XE4A 4CZYA 3ZE0A 5E6UA 3EI4A 5I5MA 5K19A 4GGCA 3IUQA 3OKYB 4NAAA 5TDHB 4MMXA 5C2VB 5FA5B 4LG8A 3VGZA 4A2MA 1T2XA 1GOFA 1UTCA 1U2VC 5HE3B 3EI1B 3AFCA 2CNXA 4JSVC 2OVQB 1B9XA 2HESX 3OKWA 2IUPA 3W15A 2EBSA 4H5JA 5CYKB 3K71A 1QFMA 4TZ4A 4G55A 2PBIB 5EMLB 3A0FA 4J87A 3BG0A 2VDQA 5THAA 2Z2OA 5IC7A 3SLED 5C86A 4QL1A 4PBZA 2P9LC 4Z7NA 4ZOXA 4JSXC 2XU7A 3DXKC 3SXTD 4ZOVA 3DSMA 1B9YA 4J79A 4FB1D 3GFCA 4PNKB 2J55H 3CIKB 4IA9A 3UVOA 4A0AA 1GG2B 3GC3B 5KDOB 3PSCB 5FFOA 2IURA 4G1EA 1JOFA 1E8MA 5HDBA 1N6EA 2OJYA 4FWWA 5C9ZB 2B4EA 2IAAA 4A11A 3MKQA 4L1MA 4FAND 3JRPA 5E6SA 5FKQA 4IRZA 2I3TA 2UZYB 1UOQA 2H14A 1GP2B 1VE7A 2H6KA 3I89A 5TEFA 4PSXB 1JV2A 3C75H 5AFU3 2QC5A 3PVWB 3EQ7A 4HDJA 4GGDA 3ZE1A 1PI6A 5HQGA 4FAVD 4QRJA 4L9OA 3NVQA 1L5GA 2YNPA 3U4YA 2XDWA 2CN2A 3ZWLB 3EG6A 3P4FA 2I0TA 2VDMA 5EMMB 1UOPA 3BWSA 1VZ3A 4J73A 3ODTA 4J81A 4X63B 3PXWD 1E8NA 4GM9A 4AEZA 1JMZB 4O45A 4CC9A 2Q7QA 4K3JB 5H17A 2QZPA 3KRXB 1RI6A 2AQ5A 3J81g 3ZDYA 5AMSA 3FGBA 4BP8A 3EWEA 4ESGA 4FA5D 2J56H 3T3MA 1L0QA 3EI3A 1H2XA 3C5MA 3N0DA 4GM3A 5M61A 4A0BB 5EAPA 2H3XA 1QFSA 2I0RA 2H47A 3IJCA 4Y7RA 5GSAA 3SBRA 3UR4A 5EM2B 1MG2A 1O6GA 3VI4A 5EALA 4PXWA 2B5LA 4CI2A 1OMWB 5IJ7E 3V9FA 1PEVA 5I5JA 4BCBA 2OK4A 1JMXB 3IUMA 4J8BA 4ZOYA 2QR5A 2HKRA 3FCSA 4CZXA 4E5ZB 4J84A 1GXRA 2XYIA 3EI2B 4NC4A 4RE6A 4NBMA 5C2WB 3I2NA 4JHNA 3IIWA 3I7HA 3MZLA 3SJLD 5K1CC 3SBPA 2GNQA 4I79A 3K26A 4BL0A 1K3IA 3IJEA 2IUVA 4O02A 2HU5A 2IWKA 3NIDA 3FM0A 2HJBA 5FKTA 4ZN4A 1H2YA 3EQ8A 3OL2B 5H1MA 3IUJA 4JD2C 1K8KC 3NVXA 4BUJC 5M5RA 3EU7A 3OKYA 1H2WA 2H6NA 4U7AA 1UOOA 1VYHC 3SCYA 5EMJB 2PM7B 2Z2PA
chains in the Genus database with same CATH topology
