3FCUA

Structure of headpiece of integrin aiibb3 in open conformation
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
457
structure length
457
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/blood clotting
molecule keywords Integrin, alpha 2b
publication title Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 457
sequence length 457
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2008-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3fcuA00
3ZDYA 1TYEA 2VDKA 5E6SA 5E6RA 5FFGA 3ZE2A 4Z7OA 3FCUA 3IJEA 3FCSA 4Z7NA 4MMZA 3VI4A 4IRZA 4WK4A 3NIDA 3V4PA 5HDBA 3K71A 2VDOA 4G1EA 3K72A 4G1MA 3V4VA 2VDMA 3VI3A 3ZE1A 4Z7QA 4WK2A 3K6SA 2VDLA 2VDQA 3ZDXA 4WJKA 4MMXA 4WK0A 1JV2A 4NENA 1U8CA 1L5GA 3NIFA 2VC2A 4UM8A 1M1XA 2VDPA 4UM9A 5FFOA 3T3PA 2VDRA 3ZE0A 2VDNA 4MMYA 4O02A 3T3MA 3ZDZA 5E6UA 3NIGA
chains in the Genus database with same CATH superfamily
2CN2A 1QFSA 4A2MA 2HYEA 1PEVA 4JSVC 3PXSD 1XIPA 2XU7A 2Z2OA 1GOGA 3MZKA 2AH1A 2VDOA 3EI1B 2I0RA 1JTDB 2VDMA 3U4YA 1I2MB 4FA1D 3O4GA 5C2WB 2O9KA 4BL0A 4NBMA 3NVNA 3V7DB 1ERJA 2XL2A 1P22A 4A08A 3ZDZA 5GSAA 4A0AA 4A2LA 2HU8A 5CYKB 2YNNA 2OK4A 3JZHA 1TYEA 2VZ3A 3GFCA 1O6FA 3AL8B 3NVXA 4BCCA 2XYIA 2GC4A 3I8CA 1SQJA 3BG1A 1JV2A 1SHYB 4G56B 2HJBA 3PXTD 5H14A 5CXBA 3DWLC 4CY2A 3P4FA 1L0QA 4CZYA 2HJ4A 2VDKA 4XEIC 1GG2B 5CXCA 5FFGA 2EICA 2B4EA 1TYQC 4OWRA 3I7PA 1Q47A 2Q7QA 3MUNA 1UOOA 1O6GA 2H9PA 4FWWA 4AMYA 4LGNA 3EQ9A 3PVWB 3EQ7A 1C9IA 2IUQA 3T3PA 4BH6A 4JD2C 1VYHC 2BKLA 4JSXC 3O4JA 4CI8A 2AH0A 4ESGA 4EWRA 4AOWA 4ERZA 1XHMA 4AMZA 3JB9L 4O1QD 4GZ8A 4H5JA 4JSNC 5FLXg 1RI6A 1B9XA 2IAAA 4XYHA 3NIDA 4FA5D 1U2VC 2Z2NA 3A0FA 2P9IC 1OMWB 3PXWD 2P9PC 3IIYA 2QXVA 3SBQA 4DNUA 4ERYA 3F3PA 4GM9A 4E54A 3SJLD 3OW8A 3C5MA 3IVMA 4D9SA 1JMXB 3IUJA 4BP8A 4O3TB 3EWEA 3T3MA 4R7AB 5E6UA 4QQEA 3OKWA 3EI3B 1GXRA 1BPOA 2W18A 5IJ8E 2CO0A 5IJ7E 2B5NA 2PM6B 3N0DA 3EI2A 5FKRA 3EI4B 4GGCA 4GGDA 2HKRA 3DXMC 4J8BA 5EMKB 4CY3A 5B4WA 4GM3A 2XL3A 3ZE1A 5EMLB 3C75H 1U4CA 4ZN4A 3RRMC 2G99A 4GM8A 3NIFA 5TF2A 3J80g 3RSEC 1A12A 5AJAA 3SN6B 2AGZA 5FQDA 3JAMg 4E5ZA 4QAMA 4ZOVA 5A2Qg 2H13A 5AFU3 4A0BA 2CE9A 1PBYB 3SBPA 4FHLA 4KFMB 4RE6A 