4J84A

Crystal structure of beta'-cop/scyl1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
300
Chain Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
total genus 88
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j84A01
3IIWA 3SBPA 3F3GA 5CYKB 2CN3A 5IJ7E 4EWRA 4O1QD 3JROA 4TZ4A 3AL8A 1Q47A 4U7AA 3SBRA 3SVWD 4CI8A 3ORVD 4FAVD 1B9YA 4BH6A 3J80g 2UZXB 2H14A 3OKTA 4YVDA 4E5ZB 4L9OA 3SXTD 5AJAA 2H47A 4K3ID 5IGOA 3EI2B 3I8EA 4GMBA 5EAPA 4E54A 2P9KC 4CY5A 3I7HA 3EI3B 3PE7A 3BG1A 5C9ZB 2J57G 4J84A 4NSXA 5A2Qg 2CO0A 5IGQA 3I7PA 3CFSB 2B5LA 3I8CA 2B5MA 1SQJA 1MG3A 4K3JB 4CI2A 2H3XA 4X63B 4FA9D 1TBGA 5HE2B 3AFCA 3C99A 3UR4A 3PVWB 4FAND 3F3PA 5CXBA 3I7NA 4ES0A 3EU7A 3I89A 1RI6A 2AGLA 4A09B 3OKYB 2I3TA 3BWSA 3DXMC 2CE9A 2YBAA 3V7DB 3U4YA 4CI1A 5EAMA 2Z2PA 2B4EA 2H13A 4J78A 2PM9A 3BG0A 5AFU3 4H5IA 3SHFA 1JMXB 4X3EA 2CN2A 3F3FA 3JZGA 3SLED 3I2NA 3NVNA 4JT5C 2IWKA 2P9NC 4X60B 4LGNA 1TYQC 4A11A 2P9PC 1K32A 2HJBA 1XIPA 2OK4A 3MZLA 3SJLD 4QRJA 3GREA 3EI4A 4CI3A 3K27A 1PI6A 1MDAH 3MKQA 2EBSA 4J77A 4FA1D 1FWXA 3I7OA 3J81g 5FKTA 1GG2B 4LG8A 5GSAA 2P9IC 3SMRA 4A0BB 3IKOA 4AEZA 2Z2NA 2H6QA 4PBZA 3UVNA 4X61B 1N6FA 2H6NA 3L4MD 2GC7A 3CIKB 4IMMA 5I5MA 1PEVA 4A09A 4QL1A 4Z8LA 3N0EA 2P9UC 4FA5D 2W18A 3UVLA 3KRWB 1U2VC 4GM3A 3A0FA 4GGCA 2H9MA 4CC9A 4A0AA 4ZOZA 5HQGA 2YMUA 2Q7QA 3AL8B 5SXMA 3IIYA 5H17A 5IJ8E 2H9PA 3FGBA 2I0RA 2AGYA 1MG2A 3V9FA 5EMKB 3EI1A 4J8BA 4JT6C 5I5JA 3AH8B 5FKRA 2IUPA 3OW8A 3PXWD 3SFZA 2QC5A 5EM2B 2OVQB 2HYEA 3EI1B 5HYNB 4BUJC 3AL9A 2HKRA 3VH0A 3RFGA 2OVRB 4A08A 4CY1A 4J8GA 5K19A 3RN1D 4O3TB 1JOFA 3ZWLB 5C2VB 2H9NA 2IWFA 1PGUA 4LG9A 4J79A 3E0CA 3EG6A 4GGDA 2AGWA 3RN0D 1XHMA 3UVOA 1YFQA 3JZHA 2I0TA 3PXSD 5H14A 1R5MA 3DWLC 1N6DA 4PSXB 4PC0A 4L3GD 1A0RB 4GM8A 1GOTB 3W15A 4CY3A 3IJ0A 3OKYA 3VA6A 3I7KA 5I5IA 2IUVA 4XEIC 4J86A 1OLZA 2CE8A 4KFMB 4IA9A 5FLXg 2YNPA 3CFVA 2HXCA 2AQ5A 4PSWB 4UI9R 2J55H 3JPXA 5FKQA 3MKSB 1NEXB 3UKUC 4J0XA 2TRCB 3JZNA 5EALA 3JB9L 4QT8A 5H1MA 5HE1B 3P4FA 5HE0B 4ZOYA 4E5ZA 2OK6A 3NVQA 4JD2C 4FB1D 4ERQA 3RLMD 5AMSA 1B9XA 5TEEA 5CXCA 4N14A 1XKSA 2CO0C 3FM0A 4A2LA 3ULEC 1L0QA 3OKWA 5GMKn 3RSEC 2H68A 1P22A 2IUQA 4U1EI 3ODTA 4XYIA 4J73A 3EI3A 4L1QD 5GXIA 2CNXA 3VGZA 4Y7RA 5FKSA 2IAAA 2XL2A 3SN6B 2OIZA 4O3UB 3KRXB 3I7LA 5THAA 2PM9B 5FA5B 2UZYB 2O9KA 4FHLA 3EMHA 3OTTA 4J87A 3UKRC 4AOWA 4CZVA 2AGXA 4CY2A 2YB8B 4J82A 4JSXC 5CXBB 2H6KA 2HKMA 5FQDA 3MMYA 4D6VA 4QQEA 3EWEA 2YNOA 3EI4B 1N6EA 4JSNC 3MZKA 4H5JA 3L4OD 4O9DA 3PSLA 3DXKC 1VYHC 3HFQA 3EI2A 1K8KC 3V5WB 3K26A 1S4UX 2PM7B 3B7FA 2OVPB 4A0BA 3C75H 4OWRA 4CZXA 1ERJA 3PSCB 5TF2A 5HE3B 2BCJB 2J56H 2I0SA 1PBYB 2BBKH 3NVXA 4MK0B 5FXYA 3IJ1A 2XU7A 1NR0A 4PNKB 4FWWA 2HESX 4FA4D 4R7AB 4ERYA 1U4CA 4BL0A 3C9CA 4A08B 4GQ2P 4A7JA 4ZN4A 1QNIA 4ZOXA 2GNQA 3PVUB 5KDOB 5GXHA 4A2MA 3JRPA 3UVMA 5TDHB 4G56B 4CZYA 2XL3A 4HDJA 2AH1A 2MTAH 4O45A 2B5NA 4ESGA 2YNNA 4XYHA 4JSVC 3UVKA 3N0DA 4PBYA 2PM6B 5CYKA 1SQ9A 3MXXA 2H9LA 5EMLB 3DSMA 4GGAA 3DM0A 5B4WA 2Z2OA 2G99A 3PXTD 3SBQA 4A11B 3FRXA 4GM9A 5TEFA 4Y5RD 4J0WA 4OZUA 2QXVA 2XYIA 5EARA 1GXRA 4A0AB 4J81A 1SHYB 3RMZD 2GC4A 4D0KA 4GZ8A 3OL2A 4GQBB 5EMJB 5IC7A 4JXMA 4JSPC 3JAMg 3SCYA 3SWSD 4ERZA 2AH0A 3GFCA 1GP2B 5JWZA 4E54B 2PBIB 2G9AA 2AGZA 3RRMC 3OL2B 1JMZB 1OMWB 5CXCB 4ZOVA 5IT9g 1JJUB 2P9LC 5EMMB 4L3HD 4I79A 4GQ1A 4PXWA 5EM2A 5K1CC 2OJYA 3C5MA 3RFHA 2HJ4A 2IURA 5C2WB 2I3SA 3IJCA 2P9SC
