4J84A

Crystal structure of beta'-cop/scyl1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
300
Chain Sequence
b'MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
molecule tags Protein transport
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 88
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j84A01
1XIPA 3OL2A 2XU7A 4UI9R 3MZKA 3SCYA 2YNPA 2OVQB 2HJ4A 3EWEA 4LGNA 3C5MA 3JZNA 5HE2B 4X61B 3IKOA 5FXYA 3E0CA 5HYNB 3J81g 4K3JB 2I3SA 4J81A 3ORVD 1PBYB 5TDHB 3SVWD 4Z8LA 5C2VB 3EI4B 3AL9A 2CN3A 4YVDA 3BG0A 2P9SC 3SBQA 1TYQC 2UZYB 3KRXB 2O9KA 5IT9g 1Q47A 3NVQA 4J0WA 4KFMB 4ERZA 3SJLD 3I89A 4O45A 4A0AA 2Z2PA 5EM2B 2PM7B 2B5MA 5CXBA 3EI4A 3B7FA 2OJYA 4ERQA 2CE8A 4EWRA 3GREA 4A11A 2I0TA 2H6NA 2HKMA 3SN6B 2CNXA 2HKRA 5HQGA 4ZOVA 2H3XA 2Z2OA 3N0DA 3DSMA 4PSWB 3V5WB 5IGOA 4GM8A 5CYKA 5C9ZB 2J56H 4FA1D 1OMWB 3UR4A 4QRJA 4FAND 3CIKB 3OL2B 1K32A 2PBIB 3PXTD 3ULEC 4FB1D 4XEIC 2PM6B 2GC7A 3UVNA 4PXWA 3RFHA 5I5MA 3SMRA 4ZOYA 4J78A 2OVRB 3K26A 5CYKB 3F3PA 4GMBA 3SWSD 1N6DA 2HJBA 3JZGA 4FWWA 5A2Qg 1JOFA 4PBZA 4JSNC 4CI3A 3N0EA 3L4MD 4E5ZB 2IUPA 1VYHC 3IJ0A 4Y7RA 4IA9A 3EI3A 4BH6A 4IMMA 4NSXA 5HE3B 3NVXA 4CY3A 2IURA 4O1QD 4X63B 3JPXA 5EMJB 5EM2A 2YNOA 4QQEA 2PM9A 2B4EA 4J87A 4JT6C 3NVNA 5EALA 4PC0A 3IJCA 3SXTD 2HXCA 1NR0A 5K19A 1A0RB 2GNQA 1MG2A 4H5IA 4X60B 2H9NA 2W18A 3CFSB 5EMKB 4GQBB 4GGDA 4XYHA 2IUVA 3FM0A 1XKSA 3JROA 3RFGA 2XL2A 4ZOXA 4FA4D 2H6KA 1GG2B 4JSXC 4A08B 5C2WB 3EI2A 2YB8B 2XL3A 3I7OA 2AGWA 4A2LA 3I2NA 4LG9A 4E5ZA 2AH0A 5AMSA 2H6QA 4L3HD 4J8GA 4PNKB 1R5MA 4G56B 4ZOZA 2IWFA 3EU7A 2AGZA 3RSEC 4O9DA 4PSXB 3UVKA 3I7KA 2QXVA 3EI2B 1JMZB 5HE1B 2AGLA 4J73A 2H9LA 3ZWLB 5K1CC 3AL8A 3VA6A 3MKSB 2EBSA 2H13A 3IIWA 5THAA 3RN0D 4R7AB 4J84A 5H14A 3BWSA 4GQ2P 3JB9L 3P4FA 3SHFA 2MTAH 2G99A 2P9NC 2YBAA 4AOWA 2BCJB 3CFVA 3K27A 4FAVD 5I5IA 2B5LA 3SLED 5EMMB 4JXMA 3DWLC 3JAMg 5SXMA 4A0BA 3ODTA 4L1QD 4CZVA 2I0SA 2P9PC 4FHLA 4H5JA 1YFQA 1PI6A 4Y5RD 2G9AA 5CXCB 3SBRA 4E54B 2OK4A 3EI3B 3OKWA 5CXCA 1U2VC 4J0XA 3PVWB 5FQDA 4OWRA 4GM3A 4JSVC 4OZUA 1GP2B 2J55H 4ESGA 2HESX 5EAMA 2AGYA 3EMHA 4A0AB 4ERYA 5IGQA 3PE7A 4BL0A 5AJAA 1B9YA 4JT5C 3AL8B 3F3GA 5GXIA 1P22A 1RI6A 3AH8B 5FLXg 3OKYB 3V9FA 3RRMC 3HFQA 1MDAH 5TF2A 4FA9D 4QT8A 3AFCA 5IJ7E 2B5NA 3C9CA 1JJUB 4N14A 2AH1A 2HYEA 3VH0A 2H68A 1L0QA 4GZ8A 3PXSD 5B4WA 1QNIA 3JZHA 4A09A 1U4CA 3I7NA 5GSAA 3C75H 4A7JA 5CXBB 4CI2A 4U7AA 3W15A 2H9MA 2IUQA 3OKYA 3OKTA 2TRCB 3I8EA 3MKQA 4HDJA 5AFU3 2BBKH 4GGCA 4AEZA 4U1EI 4CI8A 3JRPA 3I7LA 3OW8A 4J82A 3UVOA 2QC5A 4XYIA 1S4UX 1K8KC 4L3GD 3UVMA 4J77A 2CN2A 5EARA 4E54A 1GXRA 2Z2NA 4J8BA 4L9OA 5I5JA 2AQ5A 1N6FA 3DM0A 3J80g 2CE9A 5H1MA 4CY2A 5EAPA 2J57G 1PGUA 5GXHA 1GOTB 3UVLA 3L4OD 1XHMA 2Q7QA 4TZ4A 2CO0C 4ZN4A 3MZLA 1MG3A 5GMKn 2P9KC 3PSLA 4CC9A 4CZXA 3EI1B 4GGAA 3MXXA 1PEVA 4A09B 2I0RA 4D6VA 5FA5B 4QL1A 3FGBA 3GFCA 3F3FA 3PXWD 3RN1D 3DXKC 2OK6A 4GQ1A 1TBGA 2CO0A 1SQ9A 4GM9A 2P9UC 5JWZA 4CY5A 4CI1A 1FWXA 4LG8A 5FKRA 3SFZA 4A08A 5EMLB 5IJ8E 5FKTA 4A11B 4FA5D 5KDOB 3BG1A 2AGXA 2GC4A 3I8CA 2H47A 2OVPB 4PBYA 3SBPA 3MMYA 3EG6A 2IWKA 2YMUA 3FRXA 2PM9B 3DXMC 1SQJA 4BUJC 5HE0B 3PSCB 2OIZA 5TEEA 2H14A 1SHYB 3I7PA 3PVUB 5FKQA 3IJ1A 3KRWB 3VGZA 3RMZD 2IAAA 4A2MA 4CY1A 3IIYA 2XYIA 4ES0A 4MK0B 4JD2C 2P9IC 3C99A 1B9XA 2H9PA 4J86A 1ERJA 4O3TB 4JSPC 5H17A 3OTTA 3EI1A 2UZXB 4CZYA 3UKRC 4A0BB 5TEFA 5FKSA 2I3TA 4K3ID 1NEXB 4O3UB 3A0FA 2P9LC 3V7DB 1JMXB 3I7HA 4I79A 3RLMD 4D0KA 2YNNA 5IC7A 1N6EA 1OLZA 3UKUC 3U4YA 4X3EA 4J79A