1XKSA 3DSMA 4A11A 2B5MA 3SLED 3OKYB 4J87A 3PSCB 4GQ2P 4ERQA 4L1MA 2CE8A 3K6SA 3OL2A 3BWSA 3SHFA 1MG3A 3VA6A 5GXHA 4X60B 2YB8B 2P9SC 2YMUA 3PSLA 4I79A 3DDUA 5EM2A 2H9NA 2VDPA 2HXCA 3VH0A 2VDNA 2GC7A 3RLMD 3NIGA 4LG8A 4JT6C 1E5TA 4DNVA 4FA4D 3MZLA 3QHYB 5I5IA 3JZNA 5M5UA 4J78A 3N0EA 3K26A 2TRCB 4CZXA 1MG2A 1UOPA 3SMRA 5AMSA 2OVPB 2IUVA 4G55A 2OJYA 1UTCA 4GMBA 2H14A 4A08B 1FWXA 2IURA 4A0AB 2YNOA 3ZDXA 2HKMA 4L3GD 3I7LA 4AN0A 1M1XA 3ZE0A 4CY1A 2JKXA 2EBSA 3SWSD 2VZ1A 1MDAH 1QFMA 1VE7A 3IULA 3F3GA 3OTTA 2EIEA 3ZWLB 3FRXA 2XE4A 3OKTA 3GC3B 3UR4A 1PGUA 4J81A 4Y5RD 5CXBB 3JRPA 3B7FA 3CFSB 5JWZA 4N14A 3JROA 4BP9A 2P9NC 3MUOA 2VDLA 4Z8LA 1K8KC 4WK0A 3CIKB 2PM7B 2IWFA 3SVWD 5CXCB 3F3FA 4MK0B 2QZPA 1T2XA 1GOHA 3ZDYA 3EG6A 2AGWA 3UVOA 4Z7OA 5I5JA 1VZ2A 4Z7NA 2AGLA 2I0SA 3HFQA 5FA5B 5HE3B 5EAMA 3AFCA 4G1MA 1S4UX 4NSXA 2HU5A 4BCBA 3CFVA 3J81g 3PE7A 4O2WA 3DM0A 1GP2B 2P9UC 4A09A 3I89A 4J86A 3QI0A 3SFZA 4L3HD 4HDJA 1VZ3A 5H1MA 2P9KC 2I3SA 4O9DA 5KDOB 3SBRA 3DXKC 3IIWA 2EIBA 4E54B 4UI9R 5M5TA 1JOFA 2H47A 3I7KA 3K72A 2CO0C 2AGXA 4BUJC 2HESX 4WK2A 4U1EI 1B9YA 4WJKA 4DNWA 4J8GA 5TDHB 1OLZA 1NEXB 1L5GA 2PM9A 3PVUB 2J55H 5K1CC 4ES0A 5GMKn 5HE0B 4J0XA 3EI2B 3MVDK 4Y7RA 3IJCA 3IUMA 3KCIA 5IT9g 3K27A 2IUPA 5TEEA 3FCUA 2CNXA 2WQ8A 5SXMA 2H6NA 3EMHA 4MMZA 4PNKB 5FKQA 3V9FA 4IRZA 3RMZD 2XZGA 1R5MA 3UKRC 3V4PA 1GOTB 4TZ4A 5HE2B 2HU7A 4X63B 3K71A 4O45A 4E5ZB 4ZOXA 5K19A 4J84A 4A0BB 4FB1D 5C2VB 3UVLA 3RFGA 2J56H 3IUQA 4CI3A 4ZOYA 2VC2A 4A11B 2Z2PA 3EU7A 4UM9A 1H2YA 3RN0D 4CI1A 2IWKA 4O02A 1N6FA 2OVRB 5EALA 5FXYA 3MKQA 1H2WA 3FM0A 2I3TA 3OL2B 4NC4A 4NAAA 3JPXA 2H68A 5EMJB 5EM2B 4FAND 1YFQA 3IKOA 2XDWA 4K3ID 3IUNA 3C9CA 3KRXB 3RN1D 3JZGA 5CYKA 4CY5A 3W15A 1N6EA 3VI3A 4U7AA 4L1QD 5C92A 3AL8A 1NR0A 5HE1B 3MMYA 4X3EA 4CZVA 5THAA 3I8EA 5I5MA 2P9LC 2OVQB 2VDRA 3ODTA 3RFHA 4BCDA 4MMYA 4CC9A 2H9MA 4YVDA 3UVNA 2H9LA 1TBGA 4AN1A 4J73A 4GQ1A 4A7JA 2UZYB 3GREA 3I7HA 2CN3A 4OZUA 3UVKA 5GXIA 4GGAA 4X61B 2YNPA 2BBKH 4JT5C 4JXMA 4XYIA 3EQ8A 4D6VA 3C99A 1C9LA 4MMXA 3L4OD 3BG0A 3I7NA 3E0CA 3AL9A 3SXTD 2UZXB 4PBYA 3GD1I 3I2NA 2B5LA 4JSPC 5EARA 5IGOA 3ULEC 4FA9D 4IA9A 2EIDA 5IGQA 5E6SA 3IJEA 1E8NA 