chains in the Genus database with same CATH superfamily
2VDMA 3IIWA 3SBPA 3F3GA 4Z7NA 2WQ8A 3K71A 5CYKB 2VDLA 2CN3A 5IJ7E 4EWRA 4O1QD 3JROA 4TZ4A 5M5RA 3AL8A 4NBMA 1Q47A 4U7AA 3SBRA 3SVWD 4CI8A 2XE4A 2XZGA 3ORVD 5E6UA 4FAVD 4NAAA 1B9YA 4BH6A 5FFOA 3J80g 4NENA 2UZXB 2H14A 3OKTA 4YVDA 4E5ZB 4L9OA 3OF7A 3SXTD 5AJAA 2H47A 4K3ID 5IGOA 2EIBA 3EI2B 3I8EA 4GMBA 5C92A 1H2WA 5EAPA 1JTDB 4E54A 2P9KC 4CY5A 4D9SA 3I7HA 3EI3B 3PE7A 3BG1A 5C9ZB 2J57G 4J84A 4NSXA 5A2Qg 2CO0A 5IGQA 2VDRA 3I7PA 3CFSB 2B5LA 5M5UA 3I8CA 4O2WA 4AN0A 2B5MA 1SQJA 1MG3A 4K3JB 4CI2A 2H3XA 4BP8A 4X63B 4FA9D 3FCSA 1TBGA 5HE2B 3AFCA 3C99A 3UR4A 1GOHA 3PVWB 4FAND 3V4VA 3F3PA 1A12A 5CXBA 3I7NA 4ES0A 3EU7A 1I2MB 2HU7A 3I89A 1RI6A 2AGLA 4A09B 3OKYB 2I3TA 3IUMA 3BWSA 3DXMC 4AMYA 2CE9A 2EICA 2YBAA 3V7DB 4O02A 3U4YA 4CI1A 5EAMA 2Z2PA 2B4EA 2H13A 4J78A 1UOPA 2PM9A 3BG0A 5AFU3 1QFSA 4H5IA 3SHFA 1JMXB 4JHNA 4X3EA 2CN2A 3F3FA 3JZGA 3SLED 3I2NA 2VDQA 3NVNA 4JT5C 2IWKA 2P9NC 4X60B 4LGNA 3EQ9A 4L1MA 1TYQC 4A11A 1T2XA 2P9PC 5M61A 1K32A 2HJBA 1XIPA 2OK4A 3MZLA 4AX4A 3SJLD 2VDOA 4QRJA 3GREA 3EI4A 2VC2A 3QI0A 4CI3A 1C9LA 3K27A 1PI6A 4RE6A 1MDAH 4BP9A 3MKQA 2EBSA 4J77A 4FA1D 1FWXA 3I7OA 3J81g 5FKTA 1GG2B 4LG8A 5GSAA 2P9IC 3SMRA 3O4GA 4A0BB 3IKOA 4AEZA 2Z2NA 2H6QA 4PBZA 3UVNA 4X61B 3ZE2A 1N6FA 3IUJA 2H6NA 3L4MD 2GC7A 3CIKB 4IMMA 5I5MA 1PEVA 3VI3A 3ZE0A 4DNWA 4A09A 4NC4A 4QL1A 4Z8LA 3ZDXA 3N0EA 4BCBA 2P9UC 4FA5D 2W18A 3UVLA 3KRWB 1U2VC 3O4HA 4GM3A 3A0FA 4GGCA 3MUNA 2VDKA 2H9MA 4CC9A 4A0AA 4ZOZA 5HQGA 3NIGA 2YMUA 2Q7QA 3AL8B 3ZE1A 3VI4A 5SXMA 1VE7A 2EIDA 3IIYA 3DDUA 5H17A 5IJ8E 1YR2A 2H9PA 3FGBA 2I0RA 2AGYA 1MG2A 3V9FA 2XDWA 5EMKB 3EI1A 3KCIA 4J8BA 1UOOA 4JT6C 1UTCA 5I5JA 3AH8B 5FKRA 2IUPA 3IUNA 3OW8A 3IULA 3PXWD 3SFZA 2QC5A 3ZDZA 5EM2B 2OVQB 2HYEA 3EI1B 5HYNB 4BUJC 3AL9A 2HKRA 3O4JA 2VZ3A 3VH0A 3RFGA 2OVRB 4A08A 5M5SA 4CY1A 4J8GA 1O6GA 5K19A 3RN1D 4O3TB 4MMXA 1JOFA 3ZWLB 5C2VB 3EQ8A 2VZ1A 2H9NA 4AMZA 2IWFA 1PGUA 4LG9A 4UM9A 3EQ7A 5E6SA 4J79A 3EG6A 3E0CA 3IVMA 2AGWA 4GGDA 4AN1A 3RN0D 1XHMA 3UVOA 1YFQA 3JZHA 2I0TA 3PXSD 5H14A 1R5MA 3DWLC 1N6DA 4GM8A 4L3GD 4PC0A 1A0RB 4PSXB 1GOTB 3W15A 4CY3A 3IJ0A 3K72A 3OKYA 3VA6A 3I7KA 5I5IA 2IUVA 4XEIC 4J86A 1OLZA 2CE8A 4KFMB 4IA9A 1E5TA 5FLXg 2YNPA 3CFVA 2HXCA 2AQ5A 4PSWB 4UI9R 4RE5A 2J55H 3JPXA 5FKQA 3MKSB 1NEXB 3UKUC 4J0XA 2TRCB 3JZNA 5EALA 3JB9L 1H2YA 1TYEA 4QT8A 5H1MA 5HE1B 3P4FA 5HE0B 4ZOYA 4E5ZA 2OK6A 3NVQA 4JD2C 4FB1D 4ERQA 3RLMD 5HDBA 4DNUA 1H2XA 5AMSA 1B9XA 5TEEA 5CXCA 4N14A 1XKSA 1H2ZA 2CO0C 3FM0A 4UM8A 5FFGA 4A2LA 3ULEC 1L0QA 3OKWA 5GMKn 3RSEC 2QZPA 1M1XA 2H68A 2JKXA 1P22A 2IUQA 3NIDA 1O6FA 4U1EI 3ODTA 4XYIA 4J73A 3EI3A 4L1QD 3K6SA 5GXIA 2CNXA 3VGZA 4Y7RA 4Z7OA 5FKSA 2IAAA 2XL2A 3SN6B 2OIZA 4O3UB 3KRXB 3I7LA 4WK2A 3IURA 5THAA 2PM9B 5FA5B 2UZYB 2O9KA 4FHLA 3EMHA 3OTTA 4J87A 3UKRC 4AOWA 4WK4A 4CZVA 2AGXA 5M5VA 4CY2A 3GD1I 2YB8B 4J82A 4JSXC 5CXBB 3QHYB 2H6KA 2HKMA 5FQDA 3MMYA 4D6VA 4QQEA 3EWEA 2YNOA 3IJEA 3EI4B 1N6EA 4JSNC 3MZKA 4H5JA 4BCCA 3L4OD 4O9DA 3PSLA 1E8MA 3DXKC 1VYHC 1E8NA 3ZDYA 3HFQA 4IRZA 1K8KC 3EI2A 3V5WB 3K26A 1S4UX 2PM7B 4JHPC 3B7FA 2HU8A 3GC3B 4G1MA 4BCDA 1U8CA 2OVPB 4A0BA 3C75H 4OWRA 4CZXA 1ERJA 3PSCB 1QFMA 4WK0A 5TF2A 5HE3B 2BCJB 2J56H 2I0SA 1PBYB 2BBKH 3NVXA 4MK0B 5FXYA 3IJ1A 2XU7A 1NR0A 1UOQA 