4J84A

Crystal structure of beta'-cop/scyl1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
300
Chain Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 88
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j84A01
4A08A 4FB1D 4CY2A 4A0AB 3OKYA 4CY3A 4JSNC 5IJ8E 1JJUB 3A0FA 3RN1D 5H14A 5GXHA 4AOWA 4J82A 4BH6A 3SN6B 3I8CA 1PGUA 5CYKA 3BG0A 3HFQA 3IJ0A 4GM9A 4FA1D 1YFQA 1OMWB 2CO0A 2I0TA 4A7JA 2HKRA 4I79A 2Q7QA 2H9PA 3EI4B 3V9FA 4CI1A 3V7DB 2HYEA 2UZYB 5IGOA 3W15A 3ZWLB 2XU7A 1PI6A 2H6QA 3PSCB 5I5IA 1MG3A 5GXIA 1A0RB 4ERQA 3MKQA 2O9KA 1NR0A 3PXWD 1JMZB 5FKRA 4ZOZA 4JXMA 2YNNA 4LGNA 5IGQA 1K8KC 3F3GA 2XL2A 2OJYA 4X60B 3FM0A 3FGBA 2EBSA 3UVLA 3UR4A 1GXRA 3BWSA 4K3ID 2H47A 3C75H 2OIZA 4GMBA 3EI1B 4ESGA 3RFGA 2CE9A 4IA9A 4J8BA 3P4FA 5AFU3 3L4MD 4CZXA 1N6DA 3EI3B 1OLZA 3N0EA 2BBKH 1QNIA 4MK0B 2H14A 2YNPA 2MTAH 4GQ2P 3B7FA 5EM2A 3IIYA 2G9AA 4ERYA 3PVWB 4A09B 2I0SA 2OVQB 4QQEA 4PBYA 5C2VB 2IUPA 4YVDA 4JD2C 2B5NA 2AGYA 5JWZA 4NSXA 4O9DA 3EU7A 3JPXA 4A08B 4OWRA 5K1CC 4J81A 2OK4A 4JSXC 3OKYB 1XIPA 5HE0B 2P9PC 2P9NC 3AH8B 4QT8A 5FXYA 1VYHC 4ZOVA 4GGCA 3UVKA 3IKOA 5IT9g 1GG2B 2AH1A 2PM9A 3SBRA 4BUJC 4L1QD 4ERZA 2P9IC 4U1EI 5TEEA 5H1MA 1N6FA 5CYKB 4J87A 4X61B 5AMSA 3F3PA 4D6VA 3DWLC 2AGWA 3OKTA 3J81g 3DSMA 5EAPA 3N0DA 3GFCA 5I5JA 2B5MA 4GQBB 2PBIB 3V5WB 3J80g 5CXBB 2H13A 4GGAA 4J0WA 5TEFA 3BG1A 4CC9A 3I7LA 4Y7RA 4FA9D 3UVMA 4FAVD 5A2Qg 3OL2A 5IC7A 4J78A 4CI2A 5GSAA 4E5ZA 2AQ5A 2GC4A 3NVXA 4HDJA 2G99A 4O1QD 2OVRB 3ORVD 1U4CA 3SLED 3C5MA 4JSPC 4L3HD 4ZOXA 1GP2B 3IJ1A 3AL8A 1B9YA 2YBAA 4U7AA 2I3TA 2OVPB 4IMMA 5HE1B 2P9SC 4L3GD 3L4OD 1JOFA 1SHYB 2AGXA 1SQ9A 2H9MA 3UVNA 3I7OA 4JT5C 4QL1A 4A0AA 4X63B 3PE7A 3RMZD 2GC7A 4LG8A 3UKUC 3KRWB 2QC5A 3DXMC 5CXCB 5TF2A 3MXXA 3CFVA 2OK6A 3AFCA 4R7AB 5THAA 2PM7B 5AJAA 2IWFA 5H17A 4CY5A 3SVWD 4GGDA 1PEVA 5FQDA 3DM0A 1XKSA 4ZN4A 3I7PA 4O3TB 4CZVA 1RI6A 3EI4A 4ES0A 5K19A 3EWEA 3MZLA 2IUQA 2QXVA 4A0BA 4J73A 3ODTA 2IURA 2PM9B 4JT6C 1NEXB 4A2LA 4GZ8A 1FWXA 3MKSB 2P9UC 4X3EA 3EI2B 1PBYB 2CO0C 5FKTA 5GMKn 2H6NA 2HKMA 4CZYA 3U4YA 4PC0A 5EMJB 4AEZA 2BCJB 5HE2B 2Z2OA 3AL9A 4J0XA 4TZ4A 4FA4D 4PNKB 5HQGA 1R5MA 2H68A 5EMLB 3VA6A 5EALA 3K26A 4LG9A 3EI1A 4G56B 5TDHB 4Y5RD 3PXTD 3NVNA 4XEIC 3GREA 3OL2B 5HYNB 2HXCA 2AGZA 3I7NA 4FAND 4A11A 4PXWA 5EAMA 4EWRA 1B9XA 5EARA 2TRCB 4A09A 2IAAA 2J55H 2UZXB 1MDAH 3I89A 3C9CA 1XHMA 2AH0A 3DXKC 3JAMg 3JRPA 4O3UB 1GOTB 3OKWA 3RSEC 4JSVC 5EMMB 4J79A 5B4WA 3I7HA 4K3JB 4UI9R 2IWKA 4H5JA 4J86A 2YB8B 4KFMB 2H9LA 5FA5B 2J56H 3SFZA 3FRXA 1SQJA 5KDOB 1K32A 1S4UX 4Z8LA 2CN2A 3I8EA 3ULEC 4ZOYA 4E54A 4J8GA 4XYHA 2CE8A 5EMKB 3JZNA 1P22A 4PSXB 3RLMD 4FHLA 3K27A 3IJCA 2YNOA 5I5MA 3SBQA 2HJBA 5EM2B 5FLXg 5C2WB 4A0BB 5IJ7E 5CXBA 3SBPA 4FA5D 5HE3B 2Z2PA 4CY1A 2CN3A 2GNQA 1U2VC 2H6KA 3RN0D 4A2MA 4GQ1A 3PSLA 5FKQA 3UKRC 4PBZA 2YMUA 4H5IA 2HJ4A 3VH0A 3CFSB 2P9KC 2PM6B 4J84A 3JB9L 2J57G 2XYIA 2H3XA 1ERJA 4N14A 4PSWB 3RRMC 3PVUB 3SWSD 3JROA 2AGLA 4O45A 4QRJA 3SMRA 5C9ZB 3SCYA 2Z2NA 3I7KA 3NVQA 3VGZA 3SJLD 4A11B 3MMYA 4GM3A 2XL3A 1Q47A 4CI8A 3OTTA 3JZGA 2P9LC 3E0CA 3IIWA 2CNXA 4OZUA 1TBGA 5CXCA 3SXTD 2H9NA 3OW8A 3PXSD 4BL0A 4XYIA 3CIKB 4L9OA 3UVOA 5SXMA 2B5LA 3EG6A 4CI3A 1N6EA 4GM8A 2I0RA 4J77A 3EI3A 3RFHA 4E5ZB 3SHFA 1MG2A 3EMHA 1JMXB 2HESX 3I2NA 2B4EA 5FKSA 2IUVA 3AL8B 2I3SA 3MZKA 3F3FA 2W18A 3JZHA 3EI2A 1TYQC 1L0QA 4E54B 4D0KA 4FWWA 3C99A 3KRXB