chains in the Genus database with same CATH superfamily
1XIPA 3OL2A 2XU7A 4UI9R 2VDRA 3MZKA 3IJEA 3SCYA 2YNPA 2OVQB 2HJ4A 3EWEA 4LGNA 3C5MA 3JZNA 5HE2B 4X61B 3IKOA 5FXYA 3E0CA 5HYNB 3J81g 4K3JB 2I3SA 4J81A 3ORVD 4AN1A 1PBYB 1UOPA 5TDHB 3SVWD 4DNVA 4Z8LA 5C2VB 3EI4B 3AL9A 2CN3A 4YVDA 1C9IA 4BP9A 3BG0A 2P9SC 3SBQA 1TYQC 2UZYB 3KRXB 2O9KA 3MUNA 3O4GA 1Q47A 3NVQA 4J0WA 4WK0A 5M5SA 5IT9g 4JHNA 4KFMB 4ERZA 2VDPA 3SJLD 3I89A 4O45A 3MVDK 4A0AA 2Z2PA 2VC2A 5EM2B 2PM7B 2B5MA 2VDLA 5CXBA 3EI4A 3B7FA 2OJYA 4ERQA 2CE8A 4EWRA 3GREA 4A11A 2I0TA 2H6NA 2HKMA 1H2ZA 3EQ8A 3SN6B 2CNXA 2HKRA 5C86A 1E8MA 5HQGA 4ZOVA 2H3XA 2Z2OA 4MMZA 3N0DA 3DSMA 4RE6A 4NAAA 4PSWB 3V5WB 1JV2A 5IGOA 3IUNA 4GM8A 5CYKA 5C9ZB 2J56H 4FA1D 1OMWB 3UR4A 4QRJA 4FAND 3CIKB 3OL2B 1K32A 3PXTD 2PBIB 3ULEC 4FB1D 4XEIC 2PM6B 2GC7A 3UVNA 4PXWA 3EQ9A 3RFHA 5I5MA 3SMRA 4ZOYA 4J78A 2OVRB 3K26A 1QFMA 5CYKB 3F3PA 4GMBA 3SWSD 1N6DA 2HJBA 3JZGA 3ZDYA 4FWWA 5A2Qg 1JOFA 4G1MA 4PBZA 4JSNC 4CI3A 3N0EA 3T3PA 3L4MD 4E5ZB 2IUPA 4QAMA 1VYHC 3IJ0A 4Y7RA 4IA9A 3EI3A 2WQ8A 4BH6A 4IMMA 4NSXA 2VZ3A 5HE3B 3NVXA 4CY3A 2IURA 4O1QD 4BP8A 2QZPA 4X63B 5E6SA 3JPXA 5EMJB 5EM2A 2YNOA 4QQEA 2PM9A 2B4EA 4J87A 4JT6C 3NVNA 4WK4A 4Z7QA 4NBMA 5EALA 4PC0A 4DNWA 3IJCA 3SXTD 2HXCA 1NR0A 5K19A 3NIFA 1A0RB 3GD1I 2GNQA 1MG2A 1JTDB 4O02A 4H5IA 4X60B 2H9NA 4NC4A 2W18A 3CFSB 5EMKB 5FFGA 4Z7OA 4GQBB 3ZDXA 1VE6A 4GGDA 4XYHA 2IUVA 3FM0A 1XKSA 4G55A 3JROA 3RFGA 2XL2A 4ZOXA 5E6RA 4FA4D 2H6KA 1GG2B 4JSXC 3IUQA 1K3IA 4A08B 5C2WB 3EI2A 2YB8B 2JKXA 2XL3A 3I7OA 2AGWA 4A2LA 3I2NA 4LG9A 4E5ZA 2AH0A 5AMSA 2H6QA 4L3HD 4J8GA 4PNKB 1R5MA 4G56B 4ZOZA 2IWFA 2XDWA 3EU7A 2AGZA 3RSEC 4O9DA 4PSXB 3UVKA 3I7KA 2QXVA 3EI2B 3IULA 1JMZB 4AMYA 5HE1B 2AGLA 4NENA 5E6UA 4J73A 2H9LA 3ZWLB 5K1CC 3AL8A 3VA6A 3MKSB 2EBSA 2H13A 3IIWA 5THAA 3RN0D 4R7AB 4J84A 5H14A 3BWSA 4GQ2P 3ZDZA 3JB9L 3P4FA 3SHFA 3K71A 2MTAH 2G99A 2P9NC 2YBAA 1VZ3A 4AOWA 2BCJB 3CFVA 3K27A 4FAVD 5I5IA 1L5GA 2B5LA 3SLED 4BCDA 5EMMB 3O4JA 1M1XA 4JXMA 3DWLC 3JAMg 5SXMA 4A0BA 3ODTA 4L1QD 4CZVA 2I0SA 2P9PC 4FHLA 4H5JA 1YFQA 1PI6A 4Y5RD 2G9AA 3VI4A 5M5UA 5CXCB 3K6SA 2VDQA 1VZ2A 3SBRA 4E54B 2OK4A 3EI3B 3OKWA 5CXCA 1U2VC 4MMYA 4AX4A 4J0XA 3PVWB 5FQDA 4OWRA 4GM3A 3VI3A 1H2YA 1GP2B 4JSVC 2J55H 4OZUA 2HESX 4ESGA 5EAMA 2AGYA 3EMHA 4A0AB 4ERYA 5IGQA 3PE7A 2QR5A 3V4VA 4L1MA 4BL0A 5AJAA 1A12A 1B9YA 4JT5C 3AL8B 3F3GA 5GXIA 1P22A 1RI6A 3AH8B 2XZGA 4Z7NA 4AN0A 1TYEA 3FCUA 5FLXg 2HU8A 3OKYB 3V9FA 1E8NA 3RRMC 3GC3B 3HFQA 1MDAH 5TF2A 4FA9D 4QT8A 1UOQA 3AFCA 5IJ7E 4RE5A 2B5NA 3C9CA 1JJUB 4N14A 2AH1A 2HYEA 3VH0A 5M5RA 3OF7A 2H68A 1UOOA 3ZE2A 1L0QA 1T2XA 5M61A 4GZ8A 3PXSD 3FCSA 5HDBA 5B4WA 1QNIA 3JZHA 4A09A 2EIDA 1U4CA 3I7NA 5GSAA 3C75H 4A7JA 5CXBB 3ZE0A 4CI2A 1GOGA 4U7AA 5C92A 3W15A 2H9MA 2IUQA 3OKYA 3OKTA 2TRCB 3I8EA 3MKQA 4HDJA 5AFU3 2BBKH 2BKLA 1VE7A 4GGCA 4AEZA 4U1EI 4CI8A 5FFOA 3JRPA 3I7LA 1QFSA 2VDKA 3OW8A 4J82A 3UVOA 3T3MA 2QC5A 4XYIA 4O2WA 1S4UX 3DDUA 1K8KC 4L3GD 3UVMA 4J77A 2CN2A 3NIDA 5EARA 4E54A 1GXRA 3V4PA 2Z2NA 4J8BA 4L9OA 4MMXA 1O6FA 5I5JA 2AQ5A 1N6FA 3DM0A 1YR2A 1I2MB 3J80g 2CE9A 5H1MA 4CY2A 5EAPA 2J57G 1PGUA 5M5VA 1C9LA 4G1EA 5GXHA 1GOTB 3UVLA 3L4OD 1GOHA 1XHMA 3ZE1A 2EIEA 2Q7QA 4TZ4A 2HU7A 2CO0C 