4O45A

Wdr5 in complex with influenza ns1 c-terminal tail
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
305
structure length
305
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna binding protein
molecule keywords WD repeat-containing protein 5
publication title Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4o45A00
1GXRA 2IWFA 3EWEA 4PC0A 3ODTA 5HE3B 3AFCA 3NVQA 4JT6C 2I0RA 4O3UB 3RRMC 5EMLB 4A0BB 2PM7B 2YBAA 3V9FA 2H13A 4GM8A 2AGWA 4H5JA 4QQEA 5C9ZB 5FA5B 2AGZA 3DSMA 1N6FA 3EU7A 2QXVA 3RN0D 4QL1A 2EBSA 4CY5A 3KRXB 3N0DA 4CI2A 4H5IA 1MDAH 4LGNA 2AH1A 2CE9A 4J73A 3SMRA 4JD2C 4AEZA 2HXCA 1Q47A 5GMKn 4BL0A 1FWXA 3BG1A 4R7AB 2P9IC 4L3HD 3L4OD 3SBRA 3SJLD 5C2WB 3F3FA 4ZOYA 3EMHA 4A0AB 3OL2B 2XYIA 3E0CA 3EI2B 3B7FA 4IA9A 3JAMg 4CI1A 2AGLA 3I7OA 4J86A 2H3XA 4E5ZB 2YB8B 4J0XA 3CFVA 4FWWA 5EALA 2AQ5A 4CC9A 5KDOB 3JZNA 4E54B 2OVQB 4A09A 2GC4A 1JJUB 5H17A 4ES0A 5AJAA 2PM9A 3L4MD 1K32A 4A2LA 4PSXB 1ERJA 4X63B 3SWSD 4NSXA 2HJ4A 3W15A 4GGDA 4OWRA 4O45A 2IUQA 3UKRC 5EMMB 4GGCA 3IJCA 2I0SA 2CNXA 4G56B 3EI4A 5A2Qg 3JZGA 5TF2A 1PEVA 5CXBB 3A0FA 4CI8A 5THAA 5CXCB 3PSCB 5EAMA 4FA4D 4PBZA 3SHFA 4J8BA 3RMZD 2H9PA 4BH6A 1S4UX 2P9KC 5I5JA 2BBKH 3V5WB 5TEFA 3EI3B 4JT5C 3AL9A 3RFHA 5JWZA 5GSAA 2H68A 3BWSA 1XIPA 3OKYA 4GM9A 3OTTA 4J78A 5EMKB 3MKQA 4AOWA 4JSVC 4L9OA 2AH0A 2CE8A 3F3GA 4CZXA 3OKTA 2B4EA 5IT9g 2IUVA 4GM3A 4L1QD 3EI1A 2GC7A 1PBYB 4BUJC 4YVDA 4J87A 4QT8A 2IWKA 4K3ID 5GXIA 5SXMA 3UR4A 2H9LA 3MZLA 5EM2A 3RN1D 4K3JB 1U4CA 2AGYA 3I7KA 1VYHC 4U1EI 3I7PA 2HESX 1GP2B 4J8GA 3MMYA 3K27A 2BCJB 4J77A 5FKSA 2I3TA 4A2MA 3JROA 2OK6A 2IAAA 1NR0A 1JMXB 3C5MA 3U4YA 2OIZA 1TBGA 2HKMA 4CZVA 1JMZB 1SQJA 4PBYA 2H47A 3I7LA 2Z2NA 3C9CA 4A08A 2IUPA 2G9AA 4A0BA 5FKRA 4FAND 2J57G 3RSEC 5FLXg 3J81g 3F3PA 4O9DA 4J81A 2P9LC 4MK0B 4O1QD 3AL8A 5IJ8E 1PGUA 5EARA 4J82A 5FXYA 4A09B 2J55H 3UVOA 4A11B 1L0QA 2HJBA 3OL2A 3EI2A 2P9UC 2CN3A 3FGBA 3JZHA 4E5ZA 1GG2B 4U7AA 4XYIA 2H6NA 2H14A 2IURA 3I7NA 4IMMA 4QRJA 3GFCA 5K1CC 3EI4B 3SVWD 3UVLA 3PVUB 5IJ7E 3NVNA 4CY2A 1NEXB 1N6DA 4J84A 5AMSA 3SLED 3IKOA 3ZWLB 2P9SC 1U2VC 5HYNB 4CZYA 5CYKA 3SN6B 1A0RB 2UZYB 3PXTD 1OLZA 4CI3A 1MG3A 3ORVD 2OJYA 2XL3A 4GGAA 5CXCA 3OKYB 3PSLA 5GXHA 4L3GD 3JB9L 4TZ4A 1R5MA 4ERQA 2YMUA 4PNKB 3SCYA 1PI6A 2YNPA 4ZN4A 3NVXA 2Z2OA 3EI3A 4ESGA 2QC5A 4JXMA 1XHMA 2OK4A 5AFU3 4JSXC 1XKSA 3P4FA 4Z8LA 2Z2PA 3KRWB 4O3TB 3IJ0A 5HE2B 1N6EA 5TEEA 3OW8A 5FKQA 3ULEC 2CN2A 5EM2B 4PSWB 3DXKC 4GMBA 2PM6B 4LG8A 2H6KA 2H9MA 3PVWB 3K26A 2OVPB 5EMJB 3CIKB 4FAVD 1SQ9A 4FB1D 4FA1D 3MZKA 4UI9R 1RI6A 4CY3A 4Y7RA 4XYHA 4A08B 4I79A 2B5NA 5I5MA 2UZXB 3C75H 4JSNC 3C99A 3VH0A 4X60B 3SFZA 4J79A 5I5IA 3EG6A 3I89A 2B5LA 4CY1A 5TDHB 3IIWA 4ZOXA 2MTAH 3I2NA 2Q7QA 1TYQC 5H1MA 4ERZA 3AL8B 2YNNA 2XU7A 4GQ2P 3BG0A 1QNIA 4FA9D 2GNQA 2PM9B 3MXXA 3PXSD 3UVMA 4HDJA 4JSPC 3UKUC 3DWLC 4A0AA 1K8KC 2HKRA 3AH8B 5H14A 4ZOZA 2G99A 4GZ8A 2CO0C 4E54A 3OKWA 3SXTD 3FRXA 5HE0B 3HFQA 3PE7A 4A11A 3I8EA 5IC7A 3J80g 4GQBB 3JRPA 3I8CA 2O9KA 3JPXA 2OVRB 4X61B 4OZUA 4FHLA 3IJ1A 3CFSB 5FQDA 4LG9A 5CYKB 4D0KA 5K19A 1OMWB 3DXMC 3UVNA 3GREA 5CXBA 3N0EA 1B9XA 3DM0A 4GQ1A 2P9PC 1MG2A 3IIYA 4XEIC 3MKSB 5FKTA 4ERYA 2TRCB 1YFQA 2H6QA 4A7JA 1B9YA 4EWRA 3I7HA 5C2VB 2CO0A 3PXWD 4J0WA 5EAPA 4Y5RD 5HE1B 1P22A 3SBQA 1JOFA 3EI1B 2AGXA 2XL2A 2P9NC 2H9NA 4KFMB 2W18A 2J56H 3VA6A 5IGQA 1GOTB 3V7DB 1SHYB 4FA5D 2HYEA 3UVKA 3RFGA 2YNOA 3VGZA 5B4WA 3FM0A 4N14A 3SBPA 4PXWA 2I3SA 4ZOVA 2I0TA 5IGOA 4D6VA 2PBIB 4X3EA 2B5MA 3RLMD 5HQGA