3FCSA 3ZDYA 3VI3A 3K72A 4G1MA 1L5GA 4WK2A 5FFOA 3NIFA 3T3MA 4G1EA 4MMYA 3V4VA 2VDKA 5HDBA 2VDPA 2VDLA 2VDMA 1U8CA 3ZE2A 5E6RA 3V4PA 3K71A 3FCUA 1M1XA 4UM8A 4WJKA 4WK0A 3IJEA 4O02A 5E6SA 2VDQA 3ZE0A 4IRZA 3NIDA 4UM9A 2VDRA 5E6UA 3T3PA 3NIGA 3VI4A 4Z7NA 4NENA 1JV2A 1TYEA 3ZDXA 4MMXA 4Z7OA 3K6SA 4MMZA 2VDNA 4Z7QA 2VDOA 3ZDZA 3ZE1A 2VC2A 4WK4A 5FFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FCS A;  3ZDY A;  3VI3 A;  3K72 A;  4G1M A;  1L5G A;  4WK2 A;  5FFO A;  3NIF A;  3T3M A;  4G1E A;  4MMY A;  3V4V A;  2VDK A;  5HDB A;  2VDP A;  2VDL A;  2VDM A;  1U8C A;  3ZE2 A;  5E6R A;  3V4P A;  3K71 A;  3FCU A;  1M1X A;  4UM8 A;  4WJK A;  4WK0 A;  3IJE A;  4O02 A;  5E6S A;  2VDQ A;  3ZE0 A;  4IRZ A;  3NID A;  4UM9 A;  2VDR A;  5E6U A;  3T3P A;  3NIG A;  3VI4 A;  4Z7N A;  4NEN A;  1JV2 A;  1TYE A;  3ZDX A;  4MMX A;  4Z7O A;  3K6S A;  4MMZ A;  2VDN A;  4Z7Q A;  2VDO A;  3ZDZ A;  3ZE1 A;  2VC2 A;  4WK4 A;  5FFG A; 
#chains in the Genus database with same CATH topology
 3VA6 A;  2BKL A;  3O4H A;  4WK2 A;  3EMH A;  3OW8 A;  3OKT A;  4R7A B;  4ERY A;  4A2L A;  3JZH A;  1MG3 A;  4L3G D;  4GQB B;  3JPX A;  1FWX A;  3QHY B;  2VZ3 A;  5SXM A;  3UVM A;  1SQ9 A;  3ZDX A;  2H9L A;  1Q47 A;  4A09 A;  4CI1 A;  3ULE C;  4AX4 A;  2OK6 A;  4KFM B;  3IIY A;  3HFQ A;  2VDL A;  4L3H D;  3SN6 B;  5HE1 B;  2XL2 A;  2GC4 A;  3RLM D;  3O4J A;  5EAM A;  4CI3 A;  4U1E I;  2CE9 A;  4YVD A;  4BP9 A;  3JRO A;  2QXV A;  3SVW D;  3IJ0 A;  4FA4 D;  4AMZ A;  3L4O D;  3AH8 B;  5JWZ A;  4JT5 C;  4A0A B;  2OIZ A;  2YMU A;  5CXC B;  5FFG A;  3AL9 A;  4GM8 A;  3MMY A;  3I8E A;  3MUO A;  5GXI A;  2HXC A;  1M1X A;  3OTT A;  4O1Q D;  2XL3 A;  5CXB B;  3KRW B;  1VE6 A;  3NIG A;  4O3U B;  1TYQ C;  2VZ1 A;  4JSN C;  3MUN A;  2UZX B;  1N6F A;  3UKU C;  2VDO A;  2YB8 B;  1A0R B;  2VC2 A;  4J86 A;  3JZN A;  5C92 A;  3K72 A;  4A08 A;  2B5N A;  4FA1 D;  3V4V A;  3VH0 A;  3JAM g;  3AL8 B;  4E54 B;  5E6R A;  3FCU A;  4X60 B;  1VZ2 A;  3GD1 I;  4A0B A;  3I7N A;  4JT6 C;  3SWS D;  4WK0 A;  2YBA A;  5FXY A;  2G9A A;  2HJ4 A;  4NSX A;  3UVL A;  2AH1 A;  5HE0 B;  4PC0 A;  1H2Z A;  2HYE A;  1TBG A;  