4O45A

Wdr5 in complex with influenza ns1 c-terminal tail
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
305
structure length
305
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/rna binding protein
molecule keywords WD repeat-containing protein 5
total genus 105
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4o45A00
4ZN4A 4A0BB 3C75H 4E54A 4GM8A 5TEEA 1TYQC 3A0FA 4GM3A 2AGWA 4X63B 3SWSD 3PE7A 2QC5A 2YB8B 1TBGA 4BUJC 2AGLA 3ORVD 1K8KC 3I8EA 4E5ZA 1ERJA 3K26A 3OKTA 5EARA 2Z2PA 4K3JB 2H6KA 3SBPA 4CI3A 4A11B 4AEZA 4J8BA 4CI2A 4R7AB 2H9MA 2XL3A 4A09A 1S4UX 3F3GA 5CYKA 5C2VB 5GMKn 1JMXB 4J0XA 3SMRA 4GQ2P 2OIZA 3I7KA 3J80g 4N14A 2I0TA 3AFCA 4MK0B 3AL8A 3SJLD 4A0AA 3CFSB 4FB1D 3I7LA 3OW8A 4CY1A 3VA6A 5SXMA 1PEVA 3E0CA 3AL9A 3EWEA 4Y7RA 5TF2A 3B7FA 4J79A 1PGUA 3EI3A 3P4FA 3JZHA 2IURA 4JXMA 4JSXC 5FQDA 4O45A 3OL2A 3IIYA 2XL2A 2I0RA 3DXKC 4ERZA 2B5MA 5HYNB 3EI1B 4CY2A 2IAAA 4PBZA 3SCYA 2AQ5A 5I5IA 3N0DA 3SXTD 4JSVC 3CFVA 5AFU3 4A08B 5K19A 4L3HD 5FKRA 1K32A 2J55H 3U4YA 3EMHA 2OVQB 5EMLB 4J0WA 2P9UC 5EMMB 4A08A 3L4MD 4J81A 3MMYA 4J82A 4O3UB 1OMWB 2W18A 4PXWA 4FA9D 3EI4A 4GGDA 4X61B 3PXWD 4Z8LA 3CIKB 3FM0A 4D0KA 4BH6A 2AH1A 2OK4A 3L4OD 3OL2B 4CI8A 4O1QD 3UVOA 1N6FA 2XU7A 2PM6B 3OTTA 3UVMA 4H5JA 3EI3B 3JPXA 4ZOVA 3BG1A 1GOTB 5B4WA 2QXVA 3NVNA 5FKSA 3OKYB 4JT6C 2H68A 2AH0A 3HFQA 2H47A 3BG0A 3NVXA 5FXYA 4X60B 3EG6A 4XYIA 3PSLA 5CXBA 5HE0B 4L1QD 2HYEA 4PBYA 5AMSA 2B5LA 3DWLC 3IKOA 5IC7A 3I2NA 3SVWD 5IT9g 2P9KC 4A09B 2IUVA 3EI2B 5EALA 4GGAA 2O9KA 3IJ0A 3I7PA 5CYKB 2H9PA 2IUPA 5GSAA 4LG8A 2PM9B 4FAND 3JRPA 3AL8B 3BWSA 5EM2B 3JZNA 4GM9A 1JMZB 3PXSD 4A2MA 2PM7B 2Z2NA 3K27A 5AJAA 3RMZD 2PBIB 3V9FA 4L9OA 1N6EA 4X3EA 5IGOA 2HJBA 4QT8A 2HXCA 4O3TB 3I7NA 2I0SA 4A11A 2YBAA 3SLED 4J86A 4FA5D 5FKQA 5FA5B 5H14A 4JD2C 1A0RB 3I7OA 3EI2A 3RN1D 4PSWB 2CN2A 4CZXA 5JWZA 3I8CA 1B9XA 2YNPA 3PXTD 3N0EA 3OKWA 3RFHA 2H14A 4L3GD 2CE9A 2BBKH 2H9NA 4O9DA 4QQEA 3IJ1A 4ES0A 3SFZA 3ODTA 2PM9A 1QNIA 4CC9A 2UZYB 3UKRC 3V5WB 3MZLA 4FA1D 2J57G 4GQBB 1L0QA 4CZYA 4KFMB 1VYHC 2H6NA 4J73A 4CY3A 3MZKA 2I3SA 2HJ4A 2YMUA 5CXBB 1U4CA 4GGCA 1MDAH 2H9LA 2OVPB 4IMMA 3RFGA 3DM0A 3I89A 3FRXA 3C99A 2P9PC 4A2LA 2GNQA 4ERQA 3MKQA 1GG2B 4QL1A 4JSNC 4Y5RD 1N6DA 4JT5C 3UKUC 5I5MA 5IJ7E 4GQ1A 5TDHB 5IGQA 2HKMA 2P9IC 3F3PA 2OVRB 4I79A 3IJCA 3KRXB 5HE2B 3EI4B 4GMBA 4YVDA 5CXCA 1MG3A 4LGNA 3SN6B 3UVLA 3W15A 4ESGA 2P9SC 3NVQA 2AGZA 5THAA 5EM2A 2YNNA 5EAPA 2I3TA 2J56H 5HQGA 4EWRA 1R5MA 5EMKB 5KDOB 5GXHA 2GC7A 4PSXB 4CZVA 3C9CA 1MG2A 3GREA 4FWWA 3FGBA 2IUQA 1P22A 5FKTA 1GP2B 3JAMg 4CY5A 1GXRA 5HE3B 3EI1A 5GXIA 4OWRA 3SHFA 1OLZA 2EBSA 4NSXA 3PVWB 1PI6A 5HE1B 5FLXg 1U2VC 3DXMC 2CNXA 2MTAH 2GC4A 4G56B 4IA9A 4A0AB 4U7AA 4LG9A 5C2WB 4J8GA 4K3ID 2IWKA 3VGZA 3RRMC 2B5NA 2P9LC 1RI6A 4E5ZB 3JB9L 4D6VA 5EMJB 5CXCB 5H17A 1PBYB 4OZUA 3PSCB 4AOWA 4ERYA 1YFQA 3F3FA 1XKSA 2G99A 4ZOYA 3RLMD 3RN0D 5K1CC 2H13A 3J81g 2CE8A 1SHYB 1SQJA 3C5MA 4QRJA 2P9NC 3JROA 3V7DB 2BCJB 5A2Qg 2YNOA 4FAVD 4FHLA 2CN3A 2B4EA 4J84A 3KRWB 3EU7A 4U1EI 4J87A 4CI1A 1NR0A 4ZOZA 4XYHA 1Q47A 3UVKA 1SQ9A 1JOFA 2OK6A 2TRCB 5C9ZB 4TZ4A 3VH0A 2XYIA 1XHMA 2Q7QA 3SBQA 3MKSB 4PNKB 3PVUB 2H6QA 2HKRA 4J77A 4H5IA 3ZWLB 1JJUB 4A7JA 4E54B 5EAMA 4J78A 3SBRA 5TEFA 4A0BA 3JZGA 2OJYA 3IIWA 4ZOXA 4XEIC 1B9YA 2UZXB 5IJ8E 5H1MA 2Z2OA 4JSPC 4FA4D 3UR4A 2CO0A 3ULEC 2IWFA 4GZ8A 3RSEC 3GFCA 3UVNA 2HESX 1XIPA 3OKYA 5I5JA 4UI9R 2G9AA 2H3XA 2CO0C 2AGYA 4PC0A 4HDJA 2AGXA 3AH8B 3MXXA 1FWXA 1NEXB 3I7HA 4BL0A 3DSMA