chains in the Genus database with same CATH superfamily
4A08A 4FB1D 4CY2A 4A0AB 4AMYA 3OKYA 4CY3A 4JSNC 5IJ8E 1JJUB 3A0FA 3NIGA 5H14A 3RN1D 1VE7A 4NBMA 3EQ7A 5GXHA 4AOWA 5M5TA 4J82A 4QAMA 4BH6A 3SN6B 3GD1I 3I8CA 1PGUA 5CYKA 1H2XA 3BG0A 3HFQA 3IJ0A 4GM9A 1M1XA 4FA1D 1YFQA 2EIBA 1OMWB 2CO0A 2I0TA 1UOQA 1UOOA 3NIDA 4A7JA 3ZE2A 2HKRA 4I79A 2Q7QA 2H9PA 4G1MA 3EI4B 3V9FA 4JHNA 3OF7A 4CI1A 3V7DB 2QZPA 2HYEA 2UZYB 5IGOA 1U8CA 3W15A 3ZWLB 2XU7A 1GOHA 1E8NA 1PI6A 2H6QA 3PSCB 5I5IA 1MG3A 2VZ1A 5GXIA 3IVMA 1A0RB 4ERQA 3MKQA 2O9KA 3ZE0A 1NR0A 3PXWD 1JMZB 5FKRA 3V4PA 4ZOZA 2VC2A 4JXMA 2HU5A 2YNNA 4LGNA 5HDBA 5IGQA 1K8KC 3F3GA 2XL2A 2OJYA 4X60B 3FM0A 1UTCA 3FGBA 2EBSA 3UVLA 3UR4A 1GXRA 3BWSA 4K3ID 2H47A 3C75H 2OIZA 4GMBA 3EI1B 4ESGA 3RFGA 2CE9A 5M5UA 4IA9A 4J8BA 4G55A 3P4FA 3ZDZA 5AFU3 3L4MD 4CZXA 3K6SA 1N6DA 3EI3B 2EIDA 1OLZA 3N0EA 2BBKH 1QNIA 5E6RA 4MK0B 2H14A 2YNPA 2MTAH 4GQ2P 3B7FA 5EM2A 3IIYA 4MMXA 2G9AA 4ERYA 3PVWB 4A09B 1TYEA 2I0SA 2OVQB 4QQEA 3NIFA 4PBYA 5C86A 5C2VB 2IUPA 4YVDA 3O4IA 4JD2C 2B5NA 3T3PA 2AGYA 1O6GA 5JWZA 4NSXA 4O9DA 3EU7A 3JPXA 4A08B 4OWRA 5K1CC 4J81A 2OK4A 4JSXC 3OKYB 1XIPA 5HE0B 2P9PC 1H2WA 2P9NC 3AH8B 4QT8A 5FXYA 1JTDB 1VYHC 4ZOVA 4GGCA 3QI0A 3UVKA 1C9IA 3IKOA 1A12A 5IT9g 1GG2B 2AH1A 4WJKA 2PM9A 3SBRA 4BUJC 4L1QD 4ERZA 2P9IC 4U1EI 5TEEA 1YR2A 5H1MA 1N6FA 5CYKB 4J87A 1BPOA 1L5GA 4X61B 5AMSA 3F3PA 4NC4A 4D6VA 3DWLC 3FCSA 2AGWA 3OKTA 3J81g 3DSMA 3EQ9A 5EAPA 3N0DA 3GFCA 4WK0A 3O4HA 5I5JA 2B5MA 4GQBB 2PBIB 3V5WB 1QFMA 3J80g 5CXBB 2H13A 5E6UA 4GGAA 4J0WA 5TEFA 3BG1A 4JHPC 4CC9A 3I7LA 4Y7RA 4FA9D 3UVMA 4O02A 3MVDK 4FAVD 5A2Qg 3OL2A 1T2XA 4BP9A 5IC7A 4J78A 2BKLA 4CI2A 5GSAA 4E5ZA 2AQ5A 2GC4A 2HU8A 3NVXA 4HDJA 2G99A 4O1QD 2OVRB 3ORVD 1U4CA 5E6SA 3SLED 3C5MA 2JKXA 4G1EA 4JSPC 4L3HD 4ZOXA 4MMZA 1GP2B 4O2WA 3IJ1A 3AL8A 1B9YA 2YBAA 4U7AA 2I3TA 2OVPB 4IMMA 5HE1B 2P9SC 4L3GD 3L4OD 1JOFA 1SHYB 2AGXA 1SQ9A 2H9MA 3UVNA 3I7OA 4JT5C 2VDMA 4QL1A 4A0AA 4X63B 3PE7A 1VZ3A 3DDUA 3RMZD 2GC7A 4LG8A 3UKUC 1VZ2A 3KRWB 2QC5A 3DXMC 5CXCB 5TF2A 3MXXA 3CFVA 2VDNA 2OK6A 3AFCA 4R7AB 5THAA 4UM8A 2PM7B 5AJAA 2IWFA 5H17A 4Z7OA 4CY5A 3SVWD 4GGDA 1PEVA 5FQDA 3DM0A 1E8MA 1XKSA 3FCUA 4ZN4A 3I7PA 5M5RA 4O3TB 4CZVA 1RI6A 3EI4A 4ES0A 5K19A 3EWEA 4NENA 3MZLA 2IUQA 2VDKA 3ZDXA 2QXVA 4A0BA 5FFGA 4J73A 3ODTA 2IURA 4DNUA 4WK4A 2PM9B 4JT6C 3IUNA 1NEXB 4A2LA 4GZ8A 1FWXA 3MKSB 4WK2A 2P9UC 1H2YA 4RE5A 4X3EA 3EI2B 1PBYB 2CO0C 5FKTA 2QR5A 5GMKn 2H6NA 2HKMA 4CZYA 3U4YA 4NAAA 5C92A 4PC0A 5EMJB 4AEZA 2BCJB 5HE2B 2Z2OA 1QFSA 3AL9A 1H2ZA 4J0XA 4TZ4A 4FA4D 2VDPA 3MUOA 3IULA 4PNKB 5FFOA 5HQGA 1R5MA 2H68A 5EMLB 2EIEA 3VA6A 5EALA 3K26A 4LG9A 3EI1A 1UOPA 4G56B 5TDHB 3VI3A 4Y5RD 3PXTD 3NVNA 2XDWA 4XEIC 3GREA 2WQ8A 3OL2B 5HYNB 1JV2A 2HXCA 2AGZA 3I7NA 4FAND 4A11A 3IUMA 4PXWA 5EAMA 4EWRA 4AX4A 1B9XA 5EARA 2TRCB 4A09A 2IAAA 2J55H 2UZXB 1MDAH 3I89A 3C9CA 4D9SA 1XHMA 2AH0A 3DXKC 3JAMg 3JRPA 4BP8A 4Z7QA 4AMZA 3T3MA 4O3UB 1GOTB 3OKWA 3RSEC 4JSVC 3K72A 5EMMB 4J79A 5B4WA 2VDOA 1I2MB 3I7HA 3GC3B 4K3JB 4UI9R 2IWKA 4H5JA 4J86A 2YB8B 4KFMB 2H9LA 5FA5B 1GOFA 5M5VA 2J56H 3SFZA 3FRXA 1SQJA 5KDOB 3IURA 1K32A 2XE4A 1S4UX 4BCCA 4Z8LA 2CN2A 3I8EA 3ULEC 4ZOYA 4E54A 4J8GA 4XYHA 2CE8A 5EMKB 3JZNA 3KCIA 1P22A 4PSXB 3RLMD 2VDRA 4FHLA 3K27A 3IJCA 3EQ8A 3IJEA 2YNOA 5I5MA 3SBQA 