chains in the Genus database with same CATH superfamily
1GXRA 1O6FA 2IWFA 4G55A 3V4VA 3EWEA 4PC0A 3ODTA 1I2MB 4NENA 5HE3B 3AFCA 4Z7QA 5M5SA 3NVQA 4JT6C 2I0RA 4O3UB 4G1MA 3RRMC 5EMLB 3K71A 4A0BB 2PM7B 2YBAA 3V9FA 2H13A 1TYEA 4GM8A 2AGWA 4H5JA 4QQEA 5C9ZB 3ZDZA 4DNVA 5FA5B 1GOGA 1H2ZA 2AGZA 3DSMA 1N6FA 3EU7A 2QXVA 3O4JA 3RN0D 4QL1A 2EBSA 4CY5A 3KRXB 3N0DA 4IRZA 4CI2A 4H5IA 1MDAH 4LGNA 2AH1A 2CE9A 4J73A 3SMRA 4JD2C 4AEZA 2HXCA 1Q47A 5GMKn 5M5TA 3QI0A 4BL0A 1FWXA 3BG1A 4R7AB 2P9IC 4L3HD 3L4OD 3SBRA 3SJLD 5M5VA 5C2WB 3F3FA 4ZOYA 3EMHA 3K6SA 4A0AB 3OL2B 2XYIA 2EIDA 3E0CA 3EI2B 3B7FA 4IA9A 3JAMg 4CI1A 2AGLA 3I7OA 4J86A 4WK4A 2XZGA 2H3XA 4E5ZB 4UM9A 2VDQA 2YB8B 4J0XA 3CFVA 4FWWA 5EALA 2AQ5A 1E8MA 4CC9A 5KDOB 4WK2A 3JZNA 4E54B 1C9LA 2OVQB 4A09A 2GC4A 1JJUB 5H17A 4ES0A 5AJAA 2PM9A 4MMYA 3L4MD 1K32A 4A2LA 4PSXB 1ERJA 4X63B 3SWSD 3IUMA 4NSXA 4BCCA 2HJ4A 4O2WA 3T3PA 1U8CA 1A12A 3W15A 4GGDA 4OWRA 4O45A 2IUQA 3UKRC 4AMYA 5EMMB 4GGCA 3IJCA 2I0SA 2CNXA 2EIBA 3IVMA 4Z7OA 4G56B 3NIFA 3EI4A 5A2Qg 3JZGA 2EIEA 5TF2A 1PEVA 2QR5A 5CXBB 3A0FA 4CI8A 5THAA 5CXCB 3ZDYA 1K3IA 3PSCB 5EAMA 4FA4D 4MMXA 4PBZA 3SHFA 4J8BA 3RMZD 2H9PA 1VE7A 3DDUA 4BH6A 1S4UX 2P9KC 5I5JA 2BBKH 4O02A 3V5WB 1UOOA 5TEFA 3IUJA 1BPOA 2JKXA 3EI3B 4JT5C 3AL9A 3RFHA 5JWZA 2WQ8A 2H68A 5GSAA 3BWSA 4MMZA 1XIPA 3OKYA 4GM9A 4JHPC 3OTTA 4J78A 5EMKB 3MKQA 4AOWA 2VZ3A 4JSVC 4L9OA 5FFOA 2AH0A 2CE8A 3F3GA 4CZXA 3OKTA 2B4EA 5IT9g 2IUVA 4GM3A 4L1QD 3EI1A 2GC7A 2HU8A 3OF7A 1PBYB 4BUJC 4YVDA 5M61A 4J87A 4QT8A 2IWKA 4K3ID 4AN1A 5M5RA 5GXIA 5SXMA 3O4GA 3UR4A 2H9LA 3MZLA 3V4PA 5EM2A 3RN1D 4UM8A 1UOPA 4K3JB 3ZE1A 1U4CA 2AGYA 3I7KA 1VYHC 4U1EI 3I7PA 2HU5A 2HESX 1GP2B 4J8GA 3MMYA 3K27A 2BCJB 4J77A 5FKSA 2I3TA 4A2MA 3JROA 2OK6A 2IAAA 3C5MA 1JMXB 1NR0A 1GOFA 5HDBA 3U4YA 2OIZA 1TBGA 2HKMA 4CZVA 1JMZB 1SQJA 3IURA 4PBYA 2H47A 3I7LA 2Z2NA 3C9CA 5C86A 4A08A 2IUPA 2G9AA 4A0BA 5FKRA 4FAND 2J57G 3RSEC 5FLXg 1VZ3A 3J81g 3F3PA 1UTCA 4G1EA 3NIDA 4O9DA 4J81A 2P9LC 4MK0B 4O1QD 5C92A 3AL8A 5IJ8E 1PGUA 5EARA 2BKLA 4J82A 5FXYA 4A09B 2J55H 3UVOA 4A11B 1L0QA 2HJBA 3OL2A 3EI2A 2P9UC 2CN3A 3FGBA 3JZHA 4E5ZA 1GG2B 4U7AA 4Z7NA 4XYIA 2H6NA 2H14A 2IURA 3I7NA 4IMMA 1YR2A 4QRJA 3GFCA 5K1CC 3EI4B 3SVWD 2HU7A 2VDNA 3UVLA 3PVUB 1H2XA 5IJ7E 1QFSA 3NVNA 4CY2A 4AN0A 1NEXB 1N6DA 4J84A 5AMSA 3IUQA 3GD1I 4RE5A 3SLED 3IKOA 3ZWLB 2P9SC 1U2VC 5HYNB 4CZYA 1M1XA 5CYKA 3SN6B 1JTDB 1T2XA 1A0RB 2UZYB 2VC2A 1OLZA 3PXTD 4CI3A 1MG3A 3VI4A 3ORVD 1GOHA 3ZE2A 2OJYA 2VDRA 2XL3A 4GGAA 5CXCA 3MUOA 1JV2A 3OKYB 3PSLA 5GXHA 4L3GD 3NIGA 3FCUA 4NC4A 3JB9L 4TZ4A 1R5MA 4ERQA 2YMUA 4PNKB 3SCYA 1PI6A 2YNPA 4ZN4A 3ZDXA 3NVXA 2Z2OA 3EI3A 4ESGA 2QC5A 5E6SA 1L5GA 3VI3A 4JXMA 1C9IA 1XHMA 2OK4A 5AFU3 2QZPA 4JSXC 1XKSA 1H2WA 3P4FA 4Z8LA 5E6RA 2Z2PA 3KRWB 3EQ9A 4O3TB 3IJ0A 5HE2B 1N6EA 5TEEA 3OW8A 5FKQA 3ULEC 2CN2A 5EM2B 4PSWB 3DXKC 4GMBA 2PM6B 4LG8A 2H6KA 2H9MA 3PVWB 3K26A 3ZE0A 4WJKA 2OVPB 4NBMA 5EMJB 3KCIA 3CIKB 4FAVD 3IULA 3T3MA 1SQ9A 4FB1D 2EICA 4FA1D 3MZKA 4UI9R 1RI6A 4CY3A 4Y7RA 4XYHA 4A08B 4I79A 2B5NA 5I5MA 2UZXB 3GC3B 3C75H 4JSNC 3C99A 4AMZA 3VH0A 4DNUA 4X60B 3SFZA 4J79A 2VDKA 5I5IA 3EG6A 3EQ7A 3I89A 2B5LA 4CY1A 5TDHB 3IIWA 1VE6A 4L1MA 4ZOXA 2MTAH 3I2NA 