4PNKB 4FWWA 2HESX 5E6RA 4FA4D 4R7AB 4ERYA 3IUQA 1JV2A 1U4CA 4BL0A 3C9CA 4A08B 4GQ2P 4Z7QA 1VE6A 3T3MA 4A7JA 4ZN4A 1QNIA 4ZOXA 4DNVA 2GNQA 3PVUB 1L5GA 5KDOB 5GXHA 2QR5A 4A2MA 3JRPA 3UVMA 5TDHB 4G56B 4CZYA 3FCUA 2XL3A 4HDJA 2AH1A 2MTAH 4O45A 2B5NA 4ESGA 2YNNA 4XYHA 5M5TA 4JSVC 3UVKA 3N0DA 4PBYA 4MMYA 4WJKA 2PM6B 4QAMA 5CYKA 1SQ9A 3MXXA 2H9LA 5EMLB 2BKLA 3DSMA 4MMZA 4GGAA 2HU5A 3DM0A 5B4WA 2Z2OA 2G99A 1K3IA 3PXTD 3SBQA 4A11B 3FRXA 4GM9A 5TEFA 1GOGA 3T3PA 4Y5RD 4J0WA 4OZUA 2QXVA 2XYIA 5EARA 1GXRA 4A0AB 4J81A 1VZ3A 1SHYB 3RMZD 3MVDK 2GC4A 4D0KA 1GOFA 4GZ8A 3OL2A 4GQBB 5EMJB 5IC7A 4JXMA 4JSPC 3JAMg 1C9IA 3SCYA 3SWSD 4ERZA 4G55A 2AH0A 3GFCA 1GP2B 5JWZA 4E54B 2EIEA 2PBIB 2G9AA 2AGZA 3RRMC 2VDPA 4G1EA 3O4IA 1JMZB 3OL2B 3V4PA 1OMWB 5CXCB 4ZOVA 5IT9g 1JJUB 2P9LC 5EMMB 4L3HD 4I79A 4GQ1A 5C86A 4PXWA 5EM2A 5K1CC 1BPOA 2OJYA 3NIFA 3C5MA 3RFHA 2HJ4A 1VZ2A 2VDNA 2IURA 3MUOA 5C2WB 2I3SA 3IJCA 2P9SC
chains in the Genus database with same CATH topology
3IIWA 3SBPA 3F3GA 5CYKB 2CN3A 5IJ7E 4EWRA 4O1QD 3JROA 4TZ4A 3AL8A 1Q47A 4U7AA 3SBRA 3SVWD 4CI8A 3ORVD 4FAVD 1B9YA 4BH6A 3J80g 2UZXB 2H14A 3OKTA 4YVDA 4E5ZB 4L9OA 3SXTD 5AJAA 2H47A 4K3ID 5IGOA 3EI2B 3I8EA 4GMBA 5EAPA 4E54A 2P9KC 4CY5A 3I7HA 3EI3B 3PE7A 3BG1A 5C9ZB 2J57G 4J84A 4NSXA 5A2Qg 2CO0A 5IGQA 3I7PA 3CFSB 2B5LA 3I8CA 2B5MA 1SQJA 1MG3A 4K3JB 4CI2A 2H3XA 4X63B 4FA9D 1TBGA 5HE2B 3AFCA 3C99A 3UR4A 3PVWB 4FAND 3F3PA 5CXBA 3I7NA 4ES0A 3EU7A 3I89A 1RI6A 2AGLA 4A09B 3OKYB 2I3TA 3BWSA 3DXMC 2CE9A 2YBAA 3V7DB 3U4YA 4CI1A 5EAMA 2Z2PA 2B4EA 2H13A 4J78A 2PM9A 3BG0A 5AFU3 4H5IA 3SHFA 1JMXB 4X3EA 2CN2A 3F3FA 3JZGA 3SLED 3I2NA 3NVNA 4JT5C 2IWKA 2P9NC 4X60B 4LGNA 1TYQC 4A11A 2P9PC 1K32A 2HJBA 1XIPA 2OK4A 3MZLA 3SJLD 4QRJA 3GREA 3EI4A 4CI3A 3K27A 1PI6A 1MDAH 3MKQA 2EBSA 4J77A 4FA1D 1FWXA 3I7OA 3J81g 5FKTA 1GG2B 4LG8A 5GSAA 2P9IC 3SMRA 4A0BB 3IKOA 4AEZA 2Z2NA 2H6QA 4PBZA 3UVNA 4X61B 1N6FA 2H6NA 3L4MD 2GC7A 3CIKB 4IMMA 5I5MA 1PEVA 4A09A 4QL1A 4Z8LA 3N0EA 2P9UC 4FA5D 2W18A 3UVLA 3KRWB 1U2VC 4GM3A 3A0FA 4GGCA 2H9MA 4CC9A 4A0AA 4ZOZA 5HQGA 2YMUA 2Q7QA 3AL8B 5SXMA 3IIYA 5H17A 5IJ8E 2H9PA 3FGBA 2I0RA 2AGYA 1MG2A 3V9FA 5EMKB 3EI1A 4J8BA 4JT6C 5I5JA 3AH8B 5FKRA 2IUPA 3OW8A 3PXWD 3SFZA 2QC5A 5EM2B 2OVQB 2HYEA 3EI1B 5HYNB 4BUJC 3AL9A 2HKRA 3VH0A 3RFGA 2OVRB 4A08A 4CY1A 4J8GA 5K19A 3RN1D 4O3TB 1JOFA 3ZWLB 5C2VB 2H9NA 2IWFA 1PGUA 4LG9A 4J79A 3E0CA 3EG6A 4GGDA 2AGWA 3RN0D 1XHMA 3UVOA 1YFQA 3JZHA 2I0TA 3PXSD 5H14A 1R5MA 3DWLC 1N6DA 4PSXB 4PC0A 4L3GD 1A0RB 4GM8A 1GOTB 3W15A 4CY3A 3IJ0A 3OKYA 3VA6A 3I7KA 5I5IA 2IUVA 4XEIC 4J86A 1OLZA 2CE8A 4KFMB 4IA9A 5FLXg 2YNPA 3CFVA 2HXCA 2AQ5A 4PSWB 4UI9R 2J55H 3JPXA 5FKQA 3MKSB 1NEXB 3UKUC 4J0XA 2TRCB 3JZNA 5EALA 3JB9L 4QT8A 5H1MA 5HE1B 3P4FA 5HE0B 4ZOYA 4E5ZA 2OK6A 3NVQA 4JD2C 4FB1D 4ERQA 3RLMD 5AMSA 1B9XA 5TEEA 5CXCA 4N14A 1XKSA 2CO0C 3FM0A 4A2LA 3ULEC 1L0QA 3OKWA 5GMKn 3RSEC 2H68A 1P22A 2IUQA 4U1EI 3ODTA 4XYIA 4J73A 3EI3A 4L1QD 5GXIA 2CNXA 3VGZA 4Y7RA 5FKSA 2IAAA 2XL2A 3SN6B 2OIZA 4O3UB 3KRXB 3I7LA 5THAA 2PM9B 5FA5B 2UZYB 2O9KA 4FHLA 3EMHA 3OTTA 4J87A 3UKRC 4AOWA 4CZVA 2AGXA 4CY2A 2YB8B 4J82A 4JSXC 5CXBB 2H6KA 2HKMA 5FQDA 3MMYA 4D6VA 4QQEA 3EWEA 2YNOA 3EI4B 1N6EA 4JSNC 3MZKA 4H5JA 3L4OD 4O9DA 3PSLA 3DXKC 1VYHC 3HFQA 3EI2A 1K8KC 3V5WB 3K26A 1S4UX 2PM7B 3B7FA 2OVPB 4A0BA 3C75H 4OWRA 4CZXA 1ERJA 