1H2WA 4ZN4A 1GOFA 1H2XA 3NIGA 3IURA 1O6GA 3MZLA 1MG3A 4IRZA 5GMKn 1E5TA 2P9KC 3PSLA 1UTCA 4UM8A 4CC9A 4CZXA 3EI1B 4GGAA 3MXXA 1PEVA 4A09B 2I0RA 2VDMA 4D9SA 4D6VA 5FA5B 4QL1A 3FGBA 4BCCA 4BCBA 3GFCA 3F3FA 1BPOA 3PXWD 3RN1D 3DXKC 1U8CA 2OK6A 4GQ1A 1TBGA 2CO0A 1SQ9A 2VZ1A 4GM9A 2P9UC 5JWZA 4CY5A 4CI1A 2HU5A 3IVMA 1FWXA 2EICA 4LG8A 4WK2A 5FKRA 3SFZA 4A08A 5EMLB 5IJ8E 5FKTA 4A11B 4FA5D 5KDOB 3BG1A 2AGXA 3I8CA 2GC4A 2H47A 3O4IA 2OVPB 4PBYA 3SBPA 2EIBA 3MMYA 3EG6A 2IWKA 2XE4A 2VDOA 2YMUA 4DNUA 3FRXA 2PM9B 3DXMC 1SQJA 4WJKA 4BUJC 3K72A 3PSCB 5HE0B 2OIZA 5TEEA 2H14A 1SHYB 3I7PA 3PVUB 5FKQA 3IJ1A 3KRWB 3EQ7A 3QI0A 3VGZA 3RMZD 2IAAA 4A2MA 5M5TA 4CY1A 3IIYA 4AMZA 2XYIA 4ES0A 4MK0B 4JD2C 2P9IC 3C99A 1B9XA 2H9PA 4J86A 1ERJA 4O3TB 4JSPC 5H17A 3IUJA 3OTTA 3KCIA 3EI1A 2UZXB 4CZYA 3UKRC 4A0BB 5TEFA 4JHPC 5FKSA 2I3TA 4K3ID 1NEXB 2VDNA 3MUOA 4O3UB 3A0FA 2P9LC 3QHYB 3O4HA 3V7DB 1JMXB 3I7HA 4I79A 3RLMD 4UM9A 4D0KA 2YNNA 5IC7A 1N6EA 1OLZA 3IUMA 3UKUC 3U4YA 4X3EA 4J79A
chains in the Genus database with same CATH topology
1XIPA 3OL2A 2XU7A 4UI9R 3MZKA 3SCYA 2YNPA 2OVQB 2HJ4A 3EWEA 4LGNA 3C5MA 3JZNA 5HE2B 4X61B 3IKOA 5FXYA 3E0CA 5HYNB 3J81g 4K3JB 2I3SA 4J81A 3ORVD 1PBYB 5TDHB 3SVWD 4Z8LA 5C2VB 3EI4B 3AL9A 2CN3A 4YVDA 3BG0A 2P9SC 3SBQA 1TYQC 2UZYB 3KRXB 2O9KA 5IT9g 1Q47A 3NVQA 4J0WA 4KFMB 4ERZA 3SJLD 3I89A 4O45A 4A0AA 2Z2PA 5EM2B 2PM7B 2B5MA 5CXBA 3EI4A 3B7FA 2OJYA 4ERQA 2CE8A 4EWRA 3GREA 4A11A 2I0TA 2H6NA 2HKMA 3SN6B 2CNXA 2HKRA 5HQGA 4ZOVA 2H3XA 2Z2OA 3N0DA 3DSMA 4PSWB 3V5WB 5IGOA 4GM8A 5CYKA 5C9ZB 2J56H 4FA1D 1OMWB 3UR4A 4QRJA 4FAND 3CIKB 3OL2B 1K32A 2PBIB 3PXTD 3ULEC 4FB1D 4XEIC 2PM6B 2GC7A 3UVNA 4PXWA 3RFHA 5I5MA 3SMRA 4ZOYA 4J78A 2OVRB 3K26A 5CYKB 3F3PA 4GMBA 3SWSD 1N6DA 2HJBA 3JZGA 4FWWA 5A2Qg 1JOFA 4PBZA 4JSNC 4CI3A 3N0EA 3L4MD 4E5ZB 2IUPA 1VYHC 3IJ0A 4Y7RA 4IA9A 3EI3A 4BH6A 4IMMA 4NSXA 5HE3B 3NVXA 4CY3A 2IURA 4O1QD 4X63B 3JPXA 5EMJB 5EM2A 2YNOA 4QQEA 2PM9A 2B4EA 4J87A 4JT6C 3NVNA 5EALA 4PC0A 3IJCA 3SXTD 2HXCA 1NR0A 5K19A 1A0RB 2GNQA 1MG2A 4H5IA 4X60B 2H9NA 2W18A 3CFSB 5EMKB 4GQBB 4GGDA 4XYHA 2IUVA 3FM0A 1XKSA 3JROA 3RFGA 2XL2A 4ZOXA 4FA4D 2H6KA 1GG2B 4JSXC 4A08B 5C2WB 3EI2A 2YB8B 2XL3A 3I7OA 2AGWA 4A2LA 3I2NA 4LG9A 4E5ZA 2AH0A 5AMSA 2H6QA 4L3HD 4J8GA 4PNKB 1R5MA 4G56B 4ZOZA 2IWFA 3EU7A 2AGZA 3RSEC 4O9DA 4PSXB 3UVKA 3I7KA 2QXVA 3EI2B 1JMZB 5HE1B 2AGLA 4J73A 2H9LA 3ZWLB 5K1CC 3AL8A 3VA6A 3MKSB 2EBSA 2H13A 3IIWA 5THAA 3RN0D 4R7AB 4J84A 5H14A 3BWSA 4GQ2P 3JB9L 3P4FA 3SHFA 2MTAH 2G99A 2P9NC 2YBAA 4AOWA 2BCJB 3CFVA 3K27A 4FAVD 5I5IA 2B5LA 3SLED 5EMMB 4JXMA 3DWLC 3JAMg 5SXMA 4A0BA 3ODTA 4L1QD 4CZVA 2I0SA 2P9PC 4FHLA 4H5JA 1YFQA 1PI6A 4Y5RD 2G9AA 5CXCB 3SBRA 4E54B 2OK4A 3EI3B 3OKWA 5CXCA 1U2VC 4J0XA 3PVWB 5FQDA 4OWRA 4GM3A 4JSVC 4OZUA 1GP2B 2J55H 4ESGA 2HESX 5EAMA 2AGYA 3EMHA 4A0AB 4ERYA 5IGQA 3PE7A 4BL0A 5AJAA 1B9YA 4JT5C 3AL8B 3F3GA 5GXIA 1P22A 1RI6A 3AH8B 5FLXg 3OKYB 3V9FA 3RRMC 3HFQA 1MDAH 5TF2A 4FA9D 4QT8A 3AFCA 5IJ7E 2B5NA 3C9CA 1JJUB 4N14A 2AH1A 2HYEA 3VH0A 2H68A 1L0QA 4GZ8A 3PXSD 5B4WA 1QNIA 3JZHA 4A09A 1U4CA 3I7NA 5GSAA 3C75H 4A7JA 5CXBB 4CI2A 4U7AA 3W15A 2H9MA 2IUQA 3OKYA 3OKTA 2TRCB 3I8EA 3MKQA 4HDJA 5AFU3 2BBKH 4GGCA 4AEZA 4U1EI 4CI8A 3JRPA 3I7LA 3OW8A 4J82A 3UVOA 2QC5A 4XYIA 1S4UX 1K8KC 4L3GD 3UVMA 4J77A 2CN2A 5EARA 4E54A 1GXRA 2Z2NA 4J8BA 4L9OA 5I5JA 2AQ5A 