2HJBA 5EM2B 5FLXg 5C2WB 5M5SA 4A0BB 5IJ7E 5CXBA 3SBPA 4FA5D 3O4GA 5HE3B 1O6FA 2Z2PA 4CY1A 3VI4A 2CN3A 2GNQA 1U2VC 2H6KA 3RN0D 2VDQA 1VE6A 4A2MA 2VZ3A 2VDLA 4GQ1A 3PSLA 5FKQA 3UKRC 4PBZA 1C9LA 4IRZA 1GOGA 2YMUA 4H5IA 2HJ4A 4L1MA 3IUJA 3VH0A 3CFSB 2P9KC 2EICA 2PM6B 4J84A 3JB9L 4BCDA 2J57G 2XYIA 2H3XA 1ERJA 4N14A 4PSWB 3RRMC 3ZDYA 3PVUB 3MUNA 3SWSD 3JROA 2AGLA 4O45A 4QRJA 3SMRA 5C9ZB 5M61A 3SCYA 2Z2NA 3I7KA 1K3IA 3NVQA 3VGZA 3SJLD 4A11B 3MMYA 4GM3A 2XL3A 1Q47A 4Z7NA 4CI8A 3OTTA 4UM9A 2P9LC 3JZGA 3E0CA 3IIWA 2CNXA 4OZUA 1TBGA 4RE6A 5CXCA 4DNVA 1E5TA 3SXTD 2H9NA 3OW8A 3PXSD 4BL0A 4XYIA 3CIKB 2HU7A 3V4VA 4L9OA 3UVOA 5SXMA 2B5LA 4BCBA 3EG6A 4CI3A 1N6EA 4GM8A 3IUQA 2I0RA 3QHYB 4J77A 3EI3A 4MMYA 3RFHA 4E5ZB 2XZGA 3SHFA 1MG2A 3EMHA 3ZE1A 1JMXB 3O4JA 4AN0A 2HESX 3K71A 4AN1A 3I2NA 2B4EA 5FKSA 2IUVA 3AL8B 2I3SA 3MZKA 3F3FA 2W18A 3JZHA 3EI2A 1TYQC 1L0QA 4E54B 4D0KA 4FWWA 4DNWA 3C99A 3KRXB
chains in the Genus database with same CATH topology
4A08A 4FB1D 4CY2A 4A0AB 3OKYA 4CY3A 4JSNC 5IJ8E 1JJUB 3A0FA 3RN1D 5H14A 5GXHA 4AOWA 4J82A 4BH6A 3SN6B 3I8CA 1PGUA 5CYKA 3BG0A 3HFQA 3IJ0A 4GM9A 4FA1D 1YFQA 1OMWB 2CO0A 2I0TA 4A7JA 2HKRA 4I79A 2Q7QA 2H9PA 3EI4B 3V9FA 4CI1A 3V7DB 2HYEA 2UZYB 5IGOA 3W15A 3ZWLB 2XU7A 1PI6A 2H6QA 3PSCB 5I5IA 1MG3A 5GXIA 1A0RB 4ERQA 3MKQA 2O9KA 1NR0A 3PXWD 1JMZB 5FKRA 4ZOZA 4JXMA 2YNNA 4LGNA 5IGQA 1K8KC 3F3GA 2XL2A 2OJYA 4X60B 3FM0A 3FGBA 2EBSA 3UVLA 3UR4A 1GXRA 3BWSA 4K3ID 2H47A 3C75H 2OIZA 4GMBA 3EI1B 4ESGA 3RFGA 2CE9A 4IA9A 4J8BA 3P4FA 5AFU3 3L4MD 4CZXA 1N6DA 3EI3B 1OLZA 3N0EA 2BBKH 1QNIA 4MK0B 2H14A 2YNPA 2MTAH 4GQ2P 3B7FA 5EM2A 3IIYA 2G9AA 4ERYA 3PVWB 4A09B 2I0SA 2OVQB 4QQEA 4PBYA 5C2VB 2IUPA 4YVDA 4JD2C 2B5NA 2AGYA 5JWZA 4NSXA 4O9DA 3EU7A 3JPXA 4A08B 4OWRA 5K1CC 4J81A 2OK4A 4JSXC 3OKYB 1XIPA 5HE0B 2P9PC 2P9NC 3AH8B 4QT8A 5FXYA 1VYHC 4ZOVA 4GGCA 3UVKA 3IKOA 5IT9g 1GG2B 2AH1A 2PM9A 3SBRA 4BUJC 4L1QD 4ERZA 2P9IC 4U1EI 5TEEA 5H1MA 1N6FA 5CYKB 4J87A 4X61B 5AMSA 3F3PA 4D6VA 3DWLC 2AGWA 3OKTA 3J81g 3DSMA 5EAPA 3N0DA 3GFCA 5I5JA 2B5MA 4GQBB 2PBIB 3V5WB 3J80g 5CXBB 2H13A 4GGAA 4J0WA 5TEFA 3BG1A 4CC9A 3I7LA 4Y7RA 4FA9D 3UVMA 4FAVD 5A2Qg 3OL2A 5IC7A 4J78A 4CI2A 5GSAA 4E5ZA 2AQ5A 2GC4A 3NVXA 4HDJA 2G99A 4O1QD 2OVRB 3ORVD 1U4CA 3SLED 3C5MA 4JSPC 4L3HD 4ZOXA 1GP2B 3IJ1A 3AL8A 1B9YA 2YBAA 4U7AA 2I3TA 2OVPB 4IMMA 5HE1B 2P9SC 4L3GD 3L4OD 1JOFA 1SHYB 2AGXA 1SQ9A 2H9MA 3UVNA 3I7OA 4JT5C 4QL1A 4A0AA 4X63B 3PE7A 3RMZD 2GC7A 4LG8A 3UKUC 3KRWB 2QC5A 3DXMC 5CXCB 5TF2A 3MXXA 3CFVA 2OK6A 3AFCA 4R7AB 5THAA 2PM7B 5AJAA 2IWFA 5H17A 4CY5A 3SVWD 4GGDA 1PEVA 5FQDA 3DM0A 1XKSA 4ZN4A 3I7PA 4O3TB 4CZVA 1RI6A 3EI4A 4ES0A 5K19A 3EWEA 3MZLA 2IUQA 2QXVA 4A0BA 4J73A 3ODTA 2IURA 2PM9B 4JT6C 1NEXB 4A2LA 4GZ8A 1FWXA 3MKSB 2P9UC 4X3EA 3EI2B 1PBYB 2CO0C 5FKTA 5GMKn 2H6NA 2HKMA 4CZYA 3U4YA 4PC0A 5EMJB 4AEZA 2BCJB 5HE2B 2Z2OA 3AL9A 4J0XA 4TZ4A 4FA4D 4PNKB 5HQGA 1R5MA 2H68A 5EMLB 3VA6A 5EALA 3K26A 4LG9A 3EI1A 4G56B 5TDHB 4Y5RD 3PXTD 3NVNA 4XEIC 3GREA 3OL2B 5HYNB 2HXCA 2AGZA 3I7NA 4FAND 4A11A 4PXWA 5EAMA 4EWRA 1B9XA 5EARA 2TRCB 4A09A 2IAAA 2J55H 2UZXB 1MDAH 3I89A 3C9CA 1XHMA 2AH0A 3DXKC 3JAMg 3JRPA 4O3UB 1GOTB 3OKWA 3RSEC 4JSVC 5EMMB 4J79A 5B4WA 3I7HA 4K3JB 4UI9R 2IWKA 4H5JA 4J86A 2YB8B 4KFMB 2H9LA 5FA5B 2J56H 3SFZA 3FRXA 1SQJA 5KDOB 1K32A 1S4UX 4Z8LA 2CN2A 3I8EA 3ULEC 4ZOYA 