3PSCB 5TF2A 5HE3B 2BCJB 2J56H 2I0SA 1PBYB 2BBKH 3NVXA 4MK0B 5FXYA 3IJ1A 2XU7A 1NR0A 4PNKB 4FWWA 2HESX 4FA4D 4R7AB 4ERYA 1U4CA 4BL0A 3C9CA 4A08B 4GQ2P 4A7JA 4ZN4A 1QNIA 4ZOXA 2GNQA 3PVUB 5KDOB 5GXHA 4A2MA 3JRPA 3UVMA 5TDHB 4G56B 4CZYA 2XL3A 4HDJA 2AH1A 2MTAH 4O45A 2B5NA 4ESGA 2YNNA 4XYHA 4JSVC 3UVKA 3N0DA 4PBYA 2PM6B 5CYKA 1SQ9A 3MXXA 2H9LA 5EMLB 3DSMA 4GGAA 3DM0A 5B4WA 2Z2OA 2G99A 3PXTD 3SBQA 4A11B 3FRXA 4GM9A 5TEFA 4Y5RD 4J0WA 4OZUA 2QXVA 2XYIA 5EARA 1GXRA 4A0AB 4J81A 1SHYB 3RMZD 2GC4A 4D0KA 4GZ8A 3OL2A 4GQBB 5EMJB 5IC7A 4JXMA 4JSPC 3JAMg 3SCYA 3SWSD 4ERZA 2AH0A 3GFCA 1GP2B 5JWZA 4E54B 2PBIB 2G9AA 2AGZA 3RRMC 3OL2B 1JMZB 1OMWB 5CXCB 4ZOVA 5IT9g 1JJUB 2P9LC 5EMMB 4L3HD 4I79A 4GQ1A 4PXWA 5EM2A 5K1CC 2OJYA 3C5MA 3RFHA 2HJ4A 2IURA 5C2WB 2I3SA 3IJCA 2P9SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIW A;  3SBP A;  3F3G A;  5CYK B;  2CN3 A;  5IJ7 E;  4EWR A;  4O1Q D;  3JRO A;  4TZ4 A;  3AL8 A;  1Q47 A;  4U7A A;  3SBR A;  3SVW D;  4CI8 A;  3ORV D;  4FAV D;  1B9Y A;  4BH6 A;  3J80 g;  2UZX B;  2H14 A;  3OKT A;  4YVD A;  4E5Z B;  4L9O A;  3SXT D;  5AJA A;  2H47 A;  4K3I D;  5IGO A;  3EI2 B;  3I8E A;  4GMB A;  5EAP A;  4E54 A;  2P9K C;  4CY5 A;  3I7H A;  3EI3 B;  3PE7 A;  3BG1 A;  5C9Z B;  2J57 G;  4J84 A;  4NSX A;  5A2Q g;  2CO0 A;  5IGQ A;  3I7P A;  3CFS B;  2B5L A;  3I8C A;  2B5M A;  1SQJ A;  1MG3 A;  4K3J B;  4CI2 A;  2H3X A;  4X63 B;  4FA9 D;  1TBG A;  5HE2 B;  3AFC A;  3C99 A;  3UR4 A;  3PVW B;  4FAN D;  3F3P A;  5CXB A;  3I7N A;  4ES0 A;  3EU7 A;  3I89 A;  1RI6 A;  2AGL A;  4A09 B;  3OKY B;  2I3T A;  3BWS A;  3DXM C;  2CE9 A;  2YBA A;  3V7D B;  3U4Y A;  4CI1 A;  5EAM A;  2Z2P A;  2B4E A;  2H13 A;  4J78 A;  2PM9 A;  3BG0 A;  5AFU 3;  4H5I A;  3SHF A;  1JMX B;  4X3E A;  2CN2 A;  3F3F A;  3JZG A;  3SLE D;  3I2N A;  3NVN A;  4JT5 C;  2IWK A;  2P9N C;  4X60 B;  4LGN A;  1TYQ C;  4A11 A;  2P9P C;  1K32 A;  2HJB A;  1XIP A;  2OK4 A;  3MZL A;  3SJL D;  4QRJ A;  3GRE A;  3EI4 A;  4CI3 A;  3K27 A;  1PI6 A;  1MDA H;  3MKQ A;  2EBS A;  4J77 A;  4FA1 D;  1FWX A;  3I7O A;  3J81 g;  5FKT A;  1GG2 B;  4LG8 A;  5GSA A;  2P9I C;  3SMR A;  4A0B B;  3IKO A;  4AEZ A;  2Z2N A;  2H6Q A;  4PBZ A;  3UVN A;  4X61 B;  1N6F A;  2H6N A;  3L4M D;  2GC7 A;  3CIK B;  4IMM A;  5I5M A;  1PEV A;  4A09 A;  4QL1 A;  4Z8L A;  3N0E A;  2P9U C;  4FA5 D;  2W18 A;  3UVL A;  3KRW B;  1U2V C;  4GM3 A;  3A0F A;  4GGC A;  2H9M A;  4CC9 A;  4A0A A;  4ZOZ A;  5HQG A;  2YMU A;  2Q7Q A;  3AL8 B;  5SXM A;  3IIY A;  5H17 A;  5IJ8 E;  2H9P A;  3FGB A;  2I0R A;  2AGY A;  1MG2 A;  3V9F A;  5EMK B;  3EI1 A;  4J8B A;  4JT6 C;  5I5J A;  3AH8 B;  5FKR A;  2IUP A;  3OW8 A;  3PXW D;  3SFZ A;  2QC5 A;  5EM2 B;  2OVQ B;  2HYE A;  3EI1 B;  5HYN B;  4BUJ C;  3AL9 A;  2HKR A;  3VH0 A;  3RFG A;  2OVR B;  4A08 A;  4CY1 A;  4J8G A;  5K19 A;  3RN1 D;  4O3T B;  1JOF A;  3ZWL B;  5C2V B;  2H9N A;  2IWF A;  1PGU A;  4LG9 A;  4J79 A;  3E0C A;  3EG6 A;  4GGD A;  2AGW A;  3RN0 D;  1XHM A;  3UVO A;  1YFQ A;  3JZH A;  2I0T A;  3PXS D;  5H14 A;  1R5M A;  3DWL C;  1N6D A;  4PSX B;  4PC0 A;  4L3G D;  1A0R B;  4GM8 A;  1GOT B;  3W15 A;  4CY3 A;  3IJ0 A;  3OKY A;  3VA6 A;  3I7K A;  5I5I A;  2IUV A;  4XEI C;  4J86 A;  1OLZ A;  2CE8 A;  4KFM B;  4IA9 A;  5FLX g;  2YNP A;  3CFV A;  2HXC A;  2AQ5 A;  4PSW B;  4UI9 