chains in the Genus database with same CATH superfamily
4NC4A 4ZN4A 4A0BB 3ZDXA 1M1XA 3C75H 4E54A 4GM8A 5TEEA 1TYQC 4NBMA 3A0FA 4GM3A 2AGWA 4X63B 3SWSD 3PE7A 5M5TA 2QC5A 2YB8B 1TBGA 4BUJC 2AGLA 3ORVD 1K8KC 2HU7A 3I8EA 3O4IA 4E5ZA 1ERJA 3K26A 3OKTA 5EARA 1QFSA 2Z2PA 4K3JB 2H6KA 3SBPA 4CI3A 4BCCA 4A11B 4AEZA 4J8BA 1VE6A 4CI2A 4R7AB 4DNUA 2H9MA 1VE7A 3IUNA 2XL3A 4A09A 1S4UX 3F3GA 5CYKA 5C2VB 4AMZA 5GMKn 1E8NA 1JMXB 4J0XA 2VZ1A 3SMRA 4GQ2P 2OIZA 3I7KA 3GD1I 3J80g 4N14A 3ZE0A 4BP8A 2I0TA 3AFCA 4MK0B 2VDOA 3AL8A 3SJLD 4A0AA 3ZE2A 4BCBA 4O2WA 3CFSB 4FB1D 3I7LA 3V4VA 3OW8A 4CY1A 3VA6A 5SXMA 1PEVA 3E0CA 3IVMA 4WK0A 3AL9A 4DNWA 3EWEA 1GOHA 4Y7RA 3B7FA 4J79A 5TF2A 1PGUA 5HDBA 3EI3A 3P4FA 3V4PA 3JZHA 2IURA 4JXMA 4JSXC 5FQDA 4O45A 4Z7QA 3OL2A 3IIYA 2XL2A 2I0RA 3DXKC 4ERZA 2B5MA 5HYNB 4BCDA 3EI1B 4CY2A 3GC3B 2IAAA 4PBZA 3SCYA 2AQ5A 5I5IA 3N0DA 3SXTD 4JSVC 3CFVA 5AFU3 4A08B 5K19A 4L3HD 1GOFA 5FKRA 1K32A 4L1MA 2J55H 3U4YA 3EMHA 2XE4A 2OVQB 5EMLB 4UM8A 4J0WA 2P9UC 5EMMB 4A08A 3L4MD 4J81A 3MMYA 4J82A 1OMWB 4O3UB 2W18A 4PXWA 4FA9D 3EI4A 3T3MA 4GGDA 4X61B 3PXWD 4Z8LA 3CIKB 4MMZA 1O6GA 3FM0A 4D0KA 4BH6A 2AH1A 2OK4A 3L4OD 3OL2B 3IUQA 4CI8A 4RE6A 4O1QD 3UVOA 1N6FA 1U8CA 1UOPA 2XU7A 2PM6B 3OTTA 3UVMA 4H5JA 3EI3B 3JPXA 4ZOVA 1T2XA 3BG1A 1GOTB 5B4WA 2QXVA 3NVNA 5FKSA 3OKYB 4JT6C 2H68A 2AH0A 3HFQA 2H47A 3BG0A 3NVXA 4QAMA 5FXYA 3K72A 3EG6A 4X60B 3PSLA 4XYIA 5CXBA 5HE0B 2VDNA 4L1QD 2HYEA 2QR5A 4PBYA 4MMXA 2VDRA 5AMSA 2B5LA 3DWLC 3IKOA 5IC7A 3I2NA 3IUJA 3SVWD 5IT9g 2P9KC 4A09B 2IUVA 3EI2B 5EALA 4GGAA 2O9KA 3IJ0A 3I7PA 5CYKB 5FFOA 2H9PA 2IUPA 2HU5A 5GSAA 4LG8A 4Z7NA 2VDKA 4AMYA 2PM9B 1JTDB 4FAND 3JRPA 5E6SA 3AL8B 3BWSA 5EM2B 3O4HA 3JZNA 1I2MB 4GM9A 1JMZB 3PXSD 5M5RA 4A2MA 2PM7B 2Z2NA 1JV2A 3K27A 5AJAA 3RMZD 2PBIB 3V9FA 4L9OA 1N6EA 4X3EA 5IGOA 5M5SA 2HJBA 4QT8A 4O02A 2HXCA 4O3TB 3I7NA 2I0SA 4A11A 2YBAA 3SLED 4JHPC 2HU8A 4J86A 4FA5D 5FKQA 5FA5B 5H14A 4JD2C 4AN1A 1A0RB 3I7OA 3ZDYA 3EI2A 3RN1D 4PSWB 4D9SA 3DDUA 2CN2A 4CZXA 5JWZA 3I8CA 3PXTD 1B9XA 2YNPA 3N0EA 3OKWA 3RFHA 2H14A 2BKLA 3O4GA 4L3GD 2CE9A 2JKXA 2BBKH 2H9NA 4O9DA 4QQEA 3IJ1A 4ES0A 3SFZA 3ODTA 3OF7A 2PM9A 2WQ8A 1QNIA 3K6SA 4CC9A 2UZYB 3UKRC 5M5UA 3V5WB 2VDPA 3MZLA 3IJEA 4FA1D 2J57G 4GQBB 1L0QA 4CZYA 1TYEA 4KFMB 1VYHC 2H6NA 4J73A 4CY3A 2EIDA 3MZKA 2I3SA 2HJ4A 1H2WA 3VI4A 4WK2A 2XZGA 2VZ3A 3IUMA 2YMUA 5CXBB 4DNVA 1BPOA 1U4CA 4GGCA 1MDAH 1O6FA 2H9LA 2OVPB 4IMMA 3RFGA 3DM0A 3I89A 3FRXA 3C99A 2P9PC 3QI0A 4A2LA 2GNQA 4ERQA 3MKQA 1GG2B 2EIBA 4QL1A 4JSNC 4Y5RD 1N6DA 4JT5C 1A12A 3UKUC 5I5MA 1VZ2A 1VZ3A 5IJ7E 4GQ1A 5TDHB 3NIDA 1UOQA 5IGQA 2HKMA 2P9IC 2VDMA 3F3PA 2OVRB 4I79A 3IJCA 3KRXB 4Z7OA 4MMYA 3T3PA 5HE2B 3EI4B 4GMBA 4YVDA 5CXCA 1MG3A 4LGNA 1UTCA 1UOOA 3SN6B 3UVLA 4G1MA 3W15A 4ESGA 2P9SC 3NVQA 2AGZA 1K3IA 5THAA 1H2YA 5EM2A 2YNNA 5EAPA 2I3TA 2J56H 5HQGA 4EWRA 1R5MA 5EMKB 1H2XA 5KDOB 5GXHA 4JHNA 2GC7A 4PSXB 4CZVA 3C9CA 1MG2A 3GREA 4FWWA 3FGBA 5FFGA 3FCSA 2IUQA 1P22A 1GOGA 1GP2B 5FKTA 3EQ9A 3JAMg 4CY5A 1GXRA 5E6RA 1L5GA 2EICA 5HE3B 3EI1A 5GXIA 4BP9A 4OWRA 3SHFA 1OLZA 2EBSA 4NSXA 3O4JA 3PVWB 3EQ8A 1PI6A 3FCUA 4RE5A 5HE1B 5FLXg 1U2VC 3K71A 3DXMC 2CNXA 2MTAH 2GC4A 3QHYB 4G56B 4IA9A 4A0AB 4U7AA 4LG9A 