3MUNA 2Q7QA 1TYQC 3FCSA 5H1MA 5M5UA 3MVDK 4ERZA 3AL8B 2YNNA 2XU7A 4GQ2P 3BG0A 1QNIA 4FA9D 1QFMA 2GNQA 2PM9B 3MXXA 3PXSD 3UVMA 4HDJA 4JSPC 3UKUC 3DWLC 4A0AA 1K8KC 2HKRA 3AH8B 5H14A 4BP8A 4JHNA 4NAAA 4ZOZA 3O4IA 2G99A 4GZ8A 2CO0C 4E54A 3OKWA 4RE6A 3SXTD 3FRXA 5HE0B 4BCDA 3HFQA 3PE7A 4A11A 1H2YA 3I8EA 5IC7A 1VZ2A 4QAMA 3J80g 4GQBB 3JRPA 1O6GA 3I8CA 2O9KA 2VDLA 3JPXA 2OVRB 4AX4A 3IJEA 4X61B 1E5TA 4OZUA 2VDMA 4BP9A 2VDOA 5E6UA 4FHLA 5FFGA 3IUNA 4D9SA 3IJ1A 1E8NA 3CFSB 1UOQA 5FQDA 4LG9A 5CYKB 4D0KA 5K19A 1OMWB 3O4HA 3DXMC 3UVNA 3GREA 3QHYB 5CXBA 3N0EA 1B9XA 3DM0A 4GQ1A 2P9PC 1MG2A 3IIYA 2VDPA 4XEIC 3MKSB 5FKTA 2VZ1A 4ERYA 2TRCB 1YFQA 3K72A 2H6QA 4A7JA 1B9YA 2XDWA 4EWRA 3I7HA 4WK0A 2CO0A 5C2VB 3PXWD 4J0WA 5EAPA 4Y5RD 5HE1B 1P22A 3SBQA 1JOFA 3EI1B 2XE4A 2AGXA 2XL2A 2P9NC 2H9NA 4KFMB 2W18A 2J56H 3VA6A 4DNWA 5IGQA 1GOTB 3V7DB 1SHYB 4FA5D 2HYEA 3UVKA 3RFGA 2YNOA 4BCBA 3VGZA 3EQ8A 3FM0A 5B4WA 4N14A 3SBPA 4PXWA 2I3SA 4ZOVA 2I0TA 5IGOA 4D6VA 2PBIB 4X3EA 2B5MA 3RLMD 5HQGA
chains in the Genus database with same CATH topology
1GXRA 2IWFA 3EWEA 4PC0A 3ODTA 5HE3B 3AFCA 3NVQA 4JT6C 2I0RA 4O3UB 3RRMC 5EMLB 4A0BB 2PM7B 2YBAA 3V9FA 2H13A 4GM8A 2AGWA 4H5JA 4QQEA 5C9ZB 5FA5B 2AGZA 3DSMA 1N6FA 3EU7A 2QXVA 3RN0D 4QL1A 2EBSA 4CY5A 3KRXB 3N0DA 4CI2A 4H5IA 1MDAH 4LGNA 2AH1A 2CE9A 4J73A 3SMRA 4JD2C 4AEZA 2HXCA 1Q47A 5GMKn 4BL0A 1FWXA 3BG1A 4R7AB 2P9IC 4L3HD 3L4OD 3SBRA 3SJLD 5C2WB 3F3FA 4ZOYA 3EMHA 4A0AB 3OL2B 2XYIA 3E0CA 3EI2B 3B7FA 4IA9A 3JAMg 4CI1A 2AGLA 3I7OA 4J86A 2H3XA 4E5ZB 2YB8B 4J0XA 3CFVA 4FWWA 5EALA 2AQ5A 4CC9A 5KDOB 3JZNA 4E54B 2OVQB 4A09A 2GC4A 1JJUB 5H17A 4ES0A 5AJAA 2PM9A 3L4MD 1K32A 4A2LA 4PSXB 1ERJA 4X63B 3SWSD 4NSXA 2HJ4A 3W15A 4GGDA 4OWRA 4O45A 2IUQA 3UKRC 5EMMB 4GGCA 3IJCA 2I0SA 2CNXA 4G56B 3EI4A 5A2Qg 3JZGA 5TF2A 1PEVA 5CXBB 3A0FA 4CI8A 5THAA 5CXCB 3PSCB 5EAMA 4FA4D 4PBZA 3SHFA 4J8BA 3RMZD 2H9PA 4BH6A 1S4UX 2P9KC 5I5JA 2BBKH 3V5WB 5TEFA 3EI3B 4JT5C 3AL9A 3RFHA 5JWZA 5GSAA 2H68A 3BWSA 1XIPA 3OKYA 4GM9A 3OTTA 4J78A 5EMKB 3MKQA 4AOWA 4JSVC 4L9OA 2AH0A 2CE8A 3F3GA 4CZXA 3OKTA 2B4EA 5IT9g 2IUVA 4GM3A 4L1QD 3EI1A 2GC7A 1PBYB 4BUJC 4YVDA 4J87A 4QT8A 2IWKA 4K3ID 5GXIA 5SXMA 3UR4A 2H9LA 3MZLA 5EM2A 3RN1D 4K3JB 1U4CA 2AGYA 3I7KA 1VYHC 4U1EI 3I7PA 2HESX 1GP2B 4J8GA 3MMYA 3K27A 2BCJB 4J77A 5FKSA 2I3TA 4A2MA 3JROA 2OK6A 2IAAA 1NR0A 1JMXB 3C5MA 3U4YA 2OIZA 1TBGA 2HKMA 4CZVA 1JMZB 1SQJA 4PBYA 2H47A 3I7LA 2Z2NA 3C9CA 4A08A 2IUPA 2G9AA 4A0BA 5FKRA 4FAND 2J57G 3RSEC 5FLXg 3J81g 3F3PA 4O9DA 4J81A 2P9LC 4MK0B 4O1QD 3AL8A 5IJ8E 1PGUA 5EARA 4J82A 5FXYA 4A09B 2J55H 3UVOA 4A11B 1L0QA 2HJBA 3OL2A 3EI2A 2P9UC 2CN3A 3FGBA 3JZHA 4E5ZA 1GG2B 4U7AA 4XYIA 2H6NA 2H14A 2IURA 3I7NA 4IMMA 4QRJA 3GFCA 5K1CC 3EI4B 3SVWD 3UVLA 3PVUB 5IJ7E 3NVNA 4CY2A 1NEXB 1N6DA 4J84A 5AMSA 3SLED 3IKOA 3ZWLB 2P9SC 1U2VC 5HYNB 4CZYA 5CYKA 3SN6B 1A0RB 2UZYB 3PXTD 1OLZA 4CI3A 1MG3A 3ORVD 2OJYA 2XL3A 4GGAA 5CXCA 3OKYB 3PSLA 5GXHA 4L3GD 3JB9L 4TZ4A 1R5MA 4ERQA 2YMUA 4PNKB 3SCYA 1PI6A 2YNPA 4ZN4A 3NVXA 2Z2OA 3EI3A 4ESGA 2QC5A 4JXMA 1XHMA 2OK4A 5AFU3 4JSXC 1XKSA 3P4FA 4Z8LA 2Z2PA 3KRWB 4O3TB 3IJ0A 5HE2B 1N6EA 5TEEA 3OW8A 5FKQA 3ULEC 2CN2A 5EM2B 4PSWB 3DXKC 4GMBA 2PM6B 4LG8A 2H6KA 2H9MA 3PVWB 3K26A 2OVPB 5EMJB 3CIKB 4FAVD 1SQ9A 4FB1D 4FA1D 3MZKA 4UI9R 1RI6A 4CY3A 4Y7RA 4XYHA 4A08B 4I79A 2B5NA 5I5MA 2UZXB 3C75H 4JSNC 3C99A 