1N6FA 3DM0A 3J80g 2CE9A 5H1MA 4CY2A 5EAPA 2J57G 1PGUA 5GXHA 1GOTB 3UVLA 3L4OD 1XHMA 2Q7QA 4TZ4A 2CO0C 4ZN4A 3MZLA 1MG3A 5GMKn 2P9KC 3PSLA 4CC9A 4CZXA 3EI1B 4GGAA 3MXXA 1PEVA 4A09B 2I0RA 4D6VA 5FA5B 4QL1A 3FGBA 3GFCA 3F3FA 3PXWD 3RN1D 3DXKC 2OK6A 4GQ1A 1TBGA 2CO0A 1SQ9A 4GM9A 2P9UC 5JWZA 4CY5A 4CI1A 1FWXA 4LG8A 5FKRA 3SFZA 4A08A 5EMLB 5IJ8E 5FKTA 4A11B 4FA5D 5KDOB 3BG1A 2AGXA 2GC4A 3I8CA 2H47A 2OVPB 4PBYA 3SBPA 3MMYA 3EG6A 2IWKA 2YMUA 3FRXA 2PM9B 3DXMC 1SQJA 4BUJC 5HE0B 3PSCB 2OIZA 5TEEA 2H14A 1SHYB 3I7PA 3PVUB 5FKQA 3IJ1A 3KRWB 3VGZA 3RMZD 2IAAA 4A2MA 4CY1A 3IIYA 2XYIA 4ES0A 4MK0B 4JD2C 2P9IC 3C99A 1B9XA 2H9PA 4J86A 1ERJA 4O3TB 4JSPC 5H17A 3OTTA 3EI1A 2UZXB 4CZYA 3UKRC 4A0BB 5TEFA 5FKSA 2I3TA 4K3ID 1NEXB 4O3UB 3A0FA 2P9LC 3V7DB 1JMXB 3I7HA 4I79A 3RLMD 4D0KA 2YNNA 5IC7A 1N6EA 1OLZA 3UKUC 3U4YA 4X3EA 4J79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIP A;  3OL2 A;  2XU7 A;  4UI9 R;  3MZK A;  3SCY A;  2YNP A;  2OVQ B;  2HJ4 A;  3EWE A;  4LGN A;  3C5M A;  3JZN A;  5HE2 B;  4X61 B;  3IKO A;  5FXY A;  3E0C A;  5HYN B;  3J81 g;  4K3J B;  2I3S A;  4J81 A;  3ORV D;  1PBY B;  5TDH B;  3SVW D;  4Z8L A;  5C2V B;  3EI4 B;  3AL9 A;  2CN3 A;  4YVD A;  3BG0 A;  2P9S C;  3SBQ A;  1TYQ C;  2UZY B;  3KRX B;  2O9K A;  5IT9 g;  1Q47 A;  3NVQ A;  4J0W A;  4KFM B;  4ERZ A;  3SJL D;  3I89 A;  4O45 A;  4A0A A;  2Z2P A;  5EM2 B;  2PM7 B;  2B5M A;  5CXB A;  3EI4 A;  3B7F A;  2OJY A;  4ERQ A;  2CE8 A;  4EWR A;  3GRE A;  4A11 A;  2I0T A;  2H6N A;  2HKM A;  3SN6 B;  2CNX A;  2HKR A;  5HQG A;  4ZOV A;  2H3X A;  2Z2O A;  3N0D A;  3DSM A;  4PSW B;  3V5W B;  5IGO A;  4GM8 A;  5CYK A;  5C9Z B;  2J56 H;  4FA1 D;  1OMW B;  3UR4 A;  4QRJ A;  4FAN D;  3CIK B;  3OL2 B;  1K32 A;  2PBI B;  3PXT D;  3ULE C;  4FB1 D;  4XEI C;  2PM6 B;  2GC7 A;  3UVN A;  4PXW A;  3RFH A;  5I5M A;  3SMR A;  4ZOY A;  4J78 A;  2OVR B;  3K26 A;  5CYK B;  3F3P A;  4GMB A;  3SWS D;  1N6D A;  2HJB A;  3JZG A;  4FWW A;  5A2Q g;  1JOF A;  4PBZ A;  4JSN C;  4CI3 A;  3N0E A;  3L4M D;  4E5Z B;  2IUP A;  1VYH C;  3IJ0 A;  4Y7R A;  4IA9 A;  3EI3 A;  4BH6 A;  4IMM A;  4NSX A;  5HE3 B;  3NVX A;  4CY3 A;  2IUR A;  4O1Q D;  4X63 B;  3JPX A;  5EMJ B;  5EM2 A;  2YNO A;  4QQE A;  2PM9 A;  2B4E A;  4J87 A;  4JT6 C;  3NVN A;  5EAL A;  4PC0 A;  3IJC A;  3SXT D;  2HXC A;  1NR0 A;  5K19 A;  1A0R B;  2GNQ A;  1MG2 A;  4H5I A;  4X60 B;  2H9N A;  2W18 A;  3CFS B;  5EMK B;  4GQB B;  4GGD A;  4XYH A;  2IUV A;  3FM0 A;  1XKS A;  3JRO A;  3RFG A;  2XL2 A;  4ZOX A;  4FA4 D;  2H6K A;  1GG2 B;  4JSX C;  4A08 B;  5C2W B;  3EI2 A;  2YB8 B;  2XL3 A;  3I7O A;  2AGW A;  4A2L A;  3I2N A;  4LG9 A;  4E5Z A;  2AH0 A;  5AMS A;  2H6Q A;  4L3H D;  4J8G A;  4PNK B;  1R5M A;  4G56 B;  4ZOZ A;  2IWF A;  3EU7 A;  2AGZ A;  3RSE C;  4O9D A;  4PSX B;  3UVK A;  3I7K A;  2QXV A;  3EI2 B;  1JMZ B;  5HE1 B;  2AGL A;  4J73 A;  2H9L A;  3ZWL B;  5K1C C;  3AL8 A;  3VA6 A;  3MKS B;  2EBS A;  2H13 A;  3IIW A;  5THA A;  3RN0 D;  4R7A B;  4J84 A;  5H14 A;  3BWS A;  4GQ2 P;  3JB9 L;  3P4F A;  3SHF A;  2MTA H;  2G99 A;  2P9N C;  2YBA A;  4AOW A;  2BCJ B;  3CFV A;  3K27 A;  4FAV D;  5I5I A;  2B5L A;  3SLE D;  5EMM B;  4JXM A;  3DWL C;  3JAM g;  5SXM A;  4A0B A;  3ODT A;  4L1Q D;  4CZV A;  2I0S A;  2P9P C;  4FHL A;  4H5J A;  1YFQ A;  1PI6 A;  4Y5R D;  2G9A A;  5CXC B;  