R;  2J55 H;  3JPX A;  5FKQ A;  3MKS B;  1NEX B;  3UKU C;  4J0X A;  2TRC B;  3JZN A;  5EAL A;  3JB9 L;  4QT8 A;  5H1M A;  5HE1 B;  3P4F A;  5HE0 B;  4ZOY A;  4E5Z A;  2OK6 A;  3NVQ A;  4JD2 C;  4FB1 D;  4ERQ A;  3RLM D;  5AMS A;  1B9X A;  5TEE A;  5CXC A;  4N14 A;  1XKS A;  2CO0 C;  3FM0 A;  4A2L A;  3ULE C;  1L0Q A;  3OKW A;  5GMK n;  3RSE C;  2H68 A;  1P22 A;  2IUQ A;  4U1E I;  3ODT A;  4XYI A;  4J73 A;  3EI3 A;  4L1Q D;  5GXI A;  2CNX A;  3VGZ A;  4Y7R A;  5FKS A;  2IAA A;  2XL2 A;  3SN6 B;  2OIZ A;  4O3U B;  3KRX B;  3I7L A;  5THA A;  2PM9 B;  5FA5 B;  2UZY B;  2O9K A;  4FHL A;  3EMH A;  3OTT A;  4J87 A;  3UKR C;  4AOW A;  4CZV A;  2AGX A;  4CY2 A;  2YB8 B;  4J82 A;  4JSX C;  5CXB B;  2H6K A;  2HKM A;  5FQD A;  3MMY A;  4D6V A;  4QQE A;  3EWE A;  2YNO A;  3EI4 B;  1N6E A;  4JSN C;  3MZK A;  4H5J A;  3L4O D;  4O9D A;  3PSL A;  3DXK C;  1VYH C;  3HFQ A;  3EI2 A;  1K8K C;  3V5W B;  3K26 A;  1S4U X;  2PM7 B;  3B7F A;  2OVP B;  4A0B A;  3C75 H;  4OWR A;  4CZX A;  1ERJ A;  3PSC B;  5TF2 A;  5HE3 B;  2BCJ B;  2J56 H;  2I0S A;  1PBY B;  2BBK H;  3NVX A;  4MK0 B;  5FXY A;  3IJ1 A;  2XU7 A;  1NR0 A;  4PNK B;  4FWW A;  2HES X;  4FA4 D;  4R7A B;  4ERY A;  1U4C A;  4BL0 A;  3C9C A;  4A08 B;  4GQ2 P;  4A7J A;  4ZN4 A;  1QNI A;  4ZOX A;  2GNQ A;  3PVU B;  5KDO B;  5GXH A;  4A2M A;  3JRP A;  3UVM A;  5TDH B;  4G56 B;  4CZY A;  2XL3 A;  4HDJ A;  2AH1 A;  2MTA H;  4O45 A;  2B5N A;  4ESG A;  2YNN A;  4XYH A;  4JSV C;  3UVK A;  3N0D A;  4PBY A;  2PM6 B;  5CYK A;  1SQ9 A;  3MXX A;  2H9L A;  5EML B;  3DSM A;  4GGA A;  3DM0 A;  5B4W A;  2Z2O A;  2G99 A;  3PXT D;  3SBQ A;  4A11 B;  3FRX A;  4GM9 A;  5TEF A;  4Y5R D;  4J0W A;  4OZU A;  2QXV A;  2XYI A;  5EAR A;  1GXR A;  4A0A B;  4J81 A;  1SHY B;  3RMZ D;  2GC4 A;  4D0K A;  4GZ8 A;  3OL2 A;  4GQB B;  5EMJ B;  5IC7 A;  4JXM A;  4JSP C;  3JAM g;  3SCY A;  3SWS D;  4ERZ A;  2AH0 A;  3GFC A;  1GP2 B;  5JWZ A;  4E54 B;  2PBI B;  2G9A A;  2AGZ A;  3RRM C;  3OL2 B;  1JMZ B;  1OMW B;  5CXC B;  4ZOV A;  5IT9 g;  1JJU B;  2P9L C;  5EMM B;  4L3H D;  4I79 A;  4GQ1 A;  4PXW A;  5EM2 A;  5K1C C;  2OJY A;  3C5M A;  3RFH A;  2HJ4 A;  2IUR A;  5C2W B;  2I3S A;  3IJC A;  2P9S C; 
#chains in the Genus database with same CATH topology
 2VDM A;  3IIW A;  3SBP A;  3F3G A;  4Z7N A;  2WQ8 A;  3K71 A;  5CYK B;  2VDL A;  2CN3 A;  5IJ7 E;  4EWR A;  4O1Q D;  3JRO A;  4TZ4 A;  5M5R A;  3AL8 A;  4NBM A;  1Q47 A;  4U7A A;  3SBR A;  3SVW D;  4CI8 A;  2XE4 A;  2XZG A;  3ORV D;  5E6U A;  4FAV D;  4NAA A;  1B9Y A;  4BH6 A;  5FFO A;  3J80 g;  4NEN A;  2UZX B;  2H14 A;  3OKT A;  4YVD A;  4E5Z B;  4L9O A;  3OF7 A;  3SXT D;  5AJA A;  2H47 A;  4K3I D;  5IGO A;  2EIB A;  3EI2 B;  3I8E A;  4GMB A;  5C92 A;  1H2W A;  5EAP A;  1JTD B;  4E54 A;  2P9K C;  4CY5 A;  4D9S A;  3I7H A;  3EI3 B;  3PE7 A;  3BG1 A;  5C9Z B;  2J57 G;  4J84 A;  4NSX A;  5A2Q g;  2CO0 A;  5IGQ A;  2VDR A;  3I7P A;  3CFS B;  2B5L A;  5M5U A;  3I8C A;  4O2W A;  4AN0 A;  2B5M A;  1SQJ A;  1MG3 A;  4K3J B;  4CI2 A;  2H3X A;  4BP8 A;  4X63 B;  4FA9 D;  3FCS A;  1TBG A;  5HE2 B;  3AFC A;  3C99 A;  3UR4 A;  1GOH A;  3PVW B;  4FAN D;  3V4V A;  3F3P A;  1A12 A;  5CXB A;  3I7N A;  4ES0 A;  3EU7 A;  1I2M B;  2HU7 A;  3I89 A;  1RI6 A;  2AGL A;  4A09 B;  3OKY B;  2I3T A;  3IUM A;  3BWS A;  3DXM