3VH0A 4X60B 3SFZA 4J79A 5I5IA 3EG6A 3I89A 2B5LA 4CY1A 5TDHB 3IIWA 4ZOXA 2MTAH 3I2NA 2Q7QA 1TYQC 5H1MA 4ERZA 3AL8B 2YNNA 2XU7A 4GQ2P 3BG0A 1QNIA 4FA9D 2GNQA 2PM9B 3MXXA 3PXSD 3UVMA 4HDJA 4JSPC 3UKUC 3DWLC 4A0AA 1K8KC 2HKRA 3AH8B 5H14A 4ZOZA 2G99A 4GZ8A 2CO0C 4E54A 3OKWA 3SXTD 3FRXA 5HE0B 3HFQA 3PE7A 4A11A 3I8EA 5IC7A 3J80g 4GQBB 3JRPA 3I8CA 2O9KA 3JPXA 2OVRB 4X61B 4OZUA 4FHLA 3IJ1A 3CFSB 5FQDA 4LG9A 5CYKB 4D0KA 5K19A 1OMWB 3DXMC 3UVNA 3GREA 5CXBA 3N0EA 1B9XA 3DM0A 4GQ1A 2P9PC 1MG2A 3IIYA 4XEIC 3MKSB 5FKTA 4ERYA 2TRCB 1YFQA 2H6QA 4A7JA 1B9YA 4EWRA 3I7HA 5C2VB 2CO0A 3PXWD 4J0WA 5EAPA 4Y5RD 5HE1B 1P22A 3SBQA 1JOFA 3EI1B 2AGXA 2XL2A 2P9NC 2H9NA 4KFMB 2W18A 2J56H 3VA6A 5IGQA 1GOTB 3V7DB 1SHYB 4FA5D 2HYEA 3UVKA 3RFGA 2YNOA 3VGZA 5B4WA 3FM0A 4N14A 3SBPA 4PXWA 2I3SA 4ZOVA 2I0TA 5IGOA 4D6VA 2PBIB 4X3EA 2B5MA 3RLMD 5HQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXR A;  2IWF A;  3EWE A;  4PC0 A;  3ODT A;  5HE3 B;  3AFC A;  3NVQ A;  4JT6 C;  2I0R A;  4O3U B;  3RRM C;  5EML B;  4A0B B;  2PM7 B;  2YBA A;  3V9F A;  2H13 A;  4GM8 A;  2AGW A;  4H5J A;  4QQE A;  5C9Z B;  5FA5 B;  2AGZ A;  3DSM A;  1N6F A;  3EU7 A;  2QXV A;  3RN0 D;  4QL1 A;  2EBS A;  4CY5 A;  3KRX B;  3N0D A;  4CI2 A;  4H5I A;  1MDA H;  4LGN A;  2AH1 A;  2CE9 A;  4J73 A;  3SMR A;  4JD2 C;  4AEZ A;  2HXC A;  1Q47 A;  5GMK n;  4BL0 A;  1FWX A;  3BG1 A;  4R7A B;  2P9I C;  4L3H D;  3L4O D;  3SBR A;  3SJL D;  5C2W B;  3F3F A;  4ZOY A;  3EMH A;  4A0A B;  3OL2 B;  2XYI A;  3E0C A;  3EI2 B;  3B7F A;  4IA9 A;  3JAM g;  4CI1 A;  2AGL A;  3I7O A;  4J86 A;  2H3X A;  4E5Z B;  2YB8 B;  4J0X A;  3CFV A;  4FWW A;  5EAL A;  2AQ5 A;  4CC9 A;  5KDO B;  3JZN A;  4E54 B;  2OVQ B;  4A09 A;  2GC4 A;  1JJU B;  5H17 A;  4ES0 A;  5AJA A;  2PM9 A;  3L4M D;  1K32 A;  4A2L A;  4PSX B;  1ERJ A;  4X63 B;  3SWS D;  4NSX A;  2HJ4 A;  3W15 A;  4GGD A;  4OWR A;  4O45 A;  2IUQ A;  3UKR C;  5EMM B;  4GGC A;  3IJC A;  2I0S A;  2CNX A;  4G56 B;  3EI4 A;  5A2Q g;  3JZG A;  5TF2 A;  1PEV A;  5CXB B;  3A0F A;  4CI8 A;  5THA A;  5CXC B;  3PSC B;  5EAM A;  4FA4 D;  4PBZ A;  3SHF A;  4J8B A;  3RMZ D;  2H9P A;  4BH6 A;  1S4U X;  2P9K C;  5I5J A;  2BBK H;  3V5W B;  5TEF A;  3EI3 B;  4JT5 C;  3AL9 A;  3RFH A;  5JWZ A;  5GSA A;  2H68 A;  3BWS A;  1XIP A;  3OKY A;  4GM9 A;  3OTT A;  4J78 A;  5EMK B;  3MKQ A;  4AOW A;  4JSV C;  4L9O A;  2AH0 A;  2CE8 A;  3F3G A;  4CZX A;  3OKT A;  2B4E A;  5IT9 g;  2IUV A;  4GM3 A;  4L1Q D;  3EI1 A;  2GC7 A;  1PBY B;  4BUJ C;  4YVD A;  4J87 A;  4QT8 A;  2IWK A;  4K3I D;  5GXI A;  5SXM A;  3UR4 A;  2H9L A;  3MZL A;  5EM2 A;  3RN1 D;  4K3J B;  1U4C A;  2AGY A;  3I7K A;  1VYH C;  4U1E I;  3I7P A;  2HES X;  1GP2 B;  4J8G A;  3MMY A;  3K27 A;  2BCJ B;  4J77 A;  5FKS A;  2I3T A;  4A2M A;  3JRO A;  2OK6 A;  2IAA A;  1NR0 A;  1JMX B;  3C5M A;  3U4Y A;  2OIZ A;  1TBG A;  2HKM A;  4CZV A;  1JMZ B;  1SQJ A;  4PBY A;  2H47 A;  3I7L A;  2Z2N A;  3C9C A;  4A08 A;  2IUP A;  2G9A A;  4A0B A;  5FKR A;  4FAN D;  2J57 G;  3RSE C;  5FLX g;  3J81 g;  3F3P A;  4O9D A;  4J81 A;  2P9L C;  4MK0 B;  4O1Q D;  3AL8 A;  5IJ8 E;  1PGU A;  5EAR A;  4J82 A;  5FXY A;  4A09 B;  2J55 H;  3UVO A;  4A11 B;  1L0Q A;  2HJB A;  3OL2 A;  3EI2 A;  2P9U C;  2CN3 A;  3FGB A;  3JZH A;  4E5Z A;  1GG2 B;  4U7A A;  4XYI A;  2H6N A;  2H14 A;  2IUR A;  