5C2WB 5C86A 4J8GA 4K3ID 2IWKA 3VGZA 3RRMC 2B5NA 3VI3A 2P9LC 1RI6A 4E5ZB 3MUNA 3JB9L 4D6VA 5C92A 5EMJB 5CXCB 5H17A 1PBYB 4OZUA 5M61A 3PSCB 4AOWA 4ERYA 1YFQA 3F3FA 1XKSA 2VC2A 2G99A 2VDLA 4ZOYA 3RLMD 2EIEA 4IRZA 3MUOA 5K1CC 2H13A 3RN0D 3J81g 5M5VA 2CE8A 1SHYB 1SQJA 3C5MA 4QRJA 1C9IA 2P9NC 3JROA 3V7DB 2BCJB 5A2Qg 2YNOA 3ZE1A 4FAVD 4FHLA 2CN3A 2B4EA 4J84A 3KRWB 3EU7A 4U1EI 4J87A 4CI1A 3NIFA 1NR0A 4ZOZA 4XYHA 4AN0A 1Q47A 3IURA 3UVKA 5E6UA 1SQ9A 1JOFA 2OK6A 2TRCB 5C9ZB 3ZDZA 4TZ4A 4UM9A 3VH0A 3MVDK 3EQ7A 2XYIA 1XHMA 2Q7QA 3SBQA 3MKSB 4PNKB 3PVUB 2H6QA 2HKRA 4J77A 4H5IA 3ZWLB 1JJUB 4A7JA 4E54B 5EAMA 4J78A 3SBRA 5TEFA 3IULA 4A0BA 3JZGA 2OJYA 4G1EA 2QZPA 3IIWA 4ZOXA 4XEIC 1B9YA 1E8MA 2UZXB 5IJ8E 1E5TA 5H1MA 1QFMA 2Z2OA 4JSPC 4FA4D 3UR4A 2CO0A 3ULEC 2XDWA 4WJKA 4NENA 1C9LA 2IWFA 3NIGA 4GZ8A 1YR2A 4AX4A 3RSEC 3GFCA 3KCIA 3UVNA 2HESX 1XIPA 3OKYA 4WK4A 2VDQA 5I5JA 4UI9R 2G9AA 4G55A 2H3XA 2CO0C 2AGYA 4PC0A 4HDJA 1H2ZA 2AGXA 4NAAA 3AH8B 3MXXA 1FWXA 1NEXB 3I7HA 4BL0A 3DSMA
chains in the Genus database with same CATH topology
4ZN4A 4A0BB 3C75H 4E54A 4GM8A 5TEEA 1TYQC 3A0FA 4GM3A 2AGWA 4X63B 3SWSD 3PE7A 2QC5A 2YB8B 1TBGA 4BUJC 2AGLA 3ORVD 1K8KC 3I8EA 4E5ZA 1ERJA 3K26A 3OKTA 5EARA 2Z2PA 4K3JB 2H6KA 3SBPA 4CI3A 4A11B 4AEZA 4J8BA 4CI2A 4R7AB 2H9MA 2XL3A 4A09A 1S4UX 3F3GA 5CYKA 5C2VB 5GMKn 1JMXB 4J0XA 3SMRA 4GQ2P 2OIZA 3I7KA 3J80g 4N14A 2I0TA 3AFCA 4MK0B 3AL8A 3SJLD 4A0AA 3CFSB 4FB1D 3I7LA 3OW8A 4CY1A 3VA6A 5SXMA 1PEVA 3E0CA 3AL9A 3EWEA 4Y7RA 5TF2A 3B7FA 4J79A 1PGUA 3EI3A 3P4FA 3JZHA 2IURA 4JXMA 4JSXC 5FQDA 4O45A 3OL2A 3IIYA 2XL2A 2I0RA 3DXKC 4ERZA 2B5MA 5HYNB 3EI1B 4CY2A 2IAAA 4PBZA 3SCYA 2AQ5A 5I5IA 3N0DA 3SXTD 4JSVC 3CFVA 5AFU3 4A08B 5K19A 4L3HD 5FKRA 1K32A 2J55H 3U4YA 3EMHA 2OVQB 5EMLB 4J0WA 2P9UC 5EMMB 4A08A 3L4MD 4J81A 3MMYA 4J82A 4O3UB 1OMWB 2W18A 4PXWA 4FA9D 3EI4A 4GGDA 4X61B 3PXWD 4Z8LA 3CIKB 3FM0A 4D0KA 4BH6A 2AH1A 2OK4A 3L4OD 3OL2B 4CI8A 4O1QD 3UVOA 1N6FA 2XU7A 2PM6B 3OTTA 3UVMA 4H5JA 3EI3B 3JPXA 4ZOVA 3BG1A 1GOTB 5B4WA 2QXVA 3NVNA 5FKSA 3OKYB 4JT6C 2H68A 2AH0A 3HFQA 2H47A 3BG0A 3NVXA 5FXYA 4X60B 3EG6A 4XYIA 3PSLA 5CXBA 5HE0B 4L1QD 2HYEA 4PBYA 5AMSA 2B5LA 3DWLC 3IKOA 5IC7A 3I2NA 3SVWD 5IT9g 2P9KC 4A09B 2IUVA 3EI2B 5EALA 4GGAA 2O9KA 3IJ0A 3I7PA 5CYKB 2H9PA 2IUPA 5GSAA 4LG8A 2PM9B 4FAND 3JRPA 3AL8B 3BWSA 5EM2B 3JZNA 4GM9A 1JMZB 3PXSD 4A2MA 2PM7B 2Z2NA 3K27A 5AJAA 3RMZD 2PBIB 3V9FA 4L9OA 1N6EA 4X3EA 5IGOA 2HJBA 4QT8A 2HXCA 4O3TB 3I7NA 2I0SA 4A11A 2YBAA 3SLED 4J86A 4FA5D 5FKQA 5FA5B 5H14A 4JD2C 1A0RB 3I7OA 3EI2A 3RN1D 4PSWB 2CN2A 4CZXA 5JWZA 3I8CA 1B9XA 2YNPA 3PXTD 3N0EA 3OKWA 3RFHA 2H14A 4L3GD 2CE9A 2BBKH 2H9NA 4O9DA 4QQEA 3IJ1A 4ES0A 3SFZA 3ODTA 2PM9A 1QNIA 4CC9A 2UZYB 3UKRC 3V5WB 3MZLA 4FA1D 2J57G 4GQBB 1L0QA 4CZYA 4KFMB 1VYHC 2H6NA 4J73A 4CY3A 3MZKA 2I3SA 2HJ4A 2YMUA 5CXBB 1U4CA 4GGCA 1MDAH 2H9LA 2OVPB 4IMMA 3RFGA 3DM0A 3I89A 3FRXA 3C99A 2P9PC 4A2LA 2GNQA 4ERQA 3MKQA 1GG2B 4QL1A 4JSNC 4Y5RD 1N6DA 4JT5C 3UKUC 5I5MA 5IJ7E 4GQ1A 5TDHB 5IGQA 2HKMA 2P9IC 3F3PA 2OVRB 4I79A 3IJCA 3KRXB 5HE2B 3EI4B 4GMBA 4YVDA 5CXCA 1MG3A 4LGNA 3SN6B 3UVLA 3W15A 4ESGA 2P9SC 3NVQA 2AGZA 5THAA 5EM2A 2YNNA 5EAPA 2I3TA 2J56H 5HQGA 4EWRA 1R5MA 5EMKB 5KDOB 5GXHA 2GC7A 4PSXB 4CZVA 3C9CA 1MG2A 3GREA 4FWWA 3FGBA 2IUQA 1P22A 5FKTA 1GP2B 3JAMg 4CY5A 1GXRA 5HE3B 3EI1A 5GXIA 4OWRA 3SHFA 1OLZA 