3SBR A;  4E54 B;  2OK4 A;  3EI3 B;  3OKW A;  5CXC A;  1U2V C;  4J0X A;  3PVW B;  5FQD A;  4OWR A;  4GM3 A;  4JSV C;  4OZU A;  1GP2 B;  2J55 H;  4ESG A;  2HES X;  5EAM A;  2AGY A;  3EMH A;  4A0A B;  4ERY A;  5IGQ A;  3PE7 A;  4BL0 A;  5AJA A;  1B9Y A;  4JT5 C;  3AL8 B;  3F3G A;  5GXI A;  1P22 A;  1RI6 A;  3AH8 B;  5FLX g;  3OKY B;  3V9F A;  3RRM C;  3HFQ A;  1MDA H;  5TF2 A;  4FA9 D;  4QT8 A;  3AFC A;  5IJ7 E;  2B5N A;  3C9C A;  1JJU B;  4N14 A;  2AH1 A;  2HYE A;  3VH0 A;  2H68 A;  1L0Q A;  4GZ8 A;  3PXS D;  5B4W A;  1QNI A;  3JZH A;  4A09 A;  1U4C A;  3I7N A;  5GSA A;  3C75 H;  4A7J A;  5CXB B;  4CI2 A;  4U7A A;  3W15 A;  2H9M A;  2IUQ A;  3OKY A;  3OKT A;  2TRC B;  3I8E A;  3MKQ A;  4HDJ A;  5AFU 3;  2BBK H;  4GGC A;  4AEZ A;  4U1E I;  4CI8 A;  3JRP A;  3I7L A;  3OW8 A;  4J82 A;  3UVO A;  2QC5 A;  4XYI A;  1S4U X;  1K8K C;  4L3G D;  3UVM A;  4J77 A;  2CN2 A;  5EAR A;  4E54 A;  1GXR A;  2Z2N A;  4J8B A;  4L9O A;  5I5J A;  2AQ5 A;  1N6F A;  3DM0 A;  3J80 g;  2CE9 A;  5H1M A;  4CY2 A;  5EAP A;  2J57 G;  1PGU A;  5GXH A;  1GOT B;  3UVL A;  3L4O D;  1XHM A;  2Q7Q A;  4TZ4 A;  2CO0 C;  4ZN4 A;  3MZL A;  1MG3 A;  5GMK n;  2P9K C;  3PSL A;  4CC9 A;  4CZX A;  3EI1 B;  4GGA A;  3MXX A;  1PEV A;  4A09 B;  2I0R A;  4D6V A;  5FA5 B;  4QL1 A;  3FGB A;  3GFC A;  3F3F A;  3PXW D;  3RN1 D;  3DXK C;  2OK6 A;  4GQ1 A;  1TBG A;  2CO0 A;  1SQ9 A;  4GM9 A;  2P9U C;  5JWZ A;  4CY5 A;  4CI1 A;  1FWX A;  4LG8 A;  5FKR A;  3SFZ A;  4A08 A;  5EML B;  5IJ8 E;  5FKT A;  4A11 B;  4FA5 D;  5KDO B;  3BG1 A;  2AGX A;  2GC4 A;  3I8C A;  2H47 A;  2OVP B;  4PBY A;  3SBP A;  3MMY A;  3EG6 A;  2IWK A;  2YMU A;  3FRX A;  2PM9 B;  3DXM C;  1SQJ A;  4BUJ C;  5HE0 B;  3PSC B;  2OIZ A;  5TEE A;  2H14 A;  1SHY B;  3I7P A;  3PVU B;  5FKQ A;  3IJ1 A;  3KRW B;  3VGZ A;  3RMZ D;  2IAA A;  4A2M A;  4CY1 A;  3IIY A;  2XYI A;  4ES0 A;  4MK0 B;  4JD2 C;  2P9I C;  3C99 A;  1B9X A;  2H9P A;  4J86 A;  1ERJ A;  4O3T B;  4JSP C;  5H17 A;  3OTT A;  3EI1 A;  2UZX B;  4CZY A;  3UKR C;  4A0B B;  5TEF A;  5FKS A;  2I3T A;  4K3I D;  1NEX B;  4O3U B;  3A0F A;  2P9L C;  3V7D B;  1JMX B;  3I7H A;  4I79 A;  3RLM D;  4D0K A;  2YNN A;  5IC7 A;  1N6E A;  1OLZ A;  3UKU C;  3U4Y A;  4X3E A;  4J79 A; 
#chains in the Genus database with same CATH topology
 1XIP A;  3OL2 A;  2XU7 A;  4UI9 R;  2VDR A;  3MZK A;  3IJE A;  3SCY A;  2YNP A;  2OVQ B;  2HJ4 A;  3EWE A;  4LGN A;  3C5M A;  3JZN A;  5HE2 B;  4X61 B;  3IKO A;  5FXY A;  3E0C A;  5HYN B;  3J81 g;  4K3J B;  2I3S A;  4J81 A;  3ORV D;  4AN1 A;  1PBY B;  1UOP A;  5TDH B;  3SVW D;  4DNV A;  4Z8L A;  5C2V B;  3EI4 B;  3AL9 A;  2CN3 A;  4YVD A;  1C9I A;  4BP9 A;  3BG0 A;  2P9S C;  3SBQ A;  1TYQ C;  2UZY B;  3KRX B;  2O9K A;  3MUN A;  3O4G A;  1Q47 A;  3NVQ A;  4J0W A;  4WK0 A;  5M5S A;  5IT9 g;  4JHN A;  4KFM B;  4ERZ A;  2VDP A;  3SJL D;  3I89 A;  4O45 A;  3MVD K;  4A0A A;  2Z2P A;  2VC2 A;  5EM2 B;  2PM7 B;  2B5M A;  2VDL A;  5CXB A;  3EI4 A;  3B7F A;  2OJY A;  4ERQ A;  2CE8 A;  4EWR A;  3GRE A;  4A11 A;  2I0T A;  2H6N A;  2HKM A;  1H2Z A;  3EQ8 A;  3SN6 B;  2CNX A;  2HKR A;  5C86 A;  1E8M A;  5HQG A;  4ZOV A;  2H3X A;  2Z2O A;  4MMZ A;  3N0D A;  3DSM A;  4RE6 A;  4NAA A;  4PSW B;  3V5W B;  1JV2 A;  5IGO A;  3IUN A;  4GM8 A;  5CYK A;  5C9Z B;  2J56 H;  4FA1 D;  1OMW B;  