3I7N A;  4IMM A;  4QRJ A;  3GFC A;  5K1C C;  3EI4 B;  3SVW D;  3UVL A;  3PVU B;  5IJ7 E;  3NVN A;  4CY2 A;  1NEX B;  1N6D A;  4J84 A;  5AMS A;  3SLE D;  3IKO A;  3ZWL B;  2P9S C;  1U2V C;  5HYN B;  4CZY A;  5CYK A;  3SN6 B;  1A0R B;  2UZY B;  3PXT D;  1OLZ A;  4CI3 A;  1MG3 A;  3ORV D;  2OJY A;  2XL3 A;  4GGA A;  5CXC A;  3OKY B;  3PSL A;  5GXH A;  4L3G D;  3JB9 L;  4TZ4 A;  1R5M A;  4ERQ A;  2YMU A;  4PNK B;  3SCY A;  1PI6 A;  2YNP A;  4ZN4 A;  3NVX A;  2Z2O A;  3EI3 A;  4ESG A;  2QC5 A;  4JXM A;  1XHM A;  2OK4 A;  5AFU 3;  4JSX C;  1XKS A;  3P4F A;  4Z8L A;  2Z2P A;  3KRW B;  4O3T B;  3IJ0 A;  5HE2 B;  1N6E A;  5TEE A;  3OW8 A;  5FKQ A;  3ULE C;  2CN2 A;  5EM2 B;  4PSW B;  3DXK C;  4GMB A;  2PM6 B;  4LG8 A;  2H6K A;  2H9M A;  3PVW B;  3K26 A;  2OVP B;  5EMJ B;  3CIK B;  4FAV D;  1SQ9 A;  4FB1 D;  4FA1 D;  3MZK A;  4UI9 R;  1RI6 A;  4CY3 A;  4Y7R A;  4XYH A;  4A08 B;  4I79 A;  2B5N A;  5I5M A;  2UZX B;  3C75 H;  4JSN C;  3C99 A;  3VH0 A;  4X60 B;  3SFZ A;  4J79 A;  5I5I A;  3EG6 A;  3I89 A;  2B5L A;  4CY1 A;  5TDH B;  3IIW A;  4ZOX A;  2MTA H;  3I2N A;  2Q7Q A;  1TYQ C;  5H1M A;  4ERZ A;  3AL8 B;  2YNN A;  2XU7 A;  4GQ2 P;  3BG0 A;  1QNI A;  4FA9 D;  2GNQ A;  2PM9 B;  3MXX A;  3PXS D;  3UVM A;  4HDJ A;  4JSP C;  3UKU C;  3DWL C;  4A0A A;  1K8K C;  2HKR A;  3AH8 B;  5H14 A;  4ZOZ A;  2G99 A;  4GZ8 A;  2CO0 C;  4E54 A;  3OKW A;  3SXT D;  3FRX A;  5HE0 B;  3HFQ A;  3PE7 A;  4A11 A;  3I8E A;  5IC7 A;  3J80 g;  4GQB B;  3JRP A;  3I8C A;  2O9K A;  3JPX A;  2OVR B;  4X61 B;  4OZU A;  4FHL A;  3IJ1 A;  3CFS B;  5FQD A;  4LG9 A;  5CYK B;  4D0K A;  5K19 A;  1OMW B;  3DXM C;  3UVN A;  3GRE A;  5CXB A;  3N0E A;  1B9X A;  3DM0 A;  4GQ1 A;  2P9P C;  1MG2 A;  3IIY A;  4XEI C;  3MKS B;  5FKT A;  4ERY A;  2TRC B;  1YFQ A;  2H6Q A;  4A7J A;  1B9Y A;  4EWR A;  3I7H A;  5C2V B;  2CO0 A;  3PXW D;  4J0W A;  5EAP A;  4Y5R D;  5HE1 B;  1P22 A;  3SBQ A;  1JOF A;  3EI1 B;  2AGX A;  2XL2 A;  2P9N C;  2H9N A;  4KFM B;  2W18 A;  2J56 H;  3VA6 A;  5IGQ A;  1GOT B;  3V7D B;  1SHY B;  4FA5 D;  2HYE A;  3UVK A;  3RFG A;  2YNO A;  3VGZ A;  5B4W A;  3FM0 A;  4N14 A;  3SBP A;  4PXW A;  2I3S A;  4ZOV A;  2I0T A;  5IGO A;  4D6V A;  2PBI B;  4X3E A;  2B5M A;  3RLM D;  5HQG A; 
#chains in the Genus database with same CATH topology
 1GXR A;  1O6F A;  2IWF A;  4G55 A;  3V4V A;  3EWE A;  4PC0 A;  3ODT A;  1I2M B;  4NEN A;  5HE3 B;  3AFC A;  4Z7Q A;  5M5S A;  3NVQ A;  4JT6 C;  2I0R A;  4O3U B;  4G1M A;  3RRM C;  5EML B;  3K71 A;  4A0B B;  2PM7 B;  2YBA A;  3V9F A;  2H13 A;  1TYE A;  4GM8 A;  2AGW A;  4H5J A;  4QQE A;  5C9Z B;  3ZDZ A;  4DNV A;  5FA5 B;  1GOG A;  1H2Z A;  2AGZ A;  3DSM A;  1N6F A;  3EU7 A;  2QXV A;  3O4J A;  3RN0 D;  4QL1 A;  2EBS A;  4CY5 A;  3KRX B;  3N0D A;  4IRZ A;  4CI2 A;  4H5I A;  1MDA H;  4LGN A;  2AH1 A;  2CE9 A;  4J73 A;  3SMR A;  4JD2 C;  4AEZ A;  2HXC A;  1Q47 A;  5GMK n;  5M5T A;  3QI0 A;  4BL0 A;  1FWX A;  3BG1 A;  4R7A B;  2P9I C;  4L3H D;  3L4O D;  3SBR A;  3SJL D;  5M5V A;  5C2W B;  3F3F A;  4ZOY A;  3EMH A;  3K6S A;  4A0A B;  3OL2 B;  2XYI A;  2EID A;  3E0C A;  3EI2 B;  3B7F A;  4IA9 A;  3JAM g;  4CI1 A;  2AGL A;  3I7O A;  4J86 A;  4WK4 A;  2XZG A;  2H3X A;  4E5Z B;  4UM9 A;  2VDQ A;  2YB8 B;  4J0X A;  3CFV A;  4FWW A;  5EAL A;  2AQ5 A;  1E8M A;  4CC9 A;  