3RSE C;  5EM2 A;  5H14 A;  4RE5 A;  2P9U C;  4DNV A;  1TYE A;  4PBY A;  3NVN A;  4MMZ A;  4CY5 A;  4EWR A;  4XYI A;  4JSP C;  4PSW B;  4BCC A;  4QAM A;  4ZOZ A;  5IJ8 E;  3RN1 D;  5IGQ A;  4WK4 A;  4JHP C;  4H5I A;  2JKX A;  3IUN A;  3C9C A;  4E5Z A;  2AGL A;  3EI2 A;  4GQ1 A;  5TEE A;  2EID A;  3DXM C;  5AJA A;  5GMK n;  2EIC A;  1OLZ A;  1K32 A;  4GZ8 A;  1XIP A;  1C9I A;  4N14 A;  4XEI C;  3B7F A;  4ERZ A;  4J77 A;  4QT8 A;  3OL2 A;  5B4W A;  2YNN A;  4GQ2 P;  4K3I D;  3JB9 L;  2VDN A;  2HU8 A;  4OWR A;  5FKS A;  3SBQ A;  2PM9 B;  3RFG A;  2B5M A;  3KCI A;  4GGA A;  5IT9 g;  3EI1 A;  5I5I A;  2VDK A;  3SFZ A;  3PE7 A;  4BCD A;  3V4P A;  4Y5R D;  4LGN A;  5CYK A;  4Z8L A;  2H9P A;  1N6D A;  4JXM A;  4GMB A;  3RFH A;  1YFQ A;  3RRM C;  3EI4 B;  3DDU A;  4UM9 A;  3PSL A;  3T3P A;  3OF7 A;  1JTD B;  2BBK H;  2OVP B;  2HU7 A;  2PM6 B;  3N0E A;  5HE2 B;  2P9N C;  3CFS B;  2G99 A;  2Z2N A;  1NEX B;  3I7K A;  3IUL A;  4J78 A;  2IWF A;  1QNI A;  2AGW A;  2H13 A;  1A12 A;  3RMZ D;  2XZG A;  4CZV A;  3IUR A;  1C9L A;  3UKR C;  2CO0 C;  4L1Q D;  3F3G A;  3V5W B;  4UM8 A;  4WJK A;  3PXS D;  5GXH A;  4AN0 A;  4QQE A;  2VDR A;  3F3F A;  4ERQ A;  4BH6 A;  4A09 B;  3V7D B;  1SQJ A;  3SMR A;  4DNW A;  4Z7O A;  5FQD A;  4O2W A;  3IJ1 A;  3SHF A;  4G56 B;  1I2M B;  3VI3 A;  1BPO A;  2H68 A;  5CXC A;  3MZK A;  3F3P A;  4OZU A;  4UI9 R;  4A7J A;  4LG9 A;  2W18 A;  3DM0 A;  2AGZ A;  4A11 B;  1PGU A;  3L4M D;  2H9M A;  1XHM A;  3PVU B;  5TF2 A;  5M5V A;  4CY3 A;  1JJU B;  4D6V A;  5EMK B;  3EQ9 A;  3C99 A;  4J0X A;  5CXB A;  2OVR B;  4AMY A;  4AN1 A;  3MKS B;  5A2Q g;  1O6F A;  2TRC B;  3QI0 A;  4XYH A;  3JZG A;  5M5T A;  4O9D A;  4J82 A;  4ES0 A;  5M5U A;  1E5T A;  4G1M A;  4J0W A;  2IUQ A;  3PXT D;  2AGX A;  3RN0 D;  3UVN A;  4AOW A;  4MMY A;  4CY1 A;  1U8C A;  1GOG A;  5FLX g;  4X3E A;  2P9S C;  3AL8 A;  4E54 A;  2P9I C;  