C;  4AMY A;  2CE9 A;  2EIC A;  2YBA A;  3V7D B;  4O02 A;  3U4Y A;  4CI1 A;  5EAM A;  2Z2P A;  2B4E A;  2H13 A;  4J78 A;  1UOP A;  2PM9 A;  3BG0 A;  5AFU 3;  1QFS A;  4H5I A;  3SHF A;  1JMX B;  4JHN A;  4X3E A;  2CN2 A;  3F3F A;  3JZG A;  3SLE D;  3I2N A;  2VDQ A;  3NVN A;  4JT5 C;  2IWK A;  2P9N C;  4X60 B;  4LGN A;  3EQ9 A;  4L1M A;  1TYQ C;  4A11 A;  1T2X A;  2P9P C;  5M61 A;  1K32 A;  2HJB A;  1XIP A;  2OK4 A;  3MZL A;  4AX4 A;  3SJL D;  2VDO A;  4QRJ A;  3GRE A;  3EI4 A;  2VC2 A;  3QI0 A;  4CI3 A;  1C9L A;  3K27 A;  1PI6 A;  4RE6 A;  1MDA H;  4BP9 A;  3MKQ A;  2EBS A;  4J77 A;  4FA1 D;  1FWX A;  3I7O A;  3J81 g;  5FKT A;  1GG2 B;  4LG8 A;  5GSA A;  2P9I C;  3SMR A;  3O4G A;  4A0B B;  3IKO A;  4AEZ A;  2Z2N A;  2H6Q A;  4PBZ A;  3UVN A;  4X61 B;  3ZE2 A;  1N6F A;  3IUJ A;  2H6N A;  3L4M D;  2GC7 A;  3CIK B;  4IMM A;  5I5M A;  1PEV A;  3VI3 A;  3ZE0 A;  4DNW A;  4A09 A;  4NC4 A;  4QL1 A;  4Z8L A;  3ZDX A;  3N0E A;  4BCB A;  2P9U C;  4FA5 D;  2W18 A;  3UVL A;  3KRW B;  1U2V C;  3O4H A;  4GM3 A;  3A0F A;  4GGC A;  3MUN A;  2VDK A;  2H9M A;  4CC9 A;  4A0A A;  4ZOZ A;  5HQG A;  3NIG A;  2YMU A;  2Q7Q A;  3AL8 B;  3ZE1 A;  3VI4 A;  5SXM A;  1VE7 A;  2EID A;  3IIY A;  3DDU A;  5H17 A;  5IJ8 E;  1YR2 A;  2H9P A;  3FGB A;  2I0R A;  2AGY A;  1MG2 A;  3V9F A;  2XDW A;  5EMK B;  3EI1 A;  3KCI A;  4J8B A;  1UOO A;  4JT6 C;  1UTC A;  5I5J A;  3AH8 B;  5FKR A;  2IUP A;  3IUN A;  3OW8 A;  3IUL A;  3PXW D;  3SFZ A;  2QC5 A;  3ZDZ A;  5EM2 B;  2OVQ B;  2HYE A;  3EI1 B;  5HYN B;  4BUJ C;  3AL9 A;  2HKR A;  3O4J A;  2VZ3 A;  3VH0 A;  3RFG A;  2OVR B;  4A08 A;  5M5S A;  4CY1 A;  4J8G A;  1O6G A;  5K19 A;  3RN1 D;  4O3T B;  4MMX A;  1JOF A;  3ZWL B;  5C2V B;  3EQ8 A;  2VZ1 A;  2H9N A;  4AMZ A;  2IWF A;  1PGU A;  4LG9 A;  4UM9 A;  3EQ7 A;  5E6S A;  4J79 A;  3EG6 A;  3E0C A;  3IVM A;  2AGW A;  4GGD A;  4AN1 A;  3RN0 D;  1XHM A;  3UVO A;  1YFQ A;  3JZH A;  2I0T A;  3PXS D;  5H14 A;  1R5M A;  3DWL C;  1N6D A;  4GM8 A;  4L3G D;  4PC0 A;  1A0R B;  4PSX B;  1GOT B;  3W15 A;  4CY3 A;  3IJ0 A;  3K72 A;  3OKY A;  3VA6 A;  3I7K A;  5I5I A;  2IUV A;  4XEI C;  4J86 A;  1OLZ A;  2CE8 A;  4KFM B;  4IA9 A;  1E5T A;  5FLX g;  2YNP A;  3CFV A;  2HXC A;  2AQ5 A;  4PSW B;  4UI9 R;  4RE5 A;  2J55 H;  3JPX A;  5FKQ A;  3MKS B;  1NEX B;  3UKU C;  4J0X A;  2TRC B;  3JZN A;  5EAL A;  3JB9 L;  1H2Y A;  1TYE A;  4QT8 A;  5H1M A;  5HE1 B;  3P4F A;  5HE0 B;  4ZOY A;  4E5Z A;  2OK6 A;  3NVQ A;  4JD2 C;  4FB1 D;  4ERQ A;  3RLM D;  5HDB A;  4DNU A;  1H2X A;  5AMS A;  1B9X A;  5TEE A;  5CXC A;  4N14 A;  1XKS A;  1H2Z A;  2CO0 C;  3FM0 A;  4UM8 A;  5FFG A;  4A2L A;  3ULE C;  1L0Q A;  3OKW A;  5GMK n;  3RSE C;  2QZP A;  1M1X A;  2H68 A;  2JKX A;  1P22 A;  2IUQ A;  3NID A;  1O6F A;  4U1E I;  3ODT A;  4XYI A;  4J73 A;  3EI3 A;  4L1Q D;  3K6S A;  5GXI A;  2CNX A;  3VGZ A;  4Y7R A;  4Z7O A;  5FKS A;  2IAA A;  2XL2 A;  3SN6 B;  2OIZ A;  4O3U B;  3KRX B;  3I7L A;  4WK2 A;  3IUR A;  5THA A;  2PM9 B;  5FA5 B;  2UZY B;  2O9K A;  4FHL A;  3EMH A;  3OTT A;  4J87 A;  3UKR C;  4AOW A;  4WK4 A;  4CZV A;  2AGX A;  5M5V A;  4CY2 A;  3GD1 I;  2YB8 B;  4J82 A;  4JSX C;  5CXB B;  3QHY B;  2H6K A;  2HKM A;  5FQD A;  3MMY A;  4D6V A;  4QQE A;  3EWE A;  2YNO A;  3IJE A;  3EI4 B;  1N6E A;  4JSN C;  3MZK A;  