3FCSA 4ZOZA 1QNIA 2QC5A 2MTAH 5EAPA 2H6KA 5M5SA 5FKTA 4FAVD 4Z7QA 1H2ZA 2BCJB 4J82A 3OF7A 1A0RB 2G9AA 2OIZA 1SQ9A 4PSWB 1JMZB 1GOFA 2QR5A 5FFOA 3UKUC 4JHPC 2H3XA 2AGYA 4RE5A 2YBAA 3O4IA 4QRJA 5TEFA 5E6RA 1E8MA 3ZE2A 5M5VA 5M61A 4LG9A 4A09B 3VI4A 4AX4A 3IURA 4PC0A 4WK4A 5C9ZB 4QL1A 5HDBA 3IJ1A 4JHNA 4G1EA 4IMMA 3O4HA 3MKSB 3EI3A 4CI2A 5EMMB 4PXWA 4K3JB 5IC7A 3ORVD 1U8CA 3FGBA 3MXXA 3UVMA 4QT8A 4UM8A 2H6QA 4J77A 3EI4A 1VE6A 1PI6A 3L4MD 2AQ5A 3IJ0A 2OK6A 1H2XA 2I0TA 4D0KA 2PM9B 2GNQA 5HYNB 5HQGA 2PBIB 4H5IA 4GQBB 3V4VA 1JJUB 3SCYA 3V5WB 2J57G 2VDQA 3KRWB 4AEZA 1K32A 1UOQA 3OKYA 4NENA 4PBZA 1K3IA 4PSXB 3AH8B 1N6DA 1YR2A 4O3UB 3VGZA 5FKSA 4L9OA 5H17A 4J0WA 4J79A 5M5RA 3EI1A 3NVQA 3I7OA 5C86A
chains in the Genus database with same CATH topology
3ZDYA 1TYEA 2VDKA 5E6SA 5E6RA 5FFGA 3ZE2A 4Z7OA 3FCUA 3IJEA 3FCSA 4Z7NA 4MMZA 3VI4A 4IRZA 4WK4A 3NIDA 3V4PA 5HDBA 3K71A 2VDOA 4G1EA 3K72A 4G1MA 3V4VA 2VDMA 3VI3A 3ZE1A 4Z7QA 4WK2A 3K6SA 2VDLA 2VDQA 3ZDXA 4WJKA 4MMXA 4WK0A 1JV2A 4NENA 1U8CA 1L5GA 3NIFA 2VC2A 4UM8A 1M1XA 2VDPA 4UM9A 5FFOA 3T3PA 2VDRA 3ZE0A 2VDNA 4MMYA 4O02A 3T3MA 3ZDZA 5E6UA 3NIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDY A;  1TYE A;  2VDK A;  5E6S A;  5E6R A;  5FFG A;  3ZE2 A;  4Z7O A;  3FCU A;  3IJE A;  3FCS A;  4Z7N A;  4MMZ A;  3VI4 A;  4IRZ A;  4WK4 A;  3NID A;  3V4P A;  5HDB A;  3K71 A;  2VDO A;  4G1E A;  3K72 A;  4G1M A;  3V4V A;  2VDM A;  3VI3 A;  3ZE1 A;  4Z7Q A;  4WK2 A;  3K6S A;  2VDL A;  2VDQ A;  3ZDX A;  4WJK A;  4MMX A;  4WK0 A;  1JV2 A;  4NEN A;  1U8C A;  1L5G A;  3NIF A;  2VC2 A;  4UM8 A;  1M1X A;  2VDP A;  4UM9 A;  5FFO A;  3T3P A;  2VDR A;  3ZE0 A;  2VDN A;  4MMY A;  4O02 A;  3T3M A;  3ZDZ A;  5E6U A;  3NIG A; 
#chains in the Genus database with same CATH topology
 2CN2 A;  1QFS A;  4A2M A;  2HYE A;  1PEV A;  4JSV C;  3PXS D;  1XIP A;  2XU7 A;  2Z2O A;  1GOG A;  3MZK A;  2AH1 A;  2VDO A;  3EI1 B;  2I0R A;  1JTD B;  2VDM A;  3U4Y A;  1I2M B;  4FA1 D;  3O4G A;  5C2W B;  2O9K A;  4BL0 A;  4NBM A;  3NVN A;  3V7D B;  1ERJ A;  2XL2 A;  1P22 A;  4A08 A;  3ZDZ A;  5GSA A;  4A0A A;  4A2L A;  2HU8 A;  5CYK B;  2YNN A;  2OK4 A;  