4MK0 B;  2MTA H;  4J8G A;  1PBY B;  3MVD K;  4D0K A;  3K6S A;  2I0S A;  5IGO A;  4Z7Q A;  3ZDZ A;  3IVM A;  4A08 B;  3O4G A;  2P9P C;  1GOH A;  4IMM A;  3EI3 B;  2GC7 A;  3NIF A;  3IKO A;  3J80 g;  2J57 G;  1ERJ A;  2VDP A;  2EIB A;  3MXX A;  4DNU A;  2AGY A;  1SHY B;  2H9N A;  3CFV A;  2H6Q A;  3DWL C;  4CY2 A;  2P9K C;  3I7O A;  5HYN B;  2BCJ B;  1XKS A;  4D9S A;  3I7L A;  3UVK A;  2CN3 A;  5M5S A;  5FKR A;  1YR2 A;  2WQ8 A;  1MDA H;  4NEN A;  4X61 B;  1U4C A;  3K27 A;  3I7P A;  2O9K A;  2CE8 A;  2CO0 A;  1P22 A;  3ORV D;  3E0C A;  2HKM A;  4O3T B;  3I8C A;  2PM9 A;  5EAR A;  1R5M A;  2EIE A;  3GRE A;  1NR0 A;  4FA9 D;  3BG1 A;  2YNO A;  3ZE2 A;  4FHL A;  3FRX A;  2AH0 A;  1GOT B;  1S4U X;  2I3S A;  3O4I A;  4CI8 A;  2XE4 A;  4CZY A;  3ZE0 A;  5E6U A;  3EI4 A;  5I5M A;  5K19 A;  4GGC A;  3IUQ A;  3OKY B;  4NAA A;  5TDH B;  4MMX A;  5C2V B;  5FA5 B;  4LG8 A;  3VGZ A;  4A2M A;  1T2X A;  1GOF A;  1UTC A;  1U2V C;  5HE3 B;  3EI1 B;  3AFC A;  2CNX A;  4JSV C;  2OVQ B;  1B9X A;  2HES X;  3OKW A;  2IUP A;  3W15 A;  2EBS A;  4H5J A;  5CYK B;  3K71 A;  1QFM A;  4TZ4 A;  4G55 A;  2PBI B;  5EML B;  3A0F A;  4J87 A;  3BG0 A;  2VDQ A;  5THA A;  2Z2O A;  5IC7 A;  3SLE D;  5C86 A;  4QL1 A;  4PBZ A;  2P9L C;  4Z7N A;  4ZOX A;  4JSX C;  2XU7 A;  3DXK C;  3SXT D;  4ZOV A;  3DSM A;  1B9Y A;  4J79 A;  4FB1 D;  3GFC A;  4PNK B;  2J55 H;  3CIK B;  4IA9 A;  3UVO A;  4A0A A;  1GG2 B;  3GC3 B;  5KDO B;  3PSC B;  5FFO A;  2IUR A;  4G1E A;  1JOF A;  1E8M A;  5HDB A;  1N6E A;  2OJY A;  4FWW A;  5C9Z B;  2B4E A;  2IAA A;  4A11 A;  3MKQ A;  4L1M A;  4FAN D;  3JRP A;  5E6S A;  5FKQ A;  4IRZ A;  2I3T A;  2UZY B;  1UOQ A;  2H14 A;  1GP2 B;  1VE7 A;  2H6K A;  3I89 A;  5TEF A;  4PSX B;  1JV2 A;  3C75 H;  5AFU 3;  2QC5 A;  3PVW B;  3EQ7 A;  4HDJ A;  4GGD A;  3ZE1 A;  1PI6 A;  5HQG A;  4FAV D;  4QRJ A;  4L9O A;  3NVQ A;  1L5G A;  2YNP A;  