3UR4 A;  4QRJ A;  4FAN D;  3CIK B;  3OL2 B;  1K32 A;  3PXT D;  2PBI B;  3ULE C;  4FB1 D;  4XEI C;  2PM6 B;  2GC7 A;  3UVN A;  4PXW A;  3EQ9 A;  3RFH A;  5I5M A;  3SMR A;  4ZOY A;  4J78 A;  2OVR B;  3K26 A;  1QFM A;  5CYK B;  3F3P A;  4GMB A;  3SWS D;  1N6D A;  2HJB A;  3JZG A;  3ZDY A;  4FWW A;  5A2Q g;  1JOF A;  4G1M A;  4PBZ A;  4JSN C;  4CI3 A;  3N0E A;  3T3P A;  3L4M D;  4E5Z B;  2IUP A;  4QAM A;  1VYH C;  3IJ0 A;  4Y7R A;  4IA9 A;  3EI3 A;  2WQ8 A;  4BH6 A;  4IMM A;  4NSX A;  2VZ3 A;  5HE3 B;  3NVX A;  4CY3 A;  2IUR A;  4O1Q D;  4BP8 A;  2QZP A;  4X63 B;  5E6S A;  3JPX A;  5EMJ B;  5EM2 A;  2YNO A;  4QQE A;  2PM9 A;  2B4E A;  4J87 A;  4JT6 C;  3NVN A;  4WK4 A;  4Z7Q A;  4NBM A;  5EAL A;  4PC0 A;  4DNW A;  3IJC A;  3SXT D;  2HXC A;  1NR0 A;  5K19 A;  3NIF A;  1A0R B;  3GD1 I;  2GNQ A;  1MG2 A;  1JTD B;  4O02 A;  4H5I A;  4X60 B;  2H9N A;  4NC4 A;  2W18 A;  3CFS B;  5EMK B;  5FFG A;  4Z7O A;  4GQB B;  3ZDX A;  1VE6 A;  4GGD A;  4XYH A;  2IUV A;  3FM0 A;  1XKS A;  4G55 A;  3JRO A;  3RFG A;  2XL2 A;  4ZOX A;  5E6R A;  4FA4 D;  2H6K A;  1GG2 B;  4JSX C;  3IUQ A;  1K3I A;  4A08 B;  5C2W B;  3EI2 A;  2YB8 B;  2JKX A;  2XL3 A;  3I7O A;  2AGW A;  4A2L A;  3I2N A;  4LG9 A;  4E5Z A;  2AH0 A;  5AMS A;  2H6Q A;  4L3H D;  4J8G A;  4PNK B;  1R5M A;  4G56 B;  4ZOZ A;  2IWF A;  2XDW A;  3EU7 A;  2AGZ A;  3RSE C;  4O9D A;  4PSX B;  3UVK A;  3I7K A;  2QXV A;  3EI2 B;  3IUL A;  1JMZ B;  4AMY A;  5HE1 B;  2AGL A;  4NEN A;  5E6U A;  4J73 A;  2H9L A;  3ZWL B;  5K1C C;  3AL8 A;  3VA6 A;  3MKS B;  2EBS A;  2H13 A;  3IIW A;  5THA A;  3RN0 D;  4R7A B;  4J84 A;  5H14 A;  3BWS A;  4GQ2 P;  3ZDZ A;  3JB9 L;  3P4F A;  3SHF A;  3K71 A;  2MTA H;  2G99 A;  2P9N C;  2YBA A;  1VZ3 A;  4AOW A;  2BCJ B;  3CFV A;  3K27 A;  4FAV D;  5I5I A;  1L5G A;  2B5L A;  3SLE D;  4BCD A;  5EMM B;  3O4J A;  1M1X A;  4JXM A;  3DWL C;  3JAM g;  5SXM A;  4A0B A;  3ODT A;  4L1Q D;  4CZV A;  2I0S A;  2P9P C;  4FHL A;  4H5J A;  1YFQ A;  1PI6 A;  4Y5R D;  2G9A A;  3VI4 A;  5M5U A;  5CXC B;  3K6S A;  2VDQ A;  1VZ2 A;  3SBR A;  4E54 B;  2OK4 A;  3EI3 B;  3OKW A;  5CXC A;  1U2V C;  4MMY A;  4AX4 A;  4J0X A;  3PVW B;  5FQD A;  4OWR A;  4GM3 A;  3VI3 A;  1H2Y A;  1GP2 B;  4JSV C;  2J55 H;  4OZU A;  2HES X;  4ESG A;  5EAM A;  2AGY A;  3EMH A;  4A0A B;  4ERY A;  5IGQ A;  3PE7 A;  2QR5 A;  3V4V A;  4L1M A;  4BL0 A;  5AJA A;  1A12 A;  1B9Y A;  4JT5 C;  3AL8 B;  3F3G A;  5GXI A;  1P22 A;  1RI6 A;  3AH8 B;  2XZG A;  4Z7N A;  4AN0 A;  1TYE A;  3FCU A;  5FLX g;  2HU8 A;  3OKY B;  3V9F A;  1E8N A;  3RRM C;  3GC3 B;  3HFQ A;  1MDA H;  5TF2 A;  4FA9 D;  4QT8 A;  1UOQ A;  3AFC A;  5IJ7 E;  4RE5 A;  2B5N A;  3C9C A;  1JJU B;  4N14 A;  2AH1 A;  2HYE A;  3VH0 A;  5M5R A;  3OF7 A;  2H68 A;  1UOO A;  3ZE2 A;  1L0Q A;  1T2X A;  5M61 A;  4GZ8 A;  3PXS D;  3FCS A;  5HDB A;  5B4W A;  1QNI A;  3JZH A;  4A09 A;  2EID A;  1U4C A;  3I7N A;  5GSA A;  3C75 H;  4A7J A;  5CXB B;  3ZE0 A;  4CI2 A;  1GOG A;  4U7A A;  5C92 A;  3W15 A;  2H9M A;  2IUQ A;  3OKY A;  3OKT A;  2TRC B;  3I8E A;  3MKQ A;  4HDJ A;  5AFU 3;  2BBK H;  2BKL A;  1VE7 A;  4GGC A;  4AEZ A;  4U1E I;  4CI8 A;  5FFO A;  3JRP A;  3I7L A;  1QFS A;  2VDK A;  3OW8 A;  4J82 A;  3UVO A;  3T3M A;  2QC5 A;  4XYI A;  4O2W A;  1S4U X;  3DDU A;  1K8K C;  4L3G D;  3UVM A;  4J77 A;  