4H5J A;  4BCC A;  3L4O D;  4O9D A;  3PSL A;  1E8M A;  3DXK C;  1VYH C;  1E8N A;  3ZDY A;  3HFQ A;  4IRZ A;  1K8K C;  3EI2 A;  3V5W B;  3K26 A;  1S4U X;  2PM7 B;  4JHP C;  3B7F A;  2HU8 A;  3GC3 B;  4G1M A;  4BCD A;  1U8C A;  2OVP B;  4A0B A;  3C75 H;  4OWR A;  4CZX A;  1ERJ A;  3PSC B;  1QFM A;  4WK0 A;  5TF2 A;  5HE3 B;  2BCJ B;  2J56 H;  2I0S A;  1PBY B;  2BBK H;  3NVX A;  4MK0 B;  5FXY A;  3IJ1 A;  2XU7 A;  1NR0 A;  1UOQ A;  4PNK B;  4FWW A;  2HES X;  5E6R A;  4FA4 D;  4R7A B;  4ERY A;  3IUQ A;  1JV2 A;  1U4C A;  4BL0 A;  3C9C A;  4A08 B;  4GQ2 P;  4Z7Q A;  1VE6 A;  3T3M A;  4A7J A;  4ZN4 A;  1QNI A;  4ZOX A;  4DNV A;  2GNQ A;  3PVU B;  1L5G A;  5KDO B;  5GXH A;  2QR5 A;  4A2M A;  3JRP A;  3UVM A;  5TDH B;  4G56 B;  4CZY A;  3FCU A;  2XL3 A;  4HDJ A;  2AH1 A;  2MTA H;  4O45 A;  2B5N A;  4ESG A;  2YNN A;  4XYH A;  5M5T A;  4JSV C;  3UVK A;  3N0D A;  4PBY A;  4MMY A;  4WJK A;  2PM6 B;  4QAM A;  5CYK A;  1SQ9 A;  3MXX A;  2H9L A;  5EML B;  2BKL A;  3DSM A;  4MMZ A;  4GGA A;  2HU5 A;  3DM0 A;  5B4W A;  2Z2O A;  2G99 A;  1K3I A;  3PXT D;  3SBQ A;  4A11 B;  3FRX A;  4GM9 A;  5TEF A;  1GOG A;  3T3P A;  4Y5R D;  4J0W A;  4OZU A;  2QXV A;  2XYI A;  5EAR A;  1GXR A;  4A0A B;  4J81 A;  1VZ3 A;  1SHY B;  3RMZ D;  3MVD K;  2GC4 A;  4D0K A;  1GOF A;  4GZ8 A;  3OL2 A;  4GQB B;  5EMJ B;  5IC7 A;  4JXM A;  4JSP C;  3JAM g;  1C9I A;  3SCY A;  3SWS D;  4ERZ A;  4G55 A;  2AH0 A;  3GFC A;  1GP2 B;  5JWZ A;  4E54 B;  2EIE A;  2PBI B;  2G9A A;  2AGZ A;  3RRM C;  2VDP A;  4G1E A;  3O4I A;  1JMZ B;  3OL2 B;  3V4P A;  1OMW B;  5CXC B;  4ZOV A;  5IT9 g;  1JJU B;  2P9L C;  5EMM B;  4L3H D;  4I79 A;  4GQ1 A;  5C86 A;  4PXW A;  5EM2 A;  5K1C C;  1BPO A;  2OJY A;  3NIF A;  3C5M A;  3RFH A;  2HJ4 A;  1VZ2 A;  2VDN A;  2IUR A;  3MUO A;  5C2W B;  2I3S A;  3IJC A;  2P9S C; 
#chains in the Genus database with same CATH homology
 3IIW A;  3SBP A;  3F3G A;  5CYK B;  2CN3 A;  5IJ7 E;  4EWR A;  4O1Q D;  3JRO A;  4TZ4 A;  3AL8 A;  1Q47 A;  4U7A A;  3SBR A;  3SVW D;  4CI8 A;  3ORV D;  4FAV D;  1B9Y A;  4BH6 A;  3J80 g;  2UZX B;  2H14 A;  3OKT A;  4YVD A;  4E5Z B;  4L9O A;  3SXT D;  5AJA A;  2H47 A;  4K3I D;  5IGO A;  3EI2 B;  3I8E A;  4GMB A;  5EAP A;  4E54 A;  2P9K C;  4CY5 A;  3I7H A;  3EI3 B;  3PE7 A;  3BG1 A;  5C9Z B;  2J57 G;  4J84 A;  4NSX A;  5A2Q g;  2CO0 A;  5IGQ A;  3I7P A;  3CFS B;  2B5L A;  3I8C A;  2B5M A;  1SQJ A;  1MG3 A;  4K3J B;  4CI2 A;  2H3X A;  4X63 B;  4FA9 D;  1TBG A;  5HE2 B;  3AFC A;  3C99 A;  3UR4 A;  3PVW B;  4FAN D;  3F3P A;  5CXB A;  3I7N A;  4ES0 A;  3EU7 A;  3I89 A;  1RI6 A;  2AGL A;  4A09 B;  3OKY B;  2I3T A;  3BWS A;  3DXM C;  2CE9 A;  2YBA A;  3V7D B;  3U4Y A;  4CI1 A;  5EAM A;  2Z2P A;  2B4E A;  2H13 A;  4J78 A;  2PM9 A;  3BG0 A;  5AFU 3;  4H5I A;  3SHF A;  1JMX B;  4X3E A;  2CN2 A;  3F3F A;  3JZG A;  3SLE D;  3I2N A;  3NVN A;  4JT5 C;  2IWK A;  2P9N C;  4X60 B;  4LGN A;  1TYQ C;  4A11 A;  2P9P C;  1K32 A;  2HJB A;  1XIP A;  2OK4 A;  3MZL A;  3SJL D;  4QRJ A;  3GRE A;  3EI4 A;  4CI3 A;  3K27 A;  1PI6 A;  1MDA H;  3MKQ A;  2EBS A;  4J77 A;  4FA1 D;  1FWX A;  3I7O A;  3J81 g;  5FKT A;  1GG2 B;  4LG8 A;  5GSA A;  2P9I C;  3SMR A;  4A0B B;  3IKO A;  4AEZ A;  2Z2N A;  2H6Q A;  4PBZ A;  3UVN A;  4X61 B;  1N6F A;  2H6N A;  3L4M D;  2GC7 A;  3CIK B;  