3U4Y A;  2XDW A;  2CN2 A;  3ZWL B;  3EG6 A;  3P4F A;  2I0T A;  2VDM A;  5EMM B;  1UOP A;  3BWS A;  1VZ3 A;  4J73 A;  3ODT A;  4J81 A;  4X63 B;  3PXW D;  1E8N A;  4GM9 A;  4AEZ A;  1JMZ B;  4O45 A;  4CC9 A;  2Q7Q A;  4K3J B;  5H17 A;  2QZP A;  3KRX B;  1RI6 A;  2AQ5 A;  3J81 g;  3ZDY A;  5AMS A;  3FGB A;  4BP8 A;  3EWE A;  4ESG A;  4FA5 D;  2J56 H;  3T3M A;  1L0Q A;  3EI3 A;  1H2X A;  3C5M A;  3N0D A;  4GM3 A;  5M61 A;  4A0B B;  5EAP A;  2H3X A;  1QFS A;  2I0R A;  2H47 A;  3IJC A;  4Y7R A;  5GSA A;  3SBR A;  3UR4 A;  5EM2 B;  1MG2 A;  1O6G A;  3VI4 A;  5EAL A;  4PXW A;  2B5L A;  4CI2 A;  1OMW B;  5IJ7 E;  3V9F A;  1PEV A;  5I5J A;  4BCB A;  2OK4 A;  1JMX B;  3IUM A;  4J8B A;  4ZOY A;  2QR5 A;  2HKR A;  3FCS A;  4CZX A;  4E5Z B;  4J84 A;  1GXR A;  2XYI A;  3EI2 B;  4NC4 A;  4RE6 A;  4NBM A;  5C2W B;  3I2N A;  4JHN A;  3IIW A;  3I7H A;  3MZL A;  3SJL D;  5K1C C;  3SBP A;  2GNQ A;  4I79 A;  3K26 A;  4BL0 A;  1K3I A;  3IJE A;  2IUV A;  4O02 A;  2HU5 A;  2IWK A;  3NID A;  3FM0 A;  2HJB A;  5FKT A;  4ZN4 A;  1H2Y A;  3EQ8 A;  3OL2 B;  5H1M A;  3IUJ A;  4JD2 C;  1K8K C;  3NVX A;  4BUJ C;  5M5R A;  3EU7 A;  3OKY A;  1H2W A;  2H6N A;  4U7A A;  1UOO A;  1VYH C;  3SCY A;  5EMJ B;  2PM7 B;  2Z2P A; 
#chains in the Genus database with same CATH homology
 3FCS A;  3ZDY A;  3VI3 A;  3K72 A;  4G1M A;  1L5G A;  4WK2 A;  5FFO A;  3NIF A;  3T3M A;  4G1E A;  4MMY A;  3V4V A;  2VDK A;  5HDB A;  2VDP A;  2VDL A;  2VDM A;  1U8C A;  3ZE2 A;  5E6R A;  3V4P A;  3K71 A;  3FCU A;  1M1X A;  4UM8 A;  4WJK A;  4WK0 A;  3IJE A;  4O02 A;  5E6S A;  2VDQ A;  3ZE0 A;  4IRZ A;  3NID A;  4UM9 A;  2VDR A;  5E6U A;  3T3P A;  3NIG A;  3VI4 A;  4Z7N A;  4NEN A;  1JV2 A;  1TYE A;  3ZDX A;  4MMX A;  4Z7O A;  3K6S A;  4MMZ A;  2VDN A;  4Z7Q A;  2VDO A;  3ZDZ A;  3ZE1 A;  2VC2 A;  4WK4 A;  5FFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...