2EBSA 4NSXA 3PVWB 1PI6A 5HE1B 5FLXg 1U2VC 3DXMC 2CNXA 2MTAH 2GC4A 4G56B 4IA9A 4A0AB 4U7AA 4LG9A 5C2WB 4J8GA 4K3ID 2IWKA 3VGZA 3RRMC 2B5NA 2P9LC 1RI6A 4E5ZB 3JB9L 4D6VA 5EMJB 5CXCB 5H17A 1PBYB 4OZUA 3PSCB 4AOWA 4ERYA 1YFQA 3F3FA 1XKSA 2G99A 4ZOYA 3RLMD 3RN0D 5K1CC 2H13A 3J81g 2CE8A 1SHYB 1SQJA 3C5MA 4QRJA 2P9NC 3JROA 3V7DB 2BCJB 5A2Qg 2YNOA 4FAVD 4FHLA 2CN3A 2B4EA 4J84A 3KRWB 3EU7A 4U1EI 4J87A 4CI1A 1NR0A 4ZOZA 4XYHA 1Q47A 3UVKA 1SQ9A 1JOFA 2OK6A 2TRCB 5C9ZB 4TZ4A 3VH0A 2XYIA 1XHMA 2Q7QA 3SBQA 3MKSB 4PNKB 3PVUB 2H6QA 2HKRA 4J77A 4H5IA 3ZWLB 1JJUB 4A7JA 4E54B 5EAMA 4J78A 3SBRA 5TEFA 4A0BA 3JZGA 2OJYA 3IIWA 4ZOXA 4XEIC 1B9YA 2UZXB 5IJ8E 5H1MA 2Z2OA 4JSPC 4FA4D 3UR4A 2CO0A 3ULEC 2IWFA 4GZ8A 3RSEC 3GFCA 3UVNA 2HESX 1XIPA 3OKYA 5I5JA 4UI9R 2G9AA 2H3XA 2CO0C 2AGYA 4PC0A 4HDJA 2AGXA 3AH8B 3MXXA 1FWXA 1NEXB 3I7HA 4BL0A 3DSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZN4 A;  4A0B B;  3C75 H;  4E54 A;  4GM8 A;  5TEE A;  1TYQ C;  3A0F A;  4GM3 A;  2AGW A;  4X63 B;  3SWS D;  3PE7 A;  2QC5 A;  2YB8 B;  1TBG A;  4BUJ C;  2AGL A;  3ORV D;  1K8K C;  3I8E A;  4E5Z A;  1ERJ A;  3K26 A;  3OKT A;  5EAR A;  2Z2P A;  4K3J B;  2H6K A;  3SBP A;  4CI3 A;  4A11 B;  4AEZ A;  4J8B A;  4CI2 A;  4R7A B;  2H9M A;  2XL3 A;  4A09 A;  1S4U X;  3F3G A;  5CYK A;  5C2V B;  5GMK n;  1JMX B;  4J0X A;  3SMR A;  4GQ2 P;  2OIZ A;  3I7K A;  3J80 g;  4N14 A;  2I0T A;  3AFC A;  4MK0 B;  3AL8 A;  3SJL D;  4A0A A;  3CFS B;  4FB1 D;  3I7L A;  3OW8 A;  4CY1 A;  3VA6 A;  5SXM A;  1PEV A;  3E0C A;  3AL9 A;  3EWE A;  4Y7R A;  5TF2 A;  3B7F A;  4J79 A;  1PGU A;  3EI3 A;  3P4F A;  3JZH A;  2IUR A;  4JXM A;  4JSX C;  5FQD A;  4O45 A;  3OL2 A;  3IIY A;  2XL2 A;  2I0R A;  3DXK C;  4ERZ A;  2B5M A;  5HYN B;  3EI1 B;  4CY2 A;  2IAA A;  4PBZ A;  3SCY A;  2AQ5 A;  5I5I A;  3N0D A;  3SXT D;  4JSV C;  3CFV A;  5AFU 3;  4A08 B;  5K19 A;  4L3H D;  5FKR A;  1K32 A;  2J55 H;  3U4Y A;  3EMH A;  2OVQ B;  5EML B;  4J0W A;  2P9U C;  5EMM B;  4A08 A;  3L4M D;  4J81 A;  3MMY A;  4J82 A;  4O3U B;  1OMW B;  2W18 A;  4PXW A;  4FA9 D;  3EI4 A;  4GGD A;  4X61 B;  3PXW D;  4Z8L A;  3CIK B;  3FM0 A;  4D0K A;  4BH6 A;  2AH1 A;  2OK4 A;  3L4O D;  3OL2 B;  4CI8 A;  4O1Q D;  3UVO A;  1N6F A;  2XU7 A;  2PM6 B;  3OTT A;  3UVM A;  4H5J A;  3EI3 B;  3JPX A;  4ZOV A;  3BG1 A;  1GOT B;  5B4W A;  2QXV A;  3NVN A;  5FKS A;  3OKY B;  4JT6 C;  2H68 A;  2AH0 A;  3HFQ A;  2H47 A;  3BG0 A;  3NVX A;  5FXY A;  4X60 B;  3EG6 A;  4XYI A;  3PSL A;  5CXB A;  5HE0 B;  4L1Q D;  2HYE A;  4PBY A;  5AMS A;  2B5L A;  3DWL C;  3IKO A;  5IC7 A;  3I2N A;  3SVW D;  5IT9 g;  2P9K C;  4A09 B;  2IUV A;  3EI2 B;  5EAL A;  4GGA A;  2O9K A;  3IJ0 A;  3I7P A;  5CYK B;  2H9P A;  2IUP A;  5GSA A;  4LG8 A;  2PM9 B;  4FAN D;  3JRP A;  3AL8 B;  3BWS A;  5EM2 B;  3JZN A;  4GM9 A;  1JMZ B;  3PXS D;  4A2M A;  2PM7 B;  2Z2N A;  3K27 A;  5AJA A;  3RMZ D;  2PBI B;  3V9F A;  4L9O A;  1N6E A;  4X3E A;  5IGO A;  2HJB A;  4QT8 A;  2HXC A;  4O3T B;  3I7N A;  2I0S A;  4A11 A;  2YBA A;  3SLE D;  4J86 A;  4FA5 D;  5FKQ A;  5FA5 B;  5H14 A;  4JD2 C;  1A0R B;  3I7O A;  3EI2 A;  3RN1 D;  4PSW B;  2CN2 A;  4CZX A;  5JWZ A;  3I8C A;  1B9X A;  2YNP A;  3PXT D;  3N0E A;  3OKW A;  3RFH A;  2H14 A;  4L3G D;  2CE9 A;  2BBK H;  2H9N A;  4O9D A;  4QQE A;  3IJ1 A;  4ES0 A;  3SFZ A;  3ODT A;  