2CN2 A;  3NID A;  5EAR A;  4E54 A;  1GXR A;  3V4P A;  2Z2N A;  4J8B A;  4L9O A;  4MMX A;  1O6F A;  5I5J A;  2AQ5 A;  1N6F A;  3DM0 A;  1YR2 A;  1I2M B;  3J80 g;  2CE9 A;  5H1M A;  4CY2 A;  5EAP A;  2J57 G;  1PGU A;  5M5V A;  1C9L A;  4G1E A;  5GXH A;  1GOT B;  3UVL A;  3L4O D;  1GOH A;  1XHM A;  3ZE1 A;  2EIE A;  2Q7Q A;  4TZ4 A;  2HU7 A;  2CO0 C;  1H2W A;  4ZN4 A;  1GOF A;  1H2X A;  3NIG A;  3IUR A;  1O6G A;  3MZL A;  1MG3 A;  4IRZ A;  5GMK n;  1E5T A;  2P9K C;  3PSL A;  1UTC A;  4UM8 A;  4CC9 A;  4CZX A;  3EI1 B;  4GGA A;  3MXX A;  1PEV A;  4A09 B;  2I0R A;  2VDM A;  4D9S A;  4D6V A;  5FA5 B;  4QL1 A;  3FGB A;  4BCC A;  4BCB A;  3GFC A;  3F3F A;  1BPO A;  3PXW D;  3RN1 D;  3DXK C;  1U8C A;  2OK6 A;  4GQ1 A;  1TBG A;  2CO0 A;  1SQ9 A;  2VZ1 A;  4GM9 A;  2P9U C;  5JWZ A;  4CY5 A;  4CI1 A;  2HU5 A;  3IVM A;  1FWX A;  2EIC A;  4LG8 A;  4WK2 A;  5FKR A;  3SFZ A;  4A08 A;  5EML B;  5IJ8 E;  5FKT A;  4A11 B;  4FA5 D;  5KDO B;  3BG1 A;  2AGX A;  3I8C A;  2GC4 A;  2H47 A;  3O4I A;  2OVP B;  4PBY A;  3SBP A;  2EIB A;  3MMY A;  3EG6 A;  2IWK A;  2XE4 A;  2VDO A;  2YMU A;  4DNU A;  3FRX A;  2PM9 B;  3DXM C;  1SQJ A;  4WJK A;  4BUJ C;  3K72 A;  3PSC B;  5HE0 B;  2OIZ A;  5TEE A;  2H14 A;  1SHY B;  3I7P A;  3PVU B;  5FKQ A;  3IJ1 A;  3KRW B;  3EQ7 A;  3QI0 A;  3VGZ A;  3RMZ D;  2IAA A;  4A2M A;  5M5T A;  4CY1 A;  3IIY A;  4AMZ A;  2XYI A;  4ES0 A;  4MK0 B;  4JD2 C;  2P9I C;  3C99 A;  1B9X A;  2H9P A;  4J86 A;  1ERJ A;  4O3T B;  4JSP C;  5H17 A;  3IUJ A;  3OTT A;  3KCI A;  3EI1 A;  2UZX B;  4CZY A;  3UKR C;  4A0B B;  5TEF A;  4JHP C;  5FKS A;  2I3T A;  4K3I D;  1NEX B;  2VDN A;  3MUO A;  4O3U B;  3A0F A;  2P9L C;  3QHY B;  3O4H A;  3V7D B;  1JMX B;  3I7H A;  4I79 A;  3RLM D;  4UM9 A;  4D0K A;  2YNN A;  5IC7 A;  1N6E A;  1OLZ A;  3IUM A;  3UKU C;  3U4Y A;  4X3E A;  4J79 A; 
#chains in the Genus database with same CATH homology
 1XIP A;  3OL2 A;  2XU7 A;  4UI9 R;  3MZK A;  3SCY A;  2YNP A;  2OVQ B;  2HJ4 A;  3EWE A;  4LGN A;  3C5M A;  3JZN A;  5HE2 B;  4X61 B;  3IKO A;  5FXY A;  3E0C A;  5HYN B;  3J81 g;  4K3J B;  2I3S A;  4J81 A;  3ORV D;  1PBY B;  5TDH B;  3SVW D;  4Z8L A;  5C2V B;  3EI4 B;  3AL9 A;  2CN3 A;  4YVD A;  3BG0 A;  2P9S C;  3SBQ A;  1TYQ C;  2UZY B;  3KRX B;  2O9K A;  5IT9 g;  1Q47 A;  3NVQ A;  4J0W A;  4KFM B;  4ERZ A;  3SJL D;  3I89 A;  4O45 A;  4A0A A;  2Z2P A;  5EM2 B;  2PM7 B;  2B5M A;  5CXB A;  3EI4 A;  3B7F A;  2OJY A;  4ERQ A;  2CE8 A;  4EWR A;  3GRE A;  4A11 A;  2I0T A;  2H6N A;  2HKM A;  3SN6 B;  2CNX A;  2HKR A;  5HQG A;  4ZOV A;  2H3X A;  2Z2O A;  3N0D A;  3DSM A;  4PSW B;  3V5W B;  5IGO A;  4GM8 A;  5CYK A;  5C9Z B;  2J56 H;  4FA1 D;  1OMW B;  3UR4 A;  4QRJ A;  4FAN D;  3CIK B;  3OL2 B;  1K32 A;  2PBI B;  3PXT D;  3ULE C;  4FB1 D;  4XEI C;  2PM6 B;  2GC7 A;  3UVN A;  4PXW A;  3RFH A;  5I5M A;  3SMR A;  4ZOY A;  4J78 A;  2OVR B;  3K26 A;  5CYK B;  3F3P A;  4GMB A;  3SWS D;  1N6D A;  2HJB A;  3JZG A;  4FWW A;  5A2Q g;  1JOF A;  4PBZ A;  4JSN C;  4CI3 A;  3N0E A;  3L4M D;  4E5Z B;  2IUP A;  1VYH C;  3IJ0 A;  4Y7R A;  4IA9 A;  3EI3 A;  4BH6 A;  4IMM A;  4NSX A;  5HE3 B;  3NVX A;  4CY3 A;  2IUR A;  4O1Q D;  4X63 B;  3JPX A;  5EMJ B;  5EM2 A;  2YNO A;  4QQE A;  2PM9 A;  2B4E A;  4J87 A;  4JT6 C;  3NVN A;  5EAL A;  4PC0 A;  3IJC A;  3SXT