5KDO B;  4WK2 A;  3JZN A;  4E54 B;  1C9L A;  2OVQ B;  4A09 A;  2GC4 A;  1JJU B;  5H17 A;  4ES0 A;  5AJA A;  2PM9 A;  4MMY A;  3L4M D;  1K32 A;  4A2L A;  4PSX B;  1ERJ A;  4X63 B;  3SWS D;  3IUM A;  4NSX A;  4BCC A;  2HJ4 A;  4O2W A;  3T3P A;  1U8C A;  1A12 A;  3W15 A;  4GGD A;  4OWR A;  4O45 A;  2IUQ A;  3UKR C;  4AMY A;  5EMM B;  4GGC A;  3IJC A;  2I0S A;  2CNX A;  2EIB A;  3IVM A;  4Z7O A;  4G56 B;  3NIF A;  3EI4 A;  5A2Q g;  3JZG A;  2EIE A;  5TF2 A;  1PEV A;  2QR5 A;  5CXB B;  3A0F A;  4CI8 A;  5THA A;  5CXC B;  3ZDY A;  1K3I A;  3PSC B;  5EAM A;  4FA4 D;  4MMX A;  4PBZ A;  3SHF A;  4J8B A;  3RMZ D;  2H9P A;  1VE7 A;  3DDU A;  4BH6 A;  1S4U X;  2P9K C;  5I5J A;  2BBK H;  4O02 A;  3V5W B;  1UOO A;  5TEF A;  3IUJ A;  1BPO A;  2JKX A;  3EI3 B;  4JT5 C;  3AL9 A;  3RFH A;  5JWZ A;  2WQ8 A;  2H68 A;  5GSA A;  3BWS A;  4MMZ A;  1XIP A;  3OKY A;  4GM9 A;  4JHP C;  3OTT A;  4J78 A;  5EMK B;  3MKQ A;  4AOW A;  2VZ3 A;  4JSV C;  4L9O A;  5FFO A;  2AH0 A;  2CE8 A;  3F3G A;  4CZX A;  3OKT A;  2B4E A;  5IT9 g;  2IUV A;  4GM3 A;  4L1Q D;  3EI1 A;  2GC7 A;  2HU8 A;  3OF7 A;  1PBY B;  4BUJ C;  4YVD A;  5M61 A;  4J87 A;  4QT8 A;  2IWK A;  4K3I D;  4AN1 A;  5M5R A;  5GXI A;  5SXM A;  3O4G A;  3UR4 A;  2H9L A;  3MZL A;  3V4P A;  5EM2 A;  3RN1 D;  4UM8 A;  1UOP A;  4K3J B;  3ZE1 A;  1U4C A;  2AGY A;  3I7K A;  1VYH C;  4U1E I;  3I7P A;  2HU5 A;  2HES X;  1GP2 B;  4J8G A;  3MMY A;  3K27 A;  2BCJ B;  4J77 A;  5FKS A;  2I3T A;  4A2M A;  3JRO A;  2OK6 A;  2IAA A;  3C5M A;  1JMX B;  1NR0 A;  1GOF A;  5HDB A;  3U4Y A;  2OIZ A;  1TBG A;  2HKM A;  4CZV A;  1JMZ B;  1SQJ A;  3IUR A;  4PBY A;  2H47 A;  3I7L A;  2Z2N A;  3C9C A;  5C86 A;  4A08 A;  2IUP A;  2G9A A;  4A0B A;  5FKR A;  4FAN D;  2J57 G;  3RSE C;  5FLX g;  1VZ3 A;  3J81 g;  3F3P A;  1UTC A;  4G1E A;  3NID A;  4O9D A;  4J81 A;  2P9L C;  4MK0 B;  4O1Q D;  5C92 A;  3AL8 A;  5IJ8 E;  1PGU A;  5EAR A;  2BKL A;  4J82 A;  5FXY A;  4A09 B;  2J55 H;  3UVO A;  4A11 B;  1L0Q A;  2HJB A;  3OL2 A;  3EI2 A;  2P9U C;  2CN3 A;  3FGB A;  3JZH A;  4E5Z A;  1GG2 B;  4U7A A;  4Z7N A;  4XYI A;  2H6N A;  2H14 A;  2IUR A;  3I7N A;  4IMM A;  1YR2 A;  4QRJ A;  3GFC A;  5K1C C;  3EI4 B;  3SVW D;  2HU7 A;  2VDN A;  3UVL A;  3PVU B;  1H2X A;  5IJ7 E;  1QFS A;  3NVN A;  4CY2 A;  4AN0 A;  1NEX B;  1N6D A;  4J84 A;  5AMS A;  3IUQ A;  3GD1 I;  4RE5 A;  3SLE D;  3IKO A;  3ZWL B;  2P9S C;  1U2V C;  5HYN B;  4CZY A;  1M1X A;  5CYK A;  3SN6 B;  1JTD B;  1T2X A;  1A0R B;  2UZY B;  2VC2 A;  1OLZ A;  3PXT D;  4CI3 A;  1MG3 A;  3VI4 A;  3ORV D;  1GOH A;  3ZE2 A;  2OJY A;  2VDR A;  2XL3 A;  4GGA A;  5CXC A;  3MUO A;  1JV2 A;  3OKY B;  3PSL A;  5GXH A;  4L3G D;  3NIG A;  3FCU A;  4NC4 A;  3JB9 L;  4TZ4 A;  1R5M A;  4ERQ A;  2YMU A;  4PNK B;  3SCY A;  1PI6 A;  2YNP A;  4ZN4 A;  3ZDX A;  3NVX A;  2Z2O A;  3EI3 A;  4ESG A;  2QC5 A;  5E6S A;  1L5G A;  3VI3 A;  4JXM A;  1C9I A;  1XHM A;  2OK4 A;  5AFU 3;  2QZP A;  4JSX C;  1XKS A;  1H2W A;  3P4F A;  4Z8L A;  5E6R A;  2Z2P A;  3KRW B;  3EQ9 A;  4O3T B;  3IJ0 A;  5HE2 B;  1N6E A;  5TEE A;  3OW8 A;  5FKQ A;  3ULE C;  2CN2 A;  5EM2 B;  4PSW B;  3DXK C;  4GMB A;  2PM6 B;  4LG8 A;  2H6K A;  2H9M A;  3PVW B;  3K26 A;  3ZE0 A;  4WJK A;  2OVP B;  4NBM A;  5EMJ B;  3KCI A;  3CIK B;  4FAV D;  3IUL A;  3T3M A;  1SQ9 A;  4FB1 