4E54A 4J8GA 4XYHA 2CE8A 5EMKB 3JZNA 1P22A 4PSXB 3RLMD 4FHLA 3K27A 3IJCA 2YNOA 5I5MA 3SBQA 2HJBA 5EM2B 5FLXg 5C2WB 4A0BB 5IJ7E 5CXBA 3SBPA 4FA5D 5HE3B 2Z2PA 4CY1A 2CN3A 2GNQA 1U2VC 2H6KA 3RN0D 4A2MA 4GQ1A 3PSLA 5FKQA 3UKRC 4PBZA 2YMUA 4H5IA 2HJ4A 3VH0A 3CFSB 2P9KC 2PM6B 4J84A 3JB9L 2J57G 2XYIA 2H3XA 1ERJA 4N14A 4PSWB 3RRMC 3PVUB 3SWSD 3JROA 2AGLA 4O45A 4QRJA 3SMRA 5C9ZB 3SCYA 2Z2NA 3I7KA 3NVQA 3VGZA 3SJLD 4A11B 3MMYA 4GM3A 2XL3A 1Q47A 4CI8A 3OTTA 3JZGA 2P9LC 3E0CA 3IIWA 2CNXA 4OZUA 1TBGA 5CXCA 3SXTD 2H9NA 3OW8A 3PXSD 4BL0A 4XYIA 3CIKB 4L9OA 3UVOA 5SXMA 2B5LA 3EG6A 4CI3A 1N6EA 4GM8A 2I0RA 4J77A 3EI3A 3RFHA 4E5ZB 3SHFA 1MG2A 3EMHA 1JMXB 2HESX 3I2NA 2B4EA 5FKSA 2IUVA 3AL8B 2I3SA 3MZKA 3F3FA 2W18A 3JZHA 3EI2A 1TYQC 1L0QA 4E54B 4D0KA 4FWWA 3C99A 3KRXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A08 A;  4FB1 D;  4CY2 A;  4A0A B;  3OKY A;  4CY3 A;  4JSN C;  5IJ8 E;  1JJU B;  3A0F A;  3RN1 D;  5H14 A;  5GXH A;  4AOW A;  4J82 A;  4BH6 A;  3SN6 B;  3I8C A;  1PGU A;  5CYK A;  3BG0 A;  3HFQ A;  3IJ0 A;  4GM9 A;  4FA1 D;  1YFQ A;  1OMW B;  2CO0 A;  2I0T A;  4A7J A;  2HKR A;  4I79 A;  2Q7Q A;  2H9P A;  3EI4 B;  3V9F A;  4CI1 A;  3V7D B;  2HYE A;  2UZY B;  5IGO A;  3W15 A;  3ZWL B;  2XU7 A;  1PI6 A;  2H6Q A;  3PSC B;  5I5I A;  1MG3 A;  5GXI A;  1A0R B;  4ERQ A;  3MKQ A;  2O9K A;  1NR0 A;  3PXW D;  1JMZ B;  5FKR A;  4ZOZ A;  4JXM A;  2YNN A;  4LGN A;  5IGQ A;  1K8K C;  3F3G A;  2XL2 A;  2OJY A;  4X60 B;  3FM0 A;  3FGB A;  2EBS A;  3UVL A;  3UR4 A;  1GXR A;  3BWS A;  4K3I D;  2H47 A;  3C75 H;  2OIZ A;  4GMB A;  3EI1 B;  4ESG A;  3RFG A;  2CE9 A;  4IA9 A;  4J8B A;  3P4F A;  5AFU 3;  3L4M D;  4CZX A;  1N6D A;  3EI3 B;  1OLZ A;  3N0E A;  2BBK H;  1QNI A;  4MK0 B;  2H14 A;  2YNP A;  2MTA H;  4GQ2 P;  3B7F A;  5EM2 A;  3IIY A;  2G9A A;  4ERY A;  3PVW B;  4A09 B;  2I0S A;  2OVQ B;  4QQE A;  4PBY A;  5C2V B;  2IUP A;  4YVD A;  4JD2 C;  2B5N A;  2AGY A;  5JWZ A;  4NSX A;  4O9D A;  3EU7 A;  3JPX A;  4A08 B;  4OWR A;  5K1C C;  4J81 A;  2OK4 A;  4JSX C;  3OKY B;  1XIP A;  5HE0 B;  2P9P C;  2P9N C;  3AH8 B;  4QT8 A;  5FXY A;  1VYH C;  4ZOV A;  4GGC A;  3UVK A;  3IKO A;  5IT9 g;  1GG2 B;  2AH1 A;  2PM9 A;  3SBR A;  4BUJ C;  4L1Q D;  4ERZ A;  2P9I C;  4U1E I;  5TEE A;  5H1M A;  1N6F A;  5CYK B;  4J87 A;  4X61 B;  5AMS A;  3F3P A;  4D6V A;  3DWL C;  2AGW A;  3OKT A;  3J81 g;  3DSM A;  5EAP A;  3N0D A;  3GFC A;  5I5J A;  2B5M A;  4GQB B;  2PBI B;  3V5W B;  3J80 g;  5CXB B;  2H13 A;  4GGA A;  4J0W A;  5TEF A;  3BG1 A;  4CC9 A;  3I7L A;  4Y7R A;  4FA9 D;  3UVM A;  4FAV D;  5A2Q g;  3OL2 A;  5IC7 A;  4J78 A;  4CI2 A;  5GSA A;  4E5Z A;  2AQ5 A;  2GC4 A;  3NVX A;  4HDJ A;  2G99 A;  4O1Q D;  2OVR B;  3ORV D;  1U4C A;  3SLE D;  3C5M A;  4JSP C;  4L3H D;  4ZOX A;  1GP2 B;  3IJ1 A;  3AL8 A;  1B9Y A;  2YBA A;  4U7A A;  2I3T A;  2OVP B;  4IMM A;  5HE1 B;  2P9S C;  4L3G D;  3L4O D;  1JOF A;  1SHY B;  2AGX A;  1SQ9 A;  2H9M A;  3UVN A;  3I7O A;  4JT5 C;  4QL1 A;  4A0A A;  4X63 B;  3PE7 A;  3RMZ D;  2GC7 A;  4LG8 A;  3UKU C;  3KRW B;  2QC5 A;  3DXM C;  5CXC B;  5TF2 A;  3MXX A;  3CFV A;  2OK6 A;  3AFC A;  4R7A B;  5THA A;  2PM7 B;  5AJA A;  2IWF A;  5H17 A;  4CY5 A;  3SVW D;  4GGD A;  1PEV A;  5FQD A;  3DM0 A;  1XKS A;  4ZN4 A;  3I7P A;  4O3T B;  4CZV A;  1RI6 A;  3EI4 A;  4ES0 