2PM9 A;  1QNI A;  4CC9 A;  2UZY B;  3UKR C;  3V5W B;  3MZL A;  4FA1 D;  2J57 G;  4GQB B;  1L0Q A;  4CZY A;  4KFM B;  1VYH C;  2H6N A;  4J73 A;  4CY3 A;  3MZK A;  2I3S A;  2HJ4 A;  2YMU A;  5CXB B;  1U4C A;  4GGC A;  1MDA H;  2H9L A;  2OVP B;  4IMM A;  3RFG A;  3DM0 A;  3I89 A;  3FRX A;  3C99 A;  2P9P C;  4A2L A;  2GNQ A;  4ERQ A;  3MKQ A;  1GG2 B;  4QL1 A;  4JSN C;  4Y5R D;  1N6D A;  4JT5 C;  3UKU C;  5I5M A;  5IJ7 E;  4GQ1 A;  5TDH B;  5IGQ A;  2HKM A;  2P9I C;  3F3P A;  2OVR B;  4I79 A;  3IJC A;  3KRX B;  5HE2 B;  3EI4 B;  4GMB A;  4YVD A;  5CXC A;  1MG3 A;  4LGN A;  3SN6 B;  3UVL A;  3W15 A;  4ESG A;  2P9S C;  3NVQ A;  2AGZ A;  5THA A;  5EM2 A;  2YNN A;  5EAP A;  2I3T A;  2J56 H;  5HQG A;  4EWR A;  1R5M A;  5EMK B;  5KDO B;  5GXH A;  2GC7 A;  4PSX B;  4CZV A;  3C9C A;  1MG2 A;  3GRE A;  4FWW A;  3FGB A;  2IUQ A;  1P22 A;  5FKT A;  1GP2 B;  3JAM g;  4CY5 A;  1GXR A;  5HE3 B;  3EI1 A;  5GXI A;  4OWR A;  3SHF A;  1OLZ A;  2EBS A;  4NSX A;  3PVW B;  1PI6 A;  5HE1 B;  5FLX g;  1U2V C;  3DXM C;  2CNX A;  2MTA H;  2GC4 A;  4G56 B;  4IA9 A;  4A0A B;  4U7A A;  4LG9 A;  5C2W B;  4J8G A;  4K3I D;  2IWK A;  3VGZ A;  3RRM C;  2B5N A;  2P9L C;  1RI6 A;  4E5Z B;  3JB9 L;  4D6V A;  5EMJ B;  5CXC B;  5H17 A;  1PBY B;  4OZU A;  3PSC B;  4AOW A;  4ERY A;  1YFQ A;  3F3F A;  1XKS A;  2G99 A;  4ZOY A;  3RLM D;  3RN0 D;  5K1C C;  2H13 A;  3J81 g;  2CE8 A;  1SHY B;  1SQJ A;  3C5M A;  4QRJ A;  2P9N C;  3JRO A;  3V7D B;  2BCJ B;  5A2Q g;  2YNO A;  4FAV D;  4FHL A;  2CN3 A;  2B4E A;  4J84 A;  3KRW B;  3EU7 A;  4U1E I;  4J87 A;  4CI1 A;  1NR0 A;  4ZOZ A;  4XYH A;  1Q47 A;  3UVK A;  1SQ9 A;  1JOF A;  2OK6 A;  2TRC B;  5C9Z B;  4TZ4 A;  3VH0 A;  2XYI A;  1XHM A;  2Q7Q A;  3SBQ A;  3MKS B;  4PNK B;  3PVU B;  2H6Q A;  2HKR A;  4J77 A;  4H5I A;  3ZWL B;  1JJU B;  4A7J A;  4E54 B;  5EAM A;  4J78 A;  3SBR A;  5TEF A;  4A0B A;  3JZG A;  2OJY A;  3IIW A;  4ZOX A;  4XEI C;  1B9Y A;  2UZX B;  5IJ8 E;  5H1M A;  2Z2O A;  4JSP C;  4FA4 D;  3UR4 A;  2CO0 A;  3ULE C;  2IWF A;  4GZ8 A;  3RSE C;  3GFC A;  3UVN A;  2HES X;  1XIP A;  3OKY A;  5I5J A;  4UI9 R;  2G9A A;  2H3X A;  2CO0 C;  2AGY A;  4PC0 A;  4HDJ A;  2AGX A;  3AH8 B;  3MXX A;  1FWX A;  1NEX B;  3I7H A;  4BL0 A;  3DSM A; 
#chains in the Genus database with same CATH topology
 4NC4 A;  4ZN4 A;  4A0B B;  3ZDX A;  1M1X A;  3C75 H;  4E54 A;  4GM8 A;  5TEE A;  1TYQ C;  4NBM A;  3A0F A;  4GM3 A;  2AGW A;  4X63 B;  3SWS D;  3PE7 A;  5M5T A;  2QC5 A;  2YB8 B;  1TBG A;  4BUJ C;  2AGL A;  3ORV D;  1K8K C;  2HU7 A;  3I8E A;  3O4I A;  4E5Z A;  1ERJ A;  3K26 A;  3OKT A;  5EAR A;  1QFS A;  2Z2P A;  4K3J B;  2H6K A;  3SBP A;  4CI3 A;  4BCC A;  4A11 B;  4AEZ A;  4J8B A;  1VE6 A;  4CI2 A;  4R7A B;  4DNU A;  2H9M A;  1VE7 A;  3IUN A;  2XL3 A;  4A09 A;  1S4U X;  3F3G A;  5CYK A;  5C2V B;  4AMZ A;  5GMK n;  1E8N A;  1JMX B;  4J0X A;  2VZ1 A;  3SMR A;  4GQ2 P;  2OIZ A;  3I7K A;  3GD1 I;  3J80 g;  4N14 A;  3ZE0 A;  4BP8 A;  2I0T A;  3AFC A;  4MK0 B;  2VDO A;  3AL8 A;  3SJL D;  4A0A A;  3ZE2 A;  4BCB A;  4O2W A;  3CFS B;  4FB1 D;  3I7L A;  3V4V A;  3OW8 A;  4CY1 A;  3VA6 A;  5SXM A;  1PEV A;  3E0C A;  3IVM A;  4WK0 A;  3AL9 A;  4DNW A;  3EWE A;  1GOH A;  4Y7R A;  3B7F A;  4J79 A;  5TF2 A;  1PGU A;  5HDB A;  3EI3 A;  3P4F A;  3V4P A;  3JZH A;  2IUR A;  