D;  2HXC A;  1NR0 A;  5K19 A;  1A0R B;  2GNQ A;  1MG2 A;  4H5I A;  4X60 B;  2H9N A;  2W18 A;  3CFS B;  5EMK B;  4GQB B;  4GGD A;  4XYH A;  2IUV A;  3FM0 A;  1XKS A;  3JRO A;  3RFG A;  2XL2 A;  4ZOX A;  4FA4 D;  2H6K A;  1GG2 B;  4JSX C;  4A08 B;  5C2W B;  3EI2 A;  2YB8 B;  2XL3 A;  3I7O A;  2AGW A;  4A2L A;  3I2N A;  4LG9 A;  4E5Z A;  2AH0 A;  5AMS A;  2H6Q A;  4L3H D;  4J8G A;  4PNK B;  1R5M A;  4G56 B;  4ZOZ A;  2IWF A;  3EU7 A;  2AGZ A;  3RSE C;  4O9D A;  4PSX B;  3UVK A;  3I7K A;  2QXV A;  3EI2 B;  1JMZ B;  5HE1 B;  2AGL A;  4J73 A;  2H9L A;  3ZWL B;  5K1C C;  3AL8 A;  3VA6 A;  3MKS B;  2EBS A;  2H13 A;  3IIW A;  5THA A;  3RN0 D;  4R7A B;  4J84 A;  5H14 A;  3BWS A;  4GQ2 P;  3JB9 L;  3P4F A;  3SHF A;  2MTA H;  2G99 A;  2P9N C;  2YBA A;  4AOW A;  2BCJ B;  3CFV A;  3K27 A;  4FAV D;  5I5I A;  2B5L A;  3SLE D;  5EMM B;  4JXM A;  3DWL C;  3JAM g;  5SXM A;  4A0B A;  3ODT A;  4L1Q D;  4CZV A;  2I0S A;  2P9P C;  4FHL A;  4H5J A;  1YFQ A;  1PI6 A;  4Y5R D;  2G9A A;  5CXC B;  3SBR A;  4E54 B;  2OK4 A;  3EI3 B;  3OKW A;  5CXC A;  1U2V C;  4J0X A;  3PVW B;  5FQD A;  4OWR A;  4GM3 A;  4JSV C;  4OZU A;  1GP2 B;  2J55 H;  4ESG A;  2HES X;  5EAM A;  2AGY A;  3EMH A;  4A0A B;  4ERY A;  5IGQ A;  3PE7 A;  4BL0 A;  5AJA A;  1B9Y A;  4JT5 C;  3AL8 B;  3F3G A;  5GXI A;  1P22 A;  1RI6 A;  3AH8 B;  5FLX g;  3OKY B;  3V9F A;  3RRM C;  3HFQ A;  1MDA H;  5TF2 A;  4FA9 D;  4QT8 A;  3AFC A;  5IJ7 E;  2B5N A;  3C9C A;  1JJU B;  4N14 A;  2AH1 A;  2HYE A;  3VH0 A;  2H68 A;  1L0Q A;  4GZ8 A;  3PXS D;  5B4W A;  1QNI A;  3JZH A;  4A09 A;  1U4C A;  3I7N A;  5GSA A;  3C75 H;  4A7J A;  5CXB B;  4CI2 A;  4U7A A;  3W15 A;  2H9M A;  2IUQ A;  3OKY A;  3OKT A;  2TRC B;  3I8E A;  3MKQ A;  4HDJ A;  5AFU 3;  2BBK H;  4GGC A;  4AEZ A;  4U1E I;  4CI8 A;  3JRP A;  3I7L A;  3OW8 A;  4J82 A;  3UVO A;  2QC5 A;  4XYI A;  1S4U X;  1K8K C;  4L3G D;  3UVM A;  4J77 A;  2CN2 A;  5EAR A;  4E54 A;  1GXR A;  2Z2N A;  4J8B A;  4L9O A;  5I5J A;  2AQ5 A;  1N6F A;  3DM0 A;  3J80 g;  2CE9 A;  5H1M A;  4CY2 A;  5EAP A;  2J57 G;  1PGU A;  5GXH A;  1GOT B;  3UVL A;  3L4O D;  1XHM A;  2Q7Q A;  4TZ4 A;  2CO0 C;  4ZN4 A;  3MZL A;  1MG3 A;  5GMK n;  2P9K C;  3PSL A;  4CC9 A;  4CZX A;  3EI1 B;  4GGA A;  3MXX A;  1PEV A;  4A09 B;  2I0R A;  4D6V A;  5FA5 B;  4QL1 A;  3FGB A;  3GFC A;  3F3F A;  3PXW D;  3RN1 D;  3DXK C;  2OK6 A;  4GQ1 A;  1TBG A;  2CO0 A;  1SQ9 A;  4GM9 A;  2P9U C;  5JWZ A;  4CY5 A;  4CI1 A;  1FWX A;  4LG8 A;  5FKR A;  3SFZ A;  4A08 A;  5EML B;  5IJ8 E;  5FKT A;  4A11 B;  4FA5 D;  5KDO B;  3BG1 A;  2AGX A;  2GC4 A;  3I8C A;  2H47 A;  2OVP B;  4PBY A;  3SBP A;  3MMY A;  3EG6 A;  2IWK A;  2YMU A;  3FRX A;  2PM9 B;  3DXM C;  1SQJ A;  4BUJ C;  5HE0 B;  3PSC B;  2OIZ A;  5TEE A;  2H14 A;  1SHY B;  3I7P A;  3PVU B;  5FKQ A;  3IJ1 A;  3KRW B;  3VGZ A;  3RMZ D;  2IAA A;  4A2M A;  4CY1 A;  3IIY A;  2XYI A;  4ES0 A;  4MK0 B;  4JD2 C;  2P9I C;  3C99 A;  1B9X A;  2H9P A;  4J86 A;  1ERJ A;  4O3T B;  4JSP C;  5H17 A;  3OTT A;  3EI1 A;  2UZX B;  4CZY A;  3UKR C;  4A0B B;  5TEF A;  5FKS A;  2I3T A;  4K3I D;  1NEX B;  4O3U B;  3A0F A;  2P9L C;  3V7D B;  1JMX B;  3I7H A;  4I79 A;  3RLM D;  4D0K A;  2YNN A;  5IC7 A;  1N6E A;  1OLZ A;  3UKU C;  3U4Y A;  4X3E A;  4J79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...