A;  5K19 A;  3EWE A;  3MZL A;  2IUQ A;  2QXV A;  4A0B A;  4J73 A;  3ODT A;  2IUR A;  2PM9 B;  4JT6 C;  1NEX B;  4A2L A;  4GZ8 A;  1FWX A;  3MKS B;  2P9U C;  4X3E A;  3EI2 B;  1PBY B;  2CO0 C;  5FKT A;  5GMK n;  2H6N A;  2HKM A;  4CZY A;  3U4Y A;  4PC0 A;  5EMJ B;  4AEZ A;  2BCJ B;  5HE2 B;  2Z2O A;  3AL9 A;  4J0X A;  4TZ4 A;  4FA4 D;  4PNK B;  5HQG A;  1R5M A;  2H68 A;  5EML B;  3VA6 A;  5EAL A;  3K26 A;  4LG9 A;  3EI1 A;  4G56 B;  5TDH B;  4Y5R D;  3PXT D;  3NVN A;  4XEI C;  3GRE A;  3OL2 B;  5HYN B;  2HXC A;  2AGZ A;  3I7N A;  4FAN D;  4A11 A;  4PXW A;  5EAM A;  4EWR A;  1B9X A;  5EAR A;  2TRC B;  4A09 A;  2IAA A;  2J55 H;  2UZX B;  1MDA H;  3I89 A;  3C9C A;  1XHM A;  2AH0 A;  3DXK C;  3JAM g;  3JRP A;  4O3U B;  1GOT B;  3OKW A;  3RSE C;  4JSV C;  5EMM B;  4J79 A;  5B4W A;  3I7H A;  4K3J B;  4UI9 R;  2IWK A;  4H5J A;  4J86 A;  2YB8 B;  4KFM B;  2H9L A;  5FA5 B;  2J56 H;  3SFZ A;  3FRX A;  1SQJ A;  5KDO B;  1K32 A;  1S4U X;  4Z8L A;  2CN2 A;  3I8E A;  3ULE C;  4ZOY A;  4E54 A;  4J8G A;  4XYH A;  2CE8 A;  5EMK B;  3JZN A;  1P22 A;  4PSX B;  3RLM D;  4FHL A;  3K27 A;  3IJC A;  2YNO A;  5I5M A;  3SBQ A;  2HJB A;  5EM2 B;  5FLX g;  5C2W B;  4A0B B;  5IJ7 E;  5CXB A;  3SBP A;  4FA5 D;  5HE3 B;  2Z2P A;  4CY1 A;  2CN3 A;  2GNQ A;  1U2V C;  2H6K A;  3RN0 D;  4A2M A;  4GQ1 A;  3PSL A;  5FKQ A;  3UKR C;  4PBZ A;  2YMU A;  4H5I A;  2HJ4 A;  3VH0 A;  3CFS B;  2P9K C;  2PM6 B;  4J84 A;  3JB9 L;  2J57 G;  2XYI A;  2H3X A;  1ERJ A;  4N14 A;  4PSW B;  3RRM C;  3PVU B;  3SWS D;  3JRO A;  2AGL A;  4O45 A;  4QRJ A;  3SMR A;  5C9Z B;  3SCY A;  2Z2N A;  3I7K A;  3NVQ A;  3VGZ A;  3SJL D;  4A11 B;  3MMY A;  4GM3 A;  2XL3 A;  1Q47 A;  4CI8 A;  3OTT A;  3JZG A;  2P9L C;  3E0C A;  3IIW A;  2CNX A;  4OZU A;  1TBG A;  5CXC A;  3SXT D;  2H9N A;  3OW8 A;  3PXS D;  4BL0 A;  4XYI A;  3CIK B;  4L9O A;  3UVO A;  5SXM A;  2B5L A;  3EG6 A;  4CI3 A;  1N6E A;  4GM8 A;  2I0R A;  4J77 A;  3EI3 A;  3RFH A;  4E5Z B;  3SHF A;  1MG2 A;  3EMH A;  1JMX B;  2HES X;  3I2N A;  2B4E A;  5FKS A;  2IUV A;  3AL8 B;  2I3S A;  3MZK A;  3F3F A;  2W18 A;  3JZH A;  3EI2 A;  1TYQ C;  1L0Q A;  4E54 B;  4D0K A;  4FWW A;  3C99 A;  3KRX B; 
#chains in the Genus database with same CATH topology
 4A08 A;  4FB1 D;  4CY2 A;  4A0A B;  4AMY A;  3OKY A;  4CY3 A;  4JSN C;  5IJ8 E;  1JJU B;  3A0F A;  3NIG A;  5H14 A;  3RN1 D;  1VE7 A;  4NBM A;  3EQ7 A;  5GXH A;  4AOW A;  5M5T A;  4J82 A;  4QAM A;  4BH6 A;  3SN6 B;  3GD1 I;  3I8C A;  1PGU A;  5CYK A;  1H2X A;  3BG0 A;  3HFQ A;  3IJ0 A;  4GM9 A;  1M1X A;  4FA1 D;  1YFQ A;  2EIB A;  1OMW B;  2CO0 A;  2I0T A;  1UOQ A;  1UOO A;  3NID A;  4A7J A;  3ZE2 A;  2HKR A;  4I79 A;  2Q7Q A;  2H9P A;  4G1M A;  3EI4 B;  3V9F A;  4JHN A;  3OF7 A;  4CI1 A;  3V7D B;  2QZP A;  2HYE A;  2UZY B;  5IGO A;  1U8C A;  3W15 A;  3ZWL B;  2XU7 A;  1GOH A;  1E8N A;  1PI6 A;  2H6Q A;  3PSC B;  5I5I A;  1MG3 A;  2VZ1 A;  5GXI A;  3IVM A;  1A0R B;  4ERQ A;  3MKQ A;  2O9K A;  3ZE0 A;  1NR0 A;  3PXW D;  1JMZ B;  5FKR A;  3V4P A;  4ZOZ A;  2VC2 A;  4JXM A;  2HU5 A;  2YNN A;  4LGN A;  5HDB A;  5IGQ A;  1K8K C;  3F3G A;  2XL2 A;  2OJY A;  4X60 B;  3FM0 A;  1UTC A;  3FGB A;  2EBS A;  3UVL A;  3UR4 A;  1GXR A;  3BWS A;  4K3I D;  2H47 A;  3C75 H;  2OIZ A;  4GMB A;  3EI1 B;  4ESG A;  3RFG A;  