3JZH A;  1TYE A;  2VZ3 A;  3GFC A;  1O6F A;  3AL8 B;  3NVX A;  4BCC A;  2XYI A;  2GC4 A;  3I8C A;  1SQJ A;  3BG1 A;  1JV2 A;  1SHY B;  4G56 B;  2HJB A;  3PXT D;  5H14 A;  5CXB A;  3DWL C;  4CY2 A;  3P4F A;  1L0Q A;  4CZY A;  2HJ4 A;  2VDK A;  4XEI C;  1GG2 B;  5CXC A;  5FFG A;  2EIC A;  2B4E A;  1TYQ C;  4OWR A;  3I7P A;  1Q47 A;  2Q7Q A;  3MUN A;  1UOO A;  1O6G A;  2H9P A;  4FWW A;  4AMY A;  4LGN A;  3EQ9 A;  3PVW B;  3EQ7 A;  1C9I A;  2IUQ A;  3T3P A;  4BH6 A;  4JD2 C;  1VYH C;  2BKL A;  4JSX C;  3O4J A;  4CI8 A;  2AH0 A;  4ESG A;  4EWR A;  4AOW A;  4ERZ A;  1XHM A;  4AMZ A;  3JB9 L;  4O1Q D;  4GZ8 A;  4H5J A;  4JSN C;  5FLX g;  1RI6 A;  1B9X A;  2IAA A;  4XYH A;  3NID A;  4FA5 D;  1U2V C;  2Z2N A;  3A0F A;  2P9I C;  1OMW B;  3PXW D;  2P9P C;  3IIY A;  2QXV A;  3SBQ A;  4DNU A;  4ERY A;  3F3P A;  4GM9 A;  4E54 A;  3SJL D;  3OW8 A;  3C5M A;  3IVM A;  4D9S A;  1JMX B;  3IUJ A;  4BP8 A;  4O3T B;  3EWE A;  3T3M A;  4R7A B;  5E6U A;  4QQE A;  3OKW A;  3EI3 B;  1GXR A;  1BPO A;  2W18 A;  5IJ8 E;  2CO0 A;  5IJ7 E;  2B5N A;  2PM6 B;  3N0D A;  3EI2 A;  5FKR A;  3EI4 B;  4GGC A;  4GGD A;  2HKR A;  3DXM C;  4J8B A;  5EMK B;  4CY3 A;  5B4W A;  4GM3 A;  2XL3 A;  3ZE1 A;  5EML B;  3C75 H;  1U4C A;  4ZN4 A;  3RRM C;  2G99 A;  4GM8 A;  3NIF A;  5TF2 A;  3J80 g;  3RSE C;  1A12 A;  5AJA A;  3SN6 B;  2AGZ A;  5FQD A;  3JAM g;  4E5Z A;  4QAM A;  4ZOV A;  5A2Q g;  2H13 A;  5AFU 3;  4A0B A;  2CE9 A;  1PBY B;  3SBP A;  4FHL A;  4KFM B;  4RE6 A;  1XKS A;  3DSM A;  4A11 A;  2B5M A;  3SLE D;  3OKY B;  4J87 A;  3PSC B;  4GQ2 P;  4ERQ A;  4L1M A;  2CE8 A;  3K6S A;  3OL2 A;  3BWS A;  3SHF A;  1MG3 A;  3VA6 A;  5GXH A;  4X60 B;  2YB8 B;  2P9S C;  2YMU A;  3PSL A;  4I79 A;  3DDU A;  5EM2 A;  2H9N A;  2VDP A;  2HXC A;  3VH0 A;  2VDN A;  2GC7 A;  3RLM D;  3NIG A;  4LG8 A;  4JT6 C;  1E5T A;  4DNV A;  4FA4 D;  3MZL A;  3QHY B;  5I5I A;  3JZN A;  5M5U A;  4J78 A;  3N0E A;  3K26 A;  2TRC B;  4CZX A;  1MG2 A;  1UOP A;  3SMR A;  5AMS A;  2OVP B;  2IUV A;  4G55 A;  2OJY A;  1UTC A;  4GMB A;  2H14 A;  4A08 B;  1FWX A;  2IUR A;  4A0A B;  2YNO A;  3ZDX A;  2HKM A;  4L3G D;  3I7L A;  