D;  2EIC A;  4FA1 D;  3MZK A;  4UI9 R;  1RI6 A;  4CY3 A;  4Y7R A;  4XYH A;  4A08 B;  4I79 A;  2B5N A;  5I5M A;  2UZX B;  3GC3 B;  3C75 H;  4JSN C;  3C99 A;  4AMZ A;  3VH0 A;  4DNU A;  4X60 B;  3SFZ A;  4J79 A;  2VDK A;  5I5I A;  3EG6 A;  3EQ7 A;  3I89 A;  2B5L A;  4CY1 A;  5TDH B;  3IIW A;  1VE6 A;  4L1M A;  4ZOX A;  2MTA H;  3I2N A;  3MUN A;  2Q7Q A;  1TYQ C;  3FCS A;  5H1M A;  5M5U A;  3MVD K;  4ERZ A;  3AL8 B;  2YNN A;  2XU7 A;  4GQ2 P;  3BG0 A;  1QNI A;  4FA9 D;  1QFM A;  2GNQ A;  2PM9 B;  3MXX A;  3PXS D;  3UVM A;  4HDJ A;  4JSP C;  3UKU C;  3DWL C;  4A0A A;  1K8K C;  2HKR A;  3AH8 B;  5H14 A;  4BP8 A;  4JHN A;  4NAA A;  4ZOZ A;  3O4I A;  2G99 A;  4GZ8 A;  2CO0 C;  4E54 A;  3OKW A;  4RE6 A;  3SXT D;  3FRX A;  5HE0 B;  4BCD A;  3HFQ A;  3PE7 A;  4A11 A;  1H2Y A;  3I8E A;  5IC7 A;  1VZ2 A;  4QAM A;  3J80 g;  4GQB B;  3JRP A;  1O6G A;  3I8C A;  2O9K A;  2VDL A;  3JPX A;  2OVR B;  4AX4 A;  3IJE A;  4X61 B;  1E5T A;  4OZU A;  2VDM A;  4BP9 A;  2VDO A;  5E6U A;  4FHL A;  5FFG A;  3IUN A;  4D9S A;  3IJ1 A;  1E8N A;  3CFS B;  1UOQ A;  5FQD A;  4LG9 A;  5CYK B;  4D0K A;  5K19 A;  1OMW B;  3O4H A;  3DXM C;  3UVN A;  3GRE A;  3QHY B;  5CXB A;  3N0E A;  1B9X A;  3DM0 A;  4GQ1 A;  2P9P C;  1MG2 A;  3IIY A;  2VDP A;  4XEI C;  3MKS B;  5FKT A;  2VZ1 A;  4ERY A;  2TRC B;  1YFQ A;  3K72 A;  2H6Q A;  4A7J A;  1B9Y A;  2XDW A;  4EWR A;  3I7H A;  4WK0 A;  2CO0 A;  5C2V B;  3PXW D;  4J0W A;  5EAP A;  4Y5R D;  5HE1 B;  1P22 A;  3SBQ A;  1JOF A;  3EI1 B;  2XE4 A;  2AGX A;  2XL2 A;  2P9N C;  2H9N A;  4KFM B;  2W18 A;  2J56 H;  3VA6 A;  4DNW A;  5IGQ A;  1GOT B;  3V7D B;  1SHY B;  4FA5 D;  2HYE A;  3UVK A;  3RFG A;  2YNO A;  4BCB A;  3VGZ A;  3EQ8 A;  3FM0 A;  5B4W A;  4N14 A;  3SBP A;  4PXW A;  2I3S A;  4ZOV A;  2I0T A;  5IGO A;  4D6V A;  2PBI B;  4X3E A;  2B5M A;  3RLM D;  5HQG A; 
#chains in the Genus database with same CATH homology
 1GXR A;  2IWF A;  3EWE A;  4PC0 A;  3ODT A;  5HE3 B;  3AFC A;  3NVQ A;  4JT6 C;  2I0R A;  4O3U B;  3RRM C;  5EML B;  4A0B B;  2PM7 B;  2YBA A;  3V9F A;  2H13 A;  4GM8 A;  2AGW A;  4H5J A;  4QQE A;  5C9Z B;  5FA5 B;  2AGZ A;  3DSM A;  1N6F A;  3EU7 A;  2QXV A;  3RN0 D;  4QL1 A;  2EBS A;  4CY5 A;  3KRX B;  3N0D A;  4CI2 A;  4H5I A;  1MDA H;  4LGN A;  2AH1 A;  2CE9 A;  4J73 A;  3SMR A;  4JD2 C;  4AEZ A;  2HXC A;  1Q47 A;  5GMK n;  4BL0 A;  1FWX A;  3BG1 A;  4R7A B;  2P9I C;  4L3H D;  3L4O D;  3SBR A;  3SJL D;  5C2W B;  3F3F A;  4ZOY A;  3EMH A;  4A0A B;  3OL2 B;  2XYI A;  3E0C A;  3EI2 B;  3B7F A;  4IA9 A;  3JAM g;  4CI1 A;  2AGL A;  3I7O A;  4J86 A;  2H3X A;  4E5Z B;  2YB8 B;  4J0X A;  3CFV A;  4FWW A;  5EAL A;  2AQ5 A;  4CC9 A;  5KDO B;  3JZN A;  4E54 B;  2OVQ B;  4A09 A;  2GC4 A;  1JJU B;  5H17 A;  4ES0 A;  5AJA A;  2PM9 A;  3L4M D;  1K32 A;  4A2L A;  4PSX B;  1ERJ A;  4X63 B;  3SWS D;  4NSX A;  2HJ4 A;  3W15 A;  4GGD A;  4OWR A;  4O45 A;  2IUQ A;  3UKR C;  5EMM B;  4GGC A;  3IJC A;  2I0S A;  2CNX A;  4G56 B;  3EI4 A;  5A2Q g;  3JZG A;  5TF2 A;  1PEV A;  5CXB B;  3A0F A;  4CI8 A;  5THA A;  5CXC B;  3PSC B;  5EAM A;  4FA4 D;  4PBZ A;  3SHF A;  4J8B A;  3RMZ D;  2H9P A;  4BH6 A;  1S4U X;  2P9K C;  5I5J A;  2BBK H;  3V5W B;  5TEF A;  3EI3 B;  4JT5 C;  3AL9 A;  3RFH A;  5JWZ A;  5GSA A;  2H68 A;  3BWS A;  1XIP A;  3OKY A;  4GM9 A;  3OTT