2CE9 A;  5M5U A;  4IA9 A;  4J8B A;  4G55 A;  3P4F A;  3ZDZ A;  5AFU 3;  3L4M D;  4CZX A;  3K6S A;  1N6D A;  3EI3 B;  2EID A;  1OLZ A;  3N0E A;  2BBK H;  1QNI A;  5E6R A;  4MK0 B;  2H14 A;  2YNP A;  2MTA H;  4GQ2 P;  3B7F A;  5EM2 A;  3IIY A;  4MMX A;  2G9A A;  4ERY A;  3PVW B;  4A09 B;  1TYE A;  2I0S A;  2OVQ B;  4QQE A;  3NIF A;  4PBY A;  5C86 A;  5C2V B;  2IUP A;  4YVD A;  3O4I A;  4JD2 C;  2B5N A;  3T3P A;  2AGY A;  1O6G A;  5JWZ A;  4NSX A;  4O9D A;  3EU7 A;  3JPX A;  4A08 B;  4OWR A;  5K1C C;  4J81 A;  2OK4 A;  4JSX C;  3OKY B;  1XIP A;  5HE0 B;  2P9P C;  1H2W A;  2P9N C;  3AH8 B;  4QT8 A;  5FXY A;  1JTD B;  1VYH C;  4ZOV A;  4GGC A;  3QI0 A;  3UVK A;  1C9I A;  3IKO A;  1A12 A;  5IT9 g;  1GG2 B;  2AH1 A;  4WJK A;  2PM9 A;  3SBR A;  4BUJ C;  4L1Q D;  4ERZ A;  2P9I C;  4U1E I;  5TEE A;  1YR2 A;  5H1M A;  1N6F A;  5CYK B;  4J87 A;  1BPO A;  1L5G A;  4X61 B;  5AMS A;  3F3P A;  4NC4 A;  4D6V A;  3DWL C;  3FCS A;  2AGW A;  3OKT A;  3J81 g;  3DSM A;  3EQ9 A;  5EAP A;  3N0D A;  3GFC A;  4WK0 A;  3O4H A;  5I5J A;  2B5M A;  4GQB B;  2PBI B;  3V5W B;  1QFM A;  3J80 g;  5CXB B;  2H13 A;  5E6U A;  4GGA A;  4J0W A;  5TEF A;  3BG1 A;  4JHP C;  4CC9 A;  3I7L A;  4Y7R A;  4FA9 D;  3UVM A;  4O02 A;  3MVD K;  4FAV D;  5A2Q g;  3OL2 A;  1T2X A;  4BP9 A;  5IC7 A;  4J78 A;  2BKL A;  4CI2 A;  5GSA A;  4E5Z A;  2AQ5 A;  2GC4 A;  2HU8 A;  3NVX A;  4HDJ A;  2G99 A;  4O1Q D;  2OVR B;  3ORV D;  1U4C A;  5E6S A;  3SLE D;  3C5M A;  2JKX A;  4G1E A;  4JSP C;  4L3H D;  4ZOX A;  4MMZ A;  1GP2 B;  4O2W A;  3IJ1 A;  3AL8 A;  1B9Y A;  2YBA A;  4U7A A;  2I3T A;  2OVP B;  4IMM A;  5HE1 B;  2P9S C;  4L3G D;  3L4O D;  1JOF A;  1SHY B;  2AGX A;  1SQ9 A;  2H9M A;  3UVN A;  3I7O A;  4JT5 C;  2VDM A;  4QL1 A;  4A0A A;  4X63 B;  3PE7 A;  1VZ3 A;  3DDU A;  3RMZ D;  2GC7 A;  4LG8 A;  3UKU C;  1VZ2 A;  3KRW B;  2QC5 A;  3DXM C;  5CXC B;  5TF2 A;  3MXX A;  3CFV A;  2VDN A;  2OK6 A;  3AFC A;  4R7A B;  5THA A;  4UM8 A;  2PM7 B;  5AJA A;  2IWF A;  5H17 A;  4Z7O A;  4CY5 A;  3SVW D;  4GGD A;  1PEV A;  5FQD A;  3DM0 A;  1E8M A;  1XKS A;  3FCU A;  4ZN4 A;  3I7P A;  5M5R A;  4O3T B;  4CZV A;  1RI6 A;  3EI4 A;  4ES0 A;  5K19 A;  3EWE A;  4NEN A;  3MZL A;  2IUQ A;  2VDK A;  3ZDX A;  2QXV A;  4A0B A;  5FFG A;  4J73 A;  3ODT A;  2IUR A;  4DNU A;  4WK4 A;  2PM9 B;  4JT6 C;  3IUN A;  1NEX B;  4A2L A;  4GZ8 A;  1FWX A;  3MKS B;  4WK2 A;  2P9U C;  1H2Y A;  4RE5 A;  4X3E A;  3EI2 B;  1PBY B;  2CO0 C;  5FKT A;  2QR5 A;  5GMK n;  2H6N A;  2HKM A;  4CZY A;  3U4Y A;  4NAA A;  5C92 A;  4PC0 A;  5EMJ B;  4AEZ A;  2BCJ B;  5HE2 B;  2Z2O A;  1QFS A;  3AL9 A;  1H2Z A;  4J0X A;  4TZ4 A;  4FA4 D;  2VDP A;  3MUO A;  3IUL A;  4PNK B;  5FFO A;  5HQG A;  1R5M A;  2H68 A;  5EML B;  2EIE A;  3VA6 A;  5EAL A;  3K26 A;  4LG9 A;  3EI1 A;  1UOP A;  4G56 B;  5TDH B;  3VI3 A;  4Y5R D;  3PXT D;  3NVN A;  2XDW A;  4XEI C;  3GRE A;  2WQ8 A;  3OL2 B;  5HYN B;  1JV2 A;  2HXC A;  2AGZ A;  3I7N A;  4FAN D;  4A11 A;  3IUM A;  4PXW A;  5EAM A;  4EWR A;  4AX4 A;  1B9X A;  5EAR A;  2TRC B;  4A09 A;  2IAA A;  2J55 H;  2UZX B;  1MDA H;  3I89 A;  3C9C A;  4D9S A;  1XHM A;  2AH0 A;  3DXK C;  3JAM g;  3JRP A;  4BP8 A;  4Z7Q A;  4AMZ A;  3T3M A;  4O3U B;  1GOT B;  3OKW A;  3RSE C;  4JSV C;  3K72 A;  5EMM B;  4J79 A;  5B4W A;  2VDO