4JXM A;  4JSX C;  5FQD A;  4O45 A;  4Z7Q A;  3OL2 A;  3IIY A;  2XL2 A;  2I0R A;  3DXK C;  4ERZ A;  2B5M A;  5HYN B;  4BCD A;  3EI1 B;  4CY2 A;  3GC3 B;  2IAA A;  4PBZ A;  3SCY A;  2AQ5 A;  5I5I A;  3N0D A;  3SXT D;  4JSV C;  3CFV A;  5AFU 3;  4A08 B;  5K19 A;  4L3H D;  1GOF A;  5FKR A;  1K32 A;  4L1M A;  2J55 H;  3U4Y A;  3EMH A;  2XE4 A;  2OVQ B;  5EML B;  4UM8 A;  4J0W A;  2P9U C;  5EMM B;  4A08 A;  3L4M D;  4J81 A;  3MMY A;  4J82 A;  1OMW B;  4O3U B;  2W18 A;  4PXW A;  4FA9 D;  3EI4 A;  3T3M A;  4GGD A;  4X61 B;  3PXW D;  4Z8L A;  3CIK B;  4MMZ A;  1O6G A;  3FM0 A;  4D0K A;  4BH6 A;  2AH1 A;  2OK4 A;  3L4O D;  3OL2 B;  3IUQ A;  4CI8 A;  4RE6 A;  4O1Q D;  3UVO A;  1N6F A;  1U8C A;  1UOP A;  2XU7 A;  2PM6 B;  3OTT A;  3UVM A;  4H5J A;  3EI3 B;  3JPX A;  4ZOV A;  1T2X A;  3BG1 A;  1GOT B;  5B4W A;  2QXV A;  3NVN A;  5FKS A;  3OKY B;  4JT6 C;  2H68 A;  2AH0 A;  3HFQ A;  2H47 A;  3BG0 A;  3NVX A;  4QAM A;  5FXY A;  3K72 A;  3EG6 A;  4X60 B;  3PSL A;  4XYI A;  5CXB A;  5HE0 B;  2VDN A;  4L1Q D;  2HYE A;  2QR5 A;  4PBY A;  4MMX A;  2VDR A;  5AMS A;  2B5L A;  3DWL C;  3IKO A;  5IC7 A;  3I2N A;  3IUJ A;  3SVW D;  5IT9 g;  2P9K C;  4A09 B;  2IUV A;  3EI2 B;  5EAL A;  4GGA A;  2O9K A;  3IJ0 A;  3I7P A;  5CYK B;  5FFO A;  2H9P A;  2IUP A;  2HU5 A;  5GSA A;  4LG8 A;  4Z7N A;  2VDK A;  4AMY A;  2PM9 B;  1JTD B;  4FAN D;  3JRP A;  5E6S A;  3AL8 B;  3BWS A;  5EM2 B;  3O4H A;  3JZN A;  1I2M B;  4GM9 A;  1JMZ B;  3PXS D;  5M5R A;  4A2M A;  2PM7 B;  2Z2N A;  1JV2 A;  3K27 A;  5AJA A;  3RMZ D;  2PBI B;  3V9F A;  4L9O A;  1N6E A;  4X3E A;  5IGO A;  5M5S A;  2HJB A;  4QT8 A;  4O02 A;  2HXC A;  4O3T B;  3I7N A;  2I0S A;  4A11 A;  2YBA A;  3SLE D;  4JHP C;  2HU8 A;  4J86 A;  4FA5 D;  5FKQ A;  5FA5 B;  5H14 A;  4JD2 C;  4AN1 A;  1A0R B;  3I7O A;  3ZDY A;  3EI2 A;  3RN1 D;  4PSW B;  4D9S A;  3DDU A;  2CN2 A;  4CZX A;  5JWZ A;  3I8C A;  3PXT D;  1B9X A;  2YNP A;  3N0E A;  3OKW A;  3RFH A;  2H14 A;  2BKL A;  3O4G A;  4L3G D;  2CE9 A;  2JKX A;  2BBK H;  2H9N A;  4O9D A;  4QQE A;  3IJ1 A;  4ES0 A;  3SFZ A;  3ODT A;  3OF7 A;  2PM9 A;  2WQ8 A;  1QNI A;  3K6S A;  4CC9 A;  2UZY B;  3UKR C;  5M5U A;  3V5W B;  2VDP A;  3MZL A;  3IJE A;  4FA1 D;  2J57 G;  4GQB B;  1L0Q A;  4CZY A;  1TYE A;  4KFM B;  1VYH C;  2H6N A;  4J73 A;  4CY3 A;  2EID A;  3MZK A;  2I3S A;  2HJ4 A;  1H2W A;  3VI4 A;  4WK2 A;  2XZG A;  2VZ3 A;  3IUM A;  2YMU A;  5CXB B;  4DNV A;  1BPO A;  1U4C A;  4GGC A;  1MDA H;  1O6F A;  2H9L A;  2OVP B;  4IMM A;  3RFG A;  3DM0 A;  3I89 A;  3FRX A;  3C99 A;  2P9P C;  3QI0 A;  4A2L A;  2GNQ A;  4ERQ A;  3MKQ A;  1GG2 B;  2EIB A;  4QL1 A;  4JSN C;  4Y5R D;  1N6D A;  4JT5 C;  1A12 A;  3UKU C;  5I5M A;  1VZ2 A;  1VZ3 A;  5IJ7 E;  4GQ1 A;  5TDH B;  3NID A;  1UOQ A;  5IGQ A;  2HKM A;  2P9I C;  2VDM A;  3F3P A;  2OVR B;  4I79 A;  3IJC A;  3KRX B;  4Z7O A;  4MMY A;  3T3P A;  5HE2 B;  3EI4 B;  4GMB A;  4YVD A;  5CXC A;  1MG3 A;  4LGN A;  1UTC A;  1UOO A;  3SN6 B;  3UVL A;  4G1M A;  3W15 A;  4ESG A;  2P9S C;  3NVQ A;  2AGZ A;  1K3I A;  5THA A;  1H2Y A;  5EM2 A;  2YNN A;  5EAP A;  2I3T A;  2J56 H;  5HQG A;  4EWR A;  1R5M A;  5EMK B;  1H2X A;  5KDO B;  5GXH A;  4JHN A;  2GC7 A;  4PSX B;  4CZV A;  3C9C A;  1MG2 A;  3GRE A;  4FWW A;  3FGB A;  5FFG A;  3FCS A;  2IUQ A;  1P22 A;  1GOG A;  1GP2 