4AN0 A;  1M1X A;  3ZE0 A;  4CY1 A;  2JKX A;  2EBS A;  3SWS D;  2VZ1 A;  1MDA H;  1QFM A;  1VE7 A;  3IUL A;  3F3G A;  3OTT A;  2EIE A;  3ZWL B;  3FRX A;  2XE4 A;  3OKT A;  3GC3 B;  3UR4 A;  1PGU A;  4J81 A;  4Y5R D;  5CXB B;  3JRP A;  3B7F A;  3CFS B;  5JWZ A;  4N14 A;  3JRO A;  4BP9 A;  2P9N C;  3MUO A;  2VDL A;  4Z8L A;  1K8K C;  4WK0 A;  3CIK B;  2PM7 B;  2IWF A;  3SVW D;  5CXC B;  3F3F A;  4MK0 B;  2QZP A;  1T2X A;  1GOH A;  3ZDY A;  3EG6 A;  2AGW A;  3UVO A;  4Z7O A;  5I5J A;  1VZ2 A;  4Z7N A;  2AGL A;  2I0S A;  3HFQ A;  5FA5 B;  5HE3 B;  5EAM A;  3AFC A;  4G1M A;  1S4U X;  4NSX A;  2HU5 A;  4BCB A;  3CFV A;  3J81 g;  3PE7 A;  4O2W A;  3DM0 A;  1GP2 B;  2P9U C;  4A09 A;  3I89 A;  4J86 A;  3QI0 A;  3SFZ A;  4L3H D;  4HDJ A;  1VZ3 A;  5H1M A;  2P9K C;  2I3S A;  4O9D A;  5KDO B;  3SBR A;  3DXK C;  3IIW A;  2EIB A;  4E54 B;  4UI9 R;  5M5T A;  1JOF A;  2H47 A;  3I7K A;  3K72 A;  2CO0 C;  2AGX A;  4BUJ C;  2HES X;  4WK2 A;  4U1E I;  1B9Y A;  4WJK A;  4DNW A;  4J8G A;  5TDH B;  1OLZ A;  1NEX B;  1L5G A;  2PM9 A;  3PVU B;  2J55 H;  5K1C C;  4ES0 A;  5GMK n;  5HE0 B;  4J0X A;  3EI2 B;  3MVD K;  4Y7R A;  3IJC A;  3IUM A;  3KCI A;  5IT9 g;  3K27 A;  2IUP A;  5TEE A;  3FCU A;  2CNX A;  2WQ8 A;  5SXM A;  2H6N A;  3EMH A;  4MMZ A;  4PNK B;  5FKQ A;  3V9F A;  4IRZ A;  3RMZ D;  2XZG A;  1R5M A;  3UKR C;  3V4P A;  1GOT B;  4TZ4 A;  5HE2 B;  2HU7 A;  4X63 B;  3K71 A;  4O45 A;  4E5Z B;  4ZOX A;  5K19 A;  4J84 A;  4A0B B;  4FB1 D;  5C2V B;  3UVL A;  3RFG A;  2J56 H;  3IUQ A;  4CI3 A;  4ZOY A;  2VC2 A;  4A11 B;  2Z2P A;  3EU7 A;  4UM9 A;  1H2Y A;  3RN0 D;  4CI1 A;  2IWK A;  4O02 A;  1N6F A;  2OVR B;  5EAL A;  5FXY A;  3MKQ A;  1H2W A;  3FM0 A;  2I3T A;  3OL2 B;  4NC4 A;  4NAA A;  3JPX A;  2H68 A;  5EMJ B;  5EM2 B;  4FAN D;  1YFQ A;  3IKO A;  2XDW A;  4K3I D;  3IUN A;  3C9C A;  3KRX B;  3RN1 D;  3JZG A;  5CYK A;  4CY5 A;  3W15 A;  1N6E A;  3VI3 A;  4U7A A;  4L1Q D;  5C92 A;  3AL8 A;  1NR0 A;  5HE1 B;  3MMY A;  4X3E A;  4CZV A;  5THA A;  3I8E A;  5I5M A;  2P9L C;  2OVQ B;  2VDR A;  3ODT A;  3RFH A;  4BCD A;  4MMY A;  4CC9 A;  2H9M A;  4YVD A;  3UVN A;  2H9L A;  1TBG