A;  1I2M B;  3I7H A;  3GC3 B;  4K3J B;  4UI9 R;  2IWK A;  4H5J A;  4J86 A;  2YB8 B;  4KFM B;  2H9L A;  5FA5 B;  1GOF A;  5M5V A;  2J56 H;  3SFZ A;  3FRX A;  1SQJ A;  5KDO B;  3IUR A;  1K32 A;  2XE4 A;  1S4U X;  4BCC A;  4Z8L A;  2CN2 A;  3I8E A;  3ULE C;  4ZOY A;  4E54 A;  4J8G A;  4XYH A;  2CE8 A;  5EMK B;  3JZN A;  3KCI A;  1P22 A;  4PSX B;  3RLM D;  2VDR A;  4FHL A;  3K27 A;  3IJC A;  3EQ8 A;  3IJE A;  2YNO A;  5I5M A;  3SBQ A;  2HJB A;  5EM2 B;  5FLX g;  5C2W B;  5M5S A;  4A0B B;  5IJ7 E;  5CXB A;  3SBP A;  4FA5 D;  3O4G A;  5HE3 B;  1O6F A;  2Z2P A;  4CY1 A;  3VI4 A;  2CN3 A;  2GNQ A;  1U2V C;  2H6K A;  3RN0 D;  2VDQ A;  1VE6 A;  4A2M A;  2VZ3 A;  2VDL A;  4GQ1 A;  3PSL A;  5FKQ A;  3UKR C;  4PBZ A;  1C9L A;  4IRZ A;  1GOG A;  2YMU A;  4H5I A;  2HJ4 A;  4L1M A;  3IUJ A;  3VH0 A;  3CFS B;  2P9K C;  2EIC A;  2PM6 B;  4J84 A;  3JB9 L;  4BCD A;  2J57 G;  2XYI A;  2H3X A;  1ERJ A;  4N14 A;  4PSW B;  3RRM C;  3ZDY A;  3PVU B;  3MUN A;  3SWS D;  3JRO A;  2AGL A;  4O45 A;  4QRJ A;  3SMR A;  5C9Z B;  5M61 A;  3SCY A;  2Z2N A;  3I7K A;  1K3I A;  3NVQ A;  3VGZ A;  3SJL D;  4A11 B;  3MMY A;  4GM3 A;  2XL3 A;  1Q47 A;  4Z7N A;  4CI8 A;  3OTT A;  4UM9 A;  2P9L C;  3JZG A;  3E0C A;  3IIW A;  2CNX A;  4OZU A;  1TBG A;  4RE6 A;  5CXC A;  4DNV A;  1E5T A;  3SXT D;  2H9N A;  3OW8 A;  3PXS D;  4BL0 A;  4XYI A;  3CIK B;  2HU7 A;  3V4V A;  4L9O A;  3UVO A;  5SXM A;  2B5L A;  4BCB A;  3EG6 A;  4CI3 A;  1N6E A;  4GM8 A;  3IUQ A;  2I0R A;  3QHY B;  4J77 A;  3EI3 A;  4MMY A;  3RFH A;  4E5Z B;  2XZG A;  3SHF A;  1MG2 A;  3EMH A;  3ZE1 A;  1JMX B;  3O4J A;  4AN0 A;  2HES X;  3K71 A;  4AN1 A;  3I2N A;  2B4E A;  5FKS A;  2IUV A;  3AL8 B;  2I3S A;  3MZK A;  3F3F A;  2W18 A;  3JZH A;  3EI2 A;  1TYQ C;  1L0Q A;  4E54 B;  4D0K A;  4FWW A;  4DNW A;  3C99 A;  3KRX B; 
#chains in the Genus database with same CATH homology
 4A08 A;  4FB1 D;  4CY2 A;  4A0A B;  3OKY A;  4CY3 A;  4JSN C;  5IJ8 E;  1JJU B;  3A0F A;  3RN1 D;  5H14 A;  5GXH A;  4AOW A;  4J82 A;  4BH6 A;  3SN6 B;  3I8C A;  1PGU A;  5CYK A;  3BG0 A;  3HFQ A;  3IJ0 A;  4GM9 A;  4FA1 D;  1YFQ A;  1OMW B;  2CO0 A;  2I0T A;  4A7J A;  2HKR A;  4I79 A;  2Q7Q A;  2H9P A;  3EI4 B;  3V9F A;  4CI1 A;  3V7D B;  2HYE A;  2UZY B;  5IGO A;  3W15 A;  3ZWL B;  2XU7 A;  1PI6 A;  2H6Q A;  3PSC B;  5I5I A;  1MG3 A;  5GXI A;  1A0R B;  4ERQ A;  3MKQ A;  2O9K A;  1NR0 A;  3PXW D;  1JMZ B;  5FKR A;  4ZOZ A;  4JXM A;  2YNN A;  4LGN A;  5IGQ A;  1K8K C;  3F3G A;  2XL2 A;  2OJY A;  4X60 B;  3FM0 A;  3FGB A;  2EBS A;  3UVL A;  3UR4 A;  1GXR A;  3BWS A;  4K3I D;  2H47 A;  3C75 H;  2OIZ A;  4GMB A;  3EI1 B;  4ESG A;  3RFG A;  2CE9 A;  4IA9 A;  4J8B A;  3P4F A;  5AFU 3;  3L4M D;  4CZX A;  1N6D A;  3EI3 B;  1OLZ A;  3N0E A;  2BBK H;  1QNI A;  4MK0 B;  2H14 A;  2YNP A;  2MTA H;  4GQ2 P;  3B7F A;  5EM2 A;  3IIY A;  2G9A A;  4ERY A;  3PVW B;  4A09 B;  2I0S A;  2OVQ B;  4QQE A;  4PBY A;  5C2V B;  2IUP A;  4YVD A;  4JD2 C;  2B5N A;  2AGY A;  5JWZ A;  4NSX A;  4O9D A;  3EU7 A;  3JPX A;  4A08 B;  4OWR A;  5K1C C;  4J81 A;  2OK4 A;  4JSX C;  3OKY B;  1XIP A;  5HE0 B;  2P9P C;  2P9N C;  3AH8 B;  4QT8 A;  5FXY A;  1VYH C;  4ZOV A;  4GGC A;  3UVK A;  3IKO A;  5IT9 g;  1GG2 B;  2AH1 A;  2PM9 A;  3SBR A;  4BUJ C;  4L1Q D;  4ERZ A;  2P9I C;  4U1E I;  