4IMM A;  5I5M A;  1PEV A;  4A09 A;  4QL1 A;  4Z8L A;  3N0E A;  2P9U C;  4FA5 D;  2W18 A;  3UVL A;  3KRW B;  1U2V C;  4GM3 A;  3A0F A;  4GGC A;  2H9M A;  4CC9 A;  4A0A A;  4ZOZ A;  5HQG A;  2YMU A;  2Q7Q A;  3AL8 B;  5SXM A;  3IIY A;  5H17 A;  5IJ8 E;  2H9P A;  3FGB A;  2I0R A;  2AGY A;  1MG2 A;  3V9F A;  5EMK B;  3EI1 A;  4J8B A;  4JT6 C;  5I5J A;  3AH8 B;  5FKR A;  2IUP A;  3OW8 A;  3PXW D;  3SFZ A;  2QC5 A;  5EM2 B;  2OVQ B;  2HYE A;  3EI1 B;  5HYN B;  4BUJ C;  3AL9 A;  2HKR A;  3VH0 A;  3RFG A;  2OVR B;  4A08 A;  4CY1 A;  4J8G A;  5K19 A;  3RN1 D;  4O3T B;  1JOF A;  3ZWL B;  5C2V B;  2H9N A;  2IWF A;  1PGU A;  4LG9 A;  4J79 A;  3E0C A;  3EG6 A;  4GGD A;  2AGW A;  3RN0 D;  1XHM A;  3UVO A;  1YFQ A;  3JZH A;  2I0T A;  3PXS D;  5H14 A;  1R5M A;  3DWL C;  1N6D A;  4PSX B;  4PC0 A;  4L3G D;  1A0R B;  4GM8 A;  1GOT B;  3W15 A;  4CY3 A;  3IJ0 A;  3OKY A;  3VA6 A;  3I7K A;  5I5I A;  2IUV A;  4XEI C;  4J86 A;  1OLZ A;  2CE8 A;  4KFM B;  4IA9 A;  5FLX g;  2YNP A;  3CFV A;  2HXC A;  2AQ5 A;  4PSW B;  4UI9 R;  2J55 H;  3JPX A;  5FKQ A;  3MKS B;  1NEX B;  3UKU C;  4J0X A;  2TRC B;  3JZN A;  5EAL A;  3JB9 L;  4QT8 A;  5H1M A;  5HE1 B;  3P4F A;  5HE0 B;  4ZOY A;  4E5Z A;  2OK6 A;  3NVQ A;  4JD2 C;  4FB1 D;  4ERQ A;  3RLM D;  5AMS A;  1B9X A;  5TEE A;  5CXC A;  4N14 A;  1XKS A;  2CO0 C;  3FM0 A;  4A2L A;  3ULE C;  1L0Q A;  3OKW A;  5GMK n;  3RSE C;  2H68 A;  1P22 A;  2IUQ A;  4U1E I;  3ODT A;  4XYI A;  4J73 A;  3EI3 A;  4L1Q D;  5GXI A;  2CNX A;  3VGZ A;  4Y7R A;  5FKS A;  2IAA A;  2XL2 A;  3SN6 B;  2OIZ A;  4O3U B;  3KRX B;  3I7L A;  5THA A;  2PM9 B;  5FA5 B;  2UZY B;  2O9K A;  4FHL A;  3EMH A;  3OTT A;  4J87 A;  3UKR C;  4AOW A;  4CZV A;  2AGX A;  4CY2 A;  2YB8 B;  4J82 A;  4JSX C;  5CXB B;  2H6K A;  2HKM A;  5FQD A;  3MMY A;  4D6V A;  4QQE A;  3EWE A;  2YNO A;  3EI4 B;  1N6E A;  4JSN C;  3MZK A;  4H5J A;  3L4O D;  4O9D A;  3PSL A;  3DXK C;  1VYH C;  3HFQ A;  3EI2 A;  1K8K C;  3V5W B;  3K26 A;  1S4U X;  2PM7 B;  3B7F A;  2OVP B;  4A0B A;  3C75 H;  4OWR A;  4CZX A;  1ERJ A;  3PSC B;  5TF2 A;  5HE3 B;  2BCJ B;  2J56 H;  2I0S A;  1PBY B;  2BBK H;  3NVX A;  4MK0 B;  5FXY A;  3IJ1 A;  2XU7 A;  1NR0 A;  4PNK B;  4FWW A;  2HES X;  4FA4 D;  4R7A B;  4ERY A;  1U4C A;  4BL0 A;  3C9C A;  4A08 B;  4GQ2 P;  4A7J A;  4ZN4 A;  1QNI A;  4ZOX A;  2GNQ A;  3PVU B;  5KDO B;  5GXH A;  4A2M A;  3JRP A;  3UVM A;  5TDH B;  4G56 B;  4CZY A;  2XL3 A;  4HDJ A;  2AH1 A;  2MTA H;  4O45 A;  2B5N A;  4ESG A;  2YNN A;  4XYH A;  4JSV C;  3UVK A;  3N0D A;  4PBY A;  2PM6 B;  5CYK A;  1SQ9 A;  3MXX A;  2H9L A;  5EML B;  3DSM A;  4GGA A;  3DM0 A;  5B4W A;  2Z2O A;  2G99 A;  3PXT D;  3SBQ A;  4A11 B;  3FRX A;  4GM9 A;  5TEF A;  4Y5R D;  4J0W A;  4OZU A;  2QXV A;  2XYI A;  5EAR A;  1GXR A;  4A0A B;  4J81 A;  1SHY B;  3RMZ D;  2GC4 A;  4D0K A;  4GZ8 A;  3OL2 A;  4GQB B;  5EMJ B;  5IC7 A;  4JXM A;  4JSP C;  3JAM g;  3SCY A;  3SWS D;  4ERZ A;  2AH0 A;  3GFC A;  1GP2 B;  5JWZ A;  4E54 B;  2PBI B;  2G9A A;  2AGZ A;  3RRM C;  3OL2 B;  1JMZ B;  1OMW B;  5CXC B;  4ZOV A;  5IT9 g;  1JJU B;  2P9L C;  5EMM B;  4L3H D;  4I79 A;  4GQ1 A;  4PXW A;  5EM2 A;  5K1C C;  2OJY A;  3C5M A;  3RFH A;  2HJ4 A;  2IUR A;  5C2W B;  2I3S A;  3IJC A;  2P9S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...