A;  4AN1 A;  4J73 A;  4GQ1 A;  4A7J A;  2UZY B;  3GRE A;  3I7H A;  2CN3 A;  4OZU A;  3UVK A;  5GXI A;  4GGA A;  4X61 B;  2YNP A;  2BBK H;  4JT5 C;  4JXM A;  4XYI A;  3EQ8 A;  4D6V A;  3C99 A;  1C9L A;  4MMX A;  3L4O D;  3BG0 A;  3I7N A;  3E0C A;  3AL9 A;  3SXT D;  2UZX B;  4PBY A;  3GD1 I;  3I2N A;  2B5L A;  4JSP C;  5EAR A;  5IGO A;  3ULE C;  4FA9 D;  4IA9 A;  2EID A;  5IGQ A;  5E6S A;  3IJE A;  1E8N A;  3FCS A;  4ZOZ A;  1QNI A;  2QC5 A;  2MTA H;  5EAP A;  2H6K A;  5M5S A;  5FKT A;  4FAV D;  4Z7Q A;  1H2Z A;  2BCJ B;  4J82 A;  3OF7 A;  1A0R B;  2G9A A;  2OIZ A;  1SQ9 A;  4PSW B;  1JMZ B;  1GOF A;  2QR5 A;  5FFO A;  3UKU C;  4JHP C;  2H3X A;  2AGY A;  4RE5 A;  2YBA A;  3O4I A;  4QRJ A;  5TEF A;  5E6R A;  1E8M A;  3ZE2 A;  5M5V A;  5M61 A;  4LG9 A;  4A09 B;  3VI4 A;  4AX4 A;  3IUR A;  4PC0 A;  4WK4 A;  5C9Z B;  4QL1 A;  5HDB A;  3IJ1 A;  4JHN A;  4G1E A;  4IMM A;  3O4H A;  3MKS B;  3EI3 A;  4CI2 A;  5EMM B;  4PXW A;  4K3J B;  5IC7 A;  3ORV D;  1U8C A;  3FGB A;  3MXX A;  3UVM A;  4QT8 A;  4UM8 A;  2H6Q A;  4J77 A;  3EI4 A;  1VE6 A;  1PI6 A;  3L4M D;  2AQ5 A;  3IJ0 A;  2OK6 A;  1H2X A;  2I0T A;  4D0K A;  2PM9 B;  2GNQ A;  5HYN B;  5HQG A;  2PBI B;  4H5I A;  4GQB B;  3V4V A;  1JJU B;  3SCY A;  3V5W B;  2J57 G;  2VDQ A;  3KRW B;  4AEZ A;  1K32 A;  1UOQ A;  3OKY A;  4NEN A;  4PBZ A;  1K3I A;  4PSX B;  3AH8 B;  1N6D A;  1YR2 A;  4O3U B;  3VGZ A;  5FKS A;  4L9O A;  5H17 A;  4J0W A;  4J79 A;  5M5R A;  3EI1 A;  3NVQ A;  3I7O A;  5C86 A; 
#chains in the Genus database with same CATH homology
 3ZDY A;  1TYE A;  2VDK A;  5E6S A;  5E6R A;  5FFG A;  3ZE2 A;  4Z7O A;  3FCU A;  3IJE A;  3FCS A;  4Z7N A;  4MMZ A;  3VI4 A;  4IRZ A;  4WK4 A;  3NID A;  3V4P A;  5HDB A;  3K71 A;  2VDO A;  4G1E A;  3K72 A;  4G1M A;  3V4V A;  2VDM A;  3VI3 A;  3ZE1 A;  4Z7Q A;  4WK2 A;  3K6S A;  2VDL A;  2VDQ A;  3ZDX A;  4WJK A;  4MMX A;  4WK0 A;  1JV2 A;  4NEN A;  1U8C A;  1L5G A;  3NIF A;  2VC2 A;  4UM8 A;  1M1X A;  2VDP A;  4UM9 A;  5FFO A;  3T3P A;  2VDR A;  3ZE0 A;  2VDN A;  4MMY A;  4O02 A;  3T3M A;  3ZDZ A;  5E6U A;  3NIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...