5TEE A;  5H1M A;  1N6F A;  5CYK B;  4J87 A;  4X61 B;  5AMS A;  3F3P A;  4D6V A;  3DWL C;  2AGW A;  3OKT A;  3J81 g;  3DSM A;  5EAP A;  3N0D A;  3GFC A;  5I5J A;  2B5M A;  4GQB B;  2PBI B;  3V5W B;  3J80 g;  5CXB B;  2H13 A;  4GGA A;  4J0W A;  5TEF A;  3BG1 A;  4CC9 A;  3I7L A;  4Y7R A;  4FA9 D;  3UVM A;  4FAV D;  5A2Q g;  3OL2 A;  5IC7 A;  4J78 A;  4CI2 A;  5GSA A;  4E5Z A;  2AQ5 A;  2GC4 A;  3NVX A;  4HDJ A;  2G99 A;  4O1Q D;  2OVR B;  3ORV D;  1U4C A;  3SLE D;  3C5M A;  4JSP C;  4L3H D;  4ZOX A;  1GP2 B;  3IJ1 A;  3AL8 A;  1B9Y A;  2YBA A;  4U7A A;  2I3T A;  2OVP B;  4IMM A;  5HE1 B;  2P9S C;  4L3G D;  3L4O D;  1JOF A;  1SHY B;  2AGX A;  1SQ9 A;  2H9M A;  3UVN A;  3I7O A;  4JT5 C;  4QL1 A;  4A0A A;  4X63 B;  3PE7 A;  3RMZ D;  2GC7 A;  4LG8 A;  3UKU C;  3KRW B;  2QC5 A;  3DXM C;  5CXC B;  5TF2 A;  3MXX A;  3CFV A;  2OK6 A;  3AFC A;  4R7A B;  5THA A;  2PM7 B;  5AJA A;  2IWF A;  5H17 A;  4CY5 A;  3SVW D;  4GGD A;  1PEV A;  5FQD A;  3DM0 A;  1XKS A;  4ZN4 A;  3I7P A;  4O3T B;  4CZV A;  1RI6 A;  3EI4 A;  4ES0 A;  5K19 A;  3EWE A;  3MZL A;  2IUQ A;  2QXV A;  4A0B A;  4J73 A;  3ODT A;  2IUR A;  2PM9 B;  4JT6 C;  1NEX B;  4A2L A;  4GZ8 A;  1FWX A;  3MKS B;  2P9U C;  4X3E A;  3EI2 B;  1PBY B;  2CO0 C;  5FKT A;  5GMK n;  2H6N A;  2HKM A;  4CZY A;  3U4Y A;  4PC0 A;  5EMJ B;  4AEZ A;  2BCJ B;  5HE2 B;  2Z2O A;  3AL9 A;  4J0X A;  4TZ4 A;  4FA4 D;  4PNK B;  5HQG A;  1R5M A;  2H68 A;  5EML B;  3VA6 A;  5EAL A;  3K26 A;  4LG9 A;  3EI1 A;  4G56 B;  5TDH B;  4Y5R D;  3PXT D;  3NVN A;  4XEI C;  3GRE A;  3OL2 B;  5HYN B;  2HXC A;  2AGZ A;  3I7N A;  4FAN D;  4A11 A;  4PXW A;  5EAM A;  4EWR A;  1B9X A;  5EAR A;  2TRC B;  4A09 A;  2IAA A;  2J55 H;  2UZX B;  1MDA H;  3I89 A;  3C9C A;  1XHM A;  2AH0 A;  3DXK C;  3JAM g;  3JRP A;  4O3U B;  1GOT B;  3OKW A;  3RSE C;  4JSV C;  5EMM B;  4J79 A;  5B4W A;  3I7H A;  4K3J B;  4UI9 R;  2IWK A;  4H5J A;  4J86 A;  2YB8 B;  4KFM B;  2H9L A;  5FA5 B;  2J56 H;  3SFZ A;  3FRX A;  1SQJ A;  5KDO B;  1K32 A;  1S4U X;  4Z8L A;  2CN2 A;  3I8E A;  3ULE C;  4ZOY A;  4E54 A;  4J8G A;  4XYH A;  2CE8 A;  5EMK B;  3JZN A;  1P22 A;  4PSX B;  3RLM D;  4FHL A;  3K27 A;  3IJC A;  2YNO A;  5I5M A;  3SBQ A;  2HJB A;  5EM2 B;  5FLX g;  5C2W B;  4A0B B;  5IJ7 E;  5CXB A;  3SBP A;  4FA5 D;  5HE3 B;  2Z2P A;  4CY1 A;  2CN3 A;  2GNQ A;  1U2V C;  2H6K A;  3RN0 D;  4A2M A;  4GQ1 A;  3PSL A;  5FKQ A;  3UKR C;  4PBZ A;  2YMU A;  4H5I A;  2HJ4 A;  3VH0 A;  3CFS B;  2P9K C;  2PM6 B;  4J84 A;  3JB9 L;  2J57 G;  2XYI A;  2H3X A;  1ERJ A;  4N14 A;  4PSW B;  3RRM C;  3PVU B;  3SWS D;  3JRO A;  2AGL A;  4O45 A;  4QRJ A;  3SMR A;  5C9Z B;  3SCY A;  2Z2N A;  3I7K A;  3NVQ A;  3VGZ A;  3SJL D;  4A11 B;  3MMY A;  4GM3 A;  2XL3 A;  1Q47 A;  4CI8 A;  3OTT A;  3JZG A;  2P9L C;  3E0C A;  3IIW A;  2CNX A;  4OZU A;  1TBG A;  5CXC A;  3SXT D;  2H9N A;  3OW8 A;  3PXS D;  4BL0 A;  4XYI A;  3CIK B;  4L9O A;  3UVO A;  5SXM A;  2B5L A;  3EG6 A;  4CI3 A;  1N6E A;  4GM8 A;  2I0R A;  4J77 A;  3EI3 A;  3RFH A;  4E5Z B;  3SHF A;  1MG2 A;  3EMH A;  1JMX B;  2HES X;  3I2N A;  2B4E A;  5FKS A;  2IUV A;  3AL8 B;  2I3S A;  3MZK A;  3F3F A;  2W18 A;  3JZH A;  3EI2 A;  1TYQ C;  1L0Q A;  4E54 B;  4D0K A;  4FWW A;  3C99 A;  3KRX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...