B;  5FKT A;  3EQ9 A;  3JAM g;  4CY5 A;  1GXR A;  5E6R A;  1L5G A;  2EIC A;  5HE3 B;  3EI1 A;  5GXI A;  4BP9 A;  4OWR A;  3SHF A;  1OLZ A;  2EBS A;  4NSX A;  3O4J A;  3PVW B;  3EQ8 A;  1PI6 A;  3FCU A;  4RE5 A;  5HE1 B;  5FLX g;  1U2V C;  3K71 A;  3DXM C;  2CNX A;  2MTA H;  2GC4 A;  3QHY B;  4G56 B;  4IA9 A;  4A0A B;  4U7A A;  4LG9 A;  5C2W B;  5C86 A;  4J8G A;  4K3I D;  2IWK A;  3VGZ A;  3RRM C;  2B5N A;  3VI3 A;  2P9L C;  1RI6 A;  4E5Z B;  3MUN A;  3JB9 L;  4D6V A;  5C92 A;  5EMJ B;  5CXC B;  5H17 A;  1PBY B;  4OZU A;  5M61 A;  3PSC B;  4AOW A;  4ERY A;  1YFQ A;  3F3F A;  1XKS A;  2VC2 A;  2G99 A;  2VDL A;  4ZOY A;  3RLM D;  2EIE A;  4IRZ A;  3MUO A;  5K1C C;  2H13 A;  3RN0 D;  3J81 g;  5M5V A;  2CE8 A;  1SHY B;  1SQJ A;  3C5M A;  4QRJ A;  1C9I A;  2P9N C;  3JRO A;  3V7D B;  2BCJ B;  5A2Q g;  2YNO A;  3ZE1 A;  4FAV D;  4FHL A;  2CN3 A;  2B4E A;  4J84 A;  3KRW B;  3EU7 A;  4U1E I;  4J87 A;  4CI1 A;  3NIF A;  1NR0 A;  4ZOZ A;  4XYH A;  4AN0 A;  1Q47 A;  3IUR A;  3UVK A;  5E6U A;  1SQ9 A;  1JOF A;  2OK6 A;  2TRC B;  5C9Z B;  3ZDZ A;  4TZ4 A;  4UM9 A;  3VH0 A;  3MVD K;  3EQ7 A;  2XYI A;  1XHM A;  2Q7Q A;  3SBQ A;  3MKS B;  4PNK B;  3PVU B;  2H6Q A;  2HKR A;  4J77 A;  4H5I A;  3ZWL B;  1JJU B;  4A7J A;  4E54 B;  5EAM A;  4J78 A;  3SBR A;  5TEF A;  3IUL A;  4A0B A;  3JZG A;  2OJY A;  4G1E A;  2QZP A;  3IIW A;  4ZOX A;  4XEI C;  1B9Y A;  1E8M A;  2UZX B;  5IJ8 E;  1E5T A;  5H1M A;  1QFM A;  2Z2O A;  4JSP C;  4FA4 D;  3UR4 A;  2CO0 A;  3ULE C;  2XDW A;  4WJK A;  4NEN A;  1C9L A;  2IWF A;  3NIG A;  4GZ8 A;  1YR2 A;  4AX4 A;  3RSE C;  3GFC A;  3KCI A;  3UVN A;  2HES X;  1XIP A;  3OKY A;  4WK4 A;  2VDQ A;  5I5J A;  4UI9 R;  2G9A A;  4G55 A;  2H3X A;  2CO0 C;  2AGY A;  4PC0 A;  4HDJ A;  1H2Z A;  2AGX A;  4NAA A;  3AH8 B;  3MXX A;  1FWX A;  1NEX B;  3I7H A;  4BL0 A;  3DSM A; 
#chains in the Genus database with same CATH homology
 4ZN4 A;  4A0B B;  3C75 H;  4E54 A;  4GM8 A;  5TEE A;  1TYQ C;  3A0F A;  4GM3 A;  2AGW A;  4X63 B;  3SWS D;  3PE7 A;  2QC5 A;  2YB8 B;  1TBG A;  4BUJ C;  2AGL A;  3ORV D;  1K8K C;  3I8E A;  4E5Z A;  1ERJ A;  3K26 A;  3OKT A;  5EAR A;  2Z2P A;  4K3J B;  2H6K A;  3SBP A;  4CI3 A;  4A11 B;  4AEZ A;  4J8B A;  4CI2 A;  4R7A B;  2H9M A;  2XL3 A;  4A09 A;  1S4U X;  3F3G A;  5CYK A;  5C2V B;  5GMK n;  1JMX B;  4J0X A;  3SMR A;  4GQ2 P;  2OIZ A;  3I7K A;  3J80 g;  4N14 A;  2I0T A;  3AFC A;  4MK0 B;  3AL8 A;  3SJL D;  4A0A A;  3CFS B;  4FB1 D;  3I7L A;  3OW8 A;  4CY1 A;  3VA6 A;  5SXM A;  1PEV A;  3E0C A;  3AL9 A;  3EWE A;  4Y7R A;  5TF2 A;  3B7F A;  4J79 A;  1PGU A;  3EI3 A;  3P4F A;  3JZH A;  2IUR A;  4JXM A;  4JSX C;  5FQD A;  4O45 A;  3OL2 A;  3IIY A;  2XL2 A;  2I0R A;  3DXK C;  4ERZ A;  2B5M A;  5HYN B;  3EI1 B;  4CY2 A;  2IAA A;  4PBZ A;  3SCY A;  2AQ5 A;  5I5I A;  3N0D A;  3SXT D;  4JSV C;  3CFV A;  5AFU 3;  4A08 B;  5K19 A;  4L3H D;  5FKR A;  1K32 A;  2J55 H;  3U4Y A;  3EMH A;  2OVQ B;  5EML B;  4J0W A;  2P9U C;  5EMM B;  4A08 A;  3L4M D;  4J81 A;  3MMY A;  4J82 A;  4O3U B;  1OMW B;  2W18 A;  4PXW A;  4FA9 D;  3EI4 A;  4GGD A;  4X61 B;  3PXW D;  4Z8L A;  3CIK B;  3FM0 A;  4D0K A;  4BH6 A;  2AH1 A;  2OK4 A;  3L4O D;  3OL2 B;  4CI8 A;  4O1Q D;  3UVO A;  1N6F A;  2XU7 A;  2PM6 B;  3OTT A;  3UVM A;  4H5J A;  3EI3 B;  3JPX A;  4ZOV A;  3BG1 