A;  4J78 A;  5EMK B;  3MKQ A;  4AOW A;  4JSV C;  4L9O A;  2AH0 A;  2CE8 A;  3F3G A;  4CZX A;  3OKT A;  2B4E A;  5IT9 g;  2IUV A;  4GM3 A;  4L1Q D;  3EI1 A;  2GC7 A;  1PBY B;  4BUJ C;  4YVD A;  4J87 A;  4QT8 A;  2IWK A;  4K3I D;  5GXI A;  5SXM A;  3UR4 A;  2H9L A;  3MZL A;  5EM2 A;  3RN1 D;  4K3J B;  1U4C A;  2AGY A;  3I7K A;  1VYH C;  4U1E I;  3I7P A;  2HES X;  1GP2 B;  4J8G A;  3MMY A;  3K27 A;  2BCJ B;  4J77 A;  5FKS A;  2I3T A;  4A2M A;  3JRO A;  2OK6 A;  2IAA A;  1NR0 A;  1JMX B;  3C5M A;  3U4Y A;  2OIZ A;  1TBG A;  2HKM A;  4CZV A;  1JMZ B;  1SQJ A;  4PBY A;  2H47 A;  3I7L A;  2Z2N A;  3C9C A;  4A08 A;  2IUP A;  2G9A A;  4A0B A;  5FKR A;  4FAN D;  2J57 G;  3RSE C;  5FLX g;  3J81 g;  3F3P A;  4O9D A;  4J81 A;  2P9L C;  4MK0 B;  4O1Q D;  3AL8 A;  5IJ8 E;  1PGU A;  5EAR A;  4J82 A;  5FXY A;  4A09 B;  2J55 H;  3UVO A;  4A11 B;  1L0Q A;  2HJB A;  3OL2 A;  3EI2 A;  2P9U C;  2CN3 A;  3FGB A;  3JZH A;  4E5Z A;  1GG2 B;  4U7A A;  4XYI A;  2H6N A;  2H14 A;  2IUR A;  3I7N A;  4IMM A;  4QRJ A;  3GFC A;  5K1C C;  3EI4 B;  3SVW D;  3UVL A;  3PVU B;  5IJ7 E;  3NVN A;  4CY2 A;  1NEX B;  1N6D A;  4J84 A;  5AMS A;  3SLE D;  3IKO A;  3ZWL B;  2P9S C;  1U2V C;  5HYN B;  4CZY A;  5CYK A;  3SN6 B;  1A0R B;  2UZY B;  3PXT D;  1OLZ A;  4CI3 A;  1MG3 A;  3ORV D;  2OJY A;  2XL3 A;  4GGA A;  5CXC A;  3OKY B;  3PSL A;  5GXH A;  4L3G D;  3JB9 L;  4TZ4 A;  1R5M A;  4ERQ A;  2YMU A;  4PNK B;  3SCY A;  1PI6 A;  2YNP A;  4ZN4 A;  3NVX A;  2Z2O A;  3EI3 A;  4ESG A;  2QC5 A;  4JXM A;  1XHM A;  2OK4 A;  5AFU 3;  4JSX C;  1XKS A;  3P4F A;  4Z8L A;  2Z2P A;  3KRW B;  4O3T B;  3IJ0 A;  5HE2 B;  1N6E A;  5TEE A;  3OW8 A;  5FKQ A;  3ULE C;  2CN2 A;  5EM2 B;  4PSW B;  3DXK C;  4GMB A;  2PM6 B;  4LG8 A;  2H6K A;  2H9M A;  3PVW B;  3K26 A;  2OVP B;  5EMJ B;  3CIK B;  4FAV D;  1SQ9 A;  4FB1 D;  4FA1 D;  3MZK A;  4UI9 R;  1RI6 A;  4CY3 A;  4Y7R A;  4XYH A;  4A08 B;  4I79 A;  2B5N A;  5I5M A;  2UZX B;  3C75 H;  4JSN C;  3C99 A;  3VH0 A;  4X60 B;  3SFZ A;  4J79 A;  5I5I A;  3EG6 A;  3I89 A;  2B5L A;  4CY1 A;  5TDH B;  3IIW A;  4ZOX A;  2MTA H;  3I2N A;  2Q7Q A;  1TYQ C;  5H1M A;  4ERZ A;  3AL8 B;  2YNN A;  2XU7 A;  4GQ2 P;  3BG0 A;  1QNI A;  4FA9 D;  2GNQ A;  2PM9 B;  3MXX A;  3PXS D;  3UVM A;  4HDJ A;  4JSP C;  3UKU C;  3DWL C;  4A0A A;  1K8K C;  2HKR A;  3AH8 B;  5H14 A;  4ZOZ A;  2G99 A;  4GZ8 A;  2CO0 C;  4E54 A;  3OKW A;  3SXT D;  3FRX A;  5HE0 B;  3HFQ A;  3PE7 A;  4A11 A;  3I8E A;  5IC7 A;  3J80 g;  4GQB B;  3JRP A;  3I8C A;  2O9K A;  3JPX A;  2OVR B;  4X61 B;  4OZU A;  4FHL A;  3IJ1 A;  3CFS B;  5FQD A;  4LG9 A;  5CYK B;  4D0K A;  5K19 A;  1OMW B;  3DXM C;  3UVN A;  3GRE A;  5CXB A;  3N0E A;  1B9X A;  3DM0 A;  4GQ1 A;  2P9P C;  1MG2 A;  3IIY A;  4XEI C;  3MKS B;  5FKT A;  4ERY A;  2TRC B;  1YFQ A;  2H6Q A;  4A7J A;  1B9Y A;  4EWR A;  3I7H A;  5C2V B;  2CO0 A;  3PXW D;  4J0W A;  5EAP A;  4Y5R D;  5HE1 B;  1P22 A;  3SBQ A;  1JOF A;  3EI1 B;  2AGX A;  2XL2 A;  2P9N C;  2H9N A;  4KFM B;  2W18 A;  2J56 H;  3VA6 A;  5IGQ A;  1GOT B;  3V7D B;  1SHY B;  4FA5 D;  2HYE A;  3UVK A;  3RFG A;  2YNO A;  3VGZ A;  5B4W A;  3FM0 A;  4N14 A;  3SBP A;  4PXW A;  2I3S A;  4ZOV A;  2I0T A;  5IGO A;  4D6V A;  2PBI B;  4X3E A;  2B5M A;  3RLM D;  5HQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...