A;  1GOT B;  5B4W A;  2QXV A;  3NVN A;  5FKS A;  3OKY B;  4JT6 C;  2H68 A;  2AH0 A;  3HFQ A;  2H47 A;  3BG0 A;  3NVX A;  5FXY A;  4X60 B;  3EG6 A;  4XYI A;  3PSL A;  5CXB A;  5HE0 B;  4L1Q D;  2HYE A;  4PBY A;  5AMS A;  2B5L A;  3DWL C;  3IKO A;  5IC7 A;  3I2N A;  3SVW D;  5IT9 g;  2P9K C;  4A09 B;  2IUV A;  3EI2 B;  5EAL A;  4GGA A;  2O9K A;  3IJ0 A;  3I7P A;  5CYK B;  2H9P A;  2IUP A;  5GSA A;  4LG8 A;  2PM9 B;  4FAN D;  3JRP A;  3AL8 B;  3BWS A;  5EM2 B;  3JZN A;  4GM9 A;  1JMZ B;  3PXS D;  4A2M A;  2PM7 B;  2Z2N A;  3K27 A;  5AJA A;  3RMZ D;  2PBI B;  3V9F A;  4L9O A;  1N6E A;  4X3E A;  5IGO A;  2HJB A;  4QT8 A;  2HXC A;  4O3T B;  3I7N A;  2I0S A;  4A11 A;  2YBA A;  3SLE D;  4J86 A;  4FA5 D;  5FKQ A;  5FA5 B;  5H14 A;  4JD2 C;  1A0R B;  3I7O A;  3EI2 A;  3RN1 D;  4PSW B;  2CN2 A;  4CZX A;  5JWZ A;  3I8C A;  1B9X A;  2YNP A;  3PXT D;  3N0E A;  3OKW A;  3RFH A;  2H14 A;  4L3G D;  2CE9 A;  2BBK H;  2H9N A;  4O9D A;  4QQE A;  3IJ1 A;  4ES0 A;  3SFZ A;  3ODT A;  2PM9 A;  1QNI A;  4CC9 A;  2UZY B;  3UKR C;  3V5W B;  3MZL A;  4FA1 D;  2J57 G;  4GQB B;  1L0Q A;  4CZY A;  4KFM B;  1VYH C;  2H6N A;  4J73 A;  4CY3 A;  3MZK A;  2I3S A;  2HJ4 A;  2YMU A;  5CXB B;  1U4C A;  4GGC A;  1MDA H;  2H9L A;  2OVP B;  4IMM A;  3RFG A;  3DM0 A;  3I89 A;  3FRX A;  3C99 A;  2P9P C;  4A2L A;  2GNQ A;  4ERQ A;  3MKQ A;  1GG2 B;  4QL1 A;  4JSN C;  4Y5R D;  1N6D A;  4JT5 C;  3UKU C;  5I5M A;  5IJ7 E;  4GQ1 A;  5TDH B;  5IGQ A;  2HKM A;  2P9I C;  3F3P A;  2OVR B;  4I79 A;  3IJC A;  3KRX B;  5HE2 B;  3EI4 B;  4GMB A;  4YVD A;  5CXC A;  1MG3 A;  4LGN A;  3SN6 B;  3UVL A;  3W15 A;  4ESG A;  2P9S C;  3NVQ A;  2AGZ A;  5THA A;  5EM2 A;  2YNN A;  5EAP A;  2I3T A;  2J56 H;  5HQG A;  4EWR A;  1R5M A;  5EMK B;  5KDO B;  5GXH A;  2GC7 A;  4PSX B;  4CZV A;  3C9C A;  1MG2 A;  3GRE A;  4FWW A;  3FGB A;  2IUQ A;  1P22 A;  5FKT A;  1GP2 B;  3JAM g;  4CY5 A;  1GXR A;  5HE3 B;  3EI1 A;  5GXI A;  4OWR A;  3SHF A;  1OLZ A;  2EBS A;  4NSX A;  3PVW B;  1PI6 A;  5HE1 B;  5FLX g;  1U2V C;  3DXM C;  2CNX A;  2MTA H;  2GC4 A;  4G56 B;  4IA9 A;  4A0A B;  4U7A A;  4LG9 A;  5C2W B;  4J8G A;  4K3I D;  2IWK A;  3VGZ A;  3RRM C;  2B5N A;  2P9L C;  1RI6 A;  4E5Z B;  3JB9 L;  4D6V A;  5EMJ B;  5CXC B;  5H17 A;  1PBY B;  4OZU A;  3PSC B;  4AOW A;  4ERY A;  1YFQ A;  3F3F A;  1XKS A;  2G99 A;  4ZOY A;  3RLM D;  3RN0 D;  5K1C C;  2H13 A;  3J81 g;  2CE8 A;  1SHY B;  1SQJ A;  3C5M A;  4QRJ A;  2P9N C;  3JRO A;  3V7D B;  2BCJ B;  5A2Q g;  2YNO A;  4FAV D;  4FHL A;  2CN3 A;  2B4E A;  4J84 A;  3KRW B;  3EU7 A;  4U1E I;  4J87 A;  4CI1 A;  1NR0 A;  4ZOZ A;  4XYH A;  1Q47 A;  3UVK A;  1SQ9 A;  1JOF A;  2OK6 A;  2TRC B;  5C9Z B;  4TZ4 A;  3VH0 A;  2XYI A;  1XHM A;  2Q7Q A;  3SBQ A;  3MKS B;  4PNK B;  3PVU B;  2H6Q A;  2HKR A;  4J77 A;  4H5I A;  3ZWL B;  1JJU B;  4A7J A;  4E54 B;  5EAM A;  4J78 A;  3SBR A;  5TEF A;  4A0B A;  3JZG A;  2OJY A;  3IIW A;  4ZOX A;  4XEI C;  1B9Y A;  2UZX B;  5IJ8 E;  5H1M A;  2Z2O A;  4JSP C;  4FA4 D;  3UR4 A;  2CO0 A;  3ULE C;  2IWF A;  4GZ8 A;  3RSE C;  3GFC A;  3UVN A;  2HES X;  1XIP A;  3OKY A;  5I5J A;  4UI9 R;  2G9A A;  2H3X A;  2CO0 C;  2AGY A;  4PC0 A;  4HDJ A;  2AGX A;  3AH8 B;  3MXX